(data stored in ACNUC14830 zone)

EMBL: CP001146

ID   CP001146; SV 1; circular; genomic DNA; STD; PRO; 1959987 BP.
XX
AC   CP001146;
XX
PR   Project:PRJNA30731;
XX
DT   28-SEP-2008 (Rel. 97, Created)
DT   01-MAY-2014 (Rel. 120, Last updated, Version 4)
XX
DE   Dictyoglomus thermophilum H-6-12, complete genome.
XX
KW   .
XX
OS   Dictyoglomus thermophilum H-6-12
OC   Bacteria; Dictyoglomi; Dictyoglomales; Dictyoglomaceae; Dictyoglomus.
XX
RN   [1]
RC   Publication Status: Online-Only
RP   1-1959987
RX   PUBMED; 24558247.
RA   Coil D.A., Badger J.H., Forberger H.C., Riggs F., Madupu R., Fedorova N.,
RA   Ward N., Robb F.T., Eisen J.A.;
RT   "Complete Genome Sequence of the Extreme Thermophile Dictyoglomus
RT   thermophilum H-6-12";
RL   Genome Announc 2(1):e00109-14(2014).
XX
RN   [2]
RP   1-1959987
RA   Dodson R.J., Durkin A.S., Wu M., Eisen J., Sutton G.;
RT   ;
RL   Submitted (29-AUG-2008) to the INSDC.
RL   The J. Craig Venter Institute, Rockville, MD, USA
XX
DR   MD5; bd0cef6eaafe4fac831f7e7a8ddf440b.
DR   BioSample; SAMN02603928.
DR   EnsemblGenomes-Gn; DICTH_0349.
DR   EnsemblGenomes-Gn; DICTH_0617.
DR   EnsemblGenomes-Gn; DICTH_0621.
DR   EnsemblGenomes-Gn; DICTH_0622.
DR   EnsemblGenomes-Gn; DICTH_0624.
DR   EnsemblGenomes-Gn; DICTH_0677.
DR   EnsemblGenomes-Gn; DICTH_0716.
DR   EnsemblGenomes-Gn; DICTH_0717.
DR   EnsemblGenomes-Gn; DICTH_0741.
DR   EnsemblGenomes-Gn; DICTH_0742.
DR   EnsemblGenomes-Gn; DICTH_0746.
DR   EnsemblGenomes-Gn; DICTH_0811.
DR   EnsemblGenomes-Gn; DICTH_0812.
DR   EnsemblGenomes-Gn; DICTH_0876.
DR   EnsemblGenomes-Gn; DICTH_0882.
DR   EnsemblGenomes-Gn; DICTH_0926.
DR   EnsemblGenomes-Gn; DICTH_0927.
DR   EnsemblGenomes-Gn; DICTH_0928.
DR   EnsemblGenomes-Gn; DICTH_0933.
DR   EnsemblGenomes-Gn; DICTH_0951.
DR   EnsemblGenomes-Gn; DICTH_0952.
DR   EnsemblGenomes-Gn; DICTH_0953.
DR   EnsemblGenomes-Gn; DICTH_0954.
DR   EnsemblGenomes-Gn; DICTH_0955.
DR   EnsemblGenomes-Gn; DICTH_0956.
DR   EnsemblGenomes-Gn; DICTH_0957.
DR   EnsemblGenomes-Gn; DICTH_0958.
DR   EnsemblGenomes-Gn; DICTH_1035.
DR   EnsemblGenomes-Gn; DICTH_1100.
DR   EnsemblGenomes-Gn; DICTH_1101.
DR   EnsemblGenomes-Gn; DICTH_1105.
DR   EnsemblGenomes-Gn; DICTH_1106.
DR   EnsemblGenomes-Gn; DICTH_1107.
DR   EnsemblGenomes-Gn; DICTH_1111.
DR   EnsemblGenomes-Gn; DICTH_1113.
DR   EnsemblGenomes-Gn; DICTH_1143.
DR   EnsemblGenomes-Gn; DICTH_1152.
DR   EnsemblGenomes-Gn; DICTH_1153.
DR   EnsemblGenomes-Gn; DICTH_1180.
DR   EnsemblGenomes-Gn; DICTH_1181.
DR   EnsemblGenomes-Gn; DICTH_1182.
DR   EnsemblGenomes-Gn; DICTH_1183.
DR   EnsemblGenomes-Gn; DICTH_1184.
DR   EnsemblGenomes-Gn; DICTH_1236.
DR   EnsemblGenomes-Gn; DICTH_1263.
DR   EnsemblGenomes-Gn; DICTH_1266.
DR   EnsemblGenomes-Gn; DICTH_1267.
DR   EnsemblGenomes-Gn; DICTH_1268.
DR   EnsemblGenomes-Gn; DICTH_1269.
DR   EnsemblGenomes-Gn; DICTH_1279.
DR   EnsemblGenomes-Gn; DICTH_1289.
DR   EnsemblGenomes-Gn; DICTH_1290.
DR   EnsemblGenomes-Gn; DICTH_1488.
DR   EnsemblGenomes-Gn; DICTH_1529.
DR   EnsemblGenomes-Gn; DICTH_1587.
DR   EnsemblGenomes-Gn; DICTH_1690.
DR   EnsemblGenomes-Gn; EBG00001204118.
DR   EnsemblGenomes-Gn; EBG00001204119.
DR   EnsemblGenomes-Gn; EBG00001204120.
DR   EnsemblGenomes-Gn; EBG00001204121.
DR   EnsemblGenomes-Gn; EBG00001204122.
DR   EnsemblGenomes-Gn; EBG00001204123.
DR   EnsemblGenomes-Gn; EBG00001204124.
DR   EnsemblGenomes-Gn; EBG00001204125.
DR   EnsemblGenomes-Gn; EBG00001204126.
DR   EnsemblGenomes-Gn; EBG00001204127.
DR   EnsemblGenomes-Gn; EBG00001204128.
DR   EnsemblGenomes-Gn; EBG00001204129.
DR   EnsemblGenomes-Gn; EBG00001204130.
DR   EnsemblGenomes-Gn; EBG00001204131.
DR   EnsemblGenomes-Gn; EBG00001204132.
DR   EnsemblGenomes-Gn; EBG00001204133.
DR   EnsemblGenomes-Gn; EBG00001204134.
DR   EnsemblGenomes-Gn; EBG00001204135.
DR   EnsemblGenomes-Gn; EBG00001204136.
DR   EnsemblGenomes-Gn; EBG00001204137.
DR   EnsemblGenomes-Gn; EBG00001204138.
DR   EnsemblGenomes-Gn; EBG00001204139.
DR   EnsemblGenomes-Gn; EBG00001204140.
DR   EnsemblGenomes-Gn; EBG00001204141.
DR   EnsemblGenomes-Gn; EBG00001204142.
DR   EnsemblGenomes-Gn; EBG00001204143.
DR   EnsemblGenomes-Gn; EBG00001204144.
DR   EnsemblGenomes-Gn; EBG00001204145.
DR   EnsemblGenomes-Gn; EBG00001204146.
DR   EnsemblGenomes-Gn; EBG00001204147.
DR   EnsemblGenomes-Gn; EBG00001204148.
DR   EnsemblGenomes-Gn; EBG00001204149.
DR   EnsemblGenomes-Gn; EBG00001204150.
DR   EnsemblGenomes-Gn; EBG00001204151.
DR   EnsemblGenomes-Gn; EBG00001204152.
DR   EnsemblGenomes-Gn; EBG00001204153.
DR   EnsemblGenomes-Gn; EBG00001204154.
DR   EnsemblGenomes-Gn; EBG00001204155.
DR   EnsemblGenomes-Gn; EBG00001204156.
DR   EnsemblGenomes-Gn; EBG00001204157.
DR   EnsemblGenomes-Gn; EBG00001204158.
DR   EnsemblGenomes-Gn; EBG00001204159.
DR   EnsemblGenomes-Gn; EBG00001204160.
DR   EnsemblGenomes-Gn; EBG00001204161.
DR   EnsemblGenomes-Gn; EBG00001204162.
DR   EnsemblGenomes-Gn; EBG00001204163.
DR   EnsemblGenomes-Gn; EBG00001204164.
DR   EnsemblGenomes-Gn; EBG00001204165.
DR   EnsemblGenomes-Gn; EBG00001204166.
DR   EnsemblGenomes-Gn; EBG00001204167.
DR   EnsemblGenomes-Gn; EBG00001204168.
DR   EnsemblGenomes-Gn; EBG00001204169.
DR   EnsemblGenomes-Gn; EBG00001204170.
DR   EnsemblGenomes-Gn; EBG00001204171.
DR   EnsemblGenomes-Gn; EBG00001204172.
DR   EnsemblGenomes-Gn; EBG00001204173.
DR   EnsemblGenomes-Gn; EBG00001204174.
DR   EnsemblGenomes-Gn; EBG00001204175.
DR   EnsemblGenomes-Gn; EBG00001204176.
DR   EnsemblGenomes-Gn; EBG00001204177.
DR   EnsemblGenomes-Gn; EBG00001204178.
DR   EnsemblGenomes-Gn; EBG00001204179.
DR   EnsemblGenomes-Gn; EBG00001204180.
DR   EnsemblGenomes-Gn; EBG00001204181.
DR   EnsemblGenomes-Gn; EBG00001204182.
DR   EnsemblGenomes-Gn; EBG00001204183.
DR   EnsemblGenomes-Gn; EBG00001204184.
DR   EnsemblGenomes-Gn; EBG00001204185.
DR   EnsemblGenomes-Gn; EBG00001204186.
DR   EnsemblGenomes-Gn; EBG00001204187.
DR   EnsemblGenomes-Gn; EBG00001204188.
DR   EnsemblGenomes-Gn; EBG00001204189.
DR   EnsemblGenomes-Gn; EBG00001204190.
DR   EnsemblGenomes-Gn; EBG00001204191.
DR   EnsemblGenomes-Gn; EBG00001204192.
DR   EnsemblGenomes-Gn; EBG00001204193.
DR   EnsemblGenomes-Gn; EBG00001204194.
DR   EnsemblGenomes-Gn; EBG00001204195.
DR   EnsemblGenomes-Gn; EBG00001204196.
DR   EnsemblGenomes-Gn; EBG00001204197.
DR   EnsemblGenomes-Gn; EBG00001204198.
DR   EnsemblGenomes-Gn; EBG00001204199.
DR   EnsemblGenomes-Gn; EBG00001204200.
DR   EnsemblGenomes-Gn; EBG00001204201.
DR   EnsemblGenomes-Gn; EBG00001204202.
DR   EnsemblGenomes-Gn; EBG00001204203.
DR   EnsemblGenomes-Gn; EBG00001204204.
DR   EnsemblGenomes-Gn; EBG00001204205.
DR   EnsemblGenomes-Gn; EBG00001204206.
DR   EnsemblGenomes-Gn; EBG00001204207.
DR   EnsemblGenomes-Gn; EBG00001204208.
DR   EnsemblGenomes-Gn; EBG00001204209.
DR   EnsemblGenomes-Gn; EBG00001204210.
DR   EnsemblGenomes-Gn; EBG00001204211.
DR   EnsemblGenomes-Gn; EBG00001204212.
DR   EnsemblGenomes-Gn; EBG00001204213.
DR   EnsemblGenomes-Gn; EBG00001204214.
DR   EnsemblGenomes-Gn; EBG00001204215.
DR   EnsemblGenomes-Gn; EBG00001204216.
DR   EnsemblGenomes-Gn; EBG00001204217.
DR   EnsemblGenomes-Gn; EBG00001204218.
DR   EnsemblGenomes-Gn; EBG00001204219.
DR   EnsemblGenomes-Gn; EBG00001204220.
DR   EnsemblGenomes-Gn; EBG00001204221.
DR   EnsemblGenomes-Gn; EBG00001204222.
DR   EnsemblGenomes-Gn; EBG00001204223.
DR   EnsemblGenomes-Gn; EBG00001204224.
DR   EnsemblGenomes-Gn; EBG00001204225.
DR   EnsemblGenomes-Gn; EBG00001204226.
DR   EnsemblGenomes-Gn; EBG00001204227.
DR   EnsemblGenomes-Gn; EBG00001204228.
DR   EnsemblGenomes-Gn; EBG00001204229.
DR   EnsemblGenomes-Gn; EBG00001204230.
DR   EnsemblGenomes-Gn; EBG00001204231.
DR   EnsemblGenomes-Gn; EBG00001204232.
DR   EnsemblGenomes-Gn; EBG00001204233.
DR   EnsemblGenomes-Gn; EBG00001204234.
DR   EnsemblGenomes-Gn; EBG00001204235.
DR   EnsemblGenomes-Gn; EBG00001204236.
DR   EnsemblGenomes-Gn; EBG00001204237.
DR   EnsemblGenomes-Gn; EBG00001204238.
DR   EnsemblGenomes-Gn; EBG00001204239.
DR   EnsemblGenomes-Gn; EBG00001204240.
DR   EnsemblGenomes-Gn; EBG00001204241.
DR   EnsemblGenomes-Gn; EBG00001204242.
DR   EnsemblGenomes-Gn; EBG00001204243.
DR   EnsemblGenomes-Gn; EBG00001204244.
DR   EnsemblGenomes-Gn; EBG00001204245.
DR   EnsemblGenomes-Gn; EBG00001204246.
DR   EnsemblGenomes-Gn; EBG00001204247.
DR   EnsemblGenomes-Gn; EBG00001204248.
DR   EnsemblGenomes-Gn; EBG00001204249.
DR   EnsemblGenomes-Gn; EBG00001204250.
DR   EnsemblGenomes-Gn; EBG00001204251.
DR   EnsemblGenomes-Gn; EBG00001204252.
DR   EnsemblGenomes-Gn; EBG00001204253.
DR   EnsemblGenomes-Gn; EBG00001204254.
DR   EnsemblGenomes-Gn; EBG00001204255.
DR   EnsemblGenomes-Gn; EBG00001204256.
DR   EnsemblGenomes-Gn; EBG00001204257.
DR   EnsemblGenomes-Gn; EBG00001204258.
DR   EnsemblGenomes-Gn; EBG00001204259.
DR   EnsemblGenomes-Gn; EBG00001204260.
DR   EnsemblGenomes-Gn; EBG00001204261.
DR   EnsemblGenomes-Gn; EBG00001204262.
DR   EnsemblGenomes-Gn; EBG00001204263.
DR   EnsemblGenomes-Gn; EBG00001204264.
DR   EnsemblGenomes-Gn; EBG00001204265.
DR   EnsemblGenomes-Gn; EBG00001204266.
DR   EnsemblGenomes-Gn; EBG00001204267.
DR   EnsemblGenomes-Gn; EBG00001204268.
DR   EnsemblGenomes-Gn; EBG00001204269.
DR   EnsemblGenomes-Gn; EBG00001204270.
DR   EnsemblGenomes-Gn; EBG00001204271.
DR   EnsemblGenomes-Gn; EBG00001204272.
DR   EnsemblGenomes-Gn; EBG00001204273.
DR   EnsemblGenomes-Gn; EBG00001204274.
DR   EnsemblGenomes-Gn; EBG00001204275.
DR   EnsemblGenomes-Gn; EBG00001204276.
DR   EnsemblGenomes-Gn; EBG00001204277.
DR   EnsemblGenomes-Gn; EBG00001204278.
DR   EnsemblGenomes-Gn; EBG00001204279.
DR   EnsemblGenomes-Gn; EBG00001204280.
DR   EnsemblGenomes-Gn; EBG00001204281.
DR   EnsemblGenomes-Gn; EBG00001204282.
DR   EnsemblGenomes-Gn; EBG00001204283.
DR   EnsemblGenomes-Gn; EBG00001204284.
DR   EnsemblGenomes-Gn; EBG00001204285.
DR   EnsemblGenomes-Gn; EBG00001204286.
DR   EnsemblGenomes-Gn; EBG00001204287.
DR   EnsemblGenomes-Gn; EBG00001204288.
DR   EnsemblGenomes-Gn; EBG00001204289.
DR   EnsemblGenomes-Gn; EBG00001204290.
DR   EnsemblGenomes-Gn; EBG00001204291.
DR   EnsemblGenomes-Gn; EBG00001204292.
DR   EnsemblGenomes-Gn; EBG00001204293.
DR   EnsemblGenomes-Gn; EBG00001204294.
DR   EnsemblGenomes-Gn; EBG00001204295.
DR   EnsemblGenomes-Gn; EBG00001204296.
DR   EnsemblGenomes-Gn; EBG00001204297.
DR   EnsemblGenomes-Gn; EBG00001204298.
DR   EnsemblGenomes-Gn; EBG00001204299.
DR   EnsemblGenomes-Gn; EBG00001204300.
DR   EnsemblGenomes-Gn; EBG00001204301.
DR   EnsemblGenomes-Gn; EBG00001204302.
DR   EnsemblGenomes-Gn; EBG00001204303.
DR   EnsemblGenomes-Gn; EBG00001204304.
DR   EnsemblGenomes-Gn; EBG00001204305.
DR   EnsemblGenomes-Gn; EBG00001204306.
DR   EnsemblGenomes-Tr; DICTH_0349-1.
DR   EnsemblGenomes-Tr; DICTH_0617-1.
DR   EnsemblGenomes-Tr; DICTH_0621-1.
DR   EnsemblGenomes-Tr; DICTH_0622-1.
DR   EnsemblGenomes-Tr; DICTH_0624-1.
DR   EnsemblGenomes-Tr; DICTH_0677-1.
DR   EnsemblGenomes-Tr; DICTH_0716-1.
DR   EnsemblGenomes-Tr; DICTH_0717-1.
DR   EnsemblGenomes-Tr; DICTH_0741-1.
DR   EnsemblGenomes-Tr; DICTH_0742-1.
DR   EnsemblGenomes-Tr; DICTH_0746-1.
DR   EnsemblGenomes-Tr; DICTH_0811-1.
DR   EnsemblGenomes-Tr; DICTH_0812-1.
DR   EnsemblGenomes-Tr; DICTH_0876-1.
DR   EnsemblGenomes-Tr; DICTH_0882-1.
DR   EnsemblGenomes-Tr; DICTH_0926-1.
DR   EnsemblGenomes-Tr; DICTH_0927-1.
DR   EnsemblGenomes-Tr; DICTH_0928-1.
DR   EnsemblGenomes-Tr; DICTH_0933-1.
DR   EnsemblGenomes-Tr; DICTH_0951-1.
DR   EnsemblGenomes-Tr; DICTH_0952-1.
DR   EnsemblGenomes-Tr; DICTH_0953-1.
DR   EnsemblGenomes-Tr; DICTH_0954-1.
DR   EnsemblGenomes-Tr; DICTH_0955-1.
DR   EnsemblGenomes-Tr; DICTH_0956-1.
DR   EnsemblGenomes-Tr; DICTH_0957-1.
DR   EnsemblGenomes-Tr; DICTH_0958-1.
DR   EnsemblGenomes-Tr; DICTH_1035-1.
DR   EnsemblGenomes-Tr; DICTH_1100-1.
DR   EnsemblGenomes-Tr; DICTH_1101-1.
DR   EnsemblGenomes-Tr; DICTH_1105-1.
DR   EnsemblGenomes-Tr; DICTH_1106-1.
DR   EnsemblGenomes-Tr; DICTH_1107-1.
DR   EnsemblGenomes-Tr; DICTH_1111-1.
DR   EnsemblGenomes-Tr; DICTH_1113-1.
DR   EnsemblGenomes-Tr; DICTH_1143-1.
DR   EnsemblGenomes-Tr; DICTH_1152-1.
DR   EnsemblGenomes-Tr; DICTH_1153-1.
DR   EnsemblGenomes-Tr; DICTH_1180-1.
DR   EnsemblGenomes-Tr; DICTH_1181-1.
DR   EnsemblGenomes-Tr; DICTH_1182-1.
DR   EnsemblGenomes-Tr; DICTH_1183-1.
DR   EnsemblGenomes-Tr; DICTH_1184-1.
DR   EnsemblGenomes-Tr; DICTH_1236-1.
DR   EnsemblGenomes-Tr; DICTH_1263-1.
DR   EnsemblGenomes-Tr; DICTH_1266-1.
DR   EnsemblGenomes-Tr; DICTH_1267-1.
DR   EnsemblGenomes-Tr; DICTH_1268-1.
DR   EnsemblGenomes-Tr; DICTH_1269-1.
DR   EnsemblGenomes-Tr; DICTH_1279-1.
DR   EnsemblGenomes-Tr; DICTH_1289-1.
DR   EnsemblGenomes-Tr; DICTH_1290-1.
DR   EnsemblGenomes-Tr; DICTH_1488-1.
DR   EnsemblGenomes-Tr; DICTH_1529-1.
DR   EnsemblGenomes-Tr; DICTH_1587-1.
DR   EnsemblGenomes-Tr; DICTH_1690-1.
DR   EnsemblGenomes-Tr; EBT00001574752.
DR   EnsemblGenomes-Tr; EBT00001574753.
DR   EnsemblGenomes-Tr; EBT00001574754.
DR   EnsemblGenomes-Tr; EBT00001574755.
DR   EnsemblGenomes-Tr; EBT00001574756.
DR   EnsemblGenomes-Tr; EBT00001574757.
DR   EnsemblGenomes-Tr; EBT00001574758.
DR   EnsemblGenomes-Tr; EBT00001574759.
DR   EnsemblGenomes-Tr; EBT00001574760.
DR   EnsemblGenomes-Tr; EBT00001574761.
DR   EnsemblGenomes-Tr; EBT00001574762.
DR   EnsemblGenomes-Tr; EBT00001574763.
DR   EnsemblGenomes-Tr; EBT00001574764.
DR   EnsemblGenomes-Tr; EBT00001574765.
DR   EnsemblGenomes-Tr; EBT00001574766.
DR   EnsemblGenomes-Tr; EBT00001574767.
DR   EnsemblGenomes-Tr; EBT00001574768.
DR   EnsemblGenomes-Tr; EBT00001574769.
DR   EnsemblGenomes-Tr; EBT00001574770.
DR   EnsemblGenomes-Tr; EBT00001574771.
DR   EnsemblGenomes-Tr; EBT00001574772.
DR   EnsemblGenomes-Tr; EBT00001574773.
DR   EnsemblGenomes-Tr; EBT00001574774.
DR   EnsemblGenomes-Tr; EBT00001574775.
DR   EnsemblGenomes-Tr; EBT00001574776.
DR   EnsemblGenomes-Tr; EBT00001574777.
DR   EnsemblGenomes-Tr; EBT00001574778.
DR   EnsemblGenomes-Tr; EBT00001574779.
DR   EnsemblGenomes-Tr; EBT00001574780.
DR   EnsemblGenomes-Tr; EBT00001574781.
DR   EnsemblGenomes-Tr; EBT00001574782.
DR   EnsemblGenomes-Tr; EBT00001574783.
DR   EnsemblGenomes-Tr; EBT00001574784.
DR   EnsemblGenomes-Tr; EBT00001574785.
DR   EnsemblGenomes-Tr; EBT00001574786.
DR   EnsemblGenomes-Tr; EBT00001574787.
DR   EnsemblGenomes-Tr; EBT00001574788.
DR   EnsemblGenomes-Tr; EBT00001574789.
DR   EnsemblGenomes-Tr; EBT00001574790.
DR   EnsemblGenomes-Tr; EBT00001574791.
DR   EnsemblGenomes-Tr; EBT00001574792.
DR   EnsemblGenomes-Tr; EBT00001574793.
DR   EnsemblGenomes-Tr; EBT00001574796.
DR   EnsemblGenomes-Tr; EBT00001574798.
DR   EnsemblGenomes-Tr; EBT00001574800.
DR   EnsemblGenomes-Tr; EBT00001574802.
DR   EnsemblGenomes-Tr; EBT00001574804.
DR   EnsemblGenomes-Tr; EBT00001574806.
DR   EnsemblGenomes-Tr; EBT00001574808.
DR   EnsemblGenomes-Tr; EBT00001574810.
DR   EnsemblGenomes-Tr; EBT00001574811.
DR   EnsemblGenomes-Tr; EBT00001574813.
DR   EnsemblGenomes-Tr; EBT00001574815.
DR   EnsemblGenomes-Tr; EBT00001574818.
DR   EnsemblGenomes-Tr; EBT00001574819.
DR   EnsemblGenomes-Tr; EBT00001574821.
DR   EnsemblGenomes-Tr; EBT00001574823.
DR   EnsemblGenomes-Tr; EBT00001574825.
DR   EnsemblGenomes-Tr; EBT00001574827.
DR   EnsemblGenomes-Tr; EBT00001574828.
DR   EnsemblGenomes-Tr; EBT00001574831.
DR   EnsemblGenomes-Tr; EBT00001574832.
DR   EnsemblGenomes-Tr; EBT00001574835.
DR   EnsemblGenomes-Tr; EBT00001574836.
DR   EnsemblGenomes-Tr; EBT00001574838.
DR   EnsemblGenomes-Tr; EBT00001574839.
DR   EnsemblGenomes-Tr; EBT00001574841.
DR   EnsemblGenomes-Tr; EBT00001574843.
DR   EnsemblGenomes-Tr; EBT00001574845.
DR   EnsemblGenomes-Tr; EBT00001574847.
DR   EnsemblGenomes-Tr; EBT00001574849.
DR   EnsemblGenomes-Tr; EBT00001574851.
DR   EnsemblGenomes-Tr; EBT00001574853.
DR   EnsemblGenomes-Tr; EBT00001574854.
DR   EnsemblGenomes-Tr; EBT00001574856.
DR   EnsemblGenomes-Tr; EBT00001574858.
DR   EnsemblGenomes-Tr; EBT00001574860.
DR   EnsemblGenomes-Tr; EBT00001574862.
DR   EnsemblGenomes-Tr; EBT00001574863.
DR   EnsemblGenomes-Tr; EBT00001574865.
DR   EnsemblGenomes-Tr; EBT00001574867.
DR   EnsemblGenomes-Tr; EBT00001574869.
DR   EnsemblGenomes-Tr; EBT00001574870.
DR   EnsemblGenomes-Tr; EBT00001574872.
DR   EnsemblGenomes-Tr; EBT00001574874.
DR   EnsemblGenomes-Tr; EBT00001574877.
DR   EnsemblGenomes-Tr; EBT00001574879.
DR   EnsemblGenomes-Tr; EBT00001574881.
DR   EnsemblGenomes-Tr; EBT00001574882.
DR   EnsemblGenomes-Tr; EBT00001574885.
DR   EnsemblGenomes-Tr; EBT00001574886.
DR   EnsemblGenomes-Tr; EBT00001574888.
DR   EnsemblGenomes-Tr; EBT00001574890.
DR   EnsemblGenomes-Tr; EBT00001574893.
DR   EnsemblGenomes-Tr; EBT00001574895.
DR   EnsemblGenomes-Tr; EBT00001574897.
DR   EnsemblGenomes-Tr; EBT00001574899.
DR   EnsemblGenomes-Tr; EBT00001574902.
DR   EnsemblGenomes-Tr; EBT00001574904.
DR   EnsemblGenomes-Tr; EBT00001574906.
DR   EnsemblGenomes-Tr; EBT00001574908.
DR   EnsemblGenomes-Tr; EBT00001574910.
DR   EnsemblGenomes-Tr; EBT00001574912.
DR   EnsemblGenomes-Tr; EBT00001574913.
DR   EnsemblGenomes-Tr; EBT00001574915.
DR   EnsemblGenomes-Tr; EBT00001574917.
DR   EnsemblGenomes-Tr; EBT00001574919.
DR   EnsemblGenomes-Tr; EBT00001574921.
DR   EnsemblGenomes-Tr; EBT00001574923.
DR   EnsemblGenomes-Tr; EBT00001574924.
DR   EnsemblGenomes-Tr; EBT00001574926.
DR   EnsemblGenomes-Tr; EBT00001574927.
DR   EnsemblGenomes-Tr; EBT00001574930.
DR   EnsemblGenomes-Tr; EBT00001574931.
DR   EnsemblGenomes-Tr; EBT00001574932.
DR   EnsemblGenomes-Tr; EBT00001574935.
DR   EnsemblGenomes-Tr; EBT00001574937.
DR   EnsemblGenomes-Tr; EBT00001574939.
DR   EnsemblGenomes-Tr; EBT00001574941.
DR   EnsemblGenomes-Tr; EBT00001574943.
DR   EnsemblGenomes-Tr; EBT00001574946.
DR   EnsemblGenomes-Tr; EBT00001574948.
DR   EnsemblGenomes-Tr; EBT00001574950.
DR   EnsemblGenomes-Tr; EBT00001574951.
DR   EnsemblGenomes-Tr; EBT00001574953.
DR   EnsemblGenomes-Tr; EBT00001574955.
DR   EnsemblGenomes-Tr; EBT00001574957.
DR   EnsemblGenomes-Tr; EBT00001574959.
DR   EnsemblGenomes-Tr; EBT00001574961.
DR   EnsemblGenomes-Tr; EBT00001574963.
DR   EnsemblGenomes-Tr; EBT00001574965.
DR   EnsemblGenomes-Tr; EBT00001574967.
DR   EnsemblGenomes-Tr; EBT00001574968.
DR   EnsemblGenomes-Tr; EBT00001574970.
DR   EnsemblGenomes-Tr; EBT00001574972.
DR   EnsemblGenomes-Tr; EBT00001574974.
DR   EnsemblGenomes-Tr; EBT00001574976.
DR   EnsemblGenomes-Tr; EBT00001574977.
DR   EnsemblGenomes-Tr; EBT00001574978.
DR   EnsemblGenomes-Tr; EBT00001574979.
DR   EnsemblGenomes-Tr; EBT00001574980.
DR   EnsemblGenomes-Tr; EBT00001574981.
DR   EnsemblGenomes-Tr; EBT00001574982.
DR   EnsemblGenomes-Tr; EBT00001574983.
DR   EnsemblGenomes-Tr; EBT00001574984.
DR   EnsemblGenomes-Tr; EBT00001574985.
DR   EnsemblGenomes-Tr; EBT00001574986.
DR   EnsemblGenomes-Tr; EBT00001574987.
DR   EnsemblGenomes-Tr; EBT00001574988.
DR   EnsemblGenomes-Tr; EBT00001574989.
DR   EnsemblGenomes-Tr; EBT00001574990.
DR   EnsemblGenomes-Tr; EBT00001574991.
DR   EnsemblGenomes-Tr; EBT00001574992.
DR   EnsemblGenomes-Tr; EBT00001574993.
DR   EnsemblGenomes-Tr; EBT00001574994.
DR   EnsemblGenomes-Tr; EBT00001574995.
DR   EnsemblGenomes-Tr; EBT00001574996.
DR   EnsemblGenomes-Tr; EBT00001574997.
DR   EnsemblGenomes-Tr; EBT00001574998.
DR   EnsemblGenomes-Tr; EBT00001574999.
DR   EnsemblGenomes-Tr; EBT00001575000.
DR   EnsemblGenomes-Tr; EBT00001575001.
DR   EnsemblGenomes-Tr; EBT00001575002.
DR   EnsemblGenomes-Tr; EBT00001575003.
DR   EnsemblGenomes-Tr; EBT00001575004.
DR   EnsemblGenomes-Tr; EBT00001575005.
DR   EnsemblGenomes-Tr; EBT00001575006.
DR   EnsemblGenomes-Tr; EBT00001575007.
DR   EnsemblGenomes-Tr; EBT00001575008.
DR   EnsemblGenomes-Tr; EBT00001575009.
DR   EnsemblGenomes-Tr; EBT00001575010.
DR   EnsemblGenomes-Tr; EBT00001575011.
DR   EnsemblGenomes-Tr; EBT00001575012.
DR   EnsemblGenomes-Tr; EBT00001575013.
DR   EnsemblGenomes-Tr; EBT00001575014.
DR   EnsemblGenomes-Tr; EBT00001575015.
DR   EnsemblGenomes-Tr; EBT00001575016.
DR   EnsemblGenomes-Tr; EBT00001575017.
DR   EnsemblGenomes-Tr; EBT00001575018.
DR   EnsemblGenomes-Tr; EBT00001575019.
DR   EnsemblGenomes-Tr; EBT00001575020.
DR   EnsemblGenomes-Tr; EBT00001575021.
DR   EnsemblGenomes-Tr; EBT00001575022.
DR   EnsemblGenomes-Tr; EBT00001575023.
DR   EnsemblGenomes-Tr; EBT00001575024.
DR   EnsemblGenomes-Tr; EBT00001575025.
DR   EnsemblGenomes-Tr; EBT00001575026.
DR   EnsemblGenomes-Tr; EBT00001575027.
DR   EnsemblGenomes-Tr; EBT00001575028.
DR   EuropePMC; PMC3931368; 24558247.
DR   GOA; P14898.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00167; Purine.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00230; T-box.
DR   RFAM; RF00234; glmS.
DR   RFAM; RF00442; ykkC-yxkD.
DR   RFAM; RF00515; PyrR.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01703; Dictyoglomi-1.
DR   RFAM; RF01734; crcB.
DR   RFAM; RF01850; beta_tmRNA.
DR   RFAM; RF01854; Bacteria_large_SRP.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   SILVA-LSU; CP001146.
DR   SILVA-SSU; CP001146.
DR   StrainInfo; 111542; 1.
DR   UniProtKB/Swiss-Prot; P14898; AMY2_DICT6.
XX
CC   This strain was obtained from ATCC and grown by Frank Robb.  DNA
CC   was isolated at UMD.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1959987
FT                   /organism="Dictyoglomus thermophilum H-6-12"
FT                   /strain="H-6-12; ATCC 35947"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:309799"
FT                   /culture_collection="ATCC:35947"
FT   gene            48..521
FT                   /gene="purE_1"
FT                   /locus_tag="DICTH_0001"
FT   CDS_pept        48..521
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purE_1"
FT                   /locus_tag="DICTH_0001"
FT                   /product="phosphoribosylaminoimidazole carboxylase,
FT                   catalytic subunit"
FT                   /EC_number="4.1.1.21"
FT                   /note="identified by match to protein family HMM PF00731;
FT                   match to protein family HMM TIGR01162"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19707"
FT                   /db_xref="GOA:B5YAR5"
FT                   /db_xref="InterPro:IPR000031"
FT                   /db_xref="InterPro:IPR024694"
FT                   /db_xref="InterPro:IPR033626"
FT                   /db_xref="InterPro:IPR035893"
FT                   /db_xref="UniProtKB/TrEMBL:B5YAR5"
FT                   /protein_id="ACI19707.1"
FT                   /translation="MLVVILMGSKGDLEHAKKIAQTLEKFEVPYVMRIASAHKVPLKVL
FT                   EIIKEYENKDVVFITIAGRSNALSGFTDANTTKPVIACPPYSDKFAGADIFSTLRMPSG
FT                   VAPLTILEPEEAALAAVKMLAIKYENLIDKIKKYQEEKRREIEKADEEVKNNG"
FT   gene            514..1530
FT                   /gene="purC"
FT                   /locus_tag="DICTH_0002"
FT   CDS_pept        514..1530
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purC"
FT                   /locus_tag="DICTH_0002"
FT                   /product="phosphoribosylaminoimidazole-succinocarboxamide
FT                   synthase"
FT                   /EC_number="6.3.2.6"
FT                   /note="identified by match to protein family HMM TIGR00081"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18571"
FT                   /db_xref="GOA:B5YAR6"
FT                   /db_xref="InterPro:IPR001636"
FT                   /db_xref="InterPro:IPR028923"
FT                   /db_xref="UniProtKB/TrEMBL:B5YAR6"
FT                   /protein_id="ACI18571.1"
FT                   /translation="MGSVKDLIVIEKPTEKKLGRGRFLFSDRYSVFDYGEMPDLIDDKG
FT                   KAICIATAYFFEKLENLGIKTHYIGLVEDDKIKTLYELKEPTNVMEFKMVRVLKPELQE
FT                   NIYNYSIFKKERSNFLIPLEVIYRNALPEGSSVFKRLKEGSLNLEEIGLDKMPEPGQKL
FT                   EKPIVDFSTKLEVNDRYLSKKEALEISGLSETEFEKLRNLTLFIDDLITEETRKINLNN
FT                   EDGKVEYALDLERNIMLVDALGTLDECRFTFEGIPVSKEIARIYYRKTDWYKEVEEAKK
FT                   KDRFNWKNYVSTPPKLPKEIKDLISLIYKAYVNELTEIEWFETPPMKDLLTRLRELI"
FT   gene            2148..2795
FT                   /locus_tag="DICTH_0003"
FT   CDS_pept        2148..2795
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0003"
FT                   /product="MgtC family protein"
FT                   /note="identified by match to protein family HMM PF01842;
FT                   match to protein family HMM PF02308"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19638"
FT                   /db_xref="GOA:B5YAR7"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR003416"
FT                   /db_xref="UniProtKB/TrEMBL:B5YAR7"
FT                   /protein_id="ACI19638.1"
FT                   /translation="MITVWDVLIKFLLSTIFFGIIGWEREKEEKPAGLRTHILVSLGST
FT                   LFMIVSAYAFPGESDPGRIAAQVVTGIGFIGAGTILRTGFTVKGLTTAASIWAVSGVGL
FT                   AVGAGLYLPAFVSTLFIISVLVLATKLEKIFLGTHQDVALNLIIEDRPGSIGEIGTLFG
FT                   ELNIDIKQIELGNSWGGKVSLKILVRLPQKISKNDLLLRLSGLPSVVDAEII"
FT   gene            2813..3550
FT                   /locus_tag="DICTH_0004"
FT   CDS_pept        2813..3550
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0004"
FT                   /product="metallo-beta-lactamase superfamily protein"
FT                   /note="identified by match to protein family HMM PF00753"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18657"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:B5YAR8"
FT                   /protein_id="ACI18657.1"
FT                   /translation="MKSNEYASMLVEDGVHHISDYRGDSFYLIFGDNKAILFDTGMGNG
FT                   DLKGYIKNLTDKEVEVIISHAHWDHIMQANQFEKVYMNHKDIEIIKLFNMNIDYTNFLD
FT                   IRDGEIIDLGKRKLEIIEVPGHTPGSTVLLDKDNKLLFSGDAIGAGHTWMQLPGCLPLT
FT                   QYLESLYRLSKRSNEFEKIYHGHLAGTDFKPFPREYLFDLIKAVEKVISGELVGEPYPY
FT                   GNFGGLYVTYGMATLVYNPQNVK"
FT   gene            3718..5610
FT                   /locus_tag="DICTH_0005"
FT   CDS_pept        3718..5610
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0005"
FT                   /product="oligopeptide ABC transporter, periplasmic
FT                   oligopeptide-binding protein"
FT                   /note="identified by match to protein family HMM PF00496"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19406"
FT                   /db_xref="GOA:B5YAR9"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:B5YAR9"
FT                   /protein_id="ACI19406.1"
FT                   /translation="MKKVLLFVILLMLSLISFSQLGLSQLAVNVPREETIIANVLSGRV
FT                   GSPDNFNVWTTTWRSPDRGIQQLLLEPLWIVDPATGKVINALAKDKPIYNSDFTRMVVK
FT                   IREGCYWSDGVEFTADDLVYTVELIMKYQELGYNASFNEYVKRVYKTDKYTVVFELKKP
FT                   NARFHAYFLDRWGACRPLPKHVFEKVKDPITFDFKPPVGTGPYVLHSYDPGGYWTLWQR
FT                   REDWQRTPTGKLFGMPQPKYVLFYYYGPTEKQVLAQNNHQLDMADLTMEGLRSVLQTNK
FT                   YARAYRKEFPYIVNVDPCVSGVIFNNAKAPWNNKEVRWALTLAIDIVEYVGLAYDYAVT
FT                   VSPVHIPATPAYMNWYIKPLEPWLKNLTITVDGKPFKVYDPDVPMRIAEAARKRGYKVP
FT                   TDPKQIREIFGIGWYKYAPDVAEKLLIKNGFKRDKDGKWLTPEGKPWKITILTPPNPAS
FT                   VNYRNAFALSQVWKKFGIETEVYATENDGTLMNVGDFEVSTSGQWPAREPWGGHPDLYR
FT                   TMEQFSSAYYRPLGEYYPGHQCRWTNPKMDEIIKGMQSVSWDSPKNKALGMEGLKILAQ
FT                   EMPTIPTFTYPGVVGYDEYYWTNYPTAENPYCIPYHHWPNFKYMLPFLKPTGRK"
FT   gene            5721..6473
FT                   /locus_tag="DICTH_0006"
FT   CDS_pept        5721..6473
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0006"
FT                   /product="conserved protein"
FT                   /note="identified by match to protein family HMM PF02353;
FT                   match to protein family HMM PF03848; match to protein
FT                   family HMM PF05175; match to protein family HMM PF08241;
FT                   match to protein family HMM PF08242"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ACI20051"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:B5YAS0"
FT                   /protein_id="ACI20051.1"
FT                   /translation="MEEKFEANWEAVFEPEDYLYFYEDMLTDEQTQIEVDFIRRELDLK
FT                   EPKKILDIACGYGRHANRLALYGHEVVGVDLSEKFLRMAKEDADKLNVKVNYILGDIRE
FT                   INFDEEFDAVISMFTSFGYYEDEDNLKILRNVSKSLKRGGKFLLDLSNRDFILRNFLPY
FT                   VVIEKDGNYMIDFNIVDITEGRIYNKRVVIRDGVKKEKPFFIRLYTPTEIRLLLEIVGL
FT                   KVLRFYGGYDSSPLSIYSRRMIVISEKI"
FT   gene            6487..7224
FT                   /locus_tag="DICTH_0007"
FT   CDS_pept        6487..7224
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0007"
FT                   /product="tetratricopeptide repeat domain protein"
FT                   /note="identified by match to protein family HMM PF00515"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19156"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:B5YAS1"
FT                   /protein_id="ACI19156.1"
FT                   /translation="MRRFFLFLLLFVFIIMNTFGVEFDSANRIFFEARRDRNVEKIKSL
FT                   INSLESDKDLPKNSQLLTVLADSYLEYGLWGVEGKEKEKMYEKARSYAEKAIQIDPNNG
FT                   RAWYIAGASIGRLAQYKGIVQSLFMLKDFDKYIGKAIEILNDPLYKTFALLAMGMRYRD
FT                   VPWPLYNYEKAESYMKEALKYTPIYPNVYLELGYLYLKMGKKDFAKEMFLKVINSEPHP
FT                   WLVKTHEESVKLAEKELEKLGGK"
FT   gene            7229..8236
FT                   /locus_tag="DICTH_0008"
FT   CDS_pept        7229..8236
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0008"
FT                   /product="endoglucanase H"
FT                   /EC_number="3.2.1.4"
FT                   /note="identified by match to protein family HMM PF00150"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18520"
FT                   /db_xref="GOA:B5YAS2"
FT                   /db_xref="InterPro:IPR001547"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:B5YAS2"
FT                   /protein_id="ACI18520.1"
FT                   /translation="MRLKILLLLVLLIFLAGCSSYEFKLEMLPILRGINMGNALEAPRE
FT                   GEWGVVIKDEYFKIIKEAGFSHVRIPIRWNAHADMNPPYTIEKAFFDRVDHVVNEALKN
FT                   ELFVIINIHHYEEIMQYPEKHKDRFLALWRQIAEHYRDYPPTLIFELLNEPCMNLTANL
FT                   WNKYLAEAIKVIRESNPDRYIVVGPVNWNSIYALKDLKLPKDEKNIIVTFHYYNPFSFT
FT                   HQGAEWVQPSPPVGVRWWGREDEKAEIDRELDMALDWSIRNGKVPLYMGEFGAYSKADM
FT                   DSRVRWTSYVARSAEKRGIAWAYWEFCAGFGAFDPVKNEWRKPLLKALIPETKM"
FT   gene            complement(8288..9697)
FT                   /locus_tag="DICTH_0009"
FT   CDS_pept        complement(8288..9697)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0009"
FT                   /product="mannan endo-1,4-beta-mannosidase"
FT                   /EC_number="3.2.1.78"
FT                   /note="identified by match to protein family HMM PF02156;
FT                   match to protein family HMM PF03422"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19887"
FT                   /db_xref="GOA:B5YAS3"
FT                   /db_xref="InterPro:IPR000805"
FT                   /db_xref="InterPro:IPR005084"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR022790"
FT                   /db_xref="UniProtKB/TrEMBL:B5YAS3"
FT                   /protein_id="ACI19887.1"
FT                   /translation="MKFTLPLLILLLIIFSINFSSDEITIEAENGVLNGTYVARQFPGY
FT                   QGTGYVDGFDKDGDSCSVTFEVKESGMYELIIGYAAPYGYKENSLYVNGEFQTNVKFPQ
FT                   SQKFTTVYAGLIPLKNGKNTISIVKSWGWFLLDYFKIKKAEIPTMNPTNKLVTPNPSKE
FT                   AQKLMDYLVSIYGKYTLSGQMGYKDAFWIWNITDKFPAICGFDMMDYSPSRVERGASSR
FT                   DVEDAIDWWNMGGIVQFQWHWNAPKGLYDTPGKEWWRGFYTNATSFDIEYAFNHPESED
FT                   YKLIIRDIDAIAVQLKRLQEAKVPILWRPLHEAEGRWFWWGAKGPEACKKLWRLLFDRL
FT                   VNYHKINNLIWVWTTTDSPDALKWYPGDEYVDIVGADIYLKDKDYSPSTGMFYNIVKLF
FT                   GGKKLVALTENGIIPDPDLMKEQKAYWVWFMTWSGFENDPNKNEISHIKKVFNHPFVIT
FT                   KDELPNLKVEE"
FT   gene            complement(9775..10167)
FT                   /locus_tag="DICTH_0010"
FT   CDS_pept        complement(9775..10167)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0010"
FT                   /product="transcriptional regulator, MerR family"
FT                   /note="identified by match to protein family HMM PF00376"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19116"
FT                   /db_xref="GOA:B5YAS4"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="UniProtKB/TrEMBL:B5YAS4"
FT                   /protein_id="ACI19116.1"
FT                   /translation="MRIKEVCEKYGLTPDTLRFYEKIGLLPRVRRDKNGIRDYSEEDCR
FT                   WIEFIKCMRSAGIEIEALVRYVKLFQEGDATLEERKQILIEQRDKLQAKIEEMQKALER
FT                   LNYKIQVYETHIKEAERKLKKTVTKV"
FT   gene            complement(10145..10657)
FT                   /locus_tag="DICTH_0011"
FT   CDS_pept        complement(10145..10657)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0011"
FT                   /product="flavodoxin"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19752"
FT                   /db_xref="GOA:B5YAS5"
FT                   /db_xref="InterPro:IPR001226"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:B5YAS5"
FT                   /protein_id="ACI19752.1"
FT                   /translation="MSHILIIYYSWSGNTRKIAHIIQKEVGGDMVEIIPENPYPSSYNA
FT                   TVEQAKKEIKMDYKPPIKTKIEDIEKYDIIFVGTPNWWSTIAPPVATFLTQHNLLGKTI
FT                   IPFITHGGGGQGRVVSDIKRLCPESKVLEPLSIYEGGSTDLREKILEWLKKLPIKRGEN
FT                   NEDKRSM"
FT   gene            10796..11671
FT                   /locus_tag="DICTH_0012"
FT   CDS_pept        10796..11671
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0012"
FT                   /product="cobalt/zinc/cadmium cation efflux pump protein"
FT                   /note="identified by match to protein family HMM PF01545;
FT                   match to protein family HMM TIGR01297"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18933"
FT                   /db_xref="GOA:B5YAS6"
FT                   /db_xref="InterPro:IPR002524"
FT                   /db_xref="InterPro:IPR027469"
FT                   /db_xref="InterPro:IPR027470"
FT                   /db_xref="InterPro:IPR036837"
FT                   /db_xref="UniProtKB/TrEMBL:B5YAS6"
FT                   /protein_id="ACI18933.1"
FT                   /translation="MEAKKILGAMFLNFLMALLEVIGGIFSGSLALISDALHNINDFFA
FT                   LLISYLAEIISKNKKSNLKHTFGFRRVEILSALLNGVLLLGVFLFLIVEAFHRIKSPKE
FT                   VEGIQTVIIGVIGLVGNILGALLLHEDSHHNLNIKGAFLHLISDAISSVGVIIGAMFII
FT                   FYKLYIADTIISLLIAGFILYSSIDLIKETLHILMEGTPREVDINEIQKLICKIPGVRD
FT                   IHHIHVWQVSTKDYLLSAHVVVEDQKVSEAEKIVSQIKDTLREKFNINHSTLEIESETY
FT                   FKEKECQCEY"
FT   gene            11661..13430
FT                   /locus_tag="DICTH_0013"
FT   CDS_pept        11661..13430
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0013"
FT                   /product="radical SAM"
FT                   /note="identified by match to protein family HMM PF04055;
FT                   match to protein family HMM PF08497"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18555"
FT                   /db_xref="GOA:B5YAS7"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013704"
FT                   /db_xref="InterPro:IPR022946"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR024560"
FT                   /db_xref="UniProtKB/TrEMBL:B5YAS7"
FT                   /protein_id="ACI18555.1"
FT                   /translation="MNIDKFLPINLYEAKKRGWDELDIIIVTGDAYVDHPSFGASVIGR
FT                   YLEYFGFRVGIIPQPDWKDKESFKVLGKPRLFFGITAGSVDSMVANYTPNKFKRREDAY
FT                   TPGGLPGKRPDRATIVYANFVHEIFPDVPIVLGGIEASLRRFSHYDFWDNKVRHSVLLD
FT                   ARAKIIVYGMGEKQTLQIAKMLSEGKSWYEIYQIPGIVFSLGEKEFDTFIKDKDYILLP
FT                   SFEEVSQDKDRYYDFQRLLLEGMKRKKILVQRDGKRFIIQNPPPSYTSQDLDFIYSLPF
FT                   MRLPHPSYKEKIPAFETVKTSIVSHRGCFGSCTFCSLNLHQGWQVISRSEKSILEEIYR
FT                   LTKHREFRGTISDVGGPTANMYRLRCKIHNIPGSCPERDCLFPDVCKYLEVDHSAQLNL
FT                   LKKIKEIEKVKHVFIASGIRYDIALKDEYYIGEIIKEGYIGGHLSAAPEHVKDHVLEIM
FT                   KKPKFKVYEEFVDIFERNLKKYRKELYIIPYFISAHPGATIKDAWDLAMYIKGLGHYLE
FT                   QIQDYTPLPLTPASCAFYTEYHTLRKEKIYVAKTYEDRRLQRALAQYKDKKNREFLVKN
FT                   KKKIPFPLEKLLG"
FT   gene            13446..13862
FT                   /locus_tag="DICTH_0014"
FT   CDS_pept        13446..13862
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0014"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF01894;
FT                   match to protein family HMM TIGR00149"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19245"
FT                   /db_xref="InterPro:IPR001602"
FT                   /db_xref="InterPro:IPR035917"
FT                   /db_xref="UniProtKB/TrEMBL:B5YAS8"
FT                   /protein_id="ACI19245.1"
FT                   /translation="MKSYRKELWFELPTRRGFVNITDTLQKCVDESGIKEGLLLCNAMH
FT                   ITASVFINDDEPGLLKDFEIWLEKLAPEKPYNQYYHNVGENNADAHLKRTIMGREVVIA
FT                   ITNGKLDLGPWEQVFYGEFDGMRRKRVLVKIIGE"
FT   gene            complement(14023..14388)
FT                   /locus_tag="DICTH_0015"
FT   CDS_pept        complement(14023..14388)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0015"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18622"
FT                   /db_xref="GOA:B5YAS9"
FT                   /db_xref="InterPro:IPR010397"
FT                   /db_xref="UniProtKB/TrEMBL:B5YAS9"
FT                   /protein_id="ACI18622.1"
FT                   /translation="MKEIKTLGGIGAILGLLIFLPYIGFVLEIVSIVLLLVAMSKLSTY
FT                   YNNKEIFNKYLIGFILSIISGVVLIIFLGSAILSIFTSSQESLSILKGGLTFLIIGYIL
FT                   MIMGMNDWKKVSPYYLI"
FT   gene            complement(14682..15698)
FT                   /locus_tag="DICTH_0016"
FT   CDS_pept        complement(14682..15698)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0016"
FT                   /product="transcriptional regulator"
FT                   /note="identified by match to protein family HMM PF00356;
FT                   match to protein family HMM PF00532"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19458"
FT                   /db_xref="GOA:B5YAT0"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:B5YAT0"
FT                   /protein_id="ACI19458.1"
FT                   /translation="MVNIRDIAKKAGVSPSTVSRALNDDSKISEETRKKIKEIAKRLKY
FT                   KPNQAARALITRETKTIGFLILKKEKPLVADPFYSIILYSVQNELHEMGYHLLYGIIPH
FT                   GKLNPKKPPRMIQEERVDGLILAGPDMPKEFIETIKKTGIPLILVDNYSEDIDSILADN
FT                   IRGAYIATKYLIDLGHKNIAFASGPLDHISVYERWEGYKKALAEANLEYNPNYMVEEKE
FT                   LTMKTGKHAFQILWKNDPKPTAILSANDPMALGVIQCAKDMGIRVPEELSVIGIDDIDI
FT                   SSQFDPPLTTVKIFKEEMGSIAAKRLIDRIKNPNQPPVKIIVSTELIIRSSTAPLKK"
FT   gene            15922..17709
FT                   /locus_tag="DICTH_0017"
FT   CDS_pept        15922..17709
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0017"
FT                   /product="ABC-type dipeptide/oligopeptide/nickel transport
FT                   system, periplasmic component"
FT                   /note="identified by match to protein family HMM PF00496"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18898"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:B5YAT1"
FT                   /protein_id="ACI18898.1"
FT                   /translation="MKKLNLILILVLLLSLTLTLSSAAIKEPEIRFATTWPYPFHGNAF
FT                   GPGAIGGAWWFAYEPFAYYIPATGEYIPRLATSWKLEGNKLVVNLRKTRWSDGTPFTAK
FT                   DIECNIAFLHAMWEWPYEIAGVEVRSENTVALVLSSTHPFLIHSLLTDGAISTLAPYHI
FT                   YGKFLSEAKEVASLGRKIWELREQKKIVPEDLKKDYDKKAAAFREKVNNFSPIKEIGRM
FT                   PVVGTYEPTNVTQTEMVLTKNKYHWAAGKIRIPRVVFRRWSSNEFVWASLVAGEIDAAH
FT                   PSIPKDVVDQFNLLNPNLKLKAVSDLSEFALIFNFEKLLFKDLTLRKAIAYALNRTKIR
FT                   DVAAWQAKDVSDYAHGVLKSMEKTWLSADFLKTLTNYSYNPAKAEAILKEAGYTKGSDG
FT                   LWRTPDGKVVAFTVSVYGPHSDWVLAAREITEQLKNFGFKVDLKIIPEGMRDTVMRGGD
FT                   YEAAVEFGTAWWGYPHPAMGYTRIYQGEVADFTRFPAKSKFKTPWGDLVPYELTDKLQE
FT                   VTTKPAEAKDYVMKLAYITNEYLPMIPFLEKVLPIFYLDGKRVTGWPEPDDSTWSLAPG
FT                   GIERVYVLLLSEGKLRPKL"
FT   gene            17742..18728
FT                   /locus_tag="DICTH_0018"
FT   CDS_pept        17742..18728
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0018"
FT                   /product="ABC-type dipeptide/oligopeptide/nickel transport
FT                   system, permease component"
FT                   /note="identified by match to protein family HMM PF00528"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18578"
FT                   /db_xref="GOA:B5YAT2"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B5YAT2"
FT                   /protein_id="ACI18578.1"
FT                   /translation="MKYILNRLVQVLIMTFLALTVVFFIVQSMPGDPAFGLAVSIAQSR
FT                   NMPLDKALEIAHNIIGYNPKESIVLKYLKFLRNIIVGNFGYSTYFKTSVNEIIGKALPW
FT                   TLFVISLATVIGFFLGVSIGAFSAQKRGSFIDTFISTIFSIIQAIPAFVLAVVILFLGA
FT                   VRLRLLPLGGAYPIEMNPGFYPGFILAVIYHALGPLIATFIPQMASWGLAMRGNCSNVI
FT                   EEDFVRFAKIRGLPDSTIARRYVRRNAILPLVASLAIGIGYMLGGHTLVEVIFNYPGIG
FT                   YYFGQAISARDFGLLTGLFSLIVIGVILATFITELLYAVIDPRVKVQ"
FT   gene            18725..19579
FT                   /locus_tag="DICTH_0019"
FT   CDS_pept        18725..19579
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0019"
FT                   /product="ABC-type dipeptide/oligopeptide/nickel transport
FT                   system, permease component"
FT                   /note="identified by match to protein family HMM PF00528"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19643"
FT                   /db_xref="GOA:B5YAT3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR025966"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B5YAT3"
FT                   /protein_id="ACI19643.1"
FT                   /translation="MRDFIRPILMNRKAFVGLIILSIFILMAILGPVVVPLNLSSNFAE
FT                   RYQPPSWKHPYGTDYFGIDIFQQIVHGSRSVIGLSVLSSLFAVIIGSVIGIARGYLGGF
FT                   ISKFLDTIITIFLVIPSFPALLIMAAIFADKSLNIIAVALIIAMWLWAPLAKQISAQVL
FT                   SIKSKEFIEVSKMLNLGTNYILFKDILPLLIPYIFINFITQLKGAMEFSVGLMFLGLAK
FT                   FDPTHWGVMLNYALYQAGALYTPRGFHYPIIIMLHIVLLIYGGILFAQGIEEIFNPKLR
FT                   RYE"
FT   gene            19579..20541
FT                   /locus_tag="DICTH_0020"
FT   CDS_pept        19579..20541
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0020"
FT                   /product="ABC-type dipeptide/oligopeptide/nickel transport
FT                   system, ATPase component"
FT                   /note="identified by match to protein family HMM PF00005;
FT                   match to protein family HMM PF08352; match to protein
FT                   family HMM TIGR01727"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19097"
FT                   /db_xref="GOA:B5YAT4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B5YAT4"
FT                   /protein_id="ACI19097.1"
FT                   /translation="MRVILSINNLRAVYLVREGTIKACDGVSFDIEENTVYAIVGESAS
FT                   GKSTIIEAMTLTLPPNSKILEGEVIYNGRDLLKLSENELRKIRWSEIALVPQAAQQSLN
FT                   PTMRIIDHFFDTVYAHHKNWQNNEIVKKAEELIALVRLDPKNVLYSFPHQLSGGMKQRV
FT                   LIALSLVFKPKILILDEPTSALDVLTQAYIIQLLKDLKKQLKLTLIFVTHDIAVAAELS
FT                   DRISVVYAGNIVESGPTRDVLKDPKHPYTQGLVNSIMSLISDPEKIKGIPGDPPSLLDP
FT                   PSGCRFHPRCTYVREECKKEKPPMYSLNSNRKVACYLYK"
FT   gene            20554..21570
FT                   /locus_tag="DICTH_0021"
FT   CDS_pept        20554..21570
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0021"
FT                   /product="ABC-type dipeptide/oligopeptide/nickel transport
FT                   system, ATPase component"
FT                   /note="identified by match to protein family HMM PF00005;
FT                   match to protein family HMM PF08352; match to protein
FT                   family HMM TIGR01727"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19711"
FT                   /db_xref="GOA:B5YAT5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B5YAT5"
FT                   /protein_id="ACI19711.1"
FT                   /translation="MEIPVLELEGITKIFSRGYFKKKYIIALENINLRINKQDRLAIIG
FT                   ESGMGKTTLARIACLLETPTQGKIKWFGKDISNVSRRELSYLRTRVQYVHQDPYASLHP
FT                   SRTIYATLADPLSRNNNIRGKELERRVEELLNLVGLTPPSYFLNKYPHHLSGGGRQRLA
FT                   IARALTANPEVLVADEPISMIDMSLRATIIQILKILNKELGISIILILHDIGAARFFAT
FT                   NGGKIAVLYGGRIVEKGECDEIVNNPLHPYTRTLISASPIPDPDLAQEKKVIELKSYEP
FT                   PKRELGKKLCPFSHACLYSQDICFNKDPGLENVNDKHEVACFFWNRLPKWIPPWSKE"
FT   gene            21923..23845
FT                   /locus_tag="DICTH_0022"
FT   CDS_pept        21923..23845
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0022"
FT                   /product="oligopeptide ABC transporter, periplasmic
FT                   oligopeptide-binding protein"
FT                   /note="identified by match to protein family HMM PF00496"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19089"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:B5YAT6"
FT                   /protein_id="ACI19089.1"
FT                   /translation="MRLNYTKIFIILFLLIILLGNTFSATKYNEAPSLAQLVKEGKLPP
FT                   VEERLPKNPVVLKPYEEIGKYGGTWRRAWLGAGDRWGIARISMSACNLLRFSSDGKKVL
FT                   PWLVDKYTVSKDGKIYTFHIREGIKWSDGEPFTTDDVIFWYEDIICNKDLTPNMPSQFV
FT                   SSDGKSIAKFEKIDKYTFRIIFPEPKPLFIYDIPAQGWYMDTTHGSLSYYAPKHYLMQF
FT                   HPKYTPMEKLEKMAKDAGFNKWYELFKFKDDWLQNPELPVTAPWKVVSKSPNEPVFVME
FT                   RNPYYHVVDPEGNQLPYIDRVVHYLVSDAEMINMKAVAGEIDCQDRHMRVSNYSLFMEN
FT                   AQKGNYRVLKWASAVGADPAIFLNQNVKDPVKRKLFQDVRFRQALSLAINRDEINKILY
FT                   MGLGTPMQAAIPKGAAYYDPSWEKAYAQYDPGRAKILLDAMGLKVGKDGFRIGPEGKPI
FT                   ELIISFTTYPGNANMSIMELIKSYWEKIGIKTIIKQVDRSLYVTNCNSGDIEIGVWVMD
FT                   RCSNFILSPGRILGTITDGPWAPLYARWYWTKGKEGEEPTGDIRKLYELWDQVNQTTDA
FT                   TKRDILIRQIVALHRKNIWIIGTVGALPSLCIVKNNFRNVPEYLISDAPLFTPLNAFPE
FT                   QFFIK"
FT   gene            23962..24162
FT                   /locus_tag="DICTH_0023"
FT   CDS_pept        23962..24162
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0023"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19959"
FT                   /db_xref="GOA:B5YAT7"
FT                   /db_xref="InterPro:IPR027379"
FT                   /db_xref="UniProtKB/TrEMBL:B5YAT7"
FT                   /protein_id="ACI19959.1"
FT                   /translation="MEGLRENFILFLPLLLIQLVFQILAIVDLIKRNKEEIRWENKIIW
FT                   AIIILAFGILGPMAYFVFGRK"
FT   gene            24164..25060
FT                   /locus_tag="DICTH_0024"
FT   CDS_pept        24164..25060
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0024"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19593"
FT                   /db_xref="GOA:B5YAT8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR025302"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B5YAT8"
FT                   /protein_id="ACI19593.1"
FT                   /translation="MNVIETYNLCKYYPNKKALDDLNLEVPEGVIFGYLGPNGAGKTTT
FT                   IRVLLNLAKPTKGSAVILGEDITKSRKYLRWIGYLPDVPNFYNYFTAKEYLVTLCEIIG
FT                   VDKKRVDEVLEMVDLKNEKKRIGTFSRGMKQRLGVAQALLPNPKLLILDEPTSSLDPQG
FT                   RKEILDLIVSFRGEKTVFFSTHILADVERVCDRVGILKDGRLLLNDTLGNIKKKFSRRI
FT                   IRLEVDNPLRIVEQIRREDFVEEVLEENQNSLILKVRDLEMAQRRIPEIIVKEGLSLMH
FT                   FEVLEPTLEDIFFEVIS"
FT   gene            25057..25827
FT                   /locus_tag="DICTH_0025"
FT   CDS_pept        25057..25827
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0025"
FT                   /product="membrane protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18281"
FT                   /db_xref="GOA:B5YAT9"
FT                   /db_xref="InterPro:IPR032688"
FT                   /db_xref="UniProtKB/TrEMBL:B5YAT9"
FT                   /protein_id="ACI18281.1"
FT                   /translation="MILKLMKKEWKELIKTGKLYALLFVFLFFSIGSPVVAKFTPDIIK
FT                   SLASSSEMQGFIIQLPPPTWKDAFLQFFKNLNQIIFIVVVIVFMGSISEEKNKGTVSIL
FT                   LSLGVERKKWLLSKFFFQVFSTFILIISSYLICAYYTYFLFKEISIYNSLSATLLYLVY
FT                   NLFILSLLTFSGTLAKNPLQTAGIFFVVFIIFNLLLIFPNLSSYNPMNLSSLENLWISK
FT                   EVLWGDAFKNIFSTLFYSFVLVLVSIILFEKQEL"
FT   gene            25828..26997
FT                   /locus_tag="DICTH_0026"
FT   CDS_pept        25828..26997
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0026"
FT                   /product="putative glycosyltransferase"
FT                   /note="identified by match to protein family HMM PF00534"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19851"
FT                   /db_xref="GOA:B5YAU0"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:B5YAU0"
FT                   /protein_id="ACI19851.1"
FT                   /translation="MIVGLFNDSFPPVMDGVAIAVKNYAYYINKKYGKAYVVTPSFPGY
FT                   KDEEEYEVIRYFSIPVVLRPPYRFGIPFLDLKAMRKIESIPFDIIHVHSPFSSGVLGLY
FT                   IAKKRKIPIVASFHTKYYDDFKEATKSDFIARLGVKIIVEFYNRVDEVWTVNSATAETL
FT                   RDYGFKKEVKIIPNGSDFIPPRNIEEYREKIERLHNLSKEEVVILFVGQMVKQKNVEML
FT                   LRSLKVLKDENISFKAILIGTGKDEDYFKKLAEELKIEDRVIFTGKVLDRELLKAYYAR
FT                   ADLLAFPSLYDTSALVVKEAAALGCPSLLIKGSTVAEGEGVIDGLNGFLSEDDYINYAK
FT                   KMKEILSQRELLKKVGENARVTLYKHWEEIVDIVVENYKRLLDKYKGKQ"
FT   gene            27315..28286
FT                   /locus_tag="DICTH_0027"
FT   CDS_pept        27315..28286
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0027"
FT                   /product="tricarboxylate-binding protein"
FT                   /note="identified by match to protein family HMM PF03401"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18536"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:B5YAU1"
FT                   /protein_id="ACI18536.1"
FT                   /translation="MFSKKLLVTIALVLIFLITVGSGIDFPTRPVQIIVPWSAGGATDV
FT                   LFRAIASVFPKYANGQPLVVNNIPGGGAVPGTMEFLRAKPDGYTLLSFAAPILIKSHMD
FT                   PVEFNADSFEPVILIVNDPCYILVRKDAPWKDLKEYVEYAKQNPGKITIGNGGAGGGTH
FT                   LAALAFESFAKIKLTHVPFEGGGPAVTALVGGHINSYMGAAPEGLANVDSGQLRILGIF
FT                   GSKRLEKYPDVPTAKEQGFNFQFGMWRGVAVQKGTPKEIVDRLHTIFYRAMRDPDFQKK
FT                   AKELSLTLEYRGPASFAKFIKDYDKYYEDLIKSNKLGNKYKY"
FT   gene            28350..28802
FT                   /locus_tag="DICTH_0028"
FT   CDS_pept        28350..28802
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0028"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18801"
FT                   /db_xref="GOA:B5YAU2"
FT                   /db_xref="InterPro:IPR009936"
FT                   /db_xref="UniProtKB/TrEMBL:B5YAU2"
FT                   /protein_id="ACI18801.1"
FT                   /translation="MRLKFSWDTGIGIGIILFGVFILLNALNMPDMPLGLGPGDFPEIV
FT                   SIGLIICGFILTFQSFFISEKTKKIYSKSSVKDVLILIFISLLYVYLVKYIGFLYLTPF
FT                   LMLATMYLFGYKKLPYAIVISVIFTLLVYYVFYGIFKVPLPQFSLF"
FT   gene            28825..30300
FT                   /locus_tag="DICTH_0029"
FT   CDS_pept        28825..30300
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0029"
FT                   /product="tricarboxylate transport membrane protein RctA"
FT                   /note="identified by match to protein family HMM PF01970"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19919"
FT                   /db_xref="GOA:B5YAU3"
FT                   /db_xref="InterPro:IPR002823"
FT                   /db_xref="UniProtKB/TrEMBL:B5YAU3"
FT                   /protein_id="ACI19919.1"
FT                   /translation="MINYWVEGLKIALQPNNLLLMLIGTVGGIIVGALPGVTSSMGIIL
FT                   LLPFTYYLDPKSALLMLAGMYSGSMFGGSISAVLLGVPGTPSAAATLIDGYPLGRQGKA
FT                   GKAIFTALIASFSGGILSGIVLVFLAPILASFALRFSPIDYFALAIFGLSIIASVSGKH
FT                   LLKGIISGLLGLFISTVGIENIRGSTRFTFGISQLSAGFELLPVLIGVFAITEILMELE
FT                   QKGQETKIQHRISEVFLTKEEFKSIIIPILVGAIIGIVIGVIPGTGGTIATFLAYNVLK
FT                   NISKRKEKFGKGAVEGVAVVECANNAVTGGAMVPTLALGVPGDVVTAVMLGAMILIGVR
FT                   PGPLLFQATPDLVYSFFAGWFIIQFMMLVVGFVSTLTAPYILEIPKKILMPIVLIFAII
FT                   GSFAIRNSLYDVAIALIFGLFGYFMRKHNFPATPLILGIILGPMAEQNLNRALILSGND
FT                   YTVMFKSPISLTLLILAVLSIVLGVISGKREGK"
FT   gene            30317..31420
FT                   /locus_tag="DICTH_0030"
FT   CDS_pept        30317..31420
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0030"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF01321"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18762"
FT                   /db_xref="GOA:B5YAU4"
FT                   /db_xref="InterPro:IPR000587"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR029149"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:B5YAU4"
FT                   /protein_id="ACI18762.1"
FT                   /translation="MERKDEVKIKLERVRNFLRENDLSAMLIKKQPNFSWITAGGVNFV
FT                   GIATEIGVTSVLITDKEQFVIANRIEARRMREEEVDDMFEVIEYEWYEDKEMEIVKSIV
FT                   GNGKVGCDIVLPGTHFVDNTFKKLRYELTEGEIERYLYLGEKLSRTVEEVLMYEIKPGE
FT                   TEIEIAGKISARLWKDGIEPTAFMIASDDRIRNYRHPISKNKKIEKLVMASVNARYRGL
FT                   IATITRMAYFGEISENLRKQYRDNVEIECIMIAKTKIGEEMRIPVLSAIEEYEKRGYKD
FT                   EWKLHHQGGSMGYYPRDIRVTPTTTEKVCRNQAFCWNPSITGTKSEDGFIITEKGPIMI
FT                   TKPIIFPTLKVEVEGMTFVKPDILEIL"
FT   gene            31433..32614
FT                   /locus_tag="DICTH_0031"
FT   CDS_pept        31433..32614
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0031"
FT                   /product="oxidoreductase family, NAD-binding Rossmann fold
FT                   protein"
FT                   /note="identified by match to protein family HMM PF01408"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18722"
FT                   /db_xref="GOA:B5YAU5"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B5YAU5"
FT                   /protein_id="ACI18722.1"
FT                   /translation="MDKVRVGLVGAGFIARIHMAAYREISPYVEVVGVCSGRRENAERF
FT                   SKEFGIPKVFGDFEELCASSDIDIVDVCTPTNLHDEVILCAAKNKKHVICEKPLTGYFG
FT                   EDTDKELVGIEVPKSFMYKKVLEKIERIERTVKESGIKFMYGENLVYAPSIEKMKRMIY
FT                   ISSSPILEIRAECSHSGSHASYAKKWKTSGGGSLMRLGSHPVAVVLHLKHYEGLLRDGK
FT                   PIRAKAVWSEVANLTKTEKFLKEEKHYVATSWEDVEDWSILVIDFEDGTKGIIFSNDVS
FT                   LGGLKNWVQVNLSSGMIYANINPNNMMVAYAPEETVWKDEYVAEKIETKAGWNFPSPDD
FT                   FWTRGFPQELKDFVLAVKENKEPVSNFDLAKETAKVLYAGYYSSEEGRKIELM"
FT   gene            32674..33651
FT                   /locus_tag="DICTH_0032"
FT   CDS_pept        32674..33651
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0032"
FT                   /product="trap dicarboxylate transporter, dctp subunit,
FT                   putative"
FT                   /note="identified by match to protein family HMM PF03480"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19102"
FT                   /db_xref="GOA:B5YAU6"
FT                   /db_xref="InterPro:IPR018389"
FT                   /db_xref="InterPro:IPR038404"
FT                   /db_xref="UniProtKB/TrEMBL:B5YAU6"
FT                   /protein_id="ACI19102.1"
FT                   /translation="MKKYFTLLILFLLVPLSSFGSAQSNILIKATSPFPEGHIITQTMI
FT                   EFKNIIEQETQRRIKFELSIAKDTEEQANERCSKGEVDMQFTGGRAIEVFAPQYFFINA
FT                   PFVLKDYEHFFRIMKGPIGEKAKEQILKNGNMYTLGYLYRGYRQMTSNKPILSLKDLEG
FT                   LKLRLPVVPTWIKVWEALGVKAVPVPLTGLYQALKDGTAEASEGDLTQISGYKLYEVQK
FT                   YLIITNHLVSFGWVHMYKPAFDKLSKGDQELFVKTAEKVCDTATKKLIASENDILGMLM
FT                   KNGMTVIYLDDKTMTQIREKAKPAVEELFRTTWPVTTWEEILKQ"
FT   gene            33815..33967
FT                   /locus_tag="DICTH_0033"
FT   CDS_pept        33815..33967
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0033"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19927"
FT                   /db_xref="UniProtKB/TrEMBL:B5YAU7"
FT                   /protein_id="ACI19927.1"
FT                   /translation="MKITLGRVKIKESKTKQNRVNVNKVEDITLRSETVINNSPIVEYL
FT                   RTKTF"
FT   gene            34162..35730
FT                   /locus_tag="DICTH_0034"
FT   CDS_pept        34162..35730
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0034"
FT                   /product="glutamate synthase domain protein"
FT                   /note="identified by match to protein family HMM PF01645"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ACI20167"
FT                   /db_xref="GOA:B5YAU8"
FT                   /db_xref="InterPro:IPR002932"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:B5YAU8"
FT                   /protein_id="ACI20167.1"
FT                   /translation="MSFSKPNFSEATLTRLRLKDYSPFSGMCVTCLDGCPGYCEIAKSG
FT                   VRGREYIYPKPYGKVTSASEKDYPVDFSHFNINGTCVGALGVEPDPDKATFPAVDIETR
FT                   IGDIKLRGPWFTTGLGSTFIARDNWEGVAIGSALFGTMVGVGENVCGVDPDAEIKNGKV
FT                   VRSPEMERRIRLFKEWQRDNYGGVIVQENVEDSRLGTLEYVIEQLGIEFVEIKWGQGAK
FT                   DIGGEIKLSDIKRAKQLKDRGYIVFPDPDDPIIQDLYQKGGIKEFERHSRLGMASVEGF
FT                   VKRAEELRKRGAKYISLKTGAYRPKDLALALRAASEGKADLLIVDGAGGGTGMSPWRMM
FT                   NEWGIPTVYLEALTYKYAKMLAEKGKHVPTIAIAGGFTLEDHIFKGLALGAPYVKLVAM
FT                   GRATLTAAMVGKNLGEWIKKGTIPKEYAEYGNDIEEIFVAVAEIKKILGDDWKKVPPAA
FT                   LSVYGYFDRLAVGLKQFMAGARKFKLEYITRDDIVALTKEAAEVTGIPYVMDLDHEESM
FT                   KILFD"
FT   gene            complement(35786..36619)
FT                   /locus_tag="DICTH_0035"
FT   CDS_pept        complement(35786..36619)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0035"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18295"
FT                   /db_xref="UniProtKB/TrEMBL:B5YAU9"
FT                   /protein_id="ACI18295.1"
FT                   /translation="MIKNLKIKKTLLIIFTTVILSSFYSSKAFGFDWDSFLENLYHWNL
FT                   TLQGNIYGDTYIYNDSLNTSFTVIDEYGDDYTFYINQNANHTKTSYMPLTLRIPLFYND
FT                   NLSIGFSSSQRYFQTKIFEEIGSITHDYDYDNLMGVAVGVYLSVKVLPRLWIFTTLGGA
FT                   YYYLNTTADTLKPSWYGDPGLYWDGYFYEPGTPLKVRGETDYKFFFSIGMKYYIYSGIF
FT                   LELTYYHFPGATINNMSYILEGPVDLKINVSPEKLPKPITIEESHVFTLGIGIGL"
FT   gene            36742..37950
FT                   /locus_tag="DICTH_0036"
FT   CDS_pept        36742..37950
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0036"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19852"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:B5YAV0"
FT                   /protein_id="ACI19852.1"
FT                   /translation="MVDKRNLEEKINKVLEKIKIIDIHTHLFPPSFKDLFLYGIDYLLT
FT                   YHYLIAETVRYLPISPDDFYNLSLKEQAELVWKTLFVDRSPISESARGIVTILTEVGVD
FT                   FEKKDLSLIRAYFDKIDMESYVDLIFEKAKIDYVVMTNDPLDENEMKYWKCNIFKDKRF
FT                   RPSLRLDRLINDWENIREYLKVKDYKEIKDHLDKWFLMIEPLYIALSFPPDFRYPDDML
FT                   RSRLLEEIMLYAEERKVPIALMIGAKRSVNPSLRLAGDSVGKSNIESIENLCRSFPNNK
FT                   FMVTMLSRENQHELCVTARKFKNLMIFGCWWFLNTPSLIEEITKMRLELLGFSFIPQHS
FT                   DARVLEQLIYKWKHSKEIIKKVLYDKYLALIRSGWTLKEEDIERDITQLFRKNFEDFIF
FT                   SKQ"
FT   gene            37947..38876
FT                   /locus_tag="DICTH_0037"
FT   CDS_pept        37947..38876
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0037"
FT                   /product="putative K+-dependent Na+/Ca+ exchanger"
FT                   /note="identified by match to protein family HMM PF01699;
FT                   match to protein family HMM TIGR00367"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18980"
FT                   /db_xref="GOA:B5YAV1"
FT                   /db_xref="InterPro:IPR004481"
FT                   /db_xref="InterPro:IPR004837"
FT                   /db_xref="UniProtKB/TrEMBL:B5YAV1"
FT                   /protein_id="ACI18980.1"
FT                   /translation="MILSSILFNILLFILGLIFLIRGSDLFIERLKLIAKKMGVSEFVV
FT                   GAILASVATTLPEISVSIISSLQGESSLAIGNALGSVLFNISVILGVSSLIMPIKVDEK
FT                   GWKNSLLLFCISIIFGFAAIDRYLSRWEGLILLILYGIFVKRTLKGEWANQKEHKKKIL
FT                   VRDIVYVFITGGIVVLGSKLLVDSAVFFARMLKISEMIIGLTIVASGTSLPEFVNTITS
FT                   IRKKTPNIGVGNIIGACILNILIVSGVAILINPVILAKKFLYLALPIILLIVLALTISL
FT                   KRDNIIGRKTGLIFLVLYALFFILNWRI"
FT   gene            complement(38921..40621)
FT                   /locus_tag="DICTH_0038"
FT   CDS_pept        complement(38921..40621)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0038"
FT                   /product="polysaccharide ABC transporter substrate-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19060"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:B5YAV2"
FT                   /protein_id="ACI19060.1"
FT                   /translation="MKKFERFLSWFLAFTLVFSLIVSVSIREVSAQAKLYKPMNPTPEA
FT                   NKPITFKVYIGEVNPNDDQFKSPVAQKIKELTGVTLDIEYAPNQAAVREKIQIMAASGD
FT                   YPDIIYAKGDLSLLKDAGALIPLDDLIEKYAPNIKKAYGENLKRLKWSKEDPHIYCLGL
FT                   TTDNDRTLDVNGGFMLQHRVVMELGYPRIRTLRDFENAIKAYYKKHPTTDGLPTIPLTL
FT                   CADDWRTVISVTNPAFQATGAPDDGELYVDPKTLKCTFHYKRPIEKEYFRWLNRMWNEG
FT                   LLDKETFIQKEDTYKAKIASGRVLALIDAGWAIGEPITALRRAGKYEYMYGYYPVTVSE
FT                   RIKQAPPDVRVGYTGGWGIAITKSCKDPVRAIKFLDWLCTEDANILRQWGIEGVHHIYV
FT                   NGKRQFLPDVDQARRTDPYFGRKTGIGVYVYPWPRLPNYYIDSTGNPVVPDTTKEDIRK
FT                   NYTEVEKKVLAAYKAEIWKDLFPKAEEYPVKTWGYLWMYPTPDEDMRAIGNKLFDYVIK
FT                   NIPKVVMAPTKEFDKVWNEFLKGLDDLGAKKYEEYKTKQIREMVEFWKK"
FT   gene            complement(40719..41609)
FT                   /locus_tag="DICTH_0039"
FT   CDS_pept        complement(40719..41609)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0039"
FT                   /product="transmembrane lipoprotein"
FT                   /note="identified by match to protein family HMM PF00528"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19909"
FT                   /db_xref="GOA:B5YAV3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B5YAV3"
FT                   /protein_id="ACI19909.1"
FT                   /translation="MKRSLGEKIFDVINYSLMILLVVITLYPFLYVLAVSLNDPFDTIK
FT                   GGITIFPRIFTLDNYKEIFNYPSIGRAALISTLRTVIGTITGVFSTAIVAYVLSRKDFF
FT                   ARKLVTTLFIITMYVGGGLVPEYLLIRGLGLMNNFLVYILPGLINPFNLIVVRAYIETL
FT                   PSELQESAMIDGANDFVIFLKVILPLCIPVLATIALFIAVGHWNSWFDTYLYCGGNKNL
FT                   TTLQYELQKILANAAASSTTIDYYSNLDPTRTMRVTPQSLRMAMTIITTLPIVLVYPFL
FT                   QKYFIKGMTLGAIKN"
FT   gene            complement(41620..42534)
FT                   /locus_tag="DICTH_0040"
FT   CDS_pept        complement(41620..42534)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0040"
FT                   /product="transmembrane lipoprotein"
FT                   /note="identified by match to protein family HMM PF00528"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18781"
FT                   /db_xref="GOA:B5YAV4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B5YAV4"
FT                   /protein_id="ACI18781.1"
FT                   /translation="MKFAQVLKIIRRQKYLILMIFPFVVWLIIFRYIPLWGWITAFQNY
FT                   KPGIPIFQQQWVGLKYFKEMFSDPEFYLVMRNTLAMSLLGLIFGFPLPIILAILINEIR
FT                   HNTFKRTVQTISYLPHFVSWVIVASIVHAMLAPDGVVNYALLKLGLIKQPILFFGEPKY
FT                   FWWIVVFSDIWKELGWNTIIFLAAMTAINPELYEAAEVDGASRFRKIWHITLPGIMPTV
FT                   IMILILSIGNIINIGFERQFLLRTSAVRNVSDVIDLYALDYGIRAGRFSFGTAAGIFKS
FT                   VISLILLFSANKVSKKVTGHKII"
FT   gene            42685..44421
FT                   /locus_tag="DICTH_0041"
FT   CDS_pept        42685..44421
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0041"
FT                   /product="histidine kinase"
FT                   /note="identified by match to protein family HMM PF00672;
FT                   match to protein family HMM PF02518; match to protein
FT                   family HMM PF06580"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18643"
FT                   /db_xref="GOA:B5YAV5"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR010559"
FT                   /db_xref="InterPro:IPR033479"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B5YAV5"
FT                   /protein_id="ACI18643.1"
FT                   /translation="MFKFQDLKIREKLILSFLVVSFIPILVLGAVTIIHFRNFALNSSA
FT                   KEIYNELSFAKFKIMEMTNEAVNIANKLMIDQRLKEILLYRYKSPLEAYLKYSQYKDIE
FT                   NYKTLYANSIYRIRIYSENPTILENGVFYKATKKIKEKDWYKLAVNLNGFIIWDLVRQD
FT                   EDIYSDYYFSLIRLLRDVYNERFGVLVINLNKLEMKSILNHTSYDTLLVNSDGLVIFSN
FT                   KEDFIGKTFDIDLQRILSDKGYTYDLNNKKYLVFGVYLPLTGYNKDFYLVSMVPMEIIM
FT                   REPQRMQRFALTMVFIAFAGSMFFTGIFSRSVSRRIGILNKAVDKISHGNWDLDIPLQG
FT                   GDEIGRLSENVKMMAKNIKRLNELLMKQKDMKFKVLTNQLNPHFLFNTLETIHMMAVCN
FT                   EQKEIADMVLKLGKILRKTIESKGTPIKLESEIELVKSYLEIQKYRLGRLNYDIEILTD
FT                   ISEIYVLPFLIQPIVENSIIHGLENKKDGGFIKIKIFKEDERLIISVEDNGIGMSKEKI
FT                   ESLLSNSDGESSKIGMRNTLERIKLFYGEEYGINIESSEGNGTRVDIILPYPPRREMGD
FT                   VL"
FT   gene            44411..45901
FT                   /locus_tag="DICTH_0042"
FT   CDS_pept        44411..45901
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0042"
FT                   /product="two-component response regulator"
FT                   /note="identified by match to protein family HMM PF00072;
FT                   match to protein family HMM PF00165"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18257"
FT                   /db_xref="GOA:B5YAV6"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="UniProtKB/TrEMBL:B5YAV6"
FT                   /protein_id="ACI18257.1"
FT                   /translation="MYYKVLIADDEPVIRQGLKKIVNWNALGFKIVGEAEDGVEALDKV
FT                   RKLDPDLCVIDIRMPGMDGLELISEIRKSKSEIKIIILTGYPEFEYAQKAISLGVQSYM
FT                   LKPVDPQILKDELTKIYEDLERKKFLFEGSKEKILEKLLKGQISLTEKDVSKLLNFDLS
FT                   WDSYQVVLMSSDNENVDKYEISQELKKFFPISFMIDGTLGFVIEDFKKDNRKITSLRNH
FT                   LKNKFKEYFIFSVGDKVLSISQINYSYETALSLLRKRFLWENKGFLLYPCKKVNVNNFT
FT                   HVDITDEVICALESCDFIKLETLLEKKMRYHMMREEQEQEIKLSYFELYINVITAFLKK
FT                   YPKFKEYSSKYLKKRLFEGFYSKRTLLDLHNYVKDLLLELSKDLFDILGTSPLGKIAEY
FT                   IEANYYKDLRLREIAKEFGYNPCYLGKIFRKYMGENFNTYLDKVRVNKAKELLISGGKV
FT                   GEVAERVGYKDIDYFIMKFKKYTGKTPKNYIKEITGSL"
FT   repeat_region   46314..50329
FT                   /rpt_family="CRISPR"
FT                   /note="DICTH_1992"
FT   gene            complement(50412..51818)
FT                   /locus_tag="DICTH_0043"
FT   CDS_pept        complement(50412..51818)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0043"
FT                   /product="tissue alpha-L-fucosidase"
FT                   /EC_number="3.2.1.51"
FT                   /note="identified by match to protein family HMM PF01120"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ACI20073"
FT                   /db_xref="GOA:B5YAV7"
FT                   /db_xref="InterPro:IPR000933"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR016286"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR031919"
FT                   /db_xref="UniProtKB/TrEMBL:B5YAV7"
FT                   /protein_id="ACI20073.1"
FT                   /translation="MKYKMPEGPFEPTWESLKNYKIPEWYKDAKFGIFIHYGVYAVPAF
FT                   GSEWYSRNMYVEGSPEYEHHLKTYGEHKKFGYKDFIPLFKAEKFDPYEWADLFKKAGAK
FT                   YVVPVAEHHDGFAMYDCSFTRWCASKMGPKRDIIGELAKAVRDNFLTFGVSYHRAEHWW
FT                   FFHEGMKFDSDVRDKEYFDLYGPAQPESMQPNEEFLEDWLLRLFEIVDKYQPQLVYFDW
FT                   WIEQPAFEPYLKKFFAYYYNRAHEWGKGVVINYKLNAVPRECAVFDVERGKLGDIDPIY
FT                   WQTDTSISRLSWGYIENDIYKPAKEIIWELVDIVSKNGNLLLNVGPKADGTIPEPAQKT
FT                   LLEIGEWLLINGEAIYGSRPWRIYGEGPTKGNVGSFSEKEVIYTDKDFRFTTKGDILYA
FT                   ILMNKPEKDEVIIKSLSTDLTLYQKEIAKVEILELKGEVGFERSEEGLKVKIPKVEKLN
FT                   YPITFKILGR"
FT   gene            52007..52405
FT                   /locus_tag="DICTH_0044"
FT   CDS_pept        52007..52405
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0044"
FT                   /product="CrcB protein"
FT                   /note="identified by match to protein family HMM PF02537"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19286"
FT                   /db_xref="GOA:B5YAV8"
FT                   /db_xref="InterPro:IPR003691"
FT                   /db_xref="UniProtKB/TrEMBL:B5YAV8"
FT                   /protein_id="ACI19286.1"
FT                   /translation="MKNIIAISIGAFFGAVCRFAISRLNFGSFPLTTLFVNVLGSFILG
FT                   LITEIILEHIRMTETLRHMIITGFISSFTTFSSFILEIIELLIRGEITIAILYPISSIL
FT                   LGLLAFILGVRMAGVISVKQRKEECELI"
FT   gene            52402..52764
FT                   /locus_tag="DICTH_0045"
FT   CDS_pept        52402..52764
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0045"
FT                   /product="camphor resistance CrcB protein"
FT                   /note="identified by match to protein family HMM PF02537"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18453"
FT                   /db_xref="GOA:B5YAV9"
FT                   /db_xref="InterPro:IPR003691"
FT                   /db_xref="UniProtKB/TrEMBL:B5YAV9"
FT                   /protein_id="ACI18453.1"
FT                   /translation="MIYIIVGLGGTIGAILRYLVGNIFKKFTEKHGIVTFFINITGSFL
FT                   IGYFSTRQIPEEFRYFLIAGLLGGFTTYSTFMSDIVKYLRERKHFEAFVYMFFSIFLGI
FT                   IAAGLGIALANGIWKA"
FT   gene            complement(52842..55169)
FT                   /locus_tag="DICTH_0046"
FT   CDS_pept        complement(52842..55169)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0046"
FT                   /product="alpha-xylosidase"
FT                   /note="identified by match to protein family HMM PF01055"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19519"
FT                   /db_xref="GOA:B5YAW0"
FT                   /db_xref="InterPro:IPR000322"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR025887"
FT                   /db_xref="UniProtKB/TrEMBL:B5YAW0"
FT                   /protein_id="ACI19519.1"
FT                   /translation="MKFTDGHWRVREGIRIHYPCILWDYEIKEKELVVYAPSSFVKNRG
FT                   ETLYGPLFEIHFSSPFPNIIEITSYHFKGVVEKGPNFEINRDKNYKPEILDEEDSITLK
FT                   AGSLKVKINKKGTFQYTFYWKDKKLTSSGYKHMAYAIDESKNKYMVESLDLAVGELIYG
FT                   LGERFGPFIKNGQSIEMWNADAGTVSDQTYKNIPFYVTNRDYGVFVNHPEKVSFEIATE
FT                   HVERVQFSIPGEKINYFIIGGDNLKEVLENYTLLTGRPSLPPSWSFGLWLTTSFITNYD
FT                   EKTVTSFIEGMKERNIPLHVFHFDCFWMREYHWVNFEWDDRVFPNPEEMLKRLKEKGLK
FT                   ICVWINPYIAQRSKLFEEGKEKGYLLKKPDGSVWQTDEWQPGMGIVDFTNPSARDWYSK
FT                   HLRRLIKMGVDVFKTDFGERIPTDVVYYDGSDPEKMHNFYTYLYNKTVFETLKEELGEE
FT                   NAIVFARSATAGSQKFPVHWGGDSLSTYESMAETLRGGLSLSLCGFGFWSHDIAGFDSS
FT                   ATPDLYKRWVAFGLLSSHSRLHGNHDYKVPWLYDEEAVDVLRFFVNLKCSLMPYLYAKA
FT                   IEAVEKGIPMLRAMVLEFEEDPTCHFLDREYMLGDSLLVAPIFSETGEVEYYLPNVGTW
FT                   TNILTGEKKEGGKWYKEKFDYFSLPLMARPGSIIAVGENKEKPDYDYADNVTLHVFEPQ
FT                   EGKNISCEVYNQQRKIDLKINLIKENNIIKIEVEKDSGKPYSILLFNINGIKDVKGGKL
FT                   EKTEKGTRIIPEKKIREIIIEL"
FT   gene            complement(55182..57965)
FT                   /locus_tag="DICTH_0047"
FT   CDS_pept        complement(55182..57965)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0047"
FT                   /product="glucan 1,4-beta-glucosidase"
FT                   /note="identified by match to protein family HMM PF00933;
FT                   match to protein family HMM PF01915"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19629"
FT                   /db_xref="GOA:B5YAW1"
FT                   /db_xref="InterPro:IPR001764"
FT                   /db_xref="InterPro:IPR002772"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR008999"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR026891"
FT                   /db_xref="InterPro:IPR036881"
FT                   /db_xref="InterPro:IPR036962"
FT                   /db_xref="UniProtKB/TrEMBL:B5YAW1"
FT                   /protein_id="ACI19629.1"
FT                   /translation="MNIEEKVKELISKLTLEEKIKLLPTRQAEIPRLNIREFYIGGEAA
FT                   HGVAWLGKATVFPQPIGLSSSFDRELMKKIGNAVSQEARAYYYMRGKIGGLMLWAPTVD
FT                   MLRDPRWGRTEEGYGEDPFLASEMAGAYIQGMQGDDPVYLKTAMTPKHFFANNNEKDRD
FT                   KFSADIDPRNMYEYYLEVFRRVIEKYRAQCIMTAYNAVNGIPCIINPIVREVIKEKFGL
FT                   EGCVVTDAADFSQTVTSHKTFGNHYETLAYALKAGIDAFTDNPDLVIESAWQALEKGLI
FT                   TEEDIDRAISNSLKVRFRLGEFDEEISKRFYVPPNQICNNEHSQLAYMAELKSVVLLKN
FT                   ENKFLPLKKEKINKIAVIGPLANKNYNDWYSGTYPYKVSVLQGIINRLYNKEILYHDSY
FT                   DIVAIKSVKNNKYLRVIESGISPVWAVSDNITEKEVFKYIDWGWGKKSLQGIANGKYLT
FT                   ADDSTSAILSSAEEVFGWFVKEVFNIDPIGDGTYLIKTWNGKYAYIDEKEGNILKFKDS
FT                   FENLPEEKFIFEKVEKGIEKACEIAQNSDIVILCVGNNPLVNGREDEDRIDIVLPEHQE
FT                   NLVREIFKVNPNIVLLVISSYPYAICWEKDHIPAILWSSHGGQEMGNAIADILLGNFSP
FT                   AGRLNMTWYRSIHHIPPITDYDIIRGKRTYMYFDKEPLFSFGHGLTYTEFEYKNLILNS
FT                   KNFKLNEEIKLSFEIENIGDMDSEEVPQVYIKALNSKVKRPNIQLKGFTRVFVPKGERV
FT                   KVDITIPISELFIWDVREERYMVEKGEYEILIGASSKDIRLRDKFHIDGEEIKNRDPFK
FT                   STKAINFDDYHNVSFNTKRSFKETYVIFNDNDSFILFKDFEFKNKPKKVVMELSSNHSK
FT                   IVLIFSKIGKEFSFEVLDTNNEWKEIVYLLGEHIEGIQDLYIKGEKGLKINWFRFE"
FT   gene            58156..59079
FT                   /locus_tag="DICTH_0049"
FT   CDS_pept        58156..59079
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0049"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18574"
FT                   /db_xref="UniProtKB/TrEMBL:B5YAW2"
FT                   /protein_id="ACI18574.1"
FT                   /translation="MKIDKIFSNLEVMKPQSFEDMVVFPLSLKIDNIPYFITLDSALKT
FT                   RKFLIKEVHTFGEVPVLKVINHLSEQVLILDGEELRGGKQNRVVNTSILVKKNSELVIP
FT                   VSCTEAHRWHYISDVFEDPDVIPIEIRKGKTESLLRNLLSKGEFKSDQGLIWDMINRYH
FT                   MDYDVDSETSAIRDVYEKEKDKLKDRLNKFPYIDGQNGILVYVDGRFEGVDIVPLTSAY
FT                   KELHEKLIKSYIFRRPLKKKNNLFKDENEKIFDEISKIEPLKFKSVGLGWDLRYGDDKY
FT                   IGSMLVYRNKPIHINFLRRTMYSKAV"
FT   gene            complement(59057..59809)
FT                   /locus_tag="DICTH_0048"
FT   CDS_pept        complement(59057..59809)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0048"
FT                   /product="para-aminobenzoate synthase component II"
FT                   /note="identified by match to protein family HMM PF01063"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19641"
FT                   /db_xref="GOA:B5YAW3"
FT                   /db_xref="InterPro:IPR001544"
FT                   /db_xref="InterPro:IPR036038"
FT                   /db_xref="UniProtKB/TrEMBL:B5YAW3"
FT                   /protein_id="ACI19641.1"
FT                   /translation="MERKEYIYNFGLIPYETLYFENNNIHLVPEHYRRMKRAFKILNLP
FT                   FLITLEKFEEHLKEYLAKIKKPFGALRIYFKEDKPIIKEKEIKYNKEIYNKGLSIKISK
FT                   VKKHSNNILNYIKTFNMGINVIEEERAQRMGFDTCLFLNEKEFITETAFGNIFFRREKN
FT                   IYTPHIQNGLLPGTMRKKVIETTKILGYKIHISFLKIEDIKHMEECFITTSIAGAFPVN
FT                   NIENINFPSREFSLKLTEFEIFKRPWNT"
FT   gene            complement(59815..61149)
FT                   /locus_tag="DICTH_0050"
FT   CDS_pept        complement(59815..61149)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0050"
FT                   /product="anthranilate synthase component I"
FT                   /EC_number="4.1.3.27"
FT                   /note="identified by match to protein family HMM PF00425;
FT                   match to protein family HMM PF04715"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19436"
FT                   /db_xref="GOA:B5YAW4"
FT                   /db_xref="InterPro:IPR005801"
FT                   /db_xref="InterPro:IPR005802"
FT                   /db_xref="InterPro:IPR006805"
FT                   /db_xref="InterPro:IPR015890"
FT                   /db_xref="UniProtKB/TrEMBL:B5YAW4"
FT                   /protein_id="ACI19436.1"
FT                   /translation="MIELDLRKEKFFIEPFSLYFLLKEDYSILLESNYFHKNFGRYSFI
FT                   FLSPKEILICRDNDDAEDFLNKLSAEIEKKKKKNEDLIFNGGFVGFLSYDFGVDLYKIP
FT                   RKKNPLNHKAFFGYYENFIIFDHLEKKILIPSEIYKDLKEIINSLKSSSYKDYKFKEHI
FT                   VYNFFTNFKKDEYIEAIRKIKNYIYEGDVYQVNLSQRFYFNGKFDPYYIYYKLRKKNYG
FT                   AFHAFIKLKDSYIISTSPELFLYKKKNKIITRPIKGTIKRAQNREEDKKNKRILMNDTK
FT                   CRSELLMIVDLERNDFAKICIPESIHVKKLFEIESYSSVFHLVSTIEGSLKKDIEFKDI
FT                   IKATFPGGSITGAPKLNAIKIIEELEKDPRGVYTGSIGFISNNLNMAFNIAIRTLIVEK
FT                   DIAYYNVGGGIVWDSKEEDEYEETLAKGKPLLEVLLSSKNYVTKR"
FT   gene            complement(61146..61709)
FT                   /locus_tag="DICTH_0051"
FT   CDS_pept        complement(61146..61709)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0051"
FT                   /product="para-aminobenzoate synthase glutamine
FT                   amidotransferase component II"
FT                   /EC_number="2.6.1.85"
FT                   /note="identified by match to protein family HMM PF00117;
FT                   match to protein family HMM TIGR00566"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ACI20108"
FT                   /db_xref="GOA:B5YAW5"
FT                   /db_xref="InterPro:IPR006221"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:B5YAW5"
FT                   /protein_id="ACI20108.1"
FT                   /translation="MLLIVDNFDSFTYNLYNYFQRLKIKTLVKNRDKINISYISKLNPD
FT                   YIVLSPGPGRPTDDHILLEIIDVFKNTKKILGVCLGHQAIGVYFGLKLVKAQKPMHGMI
FT                   DEIIHDEKGVFKNIKNPLKVVRYHSLVLEKDKEGDNIEITAYTKNKEIMGIRHKFYKIE
FT                   GVQFHPESIGTEDGIRLLKNFLEI"
FT   gene            61828..62334
FT                   /locus_tag="DICTH_0052"
FT   CDS_pept        61828..62334
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0052"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19698"
FT                   /db_xref="UniProtKB/TrEMBL:B5YAW6"
FT                   /protein_id="ACI19698.1"
FT                   /translation="MEIFVKKLLDKGYINDKDFFVIVTEVDYKDDIPLPKGMFKFQPNF
FT                   LLHIVESVVGRNSDVVLKVYKALESKNLYKFNALFYRSMDIFGYDIEVKGQEFSEDEAE
FT                   NLSLTRKKYTQILEKMNKYIERLKKKLTEYFFEFYKEESEEMILGEEYINYFFGDDEDD
FT                   DDMEE"
FT   gene            complement(62397..63512)
FT                   /locus_tag="DICTH_0053"
FT   CDS_pept        complement(62397..63512)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0053"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19584"
FT                   /db_xref="GOA:B5YAW7"
FT                   /db_xref="InterPro:IPR009015"
FT                   /db_xref="UniProtKB/TrEMBL:B5YAW7"
FT                   /protein_id="ACI19584.1"
FT                   /translation="MKIKFLLSPIAYKVDEKLKEAKEYLGKYINLEESEDPDAIVLLTG
FT                   GTEEEALKYLKDGLFIIPFGKANGLAASLEVQAYAKEKGIKTILITKPNENIMNILKVL
FT                   DEFKNKKVGIIGKPSDWLIKSGNYDVLKDFGLEPIEISLKEVEENLKEDPSLTDKIWNL
FT                   SKEKKITKEELLKATKVYTSLKKIIEKYNLYALTIRCFDLAINLKITGCLALSLLNSEG
FT                   IISSCEGDTEALVTMLFVNKLTNKTPFMANLADIEKDEYTFAHCTIAINIPEYFNLNTH
FT                   FETLSSVGIEGYINSEKITLLRIGRNKKFTVFTGEVVKRPFEENMCRTQITVKIKDDSF
FT                   LKNPIGNHFVIVLGDEEEKIKSLEKLGWERV"
FT   gene            complement(63516..64022)
FT                   /locus_tag="DICTH_0054"
FT   CDS_pept        complement(63516..64022)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0054"
FT                   /product="flavodoxin"
FT                   /note="identified by match to protein family HMM PF00258;
FT                   match to protein family HMM PF03358"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19944"
FT                   /db_xref="GOA:B5YAW8"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:B5YAW8"
FT                   /protein_id="ACI19944.1"
FT                   /translation="MPKVLILYDSVTGNTKKMAEEVAKGVQEVEGVEVVIKHVDEAVPE
FT                   DLLNFDGIIVGSPAYCGTLTWKLKKFFDESVRVAWGKVKGKIGAAFASSGGLGGGNEAT
FT                   LYSILTVLMNYGYLVFGLPDYSAPGVTAHYGAVSVGYPKEAEQKACRMLGRHMAEYVKK
FT                   FCKGE"
FT   gene            64288..65571
FT                   /locus_tag="DICTH_0055"
FT   CDS_pept        64288..65571
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0055"
FT                   /product="bacterial extracellular solute-binding protein,
FT                   putative"
FT                   /note="identified by match to protein family HMM PF01547"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18850"
FT                   /db_xref="GOA:B5YAW9"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="InterPro:IPR006061"
FT                   /db_xref="UniProtKB/TrEMBL:B5YAW9"
FT                   /protein_id="ACI18850.1"
FT                   /translation="MKYKRLLISIFLVLFLINLGGGLFASSTKVKITFMSTKGEINQQL
FT                   EEVFKNFSKDYPNITVELIPVGAGQSPFEKLSTMYASGNAPTIAMIDPNDVEKFKDNFL
FT                   DLSNEKWTKDALKGVLDDVTFEGKVYAFPFALEGYGLIYNKQLIEKAVGKFDPNTIRTR
FT                   FSLERLFKNLEAKKVTPVVISPLDWSLGAHFITIAYATQSRDYGAVKKFIADLRAGKVD
FT                   LVNNKVFNDLLDTFDMLRKYNYLKDSPLAGTYEQGAQLLAQDKVAFWFMGNWAWPLIEE
FT                   VNPKNRDYGFVPVPLDNNPNNFFNRSIVALPTKMLCIDTKNNSKEQQEAAKTLLNWFVY
FT                   NENGQKNWVYGLNIIAPFSNVKITPNDPLAKSIVEYAKAGRTFKIPYAILPSDHWPIIG
FT                   AYMQKYLAGRMDRKQLLTEIMNYWTKAK"
FT   gene            65674..66549
FT                   /locus_tag="DICTH_0056"
FT   CDS_pept        65674..66549
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0056"
FT                   /product="multiple sugar-binding transport system permease"
FT                   /note="identified by match to protein family HMM PF00528"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19246"
FT                   /db_xref="GOA:B5YAX0"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B5YAX0"
FT                   /protein_id="ACI19246.1"
FT                   /translation="MSSYFSKTKLFVVFCGISIIAFLTVVIVPFIYGIYLTFTNWDGIH
FT                   KKYEFIGFSNYIGLLKDQVFKNSFLLTLKYVFFTVIFTNLIAFLLAYLLTSGIKGQSIF
FT                   RVIFFTPNLIGGIILGFIWQFIFHNALPYLGRHLGISLISESWLATPEKAFWALVLVTV
FT                   WQYSGYMMMIYIAGLVSIPQDLIEAAIIDGANKFKVLTKIIMPLMAPSFTVCLFLSLQR
FT                   SFMVYDLNLALTKGGPFKSTELISMHIYNEAFLSQNYGIGQAKAFVLFITVAIITLIQV
FT                   YLSKKAEVEL"
FT   gene            66549..67385
FT                   /locus_tag="DICTH_0057"
FT   CDS_pept        66549..67385
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0057"
FT                   /product="multiple sugar-binding transport system permease"
FT                   /note="identified by match to protein family HMM PF00528"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19115"
FT                   /db_xref="GOA:B5YAX1"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B5YAX1"
FT                   /protein_id="ACI19115.1"
FT                   /translation="MKGNLRVRSIFDVLKFLIILIFSSFYILPFAIVVINSFKKTGEVV
FT                   LNPLALPKEFKISNYFEAAERMNYFRSFFNTFVITVASIAIIVIFSSMTAYIFARKKWS
FT                   INKIFFSIMAASMIIPFQSVMIPLVKIYGSLNMLNNMWSLIYMYLGFGTAFAVFLYHGF
FT                   IKSIPLELEEAALVDGATTFQAFWKIVFPLLKPVTTTLIILDALWIWNDFLLPSLILIS
FT                   AEKRTLQLSTFYFYGTFTSNYGLAMAALVLTVFPIIVVSLFMQKYIIAGIVRGAIR"
FT   gene            67431..68888
FT                   /locus_tag="DICTH_0058"
FT   CDS_pept        67431..68888
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0058"
FT                   /product="raffinose invertase"
FT                   /EC_number="3.2.1.26"
FT                   /note="identified by match to protein family HMM PF00251;
FT                   match to protein family HMM PF08244"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19523"
FT                   /db_xref="GOA:B5YAX2"
FT                   /db_xref="InterPro:IPR001362"
FT                   /db_xref="InterPro:IPR006232"
FT                   /db_xref="InterPro:IPR013148"
FT                   /db_xref="InterPro:IPR013189"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="InterPro:IPR023296"
FT                   /db_xref="UniProtKB/TrEMBL:B5YAX2"
FT                   /protein_id="ACI19523.1"
FT                   /translation="MKNSEILRYARYFVSNNRDKVNNKYRLKFHLMGECGWVNDPNGFI
FT                   FFNGLYHCFFQYNPFEPFWGPTYWGHAVSKDLVKWEHLPIALAPDEEYDKGGCFSGSAI
FT                   EKDGKIYLMYTGHVEVGSSEYYQTQCIAYSIDGVNFVKYRRNPVISTKDIPENASKRDF
FT                   RDPKVFKRDDFYYVVIASQSQKGKGQILLYRSSDLFHWEYVNVILRNDNILEGDVWECP
FT                   DLFRLGEKDVLLFSAQKKEDSKIISSETFYCTGKMDFEKGLFDLYNCEKLDWGKYFYAP
FT                   QTTIDQQERRLMIAWMDNWNCPFPTQQEHNWAGAFILPRELFLRGDGLSIKPVREIEKY
FT                   RKNGMIVEKFLSNDSIYLTFDSECLETEVDLFFITPAQIEIELCSNLNASSNNSIKILY
FT                   NNVSKKLQLIINDLVFSDERQEVKIDLKGDKLNLRFFLDKSSIEIFVNEGEKVLTNRVY
FT                   PLEKYNTLKINSEGNCKVYLRKWDLEV"
FT   gene            complement(68909..69895)
FT                   /locus_tag="DICTH_0059"
FT   CDS_pept        complement(68909..69895)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0059"
FT                   /product="transcriptional regulator"
FT                   /note="identified by match to protein family HMM PF00356;
FT                   match to protein family HMM PF00532"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18415"
FT                   /db_xref="GOA:B5YAX3"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:B5YAX3"
FT                   /protein_id="ACI18415.1"
FT                   /translation="MPSLKDVAKRAGVSPTTVSRVLNNRGYISEETRRKVYKAMEELNY
FT                   QPNEIARALFKKRSYFLGLIIPDISHPFFAEITKYIEYYAYLKGYKVLICNSYLDGHKE
FT                   KEYIKMLKRHQVDGIIMGSHTLNVEDYKSINLPIVALDRYISEDIPCITSDNFTGAIMA
FT                   TKLLIERGCKYLAHISGPLELNTPANDRYYGFLKVVREKGIKHVVVETKLNKFEIEEYQ
FT                   KIIKDLFEKHPQIDGIFASSDLIAATVIRMADRFKKNVPKDLKVVGFDDIGLASLLRPS
FT                   LTTIRQDKDKMAQKLIEVLIDKIEGKNAESKYILPISLIERESTKIK"
FT   gene            70388..71023
FT                   /locus_tag="DICTH_0060"
FT   CDS_pept        70388..71023
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0060"
FT                   /product="transcriptional regulator, AcrR family"
FT                   /note="identified by match to protein family HMM PF00440"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19248"
FT                   /db_xref="GOA:B5YAX4"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:B5YAX4"
FT                   /protein_id="ACI19248.1"
FT                   /translation="MPKKTFYNIPEEKREKITRTLIKYFAEKPYSKVDVEDIAKECGIA
FT                   KGSMYQYFENKKDMYFYAIESATKRSLEILKDVNFENISLLEYVKQSFEFNWDFLLKYP
FT                   YEYILLEKSAFYDDSPYREEIREYYEKLTHNILYDFVVKNQKAGFIRDDIPPEMIMTFI
FT                   EGTSWAFKKFLVSLTRSKGMKMKDLSKEYVKDLQNYYLKILEEGIGKK"
FT   repeat_region   complement(71021..73142)
FT                   /rpt_family="CRISPR"
FT                   /note="DICTH_1993"
FT   gene            complement(73360..73623)
FT                   /gene="cas2_1"
FT                   /locus_tag="DICTH_0061"
FT   CDS_pept        complement(73360..73623)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cas2_1"
FT                   /locus_tag="DICTH_0061"
FT                   /product="CRISPR-associated protein Cas2"
FT                   /note="identified by match to protein family HMM PF02647;
FT                   match to protein family HMM TIGR01573"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19344"
FT                   /db_xref="GOA:B5YAX5"
FT                   /db_xref="InterPro:IPR019199"
FT                   /db_xref="InterPro:IPR021127"
FT                   /db_xref="UniProtKB/TrEMBL:B5YAX5"
FT                   /protein_id="ACI19344.1"
FT                   /translation="MFVIVTYDINEKRVDKVRRILRRYLSWVQNSVFEGEITIGKLEKC
FT                   KKELQFVIVPEEDSIYFYIIENKNNYIKNVLGIEKDLDSYVY"
FT   gene            complement(73626..74606)
FT                   /gene="cas1_1"
FT                   /locus_tag="DICTH_0062"
FT   CDS_pept        complement(73626..74606)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cas1_1"
FT                   /locus_tag="DICTH_0062"
FT                   /product="CRISPR-associated protein Cas1, HMARI/TNEAP
FT                   subtype"
FT                   /note="identified by match to protein family HMM PF01867;
FT                   match to protein family HMM TIGR00287; match to protein
FT                   family HMM TIGR03641"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18526"
FT                   /db_xref="GOA:B5YAX6"
FT                   /db_xref="InterPro:IPR002729"
FT                   /db_xref="InterPro:IPR019858"
FT                   /db_xref="InterPro:IPR042206"
FT                   /db_xref="InterPro:IPR042211"
FT                   /db_xref="UniProtKB/TrEMBL:B5YAX6"
FT                   /protein_id="ACI18526.1"
FT                   /translation="MSRDLFIFSSGTIKRKENTIYLETNNGERKFFPVENIDSIHLFGE
FT                   IELNTKALNFFAQKNIVIHIYNYYGYYSGSYLPREKNVSGELLVRQVQHYLDEEERMYL
FT                   AYSFVEGALFHMQRNLREYENTNEFVIKISQELENAKNCKSIQELMGCEGRARDVYYNA
FT                   FNLILKSKFFFEKREKRPPTNPINALISFGNSLIYSTVLSEIYKTQLNPTISYLHEPRE
FT                   RRFSLSLDLSEIFKPLIVDPIIFKLINNNMLKDEDFDQDVNYCYLTESGRKKFLKEFDS
FT                   KMETTIKHRKLGRSVSYKFLIRLECYKLIKHLLKDEIYKPLKAWW"
FT   gene            complement(74611..75123)
FT                   /gene="cas4_1"
FT                   /locus_tag="DICTH_0063"
FT   CDS_pept        complement(74611..75123)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cas4_1"
FT                   /locus_tag="DICTH_0063"
FT                   /product="CRISPR-associated protein Cas4"
FT                   /note="identified by match to protein family HMM PF01930;
FT                   match to protein family HMM TIGR00372"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ACI20136"
FT                   /db_xref="GOA:B5YAX7"
FT                   /db_xref="InterPro:IPR011604"
FT                   /db_xref="InterPro:IPR013343"
FT                   /db_xref="InterPro:IPR022765"
FT                   /db_xref="UniProtKB/TrEMBL:B5YAX7"
FT                   /protein_id="ACI20136.1"
FT                   /translation="MVDLLQNLRITGIKINYLFVCERKLWLFDRGIGMEETSEKVFLGK
FT                   LLDEFSYPKEKKKKILIDNLICIDILNEEEIREVKYSDKLEEPNKMQILYYLYYLKKLG
FT                   IRKKGILNYPKQKKREIVELTPEKEKLIEDAIKKIEEVVGRENPPPVEKKRYCKKCAYY
FT                   EFCFIGE"
FT   gene            complement(75144..77411)
FT                   /gene="cas3_1"
FT                   /locus_tag="DICTH_0064"
FT   CDS_pept        complement(75144..77411)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cas3_1"
FT                   /locus_tag="DICTH_0064"
FT                   /product="CRISPR-associated helicase Cas3"
FT                   /note="identified by match to protein family HMM PF00270;
FT                   match to protein family HMM PF00271; match to protein
FT                   family HMM TIGR01587; match to protein family HMM
FT                   TIGR01596"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19282"
FT                   /db_xref="GOA:B5YAX8"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR006474"
FT                   /db_xref="InterPro:IPR006483"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR035011"
FT                   /db_xref="InterPro:IPR038257"
FT                   /db_xref="UniProtKB/TrEMBL:B5YAX8"
FT                   /protein_id="ACI19282.1"
FT                   /translation="MISLGNLDIVYAKTYYENGKIVAETLEEHTSLLLKNLELLKERYY
FT                   EEIKRVLEKENYNSEKFWEILKIAALYHDLGKINSLFQNKIRELLGKEKIESRFSQEIP
FT                   HNFLSPALLPKETLSKKIAEYEDIFTLIYAIIYHHYRDLDFNEEYFKDYIKEEVLNKVD
FT                   HLSWVKKYDENFGNSESLGNEYLWLLRDRGKIENLEKKLKFIMLKGLLYRLDHSSSAHV
FT                   EIEKERIRNCEKLLISYLIKKPNSIGLKPFQKKAIHLRDKNILLVAPTGSGKTEFAVNW
FT                   IGNDKAVYTLPLRVSVNAMYERLKEIFGKDKIGLLHGDCAYYGLDEIRTLENDFQEHLH
FT                   HVTSSRQLSYPITVSTADQIFISFFHFPGYEKIFSIFPYTKIVVDEPQAYTSESLAVIV
FT                   EGLKRIDNVGGKFCLMSATFYPILRNELQDISEIIEVEASNNSSHFIRYYPEKDIEDMI
FT                   SEIIENYKKGKKVLVITNTVKKAQSIYNLLRSNKELKVNLLHSRFIWKDRNMKEKQIFL
FT                   DEKSHAPCIWISTQIVEASLDIDFDILFSELAPLDTLIQRMGRVYRKREYSEDIPNIVI
FT                   AGSLGKPSGKSHVYDSALIDATHNILSEINTKKLDERIKKMLVERLYSLEQLANTKYYK
FT                   KFRDYQKLLKLEYKAENKLEAERIFRRISNIEAIPVEVYENNKEKLLEIQEKIYSKDAL
FT                   KKLQGLRELKDLTVNIPLEIKDYAQNLISLEKDLELRIFLINLNYDTELGLLPDKNTEN
FT                   II"
FT   gene            complement(77389..78090)
FT                   /gene="cas5t"
FT                   /locus_tag="DICTH_0065"
FT   CDS_pept        complement(77389..78090)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cas5t"
FT                   /locus_tag="DICTH_0065"
FT                   /product="CRISPR-associated protein Cas5, Tneap subtype"
FT                   /note="identified by match to protein family HMM TIGR01895;
FT                   match to protein family HMM TIGR02593"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19854"
FT                   /db_xref="GOA:B5YAX9"
FT                   /db_xref="InterPro:IPR013337"
FT                   /db_xref="InterPro:IPR013422"
FT                   /db_xref="InterPro:IPR021124"
FT                   /db_xref="UniProtKB/TrEMBL:B5YAX9"
FT                   /protein_id="ACI19854.1"
FT                   /translation="MKVLKLKVYQQFANYRKPLSYSFIDTFPLPTYSNIRGWIHRILQA
FT                   QEYIPLSISIQGTYESIVYDLQTFYKFDRPRPEKKDLIFLPEYKKTIVKSPFYVANLQN
FT                   VSLILHINMEYSLLEKIKTMLLDTFPSIGRHEDMARIDKIDFVEVKRKDIGIDFYKIKY
FT                   PIYLKKETADKYNLIGINFKIPFKYRIEENLRYFEKIDVVYIEEGTLFGEVILDSEGDL
FT                   VELVGDFPGES"
FT   gene            complement(78077..78976)
FT                   /gene="cst2"
FT                   /locus_tag="DICTH_0066"
FT   CDS_pept        complement(78077..78976)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cst2"
FT                   /locus_tag="DICTH_0066"
FT                   /product="CRISPR-associated regulatory protein, DevR
FT                   family"
FT                   /note="identified by match to protein family HMM TIGR01875;
FT                   match to protein family HMM TIGR02585"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19005"
FT                   /db_xref="InterPro:IPR010154"
FT                   /db_xref="InterPro:IPR013414"
FT                   /db_xref="UniProtKB/TrEMBL:B5YAY0"
FT                   /protein_id="ACI19005.1"
FT                   /translation="MKKGGLTLTIIFEAMSLNYGEGVGNISELKKLSREGYSLTYMSRQ
FT                   ALRYELFKTLKNMFGMQDAPLTPTKEKGVIQFKEEANIKDYEEVDFFGYMKTLKGKGAL
FT                   TRSAVVKFSPAISLEPYYNDLEFGSNKNFADRSNSDPNIFQLEQHYSLYTYTVTIDLDR
FT                   LGKDENENIELDKKTRIERAQKILEALKVMNREIKGRIENLNPIFVIGGIYPVKNPFFL
FT                   NRVKICLDSSTKRFKINTELINSVLNISINGISIKDYTHIGLLKGYWENEKEFENAKDI
FT                   NTFFKDIKEGVQEFYESA"
FT   gene            complement(78992..80668)
FT                   /gene="cst1"
FT                   /locus_tag="DICTH_0067"
FT   CDS_pept        complement(78992..80668)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cst1"
FT                   /locus_tag="DICTH_0067"
FT                   /product="CRISPR-associated CXXC_CXXC protein Cst1"
FT                   /note="identified by match to protein family HMM TIGR01908"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19672"
FT                   /db_xref="InterPro:IPR010180"
FT                   /db_xref="InterPro:IPR019121"
FT                   /db_xref="UniProtKB/TrEMBL:B5YAY1"
FT                   /protein_id="ACI19672.1"
FT                   /translation="MERVYLSDWLFNAGIIGFLSILFEGKEDLKEGENTFSNGKNIYIG
FT                   KNYIEFEREVLEGFSDKYFNSAYERYRRTDRFIDYCREILEDIKKETLYKDIEKSYEEL
FT                   KNRIDNFSKLKDFLKKDFQLPPLNEVKRNPELFREYILKVLEVAEKNKQILIENDVKIY
FT                   LGKIYGQKSFLNRTITSNYKNKFKEDFEDKIINDTKKIKRSILCINCGERYAKKDTSFD
FT                   TGISPFTGVNTDALNFFWNFNAKLPLCEICELIYFCTFRGFTESVLENKYFFVNSDTSV
FT                   IDLYKKNLLLQEKLKKNLTENIFVEFFSELLLREEYEKSTHRLQGIAFIEIDLTNKDVL
FT                   PKVFSFNISRAKAEFLKEHAEKNFKNLINIRYSIKRYSIKDSIKEIIKNVTLEFLEKIL
FT                   SNTLSYGYLSFLEYLLLESIKGNKDVKTYYSPIHLNILNIIIEDYIQKFKKYERGEKMS
FT                   SKNEEQLWFMFKKGEEIANKLISENSENKIPSLTYKLLSCLRTEDVHSFMNIILRLYMT
FT                   YSLEVPSLLVKALNEKDLFLAYGYSFVNGLLSKYTSQNNEN"
FT   gene            complement(80670..81473)
FT                   /gene="cas6_1"
FT                   /locus_tag="DICTH_0068"
FT   CDS_pept        complement(80670..81473)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cas6_1"
FT                   /locus_tag="DICTH_0068"
FT                   /product="CRISPR-associated protein Cas6"
FT                   /note="identified by match to protein family HMM PF01881;
FT                   match to protein family HMM TIGR01877"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19864"
FT                   /db_xref="GOA:B5YAY2"
FT                   /db_xref="InterPro:IPR010156"
FT                   /db_xref="UniProtKB/TrEMBL:B5YAY2"
FT                   /protein_id="ACI19864.1"
FT                   /translation="MRIKVTLEGDLLPIDYRNHFMSFIKEALKATDFGKEYFKKIYQYE
FT                   EEGEIKNNKAGKPFCFAVRFLHDKEEFKKDKDVLYIKSPIELYISSVDYEFLINLYNGL
FT                   LSKKLYPFKMGLGGISKRNNIILLRERKIKEDKVIFKTLSPILIEDKNDKPLLPIDVEN
FT                   NQPLPEESEKFVYFLKELNYISDSILKSIRGQGLKIGLKFKPLKVRKEVVKHRVREKNI
FT                   EPKLYTFTCFSGTFELSGDPEDLNWLYQLGMGLRRAQGFGMVEVV"
FT   gene            81674..82864
FT                   /locus_tag="DICTH_0069"
FT   CDS_pept        81674..82864
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0069"
FT                   /product="alcohol dehydrogenase II"
FT                   /EC_number="1.1.1.1"
FT                   /note="identified by match to protein family HMM PF00465"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19306"
FT                   /db_xref="GOA:B5YAY3"
FT                   /db_xref="InterPro:IPR001670"
FT                   /db_xref="InterPro:IPR039697"
FT                   /db_xref="UniProtKB/TrEMBL:B5YAY3"
FT                   /protein_id="ACI19306.1"
FT                   /translation="MKENLNFSYFIPTKIWFGPGSLEKLREEKLPGRKALIVISAGGSM
FT                   KRLGYLDRLTDILKSKGVEYVVFDKILPNPIKKHVMEGAQIAREEKCDFVIGLGGGSSI
FT                   DSAKSIALMAKNDGDYWDYIVGGTGKGKKPEKGALPIVAITTTAGTGTEADPWTVITNE
FT                   ETNEKIGYGNEYTFPTLSIVDPELMLSVPPHLTAYQGFDAFFHAVEGYIANIATPVSDL
FT                   YALKSVELIAKYLPVCVKNGSDLTARTYVALANTLSGFVESTSSCTSEHSMEHALSAFH
FT                   PELPHGAGLIMLSEAYHTFFASKIPERYINLARAMGVDVDSLPEEERPFAFVKALKKLQ
FT                   EECGVANLKMSDYGIKEDEIEKLAKNAMETMGGLFEMDRYKLSFEEVVEIMRKAYK"
FT   gene            82944..83984
FT                   /locus_tag="DICTH_0070"
FT   CDS_pept        82944..83984
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0070"
FT                   /product="hypothetical conserved protein"
FT                   /note="identified by match to protein family HMM PF00535"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18689"
FT                   /db_xref="GOA:B5YAY4"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:B5YAY4"
FT                   /protein_id="ACI18689.1"
FT                   /translation="MRGVLYFLSWLIGWIYYRNLRFLKREGEISGDYKISVIIPARNEE
FT                   ENLGKLLSLLKNQTYKPYEVIVVNDNSEDDTEGVGERNGARVISLYEEPPEGWVGKNWA
FT                   IWNGYLESRGDILLFLDADVEPSSEFIEVMLSSYERYGGLISCWPYQRFEKFYEHLNFI
FT                   FNIGAVITMCAIKKEGAFGPAMMISREDYERVGGHKEVKDKVVEDLHFGNLCIKKGIPV
FT                   NNFLGGEYIKFRMYPKGLMDLIEGFSKNSSQGVMSLSFSKFLYLLIWFYGVFGSFAFEN
FT                   PINLYYLLFSFQFYVMTRRLGDYNLIDSVIYPIHFMFFIAVLIYSSIKTFLFKSVSWKG
FT                   RKINVG"
FT   gene            83974..84573
FT                   /locus_tag="DICTH_0071"
FT   CDS_pept        83974..84573
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0071"
FT                   /product="hypothetical membrane protein"
FT                   /note="identified by match to protein family HMM PF02660"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19868"
FT                   /db_xref="GOA:B5YAY5"
FT                   /db_xref="InterPro:IPR003811"
FT                   /db_xref="UniProtKB/TrEMBL:B5YAY5"
FT                   /protein_id="ACI19868.1"
FT                   /translation="MWDKVIIIFLQFLSGSIMYSYLIAKLLNIDLRKVRDGNPGAYNLW
FT                   ISTNWKIGLIGALLDYFKGIYPLLWFVRYKDIKDKWLITVSALAGIFGHVFSPFMGGKG
FT                   GKGVAVSFGAWTVVTGLEGPLFLGLSMFIFNLAKMHGATPEEDALKVLYGFLCLIPYVV
FT                   YKVFTGHLYILLLYLGNFGIIAYSHRNELLKVFANA"
FT   gene            84586..85887
FT                   /locus_tag="DICTH_0072"
FT   CDS_pept        84586..85887
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0072"
FT                   /product="deoxyribodipyrimidine photolyase"
FT                   /note="identified by match to protein family HMM PF03441"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18550"
FT                   /db_xref="GOA:B5YAY6"
FT                   /db_xref="InterPro:IPR002081"
FT                   /db_xref="InterPro:IPR005101"
FT                   /db_xref="InterPro:IPR006050"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR018394"
FT                   /db_xref="InterPro:IPR036134"
FT                   /db_xref="InterPro:IPR036155"
FT                   /db_xref="UniProtKB/TrEMBL:B5YAY6"
FT                   /protein_id="ACI18550.1"
FT                   /translation="MFNRVLFLFYRDLRIKDNTAFIKACEDSKEIVPLYILERHNFNKY
FT                   SFEFVISALGYVNFELNKLGSFLYLVERGFNEETFEFLREKIGFDAIYLSKDYLWSFEE
FT                   KEKLLRNFCREKGIELRFFEGNFLVSPNLISQTKVFTPFFKKWSAYLGEIRRKDFNFSK
FT                   LNTPILELSKFEDFEFSKKVRLDLIEWGFKRLESFDFDVYDEKRDLLYCDGTSKLSAYI
FT                   NYGVISIYDVYEKVKNSKSSQFLRELAFREFWYHIRMHFPETRNLEFQEKTRNIEWLYR
FT                   EDWIRKFENAETGYPIVDAGIRCLKTEGWLHNRLRMILASFFTKTLLHDWRIGEEFFKD
FT                   YLVDYDEVLNIQNWQWSASVGADPRPLRIFNPMIQSSKFDPYCEFIKKYLPELKDEDCR
FT                   KIHDPLKYKLKYYTPMVDFYAQKELAIRKYKKIF"
FT   gene            85902..86951
FT                   /locus_tag="DICTH_0073"
FT   CDS_pept        85902..86951
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0073"
FT                   /product="hypothetical conserved protein"
FT                   /note="identified by match to protein family HMM PF00535"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19332"
FT                   /db_xref="GOA:B5YAY7"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:B5YAY7"
FT                   /protein_id="ACI19332.1"
FT                   /translation="MRIILFLFSWLIGWIYYRNLRFLKREGEISGDYKTSVIIPARNEE
FT                   ENLGKLLSLLKKQTYKPYEVIVVNDNSEDDTEGVGERNGARVISLYEEPPEGWVGKNWA
FT                   IWNGYLESRGDILLFLDADVEPSSEFIEVMLSSYERYGGLISCWPYQRFEKFYEHLNFA
FT                   FNLVSVFSMAFLGKKEGAFGPAMMISRKDYERIGGHKEVRNKIVEDMEFAKKCLEEGIS
FT                   VNNFLGGEYIKFRMYPHGIKDLFQGFSKNMAKGAFSINIVNFLLIFLYMTGVYGSIFYF
FT                   RNTIFNFLYILYAIQFSVIQRRLGDYKWYDFLFYPLHFLFFLLVFTYSILRVFFVKTVV
FT                   WKGRKIRVG"
FT   gene            86941..87564
FT                   /locus_tag="DICTH_0074"
FT   CDS_pept        86941..87564
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0074"
FT                   /product="hypothetical membrane protein"
FT                   /note="identified by match to protein family HMM PF02660"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18260"
FT                   /db_xref="GOA:B5YAY8"
FT                   /db_xref="InterPro:IPR003811"
FT                   /db_xref="UniProtKB/TrEMBL:B5YAY8"
FT                   /protein_id="ACI18260.1"
FT                   /translation="MWVNLLVILLQFLSGSIMYSYIIARIMKVNLSKIRDGNPGASNLW
FT                   RALGWKYGVLALLLDYLKGVFPLAIFISLGIVKDNLIIALSALSGVMGHAFSPMLGFKG
FT                   GKAVAVSFGAWSVLTKWEAPTILGTVFTIFTLIRPKGTTVGEDAYRVFLGYIFLLPYVL
FT                   YKIFLSGFKDLHLLLFYIGNFAIILYKHYKDLWGYFRERESNKL"
FT   gene            complement(87619..88056)
FT                   /locus_tag="DICTH_0075"
FT   CDS_pept        complement(87619..88056)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0075"
FT                   /product="hypothetical conserved protein"
FT                   /note="identified by match to protein family HMM PF02566"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19386"
FT                   /db_xref="InterPro:IPR003718"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR036102"
FT                   /db_xref="UniProtKB/TrEMBL:B5YAY9"
FT                   /protein_id="ACI19386.1"
FT                   /translation="MANLVTFKAKGQWKGNLKVEVDIRNKFTINMDEPPSLGGEDTAPN
FT                   PVEVVLAALIGCLGIVIPVVAKEKNIPLNSIEIETEGDLDPRGFMGDPTVRAGYQEVRA
FT                   KVKINAPVEREKIEELMKEVERRCPVSDIIRNPVNLKISLE"
FT   gene            88204..89922
FT                   /locus_tag="DICTH_0076"
FT   CDS_pept        88204..89922
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0076"
FT                   /product="prokaryotic N-terminal methylation motif domain
FT                   protein"
FT                   /note="identified by match to protein family HMM PF07963;
FT                   match to protein family HMM TIGR02532"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18298"
FT                   /db_xref="GOA:B5YAZ0"
FT                   /db_xref="InterPro:IPR001322"
FT                   /db_xref="InterPro:IPR036415"
FT                   /db_xref="UniProtKB/TrEMBL:B5YAZ0"
FT                   /protein_id="ACI18298.1"
FT                   /translation="MRNGLKGLSFIEVLITVFIIGIIILGLVNVLSLYTDVFLFKTDER
FT                   ESISNLDMIMDRLARDIRQGRRVLSISTYTLTIELSTGVTHTYSLITGNDGKKYFGVDG
FT                   QILAGPINEIVFSGRKDDLTYTTNAYDVRVVTFTITMADGRNMSSTIALRAEVPKVAGG
FT                   VVITEIMYYPPDRDKNSDRTTPSNCQFVVLYNNSNSPVDLRGWSINGNAFSTLVSGTWT
FT                   LYPGKSAVIGSSGSNLIDTYYFPLPQYATYIRTSSSGLGTGGNALPTWGTNTITIRDSL
FT                   GNVIDQVSYSNTWGGYPKSTSGQYRDYYSLVRKSLMGSSQDPNNWGDSQNLNFVSCQGN
FT                   VDYVCYCLIPKLVITEVMYFPCPYVILGWSNTNQNEREYIEIHNPTYSSIDLTIDWSKD
FT                   NAYCVYSTSISNYIYDSTKWTLAPGDYAVVSSSAANIQQYYGLSSNIIYMKTNGQSLAS
FT                   PTYTNLPDTSFTITLLQRRSEYNTPNKAYTIDYFYYSPSLGGYPYTSYSLDRYYSIEIK
FT                   NLGLLGLFRRGDNYVQNVSSSTKLCYSVFISWENNNQGKRFEVYCTPGTKNSVSP"
FT   gene            89975..91162
FT                   /locus_tag="DICTH_0078"
FT   CDS_pept        89975..91162
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0078"
FT                   /product="methyltransferase"
FT                   /note="identified by match to protein family HMM PF01472;
FT                   match to protein family HMM PF02475; match to protein
FT                   family HMM PF03602"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ACI20156"
FT                   /db_xref="GOA:B5YAZ1"
FT                   /db_xref="InterPro:IPR002478"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR019614"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR036974"
FT                   /db_xref="InterPro:IPR041532"
FT                   /db_xref="UniProtKB/TrEMBL:B5YAZ1"
FT                   /protein_id="ACI20156.1"
FT                   /translation="MTERAKVLLKKGVHTKIVRGNPWIYDNEILKVEGDFSPGDVVDIY
FT                   DSSKSFIGRGFINPNSKIRVRVVTRKEEEINKDFFRERILKAWEYRKKVVDVDSCRVVF
FT                   AEADFLPGLIVDKFSDVLVIQTLALGIDRFKEVIVEVLDEIFNPIGIYERNDVSVRELE
FT                   GLPQVKGFLKGRFDTKVEILENGVKMIVDVENGQKTGYFLDQRENRASLKGLVDGAEVL
FT                   DVFCYTGGFSLHALKYGASKVIAVDSSSTALEMAKENAKINGFIDKIEFIEENAFDLLR
FT                   RFHKEGKTFDVVILDPPAFAKSSKNLDGALRGYKEINLRAMKIIRDGGFLITCSCSQHV
FT                   TRELFEKVIESASFDANRLLRLVEFRYQAKDHPILLSHPESLYLKCGIYQVFKKL"
FT   gene            complement(91157..92332)
FT                   /locus_tag="DICTH_0077"
FT   CDS_pept        complement(91157..92332)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0077"
FT                   /product="fusion HD-GYP domain and HD-hydrolase domain"
FT                   /note="identified by match to protein family HMM PF01966"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18823"
FT                   /db_xref="GOA:B5YAZ2"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR037522"
FT                   /db_xref="UniProtKB/TrEMBL:B5YAZ2"
FT                   /protein_id="ACI18823.1"
FT                   /translation="MSVLGFLLAFSEHLDSQLPENRRHSSRVANISLAIANYLNLSEKS
FT                   KYDLVISALLHDAGNGNKNHSNNNNHKEISDHALKSSLFLSDIPFLERTATIIKYHHFP
FT                   WNLGKGEFYQDEKIPIESQILNLAEHIDESYDKSKYILKEKNKIIKKIKEKGEKIFNPD
FT                   VLNAFYDLSQKESFWFEINYDDITPQNFSCDIKLDIDSFLLLSKAIARIVDYRSKIQVR
FT                   HSRNVANIASFLAGNLGFNDEKIKRIRISGYLHDIGKVALSSEILLKGDKLTRREIEYI
FT                   KVHPFKTFVTLKKSVPFEDIIIWSSYHHEKLNGKGYPFRLKGNEIPTEARVVAIADIYS
FT                   ALLEDRPYRKGISEARAINYMRKLAREGYIDKEIFGVLYENREELKSVIRL"
FT   gene            complement(92440..93987)
FT                   /locus_tag="DICTH_0079"
FT   CDS_pept        complement(92440..93987)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0079"
FT                   /product="RNA-metabolising metallo-beta-lactamase family"
FT                   /note="identified by match to protein family HMM PF00753;
FT                   match to protein family HMM PF07521"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18570"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:B5YAZ3"
FT                   /protein_id="ACI18570.1"
FT                   /translation="MTVKLTFYDGVNCIGGNKILLEDGEYAIFLDFGINFNEENKYFDE
FT                   FLKPRQIFGIYDLLHLNLLPPLKGLYREDLELPNIWENFEGHFLYRKVEPIAILISHAH
FT                   LDHLGYLPYITHQVPVITSLTSALIIKSLEDTSKNLSDLCFVKLKNERDGILKAEENII
FT                   FQRKYITYSENHSDKVFEFWKRIERKRINELHENPLEVKNQNLKIDPFEIMFFPVDHSI
FT                   PGAGSFAIKTSSGWIVYTGDLRLHGRNGHLTKEFINKLKHIDVKVLICEGTHPNIEKIY
FT                   TEDDVKEKALEIVKSCHHYVIADFGPRNIDRLMSFLEIGKETGRRLVLTLKDIYLLESL
FT                   SFIGYPDPKRDEFITFYEKPKGNYDPWEKNLLERYKDIPGKAVNSKDIRKNPQDYILCI
FT                   SYYDFHLLLDILPDMGVYIFSSSEAFNEEMKIDQQKIENWLKYFNLEIRGNLVEKREES
FT                   PLHASGHIHGDGLLELISNAKPEILIPVHSEKADFFEKFKDICKIIYPEKGKVIYID"
FT   gene            94049..94549
FT                   /locus_tag="DICTH_0080"
FT   CDS_pept        94049..94549
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0080"
FT                   /product="nitroreductase"
FT                   /note="identified by match to protein family HMM PF00881"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19888"
FT                   /db_xref="GOA:B5YAZ4"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="UniProtKB/TrEMBL:B5YAZ4"
FT                   /protein_id="ACI19888.1"
FT                   /translation="MNETIKTIKSRVSIRKYLDKEVPKEILEDLIDCGRLAPSGYNKQP
FT                   WVFVVVTDKELKNKLAEVTPWGRFLREAGAGILIFCEKDAETALEDACAAAENIIIAAQ
FT                   SYGLGTCWINSYKKAHSEEVKRLVKCPENMELMVMLAVGYPAEIPQRPPKKSLSEVLRW
FT                   QTF"
FT   gene            94534..95214
FT                   /locus_tag="DICTH_0081"
FT   CDS_pept        94534..95214
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0081"
FT                   /product="ribosomal large subunit pseudouridine synthase C"
FT                   /EC_number="5.4.99.-"
FT                   /note="identified by match to protein family HMM PF00849"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18568"
FT                   /db_xref="GOA:B5YAZ5"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR006224"
FT                   /db_xref="InterPro:IPR006225"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/TrEMBL:B5YAZ5"
FT                   /protein_id="ACI18568.1"
FT                   /translation="MADFLNLEVIYEDNHLLVVNKPAGILVQGDITKSTTLLEISKAYI
FT                   KEKYKKPGNVFLAIVHRLDKPVSGVVIFARNSKSAGRLSEAFRERKVEKEYIALCKGIF
FT                   KVKKGTISESLLWVEKERKARVSQDDKSKNAITHYEVLEEFKNLSLVRLIPETGRKHQL
FT                   RAHLSYIGHPILGDEKYGGGRIFKDRIFLHCKKMAVPHPVRKDIMEFEAKIPDFWSEFL
FT                   KVEI"
FT   gene            95241..95693
FT                   /locus_tag="DICTH_0082"
FT   CDS_pept        95241..95693
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0082"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19782"
FT                   /db_xref="UniProtKB/TrEMBL:B5YAZ6"
FT                   /protein_id="ACI19782.1"
FT                   /translation="MEKDLKLTIELIPESAWGENLRKYLPKKVWDRIRKEVFKKSGYKC
FT                   AICGSSEKLQCHEVWEFDDENHILKLKGFMALCEKCHLVKHFGMAGVLASEGKINLEEL
FT                   IRHFMRVNNCDRKTFEEHKREAFKKFHERSRYEWLLDISVLKSYNN"
FT   gene            95718..96098
FT                   /locus_tag="DICTH_0083"
FT   CDS_pept        95718..96098
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0083"
FT                   /product="lipoprotein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18922"
FT                   /db_xref="GOA:B5YAZ7"
FT                   /db_xref="UniProtKB/TrEMBL:B5YAZ7"
FT                   /protein_id="ACI18922.1"
FT                   /translation="MLDLRILHLAIMGLGTIFYLVTSCVGFFDKGDKKINLHVELGTTT
FT                   GILFIIGIFHLIMAQAVYPFFTHFYFAFSFFVILLISLILGIIYKNSKIKNKILIRRLH
FT                   KSITLIGLVVLIVTIILGVRVV"
FT   gene            96091..98165
FT                   /pseudo
FT                   /locus_tag="DICTH_0084"
FT                   /note="putative M protein trans-acting positive regulator,
FT                   authentic frameshift; this gene contains a frame shift
FT                   which is not the result of sequencing error; identified by
FT                   similarity to GB:AAM23598.1; match to protein family HMM
FT                   PF00874; match to protein family HMM PF05043; match to
FT                   protein family HMM PF08279"
FT   gene            98169..98459
FT                   /locus_tag="DICTH_0086"
FT   CDS_pept        98169..98459
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0086"
FT                   /product="PTS system, mannitol/fructose-specific enzyme II,
FT                   B component"
FT                   /note="identified by match to protein family HMM PF02302"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18504"
FT                   /db_xref="GOA:B5YAZ8"
FT                   /db_xref="InterPro:IPR003501"
FT                   /db_xref="InterPro:IPR013011"
FT                   /db_xref="InterPro:IPR036095"
FT                   /db_xref="UniProtKB/TrEMBL:B5YAZ8"
FT                   /protein_id="ACI18504.1"
FT                   /translation="MDKKRIKILAVCGMGLGSSLVLKMTIEKALKELGLEGDVQTADIV
FT                   TAKGAGLDVDVIITSKELAEQLGEVKVPIVTVKNYVNVKEFVEGLKRVLNL"
FT   gene            98491..99756
FT                   /locus_tag="DICTH_0087"
FT   CDS_pept        98491..99756
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0087"
FT                   /product="integral membrane protein"
FT                   /note="identified by match to protein family HMM PF04215"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19797"
FT                   /db_xref="GOA:B5YAZ9"
FT                   /db_xref="InterPro:IPR004703"
FT                   /db_xref="UniProtKB/TrEMBL:B5YAZ9"
FT                   /protein_id="ACI19797.1"
FT                   /translation="MGFLKFIQDILSVPAILVGVVAFVGLVVQKKSFSEVISGSFKSTL
FT                   GFLILSAGAATLIGSLNALGPMLEKGFSIRGVVPNNEAIVAIAQKTLGRETALIMVFGF
FT                   LVNILLARITPFKFIWLTGHHSFYMACLISATLGTVGLSGVGLIIVGSIILGLMQVLMP
FT                   AWIHPYMKKVTGTDEIALGHFGTLGYFVSGFVGSLVGKPEDSTENLSFPKSFGFLRESL
FT                   VATGFVMIIVFIIASLAAGPSYVESQLSGGQNFLVYAIVQALTFAAGVGVVIYGVRMIV
FT                   AEIVPAFKGISDKIVPEAKPALDCPVTFPYAPNAVIIGFIFSFLGGILSMLVMPLLGLP
FT                   VIIPGLVPHFFVGGTAGVIGNATGGKKGAMLGAFVNGIIISFGAALLLPALGNLGFENT
FT                   TFGDSDFQWLGILISLIGKIFK"
FT   gene            99823..100092
FT                   /locus_tag="DICTH_0088"
FT   CDS_pept        99823..100092
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0088"
FT                   /product="PTS system phosphocarrier protein Hpr"
FT                   /note="identified by match to protein family HMM PF00381;
FT                   match to protein family HMM TIGR01003"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18306"
FT                   /db_xref="GOA:B5YB00"
FT                   /db_xref="InterPro:IPR000032"
FT                   /db_xref="InterPro:IPR001020"
FT                   /db_xref="InterPro:IPR002114"
FT                   /db_xref="InterPro:IPR035895"
FT                   /db_xref="UniProtKB/TrEMBL:B5YB00"
FT                   /protein_id="ACI18306.1"
FT                   /translation="MIVEKLTIKNKTGLHARPATLFVETAKKFKSKILVEKEGKKVDAK
FT                   SLIGILSLGVEQGQDIVIHVEGPDEKEAFEELKRMIDSGLGEGE"
FT   gene            100097..101719
FT                   /gene="ptsI"
FT                   /locus_tag="DICTH_0089"
FT   CDS_pept        100097..101719
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ptsI"
FT                   /locus_tag="DICTH_0089"
FT                   /product="phosphoenolpyruvate-protein phosphotransferase"
FT                   /EC_number="2.7.3.9"
FT                   /note="identified by match to protein family HMM PF00391;
FT                   match to protein family HMM PF02896; match to protein
FT                   family HMM PF05524; match to protein family HMM TIGR01417"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19349"
FT                   /db_xref="GOA:B5YB01"
FT                   /db_xref="InterPro:IPR000121"
FT                   /db_xref="InterPro:IPR006318"
FT                   /db_xref="InterPro:IPR008279"
FT                   /db_xref="InterPro:IPR008731"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR023151"
FT                   /db_xref="InterPro:IPR024692"
FT                   /db_xref="InterPro:IPR036618"
FT                   /db_xref="InterPro:IPR036637"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:B5YB01"
FT                   /protein_id="ACI19349.1"
FT                   /translation="MGIVLKGIGIGNKISIGKVFLYNKEKIEFSQEKDELPFEIKIRQL
FT                   EESIEDVRRELEELYKSIKETFPREAEIFLFHKGILEDEYVIEKIKSYLAEGYSLVYSI
FT                   ERAFNEIKSEFEGMEQELFRERAKDIEDVEERLLKKILNINTSSLSSLPYPCIVVAKDL
FT                   TPSDTANLDFINLLGFVTEEGSITSHTAILAQVFNIPAVVGVRGIIDQVKKAEEIIIDS
FT                   GEGLVILNPTEEEKHFYSIKKDEKDKISRELIKFRDLPAITSKGRRIKVFANIGSEKEA
FT                   EIAINMGAEGIGLFRTEFIFLDRNDPPSEEEQFRIYKRVAEIFKDKPVIIRTLDIGGDK
FT                   EIPYLKLEKEKNPFLGVRGLRLCLLERELFKVQLRAILRASVFGNIWIMYPMVAIKEEV
FT                   EEANKILEEVKQEFENEGKTFVRNIKVGIMVEIPSIALSLEEVIDIIDFVSIGSNDLIQ
FT                   YTFAADRTNEKLRYLYIPNHRAVVSLIKNVVDVCHKFGKEVGVCGEIAGDEEYVPLLVD
FT                   LGVDELSMAPSKIPVIKKKIIEL"
FT   gene            101839..102426
FT                   /locus_tag="DICTH_0090"
FT   CDS_pept        101839..102426
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0090"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="identified by match to protein family HMM PF00440"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19096"
FT                   /db_xref="GOA:B5YB02"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:B5YB02"
FT                   /protein_id="ACI19096.1"
FT                   /translation="MRISKDPEVRRQELVETALKLFLTKGYENTSVRDILREIKGSPGM
FT                   FYYYFSSKEEIFEEAIKYYVENYIKELSHIFKDENLSLQEKYQKVVNAVVKAFEDMKSL
FT                   SDIYYSPQYFPLRVKISFRILDSLQESFRELIDKIKKDKNLDSQRAATFILYGVYGLLH
FT                   KDAEKLGEPKVIQNIMDFILDVTSKVLGLTKV"
FT   gene            102445..104496
FT                   /locus_tag="DICTH_0091"
FT   CDS_pept        102445..104496
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0091"
FT                   /product="membrane protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18318"
FT                   /db_xref="GOA:B5YB03"
FT                   /db_xref="InterPro:IPR004869"
FT                   /db_xref="UniProtKB/TrEMBL:B5YB03"
FT                   /protein_id="ACI18318.1"
FT                   /translation="MKRIYLWAFRHSKLVILFSLALFAFSLYLTLNLKVNYDLYSLLPQ
FT                   DLSSVKALNTLRNVFKLGEEGYILIPFKDPKEVDEFKNKIARIEGVSKVSWISDYQDIF
FT                   LPEYFWSENLKEKFIKDGYTFLKVDFLESSQSPLTKKASQEIRKILPKGAYFTGNVAIA
FT                   EDLSNLTQRETAKYLLIGSIFVIIFLFFLLPSMYVPILIYYNIFLAILVNTAISTLIGQ
FT                   EISFLTRMLVSILQMGVTMDYAIFLYHRYEEEAKNHSREEAGWIAVKTTATSIIASAGT
FT                   TIAGFLAMTQMKFGLGRDMGFILARGVLISLIFSLTILPVLFYHFYNKWANAKRWVLRL
FT                   SGERLFNFIVKARPVIFAMFIVGVLAILLAPRFPMDYKLLRGFPENVSSMVGQRKMEEI
FT                   FEKKSTIFLVGQETPKNWQEILKILKNENNITGIIGYYDMVDPLLPEYMVPENVVKNFF
FT                   KDGLSYMALDTKFEYGTSDSYKFVEGLRENIEKKYNVKITGVPVLNYDLRNVTTNDLNR
FT                   VNLLSILAIFLIIALSFLSVPVPFLLVLVIEMAITVNLLIDYLTYGFVFFSSNLFIGAI
FT                   QLGATIDYAVLLTSRYLEAKSKGFDKASAAHFAFEGINSILTSAGTMFFIALPLGIFSE
FT                   IFMAQNLAMLVSRGAIISVLFVTMFIIPLLVTFDPIIEKLTFIRKEGK"
FT   gene            104496..105845
FT                   /locus_tag="DICTH_0092"
FT   CDS_pept        104496..105845
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0092"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19367"
FT                   /db_xref="UniProtKB/TrEMBL:B5YB04"
FT                   /protein_id="ACI19367.1"
FT                   /translation="MKKRIVILGLIFIILLGLSFGSSLKVKNDETIYVLLDYDGKIKRM
FT                   DLVNWIEVQGQGNFKVVKDAKYIKNPDLYSEGVKMDFTGDKLSFYGNVKEVKNIYYKAE
FT                   VNKKLPLEFKITYKYNGKVSNPKEFLGKSGNLDIEVYIKPLEDIPFRIVMSTEFSSDDF
FT                   ILRNPEDFMVMVLGKTVRVTGFTYPIPDAKMTLSLRSNKLKVPDITFTALPSLPPVDLS
FT                   MGQKLKEFYNGLDGFLMLNQAHQKILKGILDGLEKNTPSVPQEFLTLPFILLSYQNKAY
FT                   FISENLKTYPKSFNNLYEFIKSKAENSNDEDWKKALDLANDVKKEVEENTLSEDIKKIG
FT                   DFIGDLNFQSRKAMDLLSTSLEGLQKMEDLLNTMLYGGEIEGKKLPGLVDVEKDMKKAK
FT                   DTLKKNVDELEKGEKKLKDWENKLKDYTFIGKVEGASSTVRFYFKLKEMK"
FT   gene            complement(105848..106306)
FT                   /locus_tag="DICTH_0093"
FT   CDS_pept        complement(105848..106306)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0093"
FT                   /product="small multidrug export protein"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18707"
FT                   /db_xref="GOA:B5YB05"
FT                   /db_xref="InterPro:IPR009577"
FT                   /db_xref="UniProtKB/TrEMBL:B5YB05"
FT                   /protein_id="ACI18707.1"
FT                   /translation="MKIELLLKVFLLSMTPVGECRISIPYGIYNGLSPTESFIVSFIGN
FT                   TLMGIIIYYTIDLIRRYIFSKDPLNKYYKKFVKNKLKRLKLYSLGIVFSLAVFIAIPLP
FT                   GTGAFTGAILARVLGLNLKEAIVSIISGVFTASLIVTILTLSSKAILT"
FT   gene            complement(106324..107460)
FT                   /locus_tag="DICTH_0094"
FT   CDS_pept        complement(106324..107460)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0094"
FT                   /product="acyl-coenzyme A:6-aminopenicillanic acid
FT                   acyl-transferase subfamily, putative"
FT                   /note="identified by match to protein family HMM PF03417"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19820"
FT                   /db_xref="GOA:B5YB06"
FT                   /db_xref="InterPro:IPR005079"
FT                   /db_xref="UniProtKB/TrEMBL:B5YB06"
FT                   /protein_id="ACI19820.1"
FT                   /translation="MKKKLFLIILLSLIFLQGCSKPEPAFPKNSGIRIIELRGTPYEIG
FT                   YQHGKMLKEEIQYFSHKIERIILYKSLIKTAKELEEKILNTYPEFKDLVEEMKGISKGA
FT                   DVPYENILLFNLMDEIVLQHYWKLPISGCSAFVFRNKDGNLIIGRNLDYGVFVDELPLC
FT                   PVIFKYYPQKGNSFISVSFPGLVGAYTAISKNLYLSINVSQSHKTETGAPECLLTRRII
FT                   QYSDNISEAIENALSPYQGLNILIADNKDAVVLEISPKRRELRNINEEGFLIVTNHYQH
FT                   PEMISEQAEKLIEELPIPIDGTFVRQINTKEREKIIREKILSKEEISIEDAKEILQSVS
FT                   TRLTLQSIIYLPREKILLVAQNKTSPVSYGIWLEFNLN"
FT   gene            107559..109382
FT                   /locus_tag="DICTH_0095"
FT   CDS_pept        107559..109382
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0095"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18738"
FT                   /db_xref="GOA:B5YB07"
FT                   /db_xref="InterPro:IPR018702"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniProtKB/TrEMBL:B5YB07"
FT                   /protein_id="ACI18738.1"
FT                   /translation="MKRFLKIFLIIFFLLSLTYAKEYVIREANLTYDILPTGEIEVKNQ
FT                   LTYDFSGSFSRAWMTIPKGGYSIREISVGEIIDEVYLGYTYHRETSEKIPQTFDVVEDN
FT                   NQYKITWFYRANDTNKTFVIKYKLVKALKVYNDVAEFYWKVWGGDWDIGLPALWVEVNL
FT                   PSSIESTEDVLYWLHPKIDGKIGIRKDYKGIVAFAGNIPPHQWVEVRVVFPKSYLSNLD
FT                   PSKVELIPKDGKALILDEEQKWQREELARQERVNLFIKVLSILAILLLFLGIFLPLRIY
FT                   FKYGREPKVEYYRDYEQEPPADIPPAWVEALVNQSSSLSANSIVTSTLELARRGYIKIQ
FT                   EEEKKGLLGVKYKEYKIIILDKELENDLSEELRLLLEELKSFGEEFYISELKKKDLRGF
FT                   KRKFDRIVKNYVFKEKKWINEEGKYKLYGIIALWIVVGILLFMVFSFSSFLKNELSFLM
FT                   VFFWFILVINIVISAIFIHPVQRYSPEGKLLALRWKAFKRYLKDFSLLSERPPSSLVLW
FT                   ERYLVYATVFGVAKEVLRVMQMLNVPVDQITWYVPASTISSMNIAESIQSFSSSLESFS
FT                   NAFTSSVASSTSSGSSSGGGGGGGGGGGGAG"
FT   gene            109416..111794
FT                   /gene="xfp"
FT                   /locus_tag="DICTH_0096"
FT   CDS_pept        109416..111794
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="xfp"
FT                   /locus_tag="DICTH_0096"
FT                   /product="D-xylulose 5-phosphate/D-fructose 6-phosphate
FT                   phosphoketolase"
FT                   /note="identified by match to protein family HMM PF03894"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ACI20098"
FT                   /db_xref="GOA:B5YB08"
FT                   /db_xref="InterPro:IPR005593"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR018969"
FT                   /db_xref="InterPro:IPR018970"
FT                   /db_xref="InterPro:IPR019790"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:B5YB08"
FT                   /protein_id="ACI20098.1"
FT                   /translation="MLEKLNDYWKACCYLAAGMIYLWDNPLLKEPLKPEHIKERLLGHW
FT                   GASPGLSFVYIHGNRVINKYDLNCIFIAGPGHGAPGVIAPAYLEGTISELYSQFSQDEE
FT                   GMKNLFKAFSFPGGLGSHCTPELPGSIQEGGELGYSLAHAFGAVFDHKDLIAITVVGDG
FT                   EAETGPLATCWHSNKFLNPVRDGAVLPVLLLNGYKINNPTILSRIENEELISLFKGYGY
FT                   EPYIVEGEESLEVHEKMASAMDSAVEKIISIWEEARSKNKPFRPYWPMIILRTPKGWTA
FT                   PRKVGNHYVEGYWRAHQVPFSDAKENPKSLEVLEAWLRSYEPQKLFTPEGKLREDLRDL
FT                   APKGEKRMSATHYANGGLLRRELKLPDLKSFAVSVKTPIQDEAENTRPLGLFLKEIIRL
FT                   NPDNFRVFGPDETKSNRLDAVFEFGKAWMAKVLPEDEDEGYLSPFGRTMEMLSEHTLEG
FT                   WLEGYLLTGRHGFLNTYEGFAPIISSMVNQFGKWLDISSDIPWRAPISSLNLLLTSVVW
FT                   RQDHNGFTHQDPGFITSIVDKWPNVVRVYFPPDANTLLCTAWHCFQTTNRINIIVIDKQ
FT                   KHPQYLSIEDAFKHAMKGIGIWDFASNHPEHEPDVVIASCGDIPTKEAIYAVRMLKKLF
FT                   PELKIRFVNVLNLFTLTPNTEHPDGLSDREFDSYFTKDKPVIFNFHGYPWLIHRLTYRR
FT                   NNHKNIHVRGYRENRKIGIDAGYLAPFLKGRGGITTPLQLAILNQIDRFSIAMDVIERV
FT                   EALQDEGGYYKDLLKNKQIEALEYAYNHGVDKEFDEIEL"
FT   gene            111969..113435
FT                   /locus_tag="DICTH_0097"
FT   CDS_pept        111969..113435
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0097"
FT                   /product="clostripain family"
FT                   /note="identified by match to protein family HMM PF03415"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19083"
FT                   /db_xref="InterPro:IPR005077"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="UniProtKB/TrEMBL:B5YB09"
FT                   /protein_id="ACI19083.1"
FT                   /translation="MRKEILVVFMVLLLIVSGCAPKTNVTQAQVTILTPVNGSSVPGSG
FT                   LVDIIAEVNSSVSVSRVRFYVDGEFLAEKTVTPYKATWDTSYYKHGTAHTIKVEALDGS
FT                   GKVIGSSSIVCYINVEWTILMYLDGHNDLENYIQQDISYISSFSRTDGVNIVILAGPKR
FT                   YVAESYLYYFHNGKLDILESGLYNFGNSNLLYYFLKYSVSNFPAKRYLVVLENHGSGWR
FT                   APAREDRDICFDEISGDSLTIPELREGLSYFTDIGKKIDLLYFDACVMGNLEVAYELKD
FT                   VANYLVFSEANVIGQTRWDQIMSYILSNPSTTPESLGRKIIDIYYSNYSIKPITMSLID
FT                   LSKISAILGELYYFSSYLMNTLPDSASAIMNIRLNTLSFEPYGGSNKEYIDINDFAYKI
FT                   INNSNYNELTNSAYNLVNYVSSAVLYHRYSGFNYTCGLSIWFPATVEDFLKGYNKYKEL
FT                   KFYNNSGGFSWYSFIVNELYYYFQVSLPGF"
FT   gene            113491..114102
FT                   /locus_tag="DICTH_0098"
FT   CDS_pept        113491..114102
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0098"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18290"
FT                   /db_xref="UniProtKB/TrEMBL:B5YBB7"
FT                   /protein_id="ACI18290.1"
FT                   /translation="MKKLTFLLSFVVFFVFLNVLSYADYSEPDASIVISQNTLNKFLDV
FT                   IGEVKKTDKFNISGVRGEYTWIVRNPRIILSKDKARFQADVTVSLKMPPLSYSTPAYGE
FT                   VSVKYDHGNNKINIKVEKVAFEVAFNILGRKIVVGEVDLSKIYQIAFTFPGPKPFESFT
FT                   EVNMPDGSKKKIKIDTIPVLMLDEGKIVVGTQLNYTYLGD"
FT   gene            114221..114403
FT                   /locus_tag="DICTH_0099"
FT   CDS_pept        114221..114403
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0099"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19527"
FT                   /db_xref="UniProtKB/TrEMBL:B5YBB8"
FT                   /protein_id="ACI19527.1"
FT                   /translation="MYKIKWDKETSGILLSDSPEDTIIPPRPVYFEELDLLGFDKYWDY
FT                   PKCEEPLLWGLRVGL"
FT   gene            114474..115259
FT                   /locus_tag="DICTH_0100"
FT   CDS_pept        114474..115259
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0100"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18679"
FT                   /db_xref="InterPro:IPR025248"
FT                   /db_xref="UniProtKB/TrEMBL:B5YBB9"
FT                   /protein_id="ACI18679.1"
FT                   /translation="MSSKKQSVCGISKYGTIGFRENWLRSFLNKKKKWFKNNNLSSFQY
FT                   KIFVKWLRDSEILNKNEITYLGRKLMEIFNNDELLVWEIIWTNLFYNSIIMKWYLTSIP
FT                   WSTSIKRSDLKHNLKESFPSFKDKTLDTAFSCLINTFRSNNFVNKLNLGVIEKRGKEVY
FT                   VKKIGTNNVHPLAVLYSLYRYAISKNKYKLTVSELYRQENKDGGPYLIFGISRPALENI
FT                   LRWLQESKKGFIRVDLVADLDNIYLSEDIKDYKKLLDYY"
FT   gene            115267..115536
FT                   /locus_tag="DICTH_0101"
FT   CDS_pept        115267..115536
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0101"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18293"
FT                   /db_xref="UniProtKB/TrEMBL:B5YBC0"
FT                   /protein_id="ACI18293.1"
FT                   /translation="MRISGFRYGTFGMRREWISSFLSRGREFFENNSLGPRQIEAFIWY
FT                   LRDTELIDGKLNLTELFCILKKIFEIEGINSKVLWGDNLGEFML"
FT   gene            115520..116035
FT                   /locus_tag="DICTH_0102"
FT   CDS_pept        115520..116035
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0102"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ACI20080"
FT                   /db_xref="UniProtKB/TrEMBL:B5YBC1"
FT                   /protein_id="ACI20080.1"
FT                   /translation="MNLCFNAPLFNWWANVPVGKYSRENIINLLANSYGKMNKTILNGY
FT                   SSIVETLGKSPIGELLGQGLVERKGKRVISVVKNGGKDISSIVVLYNLYRFSEKRGVYK
FT                   INLEEIENDELSPQKIFTISSFEVEDILKNSIYDSFFRVGFEERKVSIFLDKGINSISL
FT                   LKTYVGGL"
FT   gene            116037..120218
FT                   /locus_tag="DICTH_0103"
FT   CDS_pept        116037..120218
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0103"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19016"
FT                   /db_xref="UniProtKB/TrEMBL:B5YBC2"
FT                   /protein_id="ACI19016.1"
FT                   /translation="MKYKDVIELYEYFQPVYDITSEYGNYWKQFIPTKTFLETLKRFLG
FT                   SLEAEKGSPNRKSIWIQGAYGTGKSHATGVIKHLLWDDLEEIEDFIEKIDDVQLREKLR
FT                   SFRRENKVFPVTLKGVSGISDPKTLSLAIEEAVKEALKREGIEVRTQSEFERYIEKMYD
FT                   DSINWDKIIEKNIELKALVGDLEGLLRELKNRNVDVLRALDRSWDLNIPHPKIENWLGE
FT                   VLKELQGKGISSIAIYWDEFTPLMELSISSSILNILQNIAEKSLSENIFLLIISHRRPE
FT                   QSQISNVDYEKILGRFHFIEYSMENITTFHIISNAIRKKDEKRWREVREEVHNKNPGLN
FT                   RIMQKLIGIDLSLINVTKNLFPIHPYTATIATAISQYIGSSERSIFNFLYDQEKGFQKF
FT                   ISEYPDGNNGKEYFLTADFLWDFFLDDFERKPPEKVGPILSKYSLHRDALEKKSPHHSA
FT                   IFKGILLLNLLHSFIGISSLKGGFYSPSEENIKDMFLGTSHENYVDEVLIDIDKLGYVS
FT                   KTPDGLFLISLTPLPPQEINTEKEILKREYEDVTKLIHKELKDELEKALFGNILREVEF
FT                   QIYWSGIKDFDLKRKFKIDFRKPHSLHIALFLSKDKREIGDIKNTIKKLIEEEGITERN
FT                   LIFIISDTDLGVDNYEKIIEYLAREKVANTHSYKEEADINRDYVKRLIEDWVNKIKRGY
FT                   FDVYHQNESGTLESYPRLSVVSLEDRLNKVISPKIFRFGLENIEELTKNINIWKTSHSE
FT                   KVAGIFLSTNTLSELEEETKSAPYRYLRGIFMNNRGEYIVDKNLRFHNNVDIDHPTVRI
FT                   CREVENEIEKNKSKVFNLGDTLVFLRKPPYGLYHNPINYAVLSFALRPFVGKLYEANTG
FT                   KKLTSETLKDKVVDLFKYWDNGKDKEKLEVRLGTPAEEELIGVLKEMFGLREEDSLSSI
FT                   RLRIREWVERAGFPLWSLKSFGKEEKSLNLSLEVLDFLISKEKYLNENIIERSINLLKM
FT                   NQTNLKPLLNKDKLKEGFVIWLKSLEEVKIEDEEVEEVIGYLRKNMQEEVVLWKEDKVI
FT                   IKLKDWEKIREKTKNEREFISSLEEIFNIQTSKTQEDLREKIKARINDLGYPLWLLRYV
FT                   LRVEIGEALKNIEDFIKRERKLSEEILKESLENIRPYESLLSKNLSTDVLKEGFSQWVK
FT                   EKSVFNIDLDSFYSYLKANLNKDPYQWGEKDLEDTLRKYEFSKKLSEVFDVDLANSITE
FT                   LRENIKKKVQDSLYPFWSFSLLEGDEEYVELVEEIINFLTSIHNLDISEIERLSKMINR
FT                   KGNSLKEAIKEQRSKELFLKWLEDILGFNENVDEIADEVRRSMSAEDYYWNKDKVENWI
FT                   RRNLGNLISERKKERVKEKIKTTQKDLREILIELIDKYPQICSILEDILK"
FT   gene            120215..122380
FT                   /locus_tag="DICTH_0104"
FT   CDS_pept        120215..122380
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0104"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19889"
FT                   /db_xref="UniProtKB/TrEMBL:B5YBC3"
FT                   /protein_id="ACI19889.1"
FT                   /translation="MISVLHKEEFRDKVEEDKENRIPSYCRFPVRFILLENFEDLRDVV
FT                   ENFKDKANIFDITDLEIFAKNHDGWITPNAIINKIKSLTPNSDHLILLLSEIVRFLSDE
FT                   EFFSFFSGLMSIENLDISYYRRRLYIPLVGITQRFINIFWDKYNRREEFSPVWQILGNK
FT                   DRYNLFLVSFDFEVNPEEFTLINSSKDFLDLWKKPNINNKLISKSKTLWCFSSKVFSDE
FT                   FFEITRINNIKEYLSEVLKIKVPFSYKDEDENFWKILLRELENRKLHNLYDFIGEYLNI
FT                   KRLETENPISLWIKKESDFSHWLIKNYYLSDPNFENAYIREVVSSIRGYDFRDFLENYF
FT                   FKIFDKKFSSDVFDERRKVLREFYLEKKDMDFKFLENPLEERFGLLTKEEIPKYLTGIT
FT                   FFEKKWIVENLDLVKNLKNVYPELEFYLRDLSFNNLAEENLWLKDYFKEYRISRIKNSP
FT                   SEKLIEIISNKNINLDTLYKCYHSFEEVDKLIEDEDEKIWIDGLGVEFLPLVVSLLEEK
FT                   KYYVDFRIAISNPFLNDRFNDFENMERISLLDDFNQSNGYKYPENLIVEIEIVRKVVDK
FT                   ISEFRDRFVIFSNRGFRSFTYEFNKEDLVDSFQEKSAPEEVLIPVIYASKRSWEDIVYK
FT                   ITLLDEVISYRKPILRFKVKPKPKNRISIRCKDRELTVSYDGVNDLYEVDFSKFKPGEY
FT                   KITIIIGAWEETKIITLKGGFKERDIL"
FT   gene            122377..123816
FT                   /locus_tag="DICTH_0105"
FT   CDS_pept        122377..123816
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0105"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM TIGR02688"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18798"
FT                   /db_xref="GOA:B5YBC4"
FT                   /db_xref="InterPro:IPR014061"
FT                   /db_xref="InterPro:IPR027065"
FT                   /db_xref="UniProtKB/TrEMBL:B5YBC4"
FT                   /protein_id="ACI18798.1"
FT                   /translation="MRELKPLDFKIKRVFPQESVLKKKEVYSVFHGKNIPSFIKDWLVK
FT                   KFTGEDDVVDLDNLMDYMNKHIPQKESEKTFKGRIMYDKGVHRVLTRIVVEPDVNEGIF
FT                   RFSIPDLGITFREGRVSEHLLEEHNELKGGEVWGIFTLTYVPKDALDEKGFIELVDYEP
FT                   FKPYEVDLEYFREGRKEFTLEEWIDVLIRAMEYNPDGFADLEQKLLFISRLLIFVEPRL
FT                   NMIELSPKGTGKSYIFNNLSKYGWCVSGGIVTRAKMFYDMKRNVFGFITKYDFVALDEV
FT                   QTITFSNDDEMKGALKNYLEFGKFTVANVTGISNAGLMLLGNILLDSNMQPINRSYFEE
FT                   LPEIFRESALLDRFHGFIEGWKLPRINEDMKVQGYTLNVEYFSEILHILRDCPEFSAIV
FT                   EDLINIPPKADTRDVNAIKRLSSAYLRLLFPHVRRPGDISKEDFERFCLKPAIEKRGII
FT                   RRQLHILDQEYKEELPDIGVR"
FT   gene            123819..124403
FT                   /locus_tag="DICTH_0106"
FT   CDS_pept        123819..124403
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0106"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18507"
FT                   /db_xref="InterPro:IPR025745"
FT                   /db_xref="UniProtKB/TrEMBL:B5YBC5"
FT                   /protein_id="ACI18507.1"
FT                   /translation="MSYDFYEDELFEKIEEILKGEDKIEESTLTNFGKDQFYKIVEMLT
FT                   EELEKMSRDINNLSKRVEYLKEKLKKVLSYKGEYKPIEKERNVGKRPSRGLATPKEEYY
FT                   IPILESLYELGGRGTIGEVLDRVGEKMKYVLNEYDYEFLQSGNIRWRNRAQWTRLELVH
FT                   QGLLKNNSPNGVWELSEKGYKFLMEKKKSGS"
FT   gene            124406..124921
FT                   /locus_tag="DICTH_0107"
FT   CDS_pept        124406..124921
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0107"
FT                   /product="SigD"
FT                   /note="identified by match to protein family HMM PF04545;
FT                   match to protein family HMM PF08281; match to protein
FT                   family HMM TIGR02937"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19342"
FT                   /db_xref="GOA:B5YBC6"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:B5YBC6"
FT                   /protein_id="ACI19342.1"
FT                   /translation="MPDYDFYEEELFSRVEELLKELEAKEEADLEKASRKGEKKDYRVR
FT                   IKKFKFSRRYTPLEELHIEESEEVSDHYEYFEEENIYAIQDLIEDPRSIEETIEQIDIR
FT                   REIERALDALSEREREILKWRYGFKDGKPRTLEEVGKLFNITRERVRQIEERALRKLRH
FT                   ILQQRDVW"
FT   gene            complement(124927..126177)
FT                   /locus_tag="DICTH_0108"
FT   CDS_pept        complement(124927..126177)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0108"
FT                   /product="oxidoreductase, streptomycin biosynthesis
FT                   protein"
FT                   /note="identified by match to protein family HMM PF01408"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18447"
FT                   /db_xref="GOA:B5YBC7"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR004104"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B5YBC7"
FT                   /protein_id="ACI18447.1"
FT                   /translation="MRHVEVIVIGAGNRGYEAYGKIILKRPDIKAVAVAEPNDVKRERF
FT                   AKEHNIPPERQFKTWEEVFEREKFADGVIITTMDRMHVKPAIAAIKKGYNILLEKPIGV
FT                   NLEEIKELYKVAKENKANITVAHVLRYTMFFQKLKELLDKKEIGDLIGINLVENIGFFH
FT                   FAHSFVRGNWRNSETSAPSILAKSCHDLDILTFLTGEKSQTLSSFGELRYFKKENAPEG
FT                   AKERCLDCNIDCPYDAKRIYLGDYTGWPVSVISEDLSLEGRLKALREGPYGRCVYYSDN
FT                   NVVDHQIVSIKFKNNVYASFIMTAFTNKITRKIYLYGTHGEIYGDLDENKIHIQKFGKG
FT                   EELINLSLPFKDLVGHAGGDEGIMEEFVKVLKGEKEETLSNIEESIESHLMAFASEEAR
FT                   LNNKVINMDEMREKFYS"
FT   gene            complement(126174..127145)
FT                   /locus_tag="DICTH_0109"
FT   CDS_pept        complement(126174..127145)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0109"
FT                   /product="BadF/BadG/BcrA/BcrD ATPase family"
FT                   /note="identified by match to protein family HMM PF01869"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19993"
FT                   /db_xref="GOA:B5YBC8"
FT                   /db_xref="InterPro:IPR002731"
FT                   /db_xref="InterPro:IPR039758"
FT                   /db_xref="UniProtKB/TrEMBL:B5YBC8"
FT                   /protein_id="ACI19993.1"
FT                   /translation="MYFLGVDGGGTKTIAYLLDEESNLIFKNTSGPTNILENGEEVFRK
FT                   NLRELLYPVLKNINPKDIKSCFGLPAVGEFREDIKILRKIIKEELNIEADTIVNDVVIG
FT                   WAGGNLARDGIHVVAGTGTITYGRKGNKDIRVSGWGSIIGDEGSAYYIGYRTLNEVSRE
FT                   LDGRKRRTDLTKLIFKKLNLRDHLDFIEFIYDPQKDRRSNIASVAKITYEIAKIGDKKA
FT                   LKILKESAKELALTVTTANKFLKIEKPITVTYSGSVLEKNEIVREEFIKLLAKGGYEVK
FT                   PPKLSPVLGAVLLAFLNYENNGQKREDFINKLLKIYKEEEKQ"
FT   gene            complement(127183..128172)
FT                   /locus_tag="DICTH_0110"
FT   CDS_pept        complement(127183..128172)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0110"
FT                   /product="SIS domain protein"
FT                   /note="identified by match to protein family HMM PF01380"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19063"
FT                   /db_xref="GOA:B5YBC9"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR035466"
FT                   /db_xref="InterPro:IPR035490"
FT                   /db_xref="UniProtKB/TrEMBL:B5YBC9"
FT                   /protein_id="ACI19063.1"
FT                   /translation="MYIVEKEIKEQITELPKVFAYVENYLKNNNLPKFILNSDIIYFIG
FT                   CGTSLYLSLSGSRFFTHKTQIETKALPGGEVWFAIDENLGTSKNIKKSAILISRSGEST
FT                   EVIKAGEKFKEIGIPTLGITLEEDSSLVKISQSSIILPIKEEAIVMTKSFSSMLLTLQL
FT                   IASFIKGEDINIYKDLVKETERIINSANDLSLNHTSYKHYVFLGLGAEEGIARESALKL
FT                   EEMSLSKIEAYSTFEYRHGPKSLLEEGFLVSIYTKGIEEEKPLVNELKNYGADVITIGG
FT                   KDTDLYISDLPESLFLKVIWGQILGLNIAKSKNIDVENPRNLTKVVKF"
FT   gene            complement(128185..128943)
FT                   /locus_tag="DICTH_0111"
FT   CDS_pept        complement(128185..128943)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0111"
FT                   /product="transcription regulator, putative"
FT                   /note="identified by match to protein family HMM PF00455;
FT                   match to protein family HMM PF01022; match to protein
FT                   family HMM PF08220; match to protein family HMM PF08279"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18665"
FT                   /db_xref="GOA:B5YBD0"
FT                   /db_xref="InterPro:IPR001034"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR014036"
FT                   /db_xref="InterPro:IPR018356"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:B5YBD0"
FT                   /protein_id="ACI18665.1"
FT                   /translation="MKEYRFEKILKLIRERGFLTVQEIAKELSISEITVRRDLKFLEKQ
FT                   GLIKRVRGGATATSISSENSFFLRLEENKEIKKEIGKKAISLLKDNSVIAMSGGTTIYY
FT                   MVQALDQSPITDLTILTNSITTAWAVINLRKNFRLIHSGGTAKERSFECIGGHVIKFFQ
FT                   EIGKIDYYFFGANGVDIKNGITFFDMEEAEVAKTIISKAEKKVLIVDSSKFNNSAPFKV
FT                   CDLDDLDYIVSDSIPEEFKKIPEWSQKFIL"
FT   gene            129120..129251
FT                   /locus_tag="DICTH_0112"
FT   CDS_pept        129120..129251
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0112"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19216"
FT                   /db_xref="UniProtKB/TrEMBL:B5YBD1"
FT                   /protein_id="ACI19216.1"
FT                   /translation="MIINDIIRKKSKGGVLIEKDFYSFSYFPFNFAYDCFGAENSNY"
FT   gene            129265..130434
FT                   /locus_tag="DICTH_0113"
FT   CDS_pept        129265..130434
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0113"
FT                   /product="sugar ABC transporter, sugar-binding protein,
FT                   putative"
FT                   /note="identified by match to protein family HMM PF01547"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19670"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:B5YBD2"
FT                   /protein_id="ACI19670.1"
FT                   /translation="MSEQLDGIKAQIAAFEKKYPNIKVKLEHVPWEDYWTKLQTMMAGG
FT                   DCWDVFTMDTGFYLPDYVARNALIDITPYINRDKVDLSVYPAGVLKLHNFQGKYYSLPR
FT                   DYDTIGMFYNKKAFDELKLKYPDGNWTWEDLKNAVAKLTKKDAKGNILRYGITVDGGPL
FT                   SVSQAFLFPMILSLGGDLVKDGKVVFDSAQAKEALSFARELTEKGYAPKPGVTSGDLFI
FT                   AGKSAINFSGSWMMGYYAENIKSFDFGVVMIPKSKTGKRANISDSLGNVIWSKTKNLDA
FT                   AWTFVKWMASKEAAEILGKSGTVIPAYKGTDNLWVQSFKKFKKEKDAQVFIDSVKYTNP
FT                   WPQTRGSSEWFDRWETYYIVEIIAGRLGVDEGLKQATEEINGIIEKASQ"
FT   gene            130506..131246
FT                   /locus_tag="DICTH_0114"
FT   CDS_pept        130506..131246
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0114"
FT                   /product="sugar ABC transporter permease"
FT                   /note="identified by match to protein family HMM PF00528"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18506"
FT                   /db_xref="GOA:B5YBD3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B5YBD3"
FT                   /protein_id="ACI18506.1"
FT                   /translation="MEEFQNIGRQFIFLPSYYIPFGISFKLALSKYDAVSEPQYIGLEN
FT                   FRKIFQDKIFWISLKNSFLYALYVVPTVVILSFLIAVGLNKDTKFFRFLRVFYFIPTVT
FT                   SSVAINFVWLWFFNPEYGLLNTILGFLWIKKIYWLTDSKIALFSLALVGMWGSLSYNII
FT                   LFLAGLQNIPSTYYEAASLDGATKKDILFHIALPLMTPIIFFVLIMQIISSVQMFESVF
FT                   IMTRGGPGYSTYTLVYYIYRNGFN"
FT   gene            131347..131496
FT                   /locus_tag="DICTH_0115"
FT   CDS_pept        131347..131496
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0115"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19910"
FT                   /db_xref="GOA:B5YBD4"
FT                   /db_xref="UniProtKB/TrEMBL:B5YBD4"
FT                   /protein_id="ACI19910.1"
FT                   /translation="MSNKIIAFLLIIGALIIFLPYWFMLIVSFETIEEAFAVPPHFFPF
FT                   KSYN"
FT   gene            131453..131929
FT                   /locus_tag="DICTH_0116"
FT   CDS_pept        131453..131929
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0116"
FT                   /product="sugar ABC transporter, permease"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18747"
FT                   /db_xref="GOA:B5YBD5"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B5YBD5"
FT                   /protein_id="ACI18747.1"
FT                   /translation="MRYLLIFFPLNPIINNYKEIFVKLDFGRYFLNSLIVTLSLVFSQI
FT                   VLCSLAGYAFARLYFPFKNVIFLIFLSVIMLPGIVLLIPRYLILKNLGLVNTLTGVIIL
FT                   KIFSEFSIFLYRQHFLSMPIEMEEAAIVAGANMWNIFWKIMMPLFKDNILVIGE"
FT   gene            132056..133381
FT                   /locus_tag="DICTH_0117"
FT   CDS_pept        132056..133381
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0117"
FT                   /product="alpha-galactosidase"
FT                   /EC_number="3.2.1.22"
FT                   /note="identified by match to protein family HMM PF02056"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19078"
FT                   /db_xref="GOA:B5YBD6"
FT                   /db_xref="InterPro:IPR001088"
FT                   /db_xref="InterPro:IPR015955"
FT                   /db_xref="InterPro:IPR022616"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B5YBD6"
FT                   /protein_id="ACI19078.1"
FT                   /translation="MKISFIGAGSVVFTRNLLKDLALFPESEGIEIALMDIDPERLEVA
FT                   RKIAEEINEKKNKHWKIKGYMDLKSAIENSNYVINTVQIGGKEATYVDFDIPEKYGLKQ
FT                   TIGDTHGIGGIMRFLRTAPFLKDLVRNIEEYAPSALLLNFTNPMSMNQWYINDISEIET
FT                   VGLCHSIPYTIEQISSYVGVPSKEVNYKVAGINHMAWVLTFERNGENLYPLLFKAMERK
FT                   EIWERDPVRFEILRMFHYFVTESSEHNAEYVPYFIKDEELIKKLNIPIREYIRRVEENE
FT                   KVFNTFKDYYLKGNKEAYEIVKEHYGEEEEDTSKEYAIQIIHGMETNDSRLVYSIVRNE
FT                   GIIDNLPMDCMVEVPCYVDKNGVSPLKVGYLPDQLASLNLLHINVQRLAVRGAVERDKD
FT                   YIYYAALLDPLASSMLSPEKIHMMVDELLKAHKEYLKDFFIK"
FT   gene            133392..134618
FT                   /locus_tag="DICTH_0118"
FT   CDS_pept        133392..134618
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0118"
FT                   /product="tagatose 6 phosphate kinase"
FT                   /EC_number="2.7.1.144"
FT                   /note="identified by match to protein family HMM PF08013"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19904"
FT                   /db_xref="GOA:B5YBD7"
FT                   /db_xref="InterPro:IPR012062"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:B5YBD7"
FT                   /protein_id="ACI19904.1"
FT                   /translation="MWLSKDYLRKKGVYSICSSNPYVIEASVEFAKEKNDYILIEATPH
FT                   QINQFGGYSGMTPEDFKNFVMGIIKEKGIEEDRVILGGDHLGPLPWQDEPSSSAMKKAK
FT                   DLIRAFVESGYKKIHLDCSMSLSDDPVVLSPEKIAERERELLEVAEETARKYNFQPVYV
FT                   VGTDVPVAGGGEEEGITSVEDFRVAISSLKKYFEDVPRIWDRIIGFVIMLGIGFNYEKV
FT                   FEYDRIKVRKILEEVKKENLFVEGHSTDYQTKRALRDMVEDGVRILKVGPALTASFRRG
FT                   VFLLSSIEDELISEDKRSNIKKVVLETMLKDDKYWRKYYKDSERLELDIWYNLLDRIRY
FT                   YWEYKEIKIALNRLFENFSEGVDIRYIYQYFYDSYFKVREGKIRNDPRELIKNEIKKVL
FT                   EDYHYAVNL"
FT   gene            complement(134817..135413)
FT                   /locus_tag="DICTH_0119"
FT   CDS_pept        complement(134817..135413)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0119"
FT                   /product="fructokinase"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19272"
FT                   /db_xref="GOA:B5YBD8"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:B5YBD8"
FT                   /protein_id="ACI19272.1"
FT                   /translation="MELDVLTIGEILLEIMAKNIDQDFLSPGEFLGPYPSGAPAIFIDQ
FT                   VVKLGLKGGILGCVGEDDFGKNVFERLKRDGVETSLIKKTNQYITGIAFVTYFSNGERK
FT                   FIFHLPHSAASNIYPEDITDDLIKNIKALHVMGCSLAIKDNVREAIEKAVALSYEYGKL
FT                   ISFDPNIRVELGLSKENMGQKHITKVKYIKLIPLR"
FT   gene            complement(135418..136440)
FT                   /locus_tag="DICTH_0120"
FT   CDS_pept        complement(135418..136440)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0120"
FT                   /product="dehydrogenase"
FT                   /note="identified by match to protein family HMM PF00107;
FT                   match to protein family HMM PF08240"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ACI20128"
FT                   /db_xref="GOA:B5YBD9"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B5YBD9"
FT                   /protein_id="ACI20128.1"
FT                   /translation="MKNMGWLLRDIRRLELIETPIEHPKDNEVLLEVIYAGICGSDLHA
FT                   YLGEHPFVKPGIVLGHEFVGKVIEKGKDVENLEVNDFVVVEPSLTCGTCYNCTHGRYNI
FT                   CKNLDVIGCTKTNGGFQKYIKIPAHKVYKINDIPLKRAVLTEPLAVAVHGVRRSSFKPG
FT                   DEVLVIGSGPIGLLTTIVLYLSSAKKIVLVDVLDKRLHLAKTLCPGIITIKPEELNSNL
FT                   FTQEGPDLVFECVGVDQTINMAIEYARKGTDIILMGVPKEISTAKLIYIQDRELNLKGS
FT                   LMYTKDDYLIAIDLLRKNQLNYEALITHLYPFDKVSEAFEDILKYKEEYFKVIIDIKGE
FT                   "
FT   gene            136589..137287
FT                   /locus_tag="DICTH_0121"
FT   CDS_pept        136589..137287
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0121"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18949"
FT                   /db_xref="GOA:B5YBE0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B5YBE0"
FT                   /protein_id="ACI18949.1"
FT                   /translation="MFIQIKDLSKSYQLGLTKINALKRVSMDLEKGKIYVILGPSGSGK
FT                   TTLLNILGGIDKPDEGKVIVEEEDITNYGDKELTNYRRRKLGFIFQFYNLVNSLTVLEN
FT                   VLSTKYLSEDGLDPKEVLEIVGMWEHKDKFPFELSGGEQQRVAIARAVVKNPAIILCDE
FT                   PTGALDFENAKRVLKLLEDINKRYGTTIIIATHNTAIAKMSHKIIRLRSGELVEYQDNP
FT                   SPVPAEEVVW"
FT   gene            137287..139503
FT                   /locus_tag="DICTH_0122"
FT   CDS_pept        137287..139503
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0122"
FT                   /product="ABC transporter, permease protein"
FT                   /note="identified by match to protein family HMM PF02687"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ACI20072"
FT                   /db_xref="GOA:B5YBE1"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR038766"
FT                   /db_xref="UniProtKB/TrEMBL:B5YBE1"
FT                   /protein_id="ACI20072.1"
FT                   /translation="MLKKIPLRIMWRDKSHFLGIIFLVLFASFGYALFSILITNIDTNY
FT                   QNFVEKYNQENFHFTTFFPIDIEALEKKYNVLIEEKFTWDFQYGDKVIRFFNVTEKVNK
FT                   PLILEGSLPKIGEIAVDPNFAETNKLKIGDVININGMDFHISGYVALPDYIYITKNETD
FT                   LLPDPLHFGIGIMNFEDMKKFLSSVAYRYYMVRGSISDLDSFKTELNSKYTLLSFVEKD
FT                   ENFRIIVTEMKMKSARPMSFVIAGTILIISSILLFIVLRRLINSMHAEIGTLYALGYSS
FT                   KEIVSVYILFPIYIWLMGAIPGSALGYALSGPFTDFYVSFISVPVVEKFIPVKDLFIAL
FT                   FVPALFMIPSGYIAIRDLLKKRVVEIIRGESEKSFKTRFRMKFLDRFSFKRRIMLKQGL
FT                   LHPSRELVLIVGVAFATLIILYGVVAKSALSYLVEDTFKNIFKYNYMYIFNYYEKENKY
FT                   PNAEPFNMLSFYLKGTKSKVVIYGILKDSQMIILKDNKGNKINLEGLVISQSLADKFNL
FT                   KVGDVLTLVNNINGKEYSLKITGIADLYVGNSGYMNLEEFNKTFDLEEGSFIGLYSLDK
FT                   LDVPKENLVTYMSKEDAIKVFRDSAQSIDQMLQVMYLISFFLAFTIIYVLASLVITENR
FT                   KPLAIFKILGFRDGELSSMFLGFNNFSFMIGFLLGIPLYNMLIGYLIKEVLKDVDFSFK
FT                   MQAQFKDVIFSFVYLFAAFLLSRYLGRRKIKSISPAVILKEQSE"
FT   gene            complement(139538..140086)
FT                   /locus_tag="DICTH_0123"
FT   CDS_pept        complement(139538..140086)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0123"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19660"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="InterPro:IPR019243"
FT                   /db_xref="UniProtKB/TrEMBL:B5YBE2"
FT                   /protein_id="ACI19660.1"
FT                   /translation="MKRFVLMLGILLMSFTLFSNLGISAVNLSSQEIKDILHMREEEKL
FT                   ARDVYTTLYNLYKIPTFYNISKSEQTHMNAVKTLINYYNLKDPITDDSVGKFSDPKFTE
FT                   LYNNLIERGKKSVIEALKVGILIEELDIKDLQEAISRTNKADIIRVYTNLLKGSQNHKE
FT                   AFIKVLQRYGESYTPTYTN"
FT   gene            140334..140774
FT                   /locus_tag="DICTH_0124"
FT   CDS_pept        140334..140774
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0124"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19766"
FT                   /db_xref="UniProtKB/TrEMBL:B5YBE3"
FT                   /protein_id="ACI19766.1"
FT                   /translation="MKKFIFVLLVVLLSFSITYAGNFGVGVVIGEPTGLSFRLWQGKAQ
FT                   AFDFGLAWSLNANVLHLFADMVTHNYGIFKPSSGSMPFYYGVGVRILAADNTNFGIRIP
FT                   LGVVYIPKGMNLDFFFELVPTLELVPQTSIDVDGAFGFRYYF"
FT   gene            complement(140825..141688)
FT                   /locus_tag="DICTH_0125"
FT   CDS_pept        complement(140825..141688)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0125"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19417"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032319"
FT                   /db_xref="UniProtKB/TrEMBL:B5YBE4"
FT                   /protein_id="ACI19417.1"
FT                   /translation="MIDIPPLWQQTADDILLKKGVVIVIGLPNSGKSTFVKFLASYGVK
FT                   NNLKVAIINSDLGQADIGVPGTISLSLLENELFSFENLPIKSWYFIGEITPTGRFLQVI
FT                   TGVRRLLDEAKKMADIVIINTCGLVKGRLGKILKYYKTFVINPDHIVAIQTDNELDPLL
FT                   KIIGRLSKNVYKIPKSILARERPPEERREFREKRYEMYFQNAKTLLFPIYLVHSIDKYI
FT                   DFQKEDYTGRLVGLIDEKENLLELGIIQEVNLEKRNLLIFTPLKEIDKVKRIEIGSIKL
FT                   KVIREM"
FT   gene            complement(141692..142042)
FT                   /locus_tag="DICTH_0126"
FT   CDS_pept        complement(141692..142042)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0126"
FT                   /product="iojap domain protein"
FT                   /note="identified by match to protein family HMM PF02410;
FT                   match to protein family HMM TIGR00090"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18576"
FT                   /db_xref="GOA:B5YBE5"
FT                   /db_xref="InterPro:IPR004394"
FT                   /db_xref="UniProtKB/TrEMBL:B5YBE5"
FT                   /protein_id="ACI18576.1"
FT                   /translation="MNFLESREKAIRVARIVLEKKAENVIIIDVSQISGLTDYLVICTG
FT                   LTNTQRKAIQRSVEEEMEKLGFTPRGIEGREGTGWTLLDYYDLIVHIFSPRAREFYDIE
FT                   SLYENVPKITEF"
FT   gene            complement(142042..142965)
FT                   /locus_tag="DICTH_0127"
FT   CDS_pept        complement(142042..142965)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0127"
FT                   /product="transcriptional regulator"
FT                   /note="identified by match to protein family HMM PF03816;
FT                   match to protein family HMM TIGR00350"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19987"
FT                   /db_xref="GOA:B5YBE6"
FT                   /db_xref="InterPro:IPR004474"
FT                   /db_xref="UniProtKB/TrEMBL:B5YBE6"
FT                   /protein_id="ACI19987.1"
FT                   /translation="MKKWKAVVIGILVLLIVLIAVGVGGYYYIQNSFNYTPTKNYPVLE
FT                   KVELLDVAFNKIEKINVALLGVDERKTDPGRSDTIIIISLDVKNKKVNILSIPRDTRVY
FT                   IQDHGFTKINHAYAYGGVPLSLKTLESFLNIPIHYYVKVNFQQFEKFIDAIGGVDIEVE
FT                   RRMYYRDKTDKFLVDLTPGVHHLNGREALGYVRFRHDPMGDLARVERQQKFLMALFKQM
FT                   KEKINLLNMPQYISLAGSIFETNVSLMEGIVIASKFMDISEEDIHTFIMPGTTETINGI
FT                   SYVIPDESKLKDILEQYFKPNNIKEG"
FT   gene            complement(143095..143373)
FT                   /locus_tag="DICTH_0128"
FT   CDS_pept        complement(143095..143373)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0128"
FT                   /product="RNA-binding protein"
FT                   /note="identified by match to protein family HMM PF00076"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19129"
FT                   /db_xref="GOA:B5YBE7"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="UniProtKB/TrEMBL:B5YBE7"
FT                   /protein_id="ACI19129.1"
FT                   /translation="MSKTLYVGNLPWSTTEEELKNIFASHGTVYSARIISDRNTGRSKG
FT                   FGFVEVDESEAEKMISALNNTEVKGRRIIVNEAKPREERPRERRNRG"
FT   gene            complement(143370..143588)
FT                   /locus_tag="DICTH_0129"
FT   CDS_pept        complement(143370..143588)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0129"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19701"
FT                   /db_xref="UniProtKB/TrEMBL:B5YBE8"
FT                   /protein_id="ACI19701.1"
FT                   /translation="MFEFLKRNFEFVKKILETPWESPKRALKYFYFPRKRGEVYREYPK
FT                   SVLFSRVPECSPKASPETLKNFHEVKK"
FT   gene            143770..144642
FT                   /locus_tag="DICTH_0131"
FT   CDS_pept        143770..144642
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0131"
FT                   /product="radical SAM domain protein"
FT                   /note="identified by match to protein family HMM PF04055"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19440"
FT                   /db_xref="GOA:B5YBE9"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR040086"
FT                   /db_xref="UniProtKB/TrEMBL:B5YBE9"
FT                   /protein_id="ACI19440.1"
FT                   /translation="MVIKEINCKTAISKCKFPDGGWAINPYIGCSHGCIYCYARFMKKF
FT                   TKHTERWGDFVDVKINMPEILSKEIKKERYKNGNIYVGTVTDPYQPLEEKYEITRKVLE
FT                   ILSEYPYPVSILTKSDLVLRDIDILKRFKNVDVNFTLNTLDEDWKNLVEPNSPPIENRI
FT                   LAISKLKEENIKVYAMMGPFWPFFSDAEELIKTFKVLGIEEIYTESFNTIGGTFTEVED
FT                   RMAQYYPNILPRMKEILFNKDNFNNFYSLIRENLFELSKQYGIKINIYFGRGHSKFKET
FT                   TFTSSSYDV"
FT   gene            complement(144617..145597)
FT                   /locus_tag="DICTH_0130"
FT   CDS_pept        complement(144617..145597)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0130"
FT                   /product="polysaccharide deacetylase domain protein"
FT                   /note="identified by match to protein family HMM PF01522"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18864"
FT                   /db_xref="GOA:B5YBF0"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:B5YBF0"
FT                   /protein_id="ACI18864.1"
FT                   /translation="MRNMKRLNIINKMIFIIILIFFSISYSYSYVELRADINSHNEINP
FT                   GFIPYYSNEVLVLTYHVLDKKVKGPISISPQLFEEHIRYLKNAGFHPITPETLREFMEG
FT                   KTDIPDNAVLITFDDGYESFYKLAYPILEKYRVPAINFIIVSMVGKVGAFPHLTWNEMK
FT                   EMLKSNLIYFGSHTYDSHHLVRTGLFSQAPALVGHIYKPLFYRESDEEYKSRISGDLWY
FT                   SKYLLEKNLNIEVKDLCFPYGAYNSTVLEIAKELGYEVFYTTNKGINKPGKDKYIIIKR
FT                   LNAGSYNMSLTRFQSMLFKYIILSHPQIHTNKFIKNSFKHHKKMR"
FT   gene            145917..146885
FT                   /locus_tag="DICTH_0132"
FT   CDS_pept        145917..146885
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0132"
FT                   /product="transcriptional regulator"
FT                   /note="identified by match to protein family HMM PF00356;
FT                   match to protein family HMM PF00532"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18552"
FT                   /db_xref="GOA:B5YBF1"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:B5YBF1"
FT                   /protein_id="ACI18552.1"
FT                   /translation="MKDIAQKVGVSIATVSRVLNYDENFAVSDEVKRKIFEAAEEVNYY
FT                   PKKYRRTKTYKKILIVKAYSEKVELEDTYYLSLRVTIERLLRMNEFFAEIKDDNLSLEE
FT                   LENYHGVIILGNLEEKKLYSFLSKNLNIILVDFSCDNPYVDSVVVNYKLGVKQALEYLL
FT                   VLGHKKIGIISGRENTGNMDMRELYFRKFLQEKNLLNENYIFYGDFTPHGGYMAAKEML
FT                   NLPDKPTAIFVSNDSMAIGCYKAIYELGLKIPEDISIVGFNNISISRFMTPPLTTVNVS
FT                   VEEMAETSLYLLKDRLKRNRKIGKKVTISTELLVRESCKEV"
FT   gene            complement(146899..147804)
FT                   /locus_tag="DICTH_0133"
FT   CDS_pept        complement(146899..147804)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0133"
FT                   /product="transporter"
FT                   /note="identified by match to protein family HMM PF00892"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19601"
FT                   /db_xref="GOA:B5YBF2"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:B5YBF2"
FT                   /protein_id="ACI19601.1"
FT                   /translation="MHNLSFSYISSYISLILATTIWGFGFVAVKESVTHITPIQVLFIR
FT                   FFSSAFFLIIIYYNSIRSSRLQTIKRGFILGFFLFLAFWTQTIGIFYTTPGKNAFLTST
FT                   NVVIVPFLYWLIRGKKPKFFHIVSALLCVLGVFLLSYSGDAFYLNKGDFFSLLCALFFG
FT                   FHIVFTDIFIKNDDLINLSFWQFLTVSLISLLLILIKYNFVWFKNLVFIIIGEKNKRLL
FT                   FSLVYICLFSTLLAYILQTYSQKFIKPYITSIILSTEAIWGYLASYLLYKEDINLPTIL
FT                   GCGLILSSAIIVSLIDLKTN"
FT   gene            complement(147804..150896)
FT                   /locus_tag="DICTH_0134"
FT   CDS_pept        complement(147804..150896)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0134"
FT                   /product="evolved beta-galactosidase alpha-subunit"
FT                   /EC_number="3.2.1.23"
FT                   /note="identified by match to protein family HMM PF00703;
FT                   match to protein family HMM PF02836; match to protein
FT                   family HMM PF02837; match to protein family HMM PF02929"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19572"
FT                   /db_xref="GOA:B5YBF3"
FT                   /db_xref="InterPro:IPR004199"
FT                   /db_xref="InterPro:IPR006101"
FT                   /db_xref="InterPro:IPR006102"
FT                   /db_xref="InterPro:IPR006103"
FT                   /db_xref="InterPro:IPR006104"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014718"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR023230"
FT                   /db_xref="InterPro:IPR023232"
FT                   /db_xref="InterPro:IPR023933"
FT                   /db_xref="InterPro:IPR032312"
FT                   /db_xref="InterPro:IPR036156"
FT                   /db_xref="UniProtKB/TrEMBL:B5YBF3"
FT                   /protein_id="ACI19572.1"
FT                   /translation="MIKTWENHKITNINRLPARSYFYSYPTLESASYFEKKLSLGYKLL
FT                   NGKWKFLYLEAPEYSPEGFQKKDFDDSNWQEIYVPGSWEIQGFGKPNYTDLLYIFPLNP
FT                   PYVPTENPCGIYRTWFFIPANWLDKRIIIKFHGVSSAFHLWLNGFEIGYSKGSRLTSEF
FT                   DISKYVVEGPNLLTVRVYKWSDGSYLEGQDMWKLAGIIRDVEIGVEPLDGIFDFFVKTD
FT                   LSEDYKKGNIKLNLKFWNFVEEITFEYILADEYNNIIYSDNFKVSGNELNIISPYFDIK
FT                   KWSDEEPYLYNLFLILRKNQEIIQVIPQKIGFRKIEILGNKFLLNGVPIKLKGINRHEF
FT                   YPSFGYFTPMDIAEKDIKLLKQYNINSIRTSHYPNSPYFYDLCDKYGVYVISECDIETH
FT                   GFELVDKHNYLANNPEWENAFIDRIERTVHRDKNHPSIIMWSLGNESSFGINFEKCAKK
FT                   IREIDNTRMIHYEGDKEGRVTDVFSTMYTWLEPENESKSLLEVIKNCNKPYILCEYGHA
FT                   MGTGPGGLKDYQELFEAHENFQGAFIWEFCDHGLPIQNKGYGYGGDFGDEPNDSNFCID
FT                   GILFPDRTIKPGFLELKKIFEPIKIELLNIEKGIFVIKNLYNFISLDHLLVVYSIWNNN
FT                   GIIKSGEITPSNIPPRCKKEIEVEDVIKIRNNENIKQETFIDFYVILKEDTPWAKRGHI
FT                   VSYFQYRIKEEEIKEETSLINNHTKTPISVIEKGDILEIIGEDIKITFDKVKAKLIEGE
FT                   KNSKKIRLFGPFFNFWRPPIDNDKNITSDYINKYHLPFIKERVDKFEIKDFKDFLNIET
FT                   QILYGTINSTWFYVIDYSYHIYPTGDIIIKISAKTKGDKDKAPNMLPKLGFKWYLSRDL
FT                   RNVRWFGRGPHTNYIDMKESALIGCYEDYVENLMVSYIKPQDSANRSDCKYVSLTDDYG
FT                   VGIFVSTSKSFDFSAYPYEDTEIQKAKHNWELKKSNFITLNIDYKNNALGTNSCGQNQL
FT                   LKYRCKYEDFSIELFISIFNHYEISENLKYLISKKLLRRDK"
FT   gene            complement(150889..152547)
FT                   /locus_tag="DICTH_0135"
FT   CDS_pept        complement(150889..152547)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0135"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18827"
FT                   /db_xref="GOA:B5YBF4"
FT                   /db_xref="InterPro:IPR004888"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="InterPro:IPR031335"
FT                   /db_xref="UniProtKB/TrEMBL:B5YBF4"
FT                   /protein_id="ACI18827.1"
FT                   /translation="MIFLSVDLLKNIPFSTRGSYIVISLDERKSLWIRHISGGDNDWGN
FT                   LIKIEWDTVNSDIFFNFYELRINKNDSSINFTFYDDNTLVIKSINHPVTLKFATRGYDN
FT                   LIERDKNIYEFNCSHKNNVILLIEVLVGETKIYTKWNGLGCESAELYIYPLNGISLIKI
FT                   TDKIDKVSLNIKPTYEEALEKNKKKYDNFSSKFKGNKTFEYELAQYILWSNIVSPRGLL
FT                   KYETIYSSKNKMTNAWSWDNLFIILPLVNKFFDLSINAIKTFTELQREDGLIPDFVNDV
FT                   YCCYNFCKPPIIGFIIEYLNRNKLLSYEEITDLYEPLKNWALWWLNFRDDDKDYLIQYN
FT                   HGNESGMDNSTIFISSPPIESPDLNSYLIILFRVLQKMAILKSKRFEMDLFRDIESRLY
FT                   LSLINLWDGEDFVAYDKNHNKINSESLQKYIPLILEDLKPEIINQIHKTLIKKYLSPYG
FT                   ITTEAQNSKYFNETGYWRGPIWAPTTFIFYEALQKHGYLKTSQELRKKYLAMIKNSYFS
FT                   ENYNPKTGEGLCDTDFSWTASIFLTFYEEEERVND"
FT   gene            complement(152544..153365)
FT                   /locus_tag="DICTH_0136"
FT   CDS_pept        complement(152544..153365)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0136"
FT                   /product="putative sugar uptake ABC transporter permease
FT                   protein"
FT                   /note="identified by match to protein family HMM PF00528"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19825"
FT                   /db_xref="GOA:B5YBF5"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B5YBF5"
FT                   /protein_id="ACI19825.1"
FT                   /translation="MNKIIKIGYYLVMIVLSIYFIGPIYWMIISAIKPPNEIFTYPPVF
FT                   FPSKINFKNFVDAWNAQPFALYLKNSLIIVLFNTLGQVFSCTLVAYGFARYKFKGRELL
FT                   FTILLATMMIPWDVTMIPQYVLFKALKWIDTLKPFIIPAWFGSPFYIFLLRQFLLTIPK
FT                   ELEEAAAIDGANDFQIFLRIFIPLIIPAIMVLIIFNFLTCWNDFLGPLIFINNPQKYTL
FT                   MLGVAQFRGLHHIEINKIMAITTIASIPPLVLYIFAQRYITEGIVSVSVKG"
FT   gene            complement(153380..154264)
FT                   /locus_tag="DICTH_0137"
FT   CDS_pept        complement(153380..154264)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0137"
FT                   /product="putative sugar uptake ABC transporter permease
FT                   protein"
FT                   /note="identified by match to protein family HMM PF00528"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18997"
FT                   /db_xref="GOA:B5YBF6"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B5YBF6"
FT                   /protein_id="ACI18997.1"
FT                   /translation="MRIKNKKEYIPFLFLMPWILGFLIFTIGPLFFSLVMSFYKWPIVG
FT                   KPVFIGLKNYSDMFKDPLFYHSLKVTFKYVLWYVPLNTIFALLCAILINTNYKFTTLFK
FT                   ALFFLPTVVSGVAIAIVWSWIYDKEYGILNYILSLLLKIEGINWLGDTRWSVFSLVIAS
FT                   LWTMGNTMLIFLAGLKGIPKELYEAAYIDGATWWPRFIKITIPMLSPTILFNLITTLIS
FT                   AFQVLTLALLLTGGGPARSSYVYAMYVYHNAFRYSKLGYASANAWIMFLIILILTLILF
FT                   KSSNRWVYYEGEK"
FT   gene            complement(154473..155714)
FT                   /locus_tag="DICTH_0138"
FT   CDS_pept        complement(154473..155714)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0138"
FT                   /product="putative sugar uptake ABC transporter periplasmic
FT                   solute-binding protein"
FT                   /note="identified by match to protein family HMM PF01547"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18773"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:B5YBF7"
FT                   /protein_id="ACI18773.1"
FT                   /translation="MRRLNTFFLVFLLLLGISISFSQKVVTIRFATWDTGELYKIEQEI
FT                   AKRFEREYPNIKVQVESYGDSFDQKLAASFGAKNPPDVMYMWDFPTYYESLIPLDDLLK
FT                   QDKSINLNDYYPALFNYCKYEGKLYGLPVGFTSHVIYYNKDLFKTQKITTPSTNWTWDE
FT                   FIEKARKLTNPSQKIYGFAFPVSPDPYDFEQFLWSNGGSYCSPDGKEINGYLNSREMVE
FT                   VLSLFTKMLKEKIAVLTGTQQIQSGGDLFKAGKLGMLESGIWRLPEFIEAKLNFGVHIL
FT                   PAFKGKPVKSILNVSAISIAKDTKNLKEAWEFVKYYSYNKEAIKMRKGDLPTRKTVVAE
FT                   LKLNSNPYYKPFYKMIEVSADKIPSFYLNKNMRRIYDELAITIEQIFSEQANEEKIKEY
FT                   LDNLVNRTKDWLKD"
FT   gene            156493..156875
FT                   /pseudo
FT                   /locus_tag="DICTH_0139"
FT                   /note="glyoxylate reductase, authentic frameshift; this
FT                   gene contains a frame shift which is not the result of
FT                   sequencing error; identified by similarity to SP:Q9C4M5"
FT   gene            156905..158215
FT                   /locus_tag="DICTH_0141"
FT   CDS_pept        156905..158215
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0141"
FT                   /product="putative hydroxypyruvate reductase"
FT                   /EC_number="1.1.1.81"
FT                   /note="identified by match to protein family HMM PF05161"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18754"
FT                   /db_xref="GOA:B5YBF8"
FT                   /db_xref="InterPro:IPR007835"
FT                   /db_xref="InterPro:IPR025286"
FT                   /db_xref="InterPro:IPR037035"
FT                   /db_xref="InterPro:IPR038614"
FT                   /db_xref="InterPro:IPR039760"
FT                   /db_xref="UniProtKB/TrEMBL:B5YBF8"
FT                   /protein_id="ACI18754.1"
FT                   /translation="MNLREIAWKIIKSSLEVVNPKLAVKNYLSYDEKERKIKVKDREFE
FT                   IKGDIYLLSVGKASFPMTEGALEILGDLVKKGYVVVPYGYEGKLTGNIEILYSSHPIPD
FT                   KNGERAAKTILNFVESLKEDDILVFLLSGGGSALLPLPKEEITLEDKIETTKLLLSCSA
FT                   RIQEINAVRKHLSKIKGGQLAEKCKGTIITLVVSDVLGNPLDSIASGPTVPDPTTYQDV
FT                   FTILKKYDLWEKVPERVRELVKKGILGEIPETPKFINERHFTEVILSNRSCIERAIERA
FT                   KELGFNTLFLTGFLEGEAREVAKVIAGIVKEIKFSQNPISPPCALIFGGETTVTLKGDG
FT                   LGGRNQELALSFAIEIQGIDGVVLVSFATDGRDGPTDSAGAFADGNTVERAEELGMDPV
FT                   SYLLNNDSYHFFEKINSLIKTGPTHTNVNDMVVVLVE"
FT   gene            158462..158836
FT                   /locus_tag="DICTH_0142"
FT   CDS_pept        158462..158836
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0142"
FT                   /product="transcriptional regulator, PadR family, putative"
FT                   /note="identified by match to protein family HMM PF03551"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18796"
FT                   /db_xref="InterPro:IPR005149"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B5YBF9"
FT                   /protein_id="ACI18796.1"
FT                   /translation="MRGFGRWQKGMGFAPGFWLRAFVLVALSKKELHGYELLNMIDEYF
FT                   PEFCFCKGLSGMGTGYRILRMLEMEGLIKSRWETGEGPAKRVYSLTSEGEKAKEEILEY
FT                   VKEMKDRIERFLEFAGGKEV"
FT   gene            158841..159065
FT                   /locus_tag="DICTH_0143"
FT   CDS_pept        158841..159065
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0143"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18542"
FT                   /db_xref="InterPro:IPR035205"
FT                   /db_xref="UniProtKB/TrEMBL:B5YBG0"
FT                   /protein_id="ACI18542.1"
FT                   /translation="MRWWHRGYGWGFRGFGGYGAPWCPWSFWGRRWWRGRLYPYYGITK
FT                   EEEKEILEAWKNDLEAELEEIKKRLEELK"
FT   gene            159151..159351
FT                   /locus_tag="DICTH_0144"
FT   CDS_pept        159151..159351
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0144"
FT                   /product="ferredoxin 2"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19616"
FT                   /db_xref="UniProtKB/TrEMBL:B5YBG1"
FT                   /protein_id="ACI19616.1"
FT                   /translation="MHVHDHEHSGLGPEGYCICPKCGYKKVHTPGIPCKEERCPNCGSA
FT                   LIREGSYHHKLIEERKRKDEK"
FT   gene            159341..160162
FT                   /locus_tag="DICTH_0145"
FT   CDS_pept        159341..160162
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0145"
FT                   /product="MRP/NBP35 family ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18344"
FT                   /db_xref="GOA:B5YBG2"
FT                   /db_xref="InterPro:IPR000808"
FT                   /db_xref="InterPro:IPR019591"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033756"
FT                   /db_xref="UniProtKB/TrEMBL:B5YBG2"
FT                   /protein_id="ACI18344.1"
FT                   /translation="MRNDDIIKQRDKIKERMSRIKNKIVVMSGKGGVGKSTVAVNLALS
FT                   FNLKGYKVGLLDADITGYSVPKLLNLSSEKLYNTDEGILPAETTMGIKVASAGFLTESE
FT                   ETPIIWRGPLKASLIKEFLSSIIWGDLDYLIIDLPPGTGDEPLSIAQDIPDISGAVIVT
FT                   IPSDLSQRVVRRAVNFARLLNMRIIGIIENMSGFVCPHCGARVDIFNSGGGEKIAKDLN
FT                   VPLLGKIPLDPRVAESGDNGIPFILAHKDSEVSKSFMEIVEKIEDFLKGGK"
FT   gene            160165..160533
FT                   /locus_tag="DICTH_0146"
FT   CDS_pept        160165..160533
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0146"
FT                   /product="nitrogenase iron-molybdenum cofactor maturation
FT                   domain protein"
FT                   /note="identified by match to protein family HMM PF02579"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18337"
FT                   /db_xref="InterPro:IPR003731"
FT                   /db_xref="InterPro:IPR033913"
FT                   /db_xref="InterPro:IPR036105"
FT                   /db_xref="UniProtKB/TrEMBL:B5YBG3"
FT                   /protein_id="ACI18337.1"
FT                   /translation="MKVAVASDDGKVISSHFGRSRGFVIFEIEDGEIKSREYILNTFTG
FT                   HARGLHHTGHHHYDSHATIIENLRDCKAVISHGMGRRLYEDLTSAGIEVYVTDETDVDK
FT                   AIELYIKGELRNVSELLD"
FT   gene            160511..161287
FT                   /locus_tag="DICTH_0147"
FT   CDS_pept        160511..161287
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0147"
FT                   /product="metal-dependent hydrolases of the beta-lactamase
FT                   superfamily II"
FT                   /note="identified by match to protein family HMM PF00753"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19409"
FT                   /db_xref="GOA:B5YBG4"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="InterPro:IPR041712"
FT                   /db_xref="UniProtKB/TrEMBL:B5YBG4"
FT                   /protein_id="ACI19409.1"
FT                   /translation="MSQSYLTNITILCDDRLSFPLFSEHGFSVLIERRGEEALLFDTGG
FT                   SDVFIKNAKILGKDLTKVENIVISHGHYDHAGGLKYLAKFDKKYKVYLRREALLPKYSG
FT                   DRFTGIDWDSIKKDFDFIFVEKDIEELEKGIYIFGSSPLRSEFNSIDPNFYVINEKGEK
FT                   VKDKFEDELSLVIDEGEGIILITGCAHRGIVNIVDDTLNKFNKRINLLIGGFHLYKSSE
FT                   EKVKKVVDSLKGFNIGKILPYHCTGEIAIKLLDLHN"
FT   gene            161323..162063
FT                   /locus_tag="DICTH_0148"
FT   CDS_pept        161323..162063
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0148"
FT                   /product="glucose-1-phosphate thymidylyltransferase"
FT                   /EC_number="2.7.7.24"
FT                   /note="identified by match to protein family HMM PF00483"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19011"
FT                   /db_xref="GOA:B5YBG5"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR005907"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:B5YBG5"
FT                   /protein_id="ACI19011.1"
FT                   /translation="MGRDIVKGVILAGGTGSRLRPLTKVTNKHLLPVGRYPMIFYPIYK
FT                   LKQAGIYEILVVTGREHMGDVIELLGSGRDFGVEFTYKVQDEAGGIAQALGLARHFVGD
FT                   DKCVVILGDNIFEDDITPYVKKFEEQKEGAKILLKEVPDPQRFGVPVFENGRIIAIEEK
FT                   PKEPKSNFAVTGIYMYDSYVFEIIKTLKPSARGELEITDVNNTYLKMGKLTYDILKGWW
FT                   TDAGTPESLFRANELARNIILDFE"
FT   gene            162067..162651
FT                   /gene="rfbC"
FT                   /locus_tag="DICTH_0149"
FT   CDS_pept        162067..162651
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rfbC"
FT                   /locus_tag="DICTH_0149"
FT                   /product="dTDP-4-dehydrorhamnose 3,5-epimerase"
FT                   /EC_number="5.1.3.13"
FT                   /note="identified by match to protein family HMM PF00908;
FT                   match to protein family HMM TIGR01221"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19810"
FT                   /db_xref="GOA:B5YBG6"
FT                   /db_xref="InterPro:IPR000888"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:B5YBG6"
FT                   /protein_id="ACI19810.1"
FT                   /translation="MGKFKIIETPIKDLVLIETKIFRDNRGFFMETYNQKEFEEIGLKL
FT                   NFVQDNLSLSKKGVLRGLHFQFKYPQGKLIRVIKGKVYDVAVDLRINSPTFGKWYGVEL
FT                   TGENGLAFYIPEGFAHGFLTLEDDTYFFYKCTEIYYPEYDSGIIWNDPDIDIKWPLEKV
FT                   EELIISEKDKNLPKLKDIIDKLKEEGNWIKI"
FT   gene            162636..163514
FT                   /gene="rfbD_1"
FT                   /locus_tag="DICTH_0150"
FT   CDS_pept        162636..163514
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rfbD_1"
FT                   /locus_tag="DICTH_0150"
FT                   /product="dTDP-4-dehydrorhamnose reductase"
FT                   /EC_number="1.1.1.133"
FT                   /note="identified by match to protein family HMM PF01073;
FT                   match to protein family HMM PF01370; match to protein
FT                   family HMM PF02719; match to protein family HMM PF04321;
FT                   match to protein family HMM PF07993; match to protein
FT                   family HMM TIGR01214"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18454"
FT                   /db_xref="GOA:B5YBG7"
FT                   /db_xref="InterPro:IPR005913"
FT                   /db_xref="InterPro:IPR029903"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B5YBG7"
FT                   /protein_id="ACI18454.1"
FT                   /translation="MDKDMKIVILGGKGQLGTEIYEYLKDKEEIYSFSHQELDILNYDL
FT                   LEKKLQEIKPDVVINCSAYTKVDKAEEEKDECIKVNTIGAKYVSFLAYKVGAKIVYFST
FT                   DYIFDGEKSTPYTEFDDPNPLSVYGLSKLYGEKLTIEHNPNHLILRISWLYGIYGRNFV
FT                   KTILNLARERKKLTIVNDQKGSPTYTLDVAKQVYELIKKDKVGIYHSSNQGETTWYDFA
FT                   KRIIEILKIKDVEVLPIKTEEYPSIAKRPKYSVLDNFLLKLEGINIMRDWEIALEDFLN
FT                   TYKDILLGEKE"
FT   gene            163511..164521
FT                   /gene="rfbB"
FT                   /locus_tag="DICTH_0151"
FT   CDS_pept        163511..164521
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rfbB"
FT                   /locus_tag="DICTH_0151"
FT                   /product="dTDP-glucose 4,6-dehydratase"
FT                   /EC_number="4.2.1.46"
FT                   /note="identified by match to protein family HMM PF01073;
FT                   match to protein family HMM PF01370; match to protein
FT                   family HMM PF02719; match to protein family HMM PF04321;
FT                   match to protein family HMM PF07993; match to protein
FT                   family HMM TIGR01181"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18686"
FT                   /db_xref="GOA:B5YBG8"
FT                   /db_xref="InterPro:IPR005888"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B5YBG8"
FT                   /protein_id="ACI18686.1"
FT                   /translation="MKKIILITGGAGFIGSNFIHYMLNKYPEYEIVNLDKLTYAGNLEN
FT                   LKEVENNKNYHFVKGDITNRELVEHIFEEFNPQYVVNFAAESHVDRSIEGPEIFVKTNV
FT                   YGTHVLLDVAKEYWENKKMEDVRFIQISTDEVYGSLPLESKEKFTEESPLRPNSPYSAT
FT                   KAGADLICRSYFITYNFPVIITRSSNNFGPRQYPEKLIPLTIKRALEGKPIPVYGDGQN
FT                   VRDWLYVEDNCKGIDLVLHKGRIGEIYNIGGGNEWKNIDLVNLICGIIAEIKGEDAERY
FT                   KRLITFVKDRPGHDRRYALSIEKIKSELGWKPESDFLEALKFTVKWYMERWEGII"
FT   gene            164518..165192
FT                   /locus_tag="DICTH_0152"
FT   CDS_pept        164518..165192
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0152"
FT                   /product="putative O-antigen biosynthesis protein; possible
FT                   glycosyltransferase; possible methyltransferase"
FT                   /note="identified by match to protein family HMM PF08241;
FT                   match to protein family HMM PF08242"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18786"
FT                   /db_xref="GOA:B5YBG9"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B5YBG9"
FT                   /protein_id="ACI18786.1"
FT                   /translation="MSKFYEEKNVEYFLRVRKDIIDLVKKLNLEEPLSILEIGAGGGNT
FT                   LIELKRLGIAKEVVGVDIVRLVSSYQDDPLMDNFIVGNIEKFELPYPENYFDLIICADV
FT                   LEHLYDPWNAVKKLYKYLKQNGYFIASIPNIGHFSVLKKIFMDKDFRYDNAGILDKTHI
FT                   RFFCRKNIIDLFEANNLKVVKMISNFELNKRSKSNILNKISLGYLSDLLTVQYLVISQK
FT                   YG"
FT   gene            165185..166258
FT                   /locus_tag="DICTH_0153"
FT   CDS_pept        165185..166258
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0153"
FT                   /product="glycosyltransferase"
FT                   /note="identified by match to protein family HMM PF00535"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19890"
FT                   /db_xref="GOA:B5YBH0"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:B5YBH0"
FT                   /protein_id="ACI19890.1"
FT                   /translation="MVNEKVAIVILNYNGWQDTIECLESVYQIDYPNYDVILVDNASSE
FT                   DSIVKIKEYCDGKIKVESKFFEYNPNNKPIMVAEYEKNELEDCSIDPDFRNLPSNRKLI
FT                   LIKNDENYGFAGGNNVGVRFAMKYLKPEFILFLNNDTVVDEKFLMSLVGKIKDNSIIGS
FT                   AQSLLLRKDCETIDSLGQELKMRGLQISDKAMGEKISNYKDIKDAEIFGPCCAAAIYRS
FT                   EVLNKIGFFDEDFFYIYEDVDLSFRNRLAGFKSYLIVDSMVFHKRGISGGKDKTISMKS
FT                   YFSLRNYLSILIRYYPSNLIIRNLPKILYIISRLFVSSLYFKKLNETIMFFYKSLRYRY
FT                   SIEDKLKLRMIIKEWVR"
FT   gene            166255..167235
FT                   /locus_tag="DICTH_0155"
FT   CDS_pept        166255..167235
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0155"
FT                   /product="rhamnosyl transferase"
FT                   /note="identified by match to protein family HMM PF00535"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19928"
FT                   /db_xref="GOA:B5YBH1"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:B5YBH1"
FT                   /protein_id="ACI19928.1"
FT                   /translation="MKNNKVYIIIIHYKGLEDTFSLLDNLLSLDYQDFQVILVNNNPEE
FT                   NLFGNLKSFIITRGWNLLTEQVEDNYITLSIDKFKYPVVLINQERNLGYAGGVNTGIRY
FT                   TLKYNDFSYLWILNNDLILAPDSLRELINFAEKLKSEGKRVGIIGSKLLYYHSPQILQG
FT                   IGGKYNKYFALTKHVGGFEEDKGQYDRENIEIDYVIGASMFVPKEFIEDVGLMDERYFL
FT                   YFEDVDWCERARRKGYVITCCYKSKVYHKEGASIGSSSKGEKKSELADYYGIRNRIVFT
FT                   KKFYPQYLFTVYLSLLGVILNRVKRRQFNRIKLVFEAIKDIPKEN"
FT   gene            complement(167232..168236)
FT                   /locus_tag="DICTH_0154"
FT   CDS_pept        complement(167232..168236)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0154"
FT                   /product="glycosyl transferase, group 1 family protein"
FT                   /EC_number="2.4.1.-"
FT                   /note="identified by match to protein family HMM PF00534"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18817"
FT                   /db_xref="GOA:B5YBH2"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="UniProtKB/TrEMBL:B5YBH2"
FT                   /protein_id="ACI18817.1"
FT                   /translation="MKIALITGSLPPEPCGVGDYTYNLSNALIKKGLNVTVLCPKKWKP
FT                   KDIYHLYKELKNYSITHMQYPTLGYGYSIGPHFLSLIKPMVITLHEASQAHILRFISLF
FT                   AFTINSQKLIFTSKYEKEYFEKFYPYIKSKTYVIPIGSNIPFCDKSKERRKEIVYFGLI
FT                   APNKNLEDFIKLASLIKNSNLSLNLRIIGKIKDNKYYQELKYISKDLNIIWNINLNEKE
FT                   VCEILSETLFAYLPFPDGASERRGTLLATLGNGVVTITTEGRHTTEEIKDTVLIANNPQ
FT                   DAFEVIKKILNDYNLIKYLSEKSRKYAEKFTWDKIAEEHISLYQSILRNNYSG"
FT   gene            168385..168549
FT                   /locus_tag="DICTH_0156"
FT   CDS_pept        168385..168549
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0156"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18399"
FT                   /db_xref="UniProtKB/TrEMBL:B5YBH3"
FT                   /protein_id="ACI18399.1"
FT                   /translation="MGRDKRGNKINSPSVLAKLYKLYLLIENGSYPSISYLQKSLELSE
FT                   KTIDRYISY"
FT   gene            168678..169376
FT                   /locus_tag="DICTH_0157"
FT   CDS_pept        168678..169376
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0157"
FT                   /product="GntR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ACI20137"
FT                   /db_xref="InterPro:IPR026881"
FT                   /db_xref="UniProtKB/TrEMBL:B5YBH4"
FT                   /protein_id="ACI20137.1"
FT                   /translation="MVEEFRNTPLEDSLKKLAKKLEALFPEEVTIGGKELEMMLSVSLS
FT                   PIKMRVDIKDTFEKIFSAIKNRKRIIIKYYSIERDELTERKVDPYHIYNYEGVWYFCGF
FT                   CHLRKELRDFALDRIQSIDITSEKFEFPKDFNPKEYLSKPFRIYKGSFIKMKVLFDSYQ
FT                   ARWIKERIWHPNQKVEELETGEVILEIEGNSEELKRWILSYGKHAKVLEPEELREELKK
FT                   ELKEVLKNYG"
FT   gene            169449..170231
FT                   /gene="cas6_2"
FT                   /locus_tag="DICTH_0158"
FT   CDS_pept        169449..170231
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cas6_2"
FT                   /locus_tag="DICTH_0158"
FT                   /product="CRISPR-associated protein Cas6"
FT                   /note="identified by match to protein family HMM PF01881;
FT                   match to protein family HMM TIGR01877"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18721"
FT                   /db_xref="GOA:B5YBH5"
FT                   /db_xref="InterPro:IPR010156"
FT                   /db_xref="UniProtKB/TrEMBL:B5YBH5"
FT                   /protein_id="ACI18721.1"
FT                   /translation="MRIKIVYETLDGKDIILPCHYNYAIQGLIYQTFSPEIAKWLHDVG
FT                   FLLGKRKFKLFTFSRILEKGKIIVKDNDNKYLNFGRKITFYFSSPIDDIVGNLGERSFR
FT                   EREFSIGKNKVYISQLEILLPPKIEEKVYIKMLSPLTIYSTFLKNGSRIVHFYRPYENE
FT                   FSKLIEENAKKKLKIVHQNSYDGGSLSIKPYKFSLEKNRKVVIFKNTPIEGWTGVFELS
FT                   GDPALIAITYEAGLGNKNSEGFGMWEIWREKEESKDAD"
FT   gene            170221..172185
FT                   /gene="csh1"
FT                   /locus_tag="DICTH_0159"
FT   CDS_pept        170221..172185
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="csh1"
FT                   /locus_tag="DICTH_0159"
FT                   /product="CRISPR-associated protein, Csh1 family"
FT                   /note="identified by match to protein family HMM TIGR02556;
FT                   match to protein family HMM TIGR02591"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19298"
FT                   /db_xref="InterPro:IPR013389"
FT                   /db_xref="InterPro:IPR013420"
FT                   /db_xref="UniProtKB/TrEMBL:B5YBH6"
FT                   /protein_id="ACI19298.1"
FT                   /translation="MLTNIKEIGKMVRTTSAEDFVSNLVEYDEDLMVDEKENRKFLVIM
FT                   DFDLESEKINLYRREVDRQVLEEYLWVGNAKGNNPQDRLTTNNVSYLICSAGAGNGSSI
FT                   VNLLNNLKGGTLKNLLEEVKNKFFMSLPLEKVRYCLDLSKIGNGEIIDIKPPESSDEKK
FT                   YLKDIENLWKKKFLEIIEEKLGLKEKEISLFTVTINGMKPSEFKDYKEYIENSLIEESF
FT                   EESFEGTCHVCGERSEITYDTTKFPVKFYITKLITFSSDFEGKGVKKGFSKNFSLCRDC
FT                   YKDIILGIKFIQNNLDTRLGNNDLWIIPGLFFNPLGKELKESWIRTSREFVKSTFNLQE
FT                   FLSFEERIQRNLDEYREFEEIADYGTVDLLFYERSKEAFKIKEYIKDVHLRRVEKIRNS
FT                   IREVENLGREIFGEGENWFLGLEDIYFLIPIRRGKVSEYKKMLDLYEDIFLEHRIDKDI
FT                   LIDYFVDLAKVYRFEKFSQYNIKMVKNTDMGMSLSILKTNLLLKLFEKLNLITGGDRMP
FT                   EFADDVLDKDLQEYISKMQYSEEEAALFLLGYLIGEIGYEQIRGADLSAKKPILNKINF
FT                   NGISAKNLINLANEVFEKLDQYKIRGYNEKTFSVMKSLMDKHIKSWKLSEQENVYYILS
FT                   GYAFNTYKRVKSVKGKEDQ"
FT   gene            172186..173139
FT                   /gene="csh2"
FT                   /locus_tag="DICTH_0160"
FT   CDS_pept        172186..173139
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="csh2"
FT                   /locus_tag="DICTH_0160"
FT                   /product="CRISPR-associated protein, Csh2 family"
FT                   /note="identified by match to protein family HMM PF05107;
FT                   match to protein family HMM TIGR01595; match to protein
FT                   family HMM TIGR02590"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19906"
FT                   /db_xref="GOA:B5YBH7"
FT                   /db_xref="InterPro:IPR006482"
FT                   /db_xref="InterPro:IPR013419"
FT                   /db_xref="UniProtKB/TrEMBL:B5YBH7"
FT                   /protein_id="ACI19906.1"
FT                   /translation="MGVYSKNSEILFLYDAKLTNPNGDPDDENKPRIDYEKEINLVSDV
FT                   RLKRYIRDYLESIGYEIFVAKVDGEIVDATERLRRFFEKENKKVNLNKLTKEDVDFILS
FT                   KLIDVRLFGATMPIKAGEEGKGASSNFTGPVQFTWGYSLNKVELVTSNSITSTFAGRDE
FT                   AGKGQYGTFGKDWRLYYSLIAFYGIVSGYRAKYTNLSEEDVALLDKALLEAIPQMASTR
FT                   SKIGQKPRLLLRIEYSKPYFLGDLRNKVKIDKEEGLRDITDYELDITNLKEVLEQNKDR
FT                   IDKVYVFQDPELRIKGGKLFDQLKEVLGNKVVELTV"
FT   gene            173156..173908
FT                   /gene="cas5h"
FT                   /locus_tag="DICTH_0161"
FT   CDS_pept        173156..173908
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cas5h"
FT                   /locus_tag="DICTH_0161"
FT                   /product="CRISPR-associated protein Cas5, Hmari subtype"
FT                   /note="identified by match to protein family HMM TIGR02592;
FT                   match to protein family HMM TIGR02593"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18906"
FT                   /db_xref="GOA:B5YBH8"
FT                   /db_xref="InterPro:IPR013421"
FT                   /db_xref="InterPro:IPR013422"
FT                   /db_xref="InterPro:IPR021124"
FT                   /db_xref="UniProtKB/TrEMBL:B5YBH8"
FT                   /protein_id="ACI18906.1"
FT                   /translation="MKVIVFDLLGKMAHFRKFYTNSSSLSYHFPPRTTIVGLIAGLLGY
FT                   ERDTYYEIFSTDKAKITIGVKSPLRKILQVVNYVWAENVKQLNQSRGQHTQIPLEIIFP
FT                   QDMKEDICYRIFFHHKDEKIMEDLKNKLVNFDFCFPPYLGITEFVGKVDFIGEGMAEIS
FT                   RADKVLIDSVVSVDYIKKNSLILEPQVGAQYVKEKMPLSFNKDRLLEDPPKEFIGEIKI
FT                   GKISLKGNVEYYKVEVRDLVQNVIFMED"
FT   gene            173910..176315
FT                   /gene="cas3_2"
FT                   /locus_tag="DICTH_0162"
FT   CDS_pept        173910..176315
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cas3_2"
FT                   /locus_tag="DICTH_0162"
FT                   /product="CRISPR-associated helicase Cas3"
FT                   /note="identified by match to protein family HMM PF00271;
FT                   match to protein family HMM TIGR01587"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18894"
FT                   /db_xref="GOA:B5YBH9"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR006474"
FT                   /db_xref="InterPro:IPR006483"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR035011"
FT                   /db_xref="InterPro:IPR038257"
FT                   /db_xref="UniProtKB/TrEMBL:B5YBH9"
FT                   /protein_id="ACI18894.1"
FT                   /translation="MDRFYSHLERRGEEVDLERSILLKNHLREVGLKTIEYFFFEGGDL
FT                   KNIGYYIGITHDFGKYTTYFQKRLFEIEHCGDLANHGFISSLYSAYLISRKLEEFKNVE
FT                   DIKEFLPLVAFFVVYHHHLDLSSLSKLKSNLESSDKKELILKQIEDMKSNSEIINRDLK
FT                   ELELPLLEEFERDLDDVINLLRKRIYQFENKLEEKIKEKIAIFCLVLFSALIDADKKSA
FT                   GKVRDVERRDIPEDIVEVYKRETFKDNSDEINLLREEIFQKVINKLKEIDISKNKIFTF
FT                   TSPTGSGKTLTGFAFAVKLRKRIEKEFGYTPRIIYSLPFISIINQNYDVLRNVLSKLPD
FT                   FEGNSSAYIISHHHLSKVEYEEGDELREVDESLALIESWESEVIVTTFVQLLHTIIGFK
FT                   NSFLKKYHNIARSIIILDEVQNIPAEYWKLTERIFKLMSQYLNCYIILMTATKPLIFSD
FT                   GDTLEILDNNEVYFEKLNRVVLYSNVKEQKGLDSLLSWFIDIYDPQKSYMIVLNTIKSS
FT                   IEFYRMLKEQLSLKEKSIYYLSANIIPKERLDRIHRIKQDLGNNKKPILVSTQVVEAGV
FT                   DLDFDVVIRDLGPLDSVVQVAGRCNRNFKKENGEIFVFFLKDDKGRSYANMVYQKLTPR
FT                   ITFELFSELESVKESEFIKIINKYFERLRFEKSQEESELIISALNNLRFYEGKEIISVS
FT                   SFELIKEKGIVYPVFIEVDEKAMETWSKFKSIISDDSIDRWEKKKLLLNIKSQLEEYIV
FT                   NVRVNKNEPWIFDIAFDQNIGYVANKDIPEYYDSETGFKKTELSSVIF"
FT   gene            176332..176826
FT                   /gene="cas4_2"
FT                   /locus_tag="DICTH_0163"
FT   CDS_pept        176332..176826
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cas4_2"
FT                   /locus_tag="DICTH_0163"
FT                   /product="CRISPR-associated protein Cas4"
FT                   /note="identified by match to protein family HMM PF01930;
FT                   match to protein family HMM TIGR00372"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19470"
FT                   /db_xref="GOA:B5YBI0"
FT                   /db_xref="InterPro:IPR011604"
FT                   /db_xref="InterPro:IPR013343"
FT                   /db_xref="InterPro:IPR022765"
FT                   /db_xref="UniProtKB/TrEMBL:B5YBI0"
FT                   /protein_id="ACI19470.1"
FT                   /translation="MSFINGTLIASYFICKRELWLMAHELIPDQENSFLEMGRFIEEEA
FT                   YRDEEKGFLIGEMKIDIVKQGDENIIIGEIKKSSRSELSGIMQLSYYLMRLREYGIVAK
FT                   GEVLIPKERKKIPVEINEEIEGRLIEAIKDINMIISEPYPPKPEKIKYCNHCAYKEFCW
FT                   A"
FT   gene            176823..177818
FT                   /gene="cas1_2"
FT                   /locus_tag="DICTH_0164"
FT   CDS_pept        176823..177818
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cas1_2"
FT                   /locus_tag="DICTH_0164"
FT                   /product="CRISPR-associated protein Cas1, HMARI/TNEAP
FT                   subtype"
FT                   /note="identified by match to protein family HMM PF01867;
FT                   match to protein family HMM TIGR00287; match to protein
FT                   family HMM TIGR03641"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18336"
FT                   /db_xref="GOA:B5YBI1"
FT                   /db_xref="InterPro:IPR002729"
FT                   /db_xref="InterPro:IPR019858"
FT                   /db_xref="InterPro:IPR042206"
FT                   /db_xref="InterPro:IPR042211"
FT                   /db_xref="UniProtKB/TrEMBL:B5YBI1"
FT                   /protein_id="ACI18336.1"
FT                   /translation="MSESIYIFSSGELKRKHNTVYFETSDGEQKYLPIENIRDIHFFGQ
FT                   VTLNKEFLEFVSQKNVILHFYNYYDYYVGSYYPREHYNSGYMILKQAEHYLDYEKRLLL
FT                   ARKFVVGAIENIKKVLGYYISRGKESLKEKLERIEFLEESAYAEDQVEGLMGIEGNVRD
FT                   IYYSCFNEITEREEFFIDERTKKPPSNNMNALISFGNSLLYTAVLSEIYKTHLDPRIGY
FT                   LHTTNFRRFTLNLDIAEIFKPVIVDRVIFSLVNKGAITPRDFEEKLGGIYLKEKGRKLF
FT                   VQNFEERMKVTIQYKNLGKVSYRRLIRLELYKLEKHLMGEEEYQPYISQW"
FT   gene            177820..178083
FT                   /gene="cas2_2"
FT                   /locus_tag="DICTH_0165"
FT   CDS_pept        177820..178083
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cas2_2"
FT                   /locus_tag="DICTH_0165"
FT                   /product="CRISPR-associated protein Cas2"
FT                   /note="identified by match to protein family HMM PF02647;
FT                   match to protein family HMM TIGR01573"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19268"
FT                   /db_xref="GOA:B5YBI2"
FT                   /db_xref="InterPro:IPR019199"
FT                   /db_xref="InterPro:IPR021127"
FT                   /db_xref="UniProtKB/TrEMBL:B5YBI2"
FT                   /protein_id="ACI19268.1"
FT                   /translation="MYVIMVYDVNQKRVAKVLNIARKYLEWIQNSVLEGELTEAKFERL
FT                   KREVELVIDEEEDSVIFYIMRTIKYSERQILGIEKNKREQIL"
FT   repeat_region   178488..182924
FT                   /rpt_family="CRISPR"
FT                   /note="DICTH_1994"
FT   gene            183109..183555
FT                   /locus_tag="DICTH_0166"
FT   CDS_pept        183109..183555
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0166"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ACI20076"
FT                   /db_xref="GOA:B5YBI3"
FT                   /db_xref="UniProtKB/TrEMBL:B5YBI3"
FT                   /protein_id="ACI20076.1"
FT                   /translation="MLIYLKNPYLSYIKDSKINILFHKSFPQSSKGFHLLTSSLTSDLL
FT                   PMIKKSKSSIGDYLTPLLFLLRMSYFFLNWNILLIFSLRVFFIFFLGRMSRISLVSSFS
FT                   LAAKKLIAFVGIDLAIKESWKYKKSLKFLKEKNRHLKLHKKLFD"
FT   gene            183824..184921
FT                   /locus_tag="DICTH_0167"
FT   CDS_pept        183824..184921
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0167"
FT                   /product="glutamate synthase domain 1"
FT                   /note="identified by match to protein family HMM PF00310"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18766"
FT                   /db_xref="InterPro:IPR012375"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:B5YBI4"
FT                   /protein_id="ACI18766.1"
FT                   /translation="MLREGEIRIPSACGLIGYINRKRKLISGYHIVSAMTVMRERGNGL
FT                   GAGFAGYGIYPDREDYYAFHLFYEDTKAKEETSKFLYEYFDVVQEEKIPTRKVKTIKNP
FT                   PIIWRYFLKPKEEYLAEEEILEEDFVVEKVMEINTKIDGAYVFSSGKNMGVFKGVGYPE
FT                   DIGEFYRLEEYKGYIWTAHTRFPTNTPGWWGGAHPFSLLDWSVVHNGEISSYGTNARYV
FT                   EMFGYKCTLRTDTEVITYIIDLLIRKHKLPWDIVAKILSAPFYSVIERMDEEEKKKMKA
FT                   MRAVYQSCLLNGPFAIIVGFSQGIVALNDRIKLRPLVAAEKGEVLYVASEEAAIREICS
FT                   NPDKVWMPKGGEPVIGLLEEVGVLV"
FT   gene            184918..186426
FT                   /locus_tag="DICTH_0168"
FT   CDS_pept        184918..186426
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0168"
FT                   /product="glutamate synthase"
FT                   /EC_number="1.4.1.13"
FT                   /note="identified by match to protein family HMM PF00037;
FT                   match to protein family HMM PF01645"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18462"
FT                   /db_xref="GOA:B5YBI5"
FT                   /db_xref="InterPro:IPR002932"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR024188"
FT                   /db_xref="UniProtKB/TrEMBL:B5YBI5"
FT                   /protein_id="ACI18462.1"
FT                   /translation="MKTLYESDFIVIRDETKCIRCKVCVRQCANDVHEYDEEEDRIISD
FT                   NSRCVGCHRCVALCPTKAITIMRNPLEFRENYQWNARAIKDIYKQAETGGILLTGMGND
FT                   KAYPIYWDKLLINASQVTNPSIDPLREPMEIKTFIGRKPEKLEFDEEGRLLTKMPPQLE
FT                   LEVPVMFSAMSFGSISLNACESLARAAVEVGTYWNTGEGGLHKKLYPYKHRAIVQCASG
FT                   RFGVDIEYLYSGAAIEIKIGQGAKPGIGGHLPGEKVGEEVSATRMIPIGTDALSPAPQH
FT                   DIYSIEDLRQLIFALKEAVNYEKPVGVKIAAVHNVAAIASGIARAGADFIAIDGFRGGT
FT                   GAAPTRIRDNVGIPIELALAAVDSRLREEGIRNQVSIIVAGSIRNSADVIKAIALGADA
FT                   VYIGTAALISLGCHLCQNCHTGKCNWGIATQDPKLVKRLNPEIGARRAANLLKAWAHEI
FT                   KEMLGGMGINAIESLRGNRLMLRGVGLTEKELSILGVKHAGEGM"
FT   gene            186430..186885
FT                   /locus_tag="DICTH_0169"
FT   CDS_pept        186430..186885
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0169"
FT                   /product="iron-sulfur cluster-binding protein"
FT                   /note="identified by match to protein family HMM PF00037"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19479"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:B5YBI6"
FT                   /protein_id="ACI19479.1"
FT                   /translation="MLVKTKKRIYPKEEVCIGCHLCEIYCVLAHSGTRDLIKAFKKKDR
FT                   PSPRVIVEEKEGVHVTFALQCRHCDDPLCIKACITGAMHRDENTGAILCDEEKCVGCWS
FT                   CILVCPYGAIRRGENKKVASKCDLCIEKGDPICVQNCPNSALELVEV"
FT   gene            186899..188152
FT                   /locus_tag="DICTH_0170"
FT   CDS_pept        186899..188152
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0170"
FT                   /product="NADH oxidase"
FT                   /note="identified by match to protein family HMM PF00070;
FT                   match to protein family HMM PF07992"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19197"
FT                   /db_xref="GOA:B5YBI7"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR041575"
FT                   /db_xref="UniProtKB/TrEMBL:B5YBI7"
FT                   /protein_id="ACI19197.1"
FT                   /translation="MKYVIIGNSIAAAGCIEGIRKIDNENEIIVISQEPYHIYSRPLIS
FT                   YWLSGKINEEKIYYRPWDYYEKYRVKPILGRKVERVDFDEKKLYLDNNDEIYYDKLLIA
FT                   TGGKPFIPNILGLAKKNVFTFIKFDDVKAIDKAICPGAKAVVVGGGLSGLKAAEALIKR
FT                   GCEVTVIELAERILGSILDDEGAKLVQNELEKYGIKFVLKNSVIEILGEERVEKIKLQT
FT                   QEEIPADLVIFSIGVVPNVDIFKDTPLKINRGIIVNTKMETNIPDVYAAGDVVEAFDLI
FT                   LGEKRVIPILPNAYIQGEVAGINMAGGDFEYEGSFPINSIGFFDIHMMTGGIVNPKEDC
FT                   EVLKRLERDRKIYRKICLKDGRILGFIFINSFDRTGMIVDLMKNKVDVSGFKERLLLDN
FT                   FGFLDLPKEVRREKIWRV"
FT   gene            188155..188913
FT                   /locus_tag="DICTH_0171"
FT   CDS_pept        188155..188913
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0171"
FT                   /product="glutamate synthase domain 3"
FT                   /note="identified by match to protein family HMM PF01493"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19302"
FT                   /db_xref="GOA:B5YBI8"
FT                   /db_xref="InterPro:IPR002489"
FT                   /db_xref="InterPro:IPR012061"
FT                   /db_xref="InterPro:IPR035710"
FT                   /db_xref="InterPro:IPR036485"
FT                   /db_xref="UniProtKB/TrEMBL:B5YBI8"
FT                   /protein_id="ACI19302.1"
FT                   /translation="MKMIEDMITIDGKGLHYRVLNEMIEEKLKEGYERIKLININGQRY
FT                   IGAGLTFPDREIEIYGTPGNDLGVFMNGLKIKVYGNSQDGVGNTMNDGEILIYGSSGDI
FT                   MGYGMRGGKIFVKGNVGYRVGIHMKEYKEKIPVIVIGGTAGDFLGEYMAGGRIIILGLN
FT                   EDKDENICGLFCATGIHGGVIYLRGRIPDYKLGKEGKLLEIDDNDRKFIEEHVKIFSEY
FT                   FNIEYDLIMKKDFFKVIPYDKRPYGRLYAY"
FT   gene            188942..190564
FT                   /locus_tag="DICTH_0172"
FT   CDS_pept        188942..190564
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0172"
FT                   /product="NH(3)-dependent NAD(+) synthetase"
FT                   /note="identified by match to protein family HMM PF00795;
FT                   match to protein family HMM PF02540; match to protein
FT                   family HMM PF03054; match to protein family HMM TIGR00552"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19093"
FT                   /db_xref="GOA:B5YBI9"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR003694"
FT                   /db_xref="InterPro:IPR014445"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR022310"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:B5YBI9"
FT                   /protein_id="ACI19093.1"
FT                   /translation="MKVAIAQINPTIGDLKGNLEKIISKIDRAKNLSADLIIFPELSII
FT                   GYPPRDLIYNMDLAKAIETSLKEKIAPRSYDIGIILGSPYYEDKNIYNSALFFYKGKLY
FT                   FRQDKTLLPNYDVFDEKRYFKPASNNIPIKFKNKLLGITICEDIWNDKDYWNRKIYEID
FT                   PLEKLASQGIDIIINISASPYYHGKISLRIDMLRHIARKYKKEIIYVNQVGGNDELIFD
FT                   GTSLVMNKDGSLAWIGKEFEEDFVVIDTNKLSRENITINEDISFIYKALVLGVRDYVIK
FT                   TGFKKALVALSGGIDSSVTACLAVAALGKENVLGIYMPSRYSSKESAIDAEMLAKNLGI
FT                   EYRVIPIEKIFSSFIETLNPNNRVFMDNAEENLQARIRGNIIMFISNREGYLVLSTGNK
FT                   SELAMGYCTLYGDMTGGLSVIGDLPKTLVYELARYINRDREIIPERVLRKPPSAELRPN
FT                   QKDEDSLPPYHVLDPIIKSYIEDNLTVEEIIKLGYNSELVENVVKKVDSMEYKRRQAPP
FT                   VLKVTSKAFGVGRRMPIAWRRNW"
FT   gene            complement(190646..191986)
FT                   /gene="glnA_1"
FT                   /locus_tag="DICTH_0173"
FT   CDS_pept        complement(190646..191986)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glnA_1"
FT                   /locus_tag="DICTH_0173"
FT                   /product="glutamine synthetase, type I"
FT                   /EC_number="6.3.1.2"
FT                   /note="identified by match to protein family HMM PF00120;
FT                   match to protein family HMM PF03951; match to protein
FT                   family HMM TIGR00653"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ACI20027"
FT                   /db_xref="GOA:B5YBJ0"
FT                   /db_xref="InterPro:IPR008146"
FT                   /db_xref="InterPro:IPR008147"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR027303"
FT                   /db_xref="InterPro:IPR036651"
FT                   /db_xref="UniProtKB/TrEMBL:B5YBJ0"
FT                   /protein_id="ACI20027.1"
FT                   /translation="MTGSFPKTKEEVLKYVKDNNVYFIEIWFTDILGYLKSFTITAHEL
FT                   EKAFEEGLGFDGSSVRGFTRIEESDMIAFPEPETFTILPWRPKDKKVARMFATILEPNG
FT                   KPFEGDPRNVLRRMLAKAKELGFTYYVGPELEYFYLKAPSSNPEVLDWGGYFDLIPRDE
FT                   AIDLRHQTVSILEEMGIEVEFTHHEVAPSQHEIDFRYKDALTMADIVMTARLAVKEVAY
FT                   LNGVYATFMPKPLFGQNGSGMHVHMSLFKNGKNAFFDPNDKYHLSDTAKHFIAGLLKHA
FT                   KEITLITNQWVNSYKRLVPGYEAPVYISWAMRNRSDLIRVPMYKPGKEEATRIEYRAPD
FT                   PACNPYLAFAVILAAGLEGIEKKYPLPEPIEENVYHMTEEERRKRGIESLPGSLIEAIE
FT                   ITEKSELVRKALGDHVFTNFIENKKIEWDNYRRQVTTYELETYLPVL"
FT   gene            complement(192219..192557)
FT                   /locus_tag="DICTH_0174"
FT   CDS_pept        complement(192219..192557)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0174"
FT                   /product="nitrogen regulatory protein P-II"
FT                   /note="identified by match to protein family HMM PF00543"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19685"
FT                   /db_xref="GOA:B5YBJ1"
FT                   /db_xref="InterPro:IPR002187"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="InterPro:IPR017918"
FT                   /db_xref="UniProtKB/TrEMBL:B5YBJ1"
FT                   /protein_id="ACI19685.1"
FT                   /translation="MKKIEAIIRPEKLDDVRKALNKIGYSGLMISEVEGHGKQKGIVQQ
FT                   WRGEKYRIELIPKIKIEMVVKDSEVENIIRVIIESARTGEIGDGKIFISEIADAIRIRT
FT                   GERGENAI"
FT   gene            complement(192554..193702)
FT                   /locus_tag="DICTH_0175"
FT   CDS_pept        complement(192554..193702)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0175"
FT                   /product="ammonium/methylammonium permease"
FT                   /note="identified by match to protein family HMM PF00909"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18335"
FT                   /db_xref="GOA:B5YBJ2"
FT                   /db_xref="InterPro:IPR001905"
FT                   /db_xref="InterPro:IPR018047"
FT                   /db_xref="InterPro:IPR024041"
FT                   /db_xref="InterPro:IPR029020"
FT                   /db_xref="UniProtKB/TrEMBL:B5YBJ2"
FT                   /protein_id="ACI18335.1"
FT                   /translation="MFGDGTPFVGLKGLFFLSGPDNSPATGEAYRGVYSSISWAGVPLL
FT                   AKFFFQLVFCGTAATIVSGAVAERIKYISFIIFSFIMSMFIYPIVGHWIWGGGFLSKLG
FT                   MLDFAGSTVVHSVGGWAALVGAILLGPRFGKYADDGSIKPIPGHNLSLATLGTFVLWLG
FT                   WFGFNPGSTMSADPQAISHIVITTNTAAASAILSSTITSWILLGKPDLGMTLNGCLAGL
FT                   VAITAPCAFVDIPSSIVIGLIAGFLVVVSVIFFDRIKIDDPVGALSVHLVNGVFGTLSV
FT                   GIFAKEGVTSFSTVNGLLFGGGLKLFLIQLIGVLSVGIFVLLTSLITWYILKSTIGIRV
FT                   SLQEEIEGLDIGEHGNSAYPEFLIRKPNISFISVVKPEEVRK"
FT   gene            193452..193943
FT                   /locus_tag="DICTH_0176"
FT   CDS_pept        193452..193943
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0176"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18758"
FT                   /db_xref="UniProtKB/TrEMBL:B5YBJ3"
FT                   /protein_id="ACI18758.1"
FT                   /translation="MDIIKENIIKEIYFILSATAPETIVAAVPQKTSWKKNFARRGTPA
FT                   QDMEEYTPLYASPVAGELSGPERKNNPFKPTKGVPSPNINPHPRMRYPKEDMAKTIKFL
FT                   ERIFTVFFTRANPDSTIAKPKFMKNTSIPVNKTQIVSRITLFSISFTSKFLDFGKVLNF
FT                   "
FT   gene            complement(194257..194520)
FT                   /locus_tag="DICTH_0177"
FT   CDS_pept        complement(194257..194520)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0177"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18304"
FT                   /db_xref="UniProtKB/TrEMBL:B5YBJ4"
FT                   /protein_id="ACI18304.1"
FT                   /translation="MGIVENSHRQDDEYFLGIHAERCKNVKEFLVKAQRWQDTWNITRP
FT                   SFGIGMDGKTPFCQSPGVLGLLEVARKMNFYFFSFLNCLYIR"
FT   gene            194819..196222
FT                   /locus_tag="DICTH_0178"
FT   CDS_pept        194819..196222
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0178"
FT                   /product="cell surface protein"
FT                   /note="identified by match to protein family HMM PF01011"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19442"
FT                   /db_xref="InterPro:IPR002372"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR018391"
FT                   /db_xref="InterPro:IPR025666"
FT                   /db_xref="UniProtKB/TrEMBL:B5YBJ5"
FT                   /protein_id="ACI19442.1"
FT                   /translation="MRSKRFYKFLVLILALFIIGGCTLKDKPPTVIIISPTNGSTVSGV
FT                   VEIIVEATDDRSILKVDFYIDGIIVGEDTQLPYKYSWDTAKVSDGEHSVLAKAYDNGGN
FT                   IGSASITVIVKNLVPGILKWYFETNGSIYSSPAIGKDGTIYINSNDRVIYAINPDGSLK
FT                   WKFETEYGPHSFISSPAIGEDGCIYTGSTDYYVYAITPYGSFKWKYKTENFVESSPAIG
FT                   LDGTIYVGGIDGYLYAINSEGKLRWRYYFGNPISSSPAIDWDGTIYVGCEDGYLYAIDS
FT                   DGFFKWKYEIYGKVSSSPAIGPDRTIYIGSEDGYLYAIDFNGTLKWKFNLNSRVKYSSP
FT                   IIDSEGTIYIGCEDGYLYAVNPDGSLKWKFQTDGYIWSTPAIGLDGMIYVGSSSGYLYA
FT                   INPDGTLSWRYYCSPYGLDSSPVIAPDGTIYVGSVDGYLYAITLTSKGLANSPWPKFRH
FT                   DNQNTGRVK"
FT   gene            196484..197593
FT                   /locus_tag="DICTH_0179"
FT   CDS_pept        196484..197593
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0179"
FT                   /product="cell surface protein"
FT                   /note="identified by match to protein family HMM PF01011"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18516"
FT                   /db_xref="InterPro:IPR002372"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR018391"
FT                   /db_xref="InterPro:IPR025666"
FT                   /db_xref="UniProtKB/TrEMBL:B5YBJ6"
FT                   /protein_id="ACI18516.1"
FT                   /translation="MNAKKYFKFLPLVLILLLFCGCAPDGKLKWIFETRYCVDSSPAIG
FT                   QDGTIYVGSMDHYLYAINPDGTLKWKFKTGGSVHSSPAIGQDGTIYVGSNDHYLYKISP
FT                   YGILKWKFKTGRAVLSSPAIGQDGTIYVGSMDHYLYAINPDGTLKWKFKTGGSVHSSPA
FT                   IGQDGTIYVGSDDHYLYAINPNGKLKWKFETGRPVHSSPAIGQDGTIYVGSMDHYLYAI
FT                   NPDGTLKWKFKTGGSVHSSPAIGQDGTIYVGSLDDYLYAINPDGKLKWKFETGSWVDSS
FT                   PAIGQDGTVYVGSGNHLYAINPDGTLKWKFETGYCVDSSPAIGQDGTIYVGSGSYDNYL
FT                   YAINSKSKGLANSPWPKFRHDNQNTGRVK"
FT   gene            197789..197965
FT                   /locus_tag="DICTH_0180"
FT   CDS_pept        197789..197965
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0180"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19581"
FT                   /db_xref="UniProtKB/TrEMBL:B5YBJ7"
FT                   /protein_id="ACI19581.1"
FT                   /translation="MKRDINIEVQGVYINGRPYPFLEKIVLKNRQKLVITFSNVLKDYM
FT                   IKEGKVSFVKIYW"
FT   gene            197974..198279
FT                   /gene="csx3"
FT                   /locus_tag="DICTH_0181"
FT   CDS_pept        197974..198279
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="csx3"
FT                   /locus_tag="DICTH_0181"
FT                   /product="CRISPR-associated protein, Csx3 family"
FT                   /note="identified by match to protein family HMM TIGR02579"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ACI20116"
FT                   /db_xref="InterPro:IPR013409"
FT                   /db_xref="UniProtKB/TrEMBL:B5YBJ8"
FT                   /protein_id="ACI20116.1"
FT                   /translation="MKEDVLFELEEKEKYTILSFRMEKNLVPSALYNLSPPNVNTRKGL
FT                   ILNGRGPIWLYAFLVHFYHPTPFLAVYDPRVGAVVIASHVPEFRPGDVLDIYLGEG"
FT   gene            198284..200716
FT                   /gene="csm1"
FT                   /locus_tag="DICTH_0182"
FT   CDS_pept        198284..200716
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="csm1"
FT                   /locus_tag="DICTH_0182"
FT                   /product="CRISPR-associated protein, Csm1 family"
FT                   /note="identified by match to protein family HMM TIGR02578"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19358"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR013408"
FT                   /db_xref="InterPro:IPR041062"
FT                   /db_xref="UniProtKB/TrEMBL:B5YBJ9"
FT                   /protein_id="ACI19358.1"
FT                   /translation="MDDVKILLSALFHDLGKVLERTKEYYTKELPERFAKVEYVHPKFS
FT                   AFLLETLGKEKSELSNFLKEHLTEEVIDLVLFHHSPQNDYGQIIQIADWLASSEREENQ
FT                   SQKEHYVNVVLSGPFKKVDENAKDIKYPLTTLENIFPSSGDVKASDESYKRLVNSLLKL
FT                   FPKVDNIDQLLTLFEFYLSQVPAQTTGYEPDISIYDHSRITAGLAHALYKDYKNNLLNK
FT                   NDLNKIKDLLRDRKKIDTAGEEIFNRKLFTFIVGDISGIQSFLFNVSSERAGRMLKGKS
FT                   VFIDLLSRYSAKFILDSTGFTRVNTLYLGGGNFELLLSYIPEDELTRLRNHIIETLWKF
FT                   VGDDLYLGIEWDYLSINDLLNFINKREEVMLKANQRKKKRYSTLENFYDLIFVPKSEDI
FT                   KEGEYCTICGKKKVEDASSQDRWCKTCKSFVELTGKLRDASFLIEERVNIPSKDPETWD
FT                   EFFEKLGYCIDFVNNFSRLGQTSKKIYQLEDVHIKDGFIPDGFLLGSFKIIESNFEEIA
FT                   ERNIVGDYGDKKLAYLKMDADNMGEIFKKLGDKEKKREGLALTRYGILSRRMELFFGKG
FT                   VLDLIKDKREKGYLYPVFVGGDDLFIIGTYNEINNLVREIREKYSEYTGSQEIFTISTG
FT                   MGYFPDNFPLIRGARIVEEFLEKAKNFVYPEEEKPKKNKICVDGEVLSYREYEEALDIA
FT                   NELTKRILENKEERQESEEGKSKGQTSRAVITKIERSIKGFNPLLEQSLNRKISPPAVW
FT                   RFMYYLRDYKDIGERLVNILLKNLLGEGEKIRNPRLILVATKIARMKTRKLEGGKSK"
FT   gene            200713..201168
FT                   /gene="csm2"
FT                   /locus_tag="DICTH_0183"
FT   CDS_pept        200713..201168
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="csm2"
FT                   /locus_tag="DICTH_0183"
FT                   /product="CRISPR-associated protein, Csm2 family"
FT                   /note="identified by match to protein family HMM TIGR01870"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18501"
FT                   /db_xref="InterPro:IPR010149"
FT                   /db_xref="UniProtKB/TrEMBL:B5YBK0"
FT                   /protein_id="ACI18501.1"
FT                   /translation="MNERNFPQKRKSSVNPEEGWRSEVEKFLGKDFVQRVLNFHDLEIE
FT                   EFKDFNNKIQKFVEDIANNITTSSLRKIYDLIKNSEDASDLVFKLPYMVYMVGKEKDAK
FT                   REALGKLYIALKDPIENIKDERQVRNIKKFAEALVAYQKLYGGKEER"
FT   gene            201168..201917
FT                   /gene="csm3"
FT                   /locus_tag="DICTH_0184"
FT   CDS_pept        201168..201917
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="csm3"
FT                   /locus_tag="DICTH_0184"
FT                   /product="CRISPR-associated RAMP protein, Csm3 family"
FT                   /note="identified by match to protein family HMM PF03787;
FT                   match to protein family HMM TIGR02582"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19681"
FT                   /db_xref="InterPro:IPR005537"
FT                   /db_xref="InterPro:IPR013412"
FT                   /db_xref="UniProtKB/TrEMBL:B5YBK1"
FT                   /protein_id="ACI19681.1"
FT                   /translation="MNKFIGRLFIEGDIRLLTGLHIGGSRETVEIGGLDNPVIKTIEGI
FT                   PYIPGSSLKGKIRCLLERARNINPKEGEPCGCGKCEVCLLFGSHNDKTKTLSRVIIRDS
FT                   FLDQEDFKNNFGKYFDRDIEYTEEKTENIIDRIAGTARYPRTMERVPAGAKFKFSSSIA
FT                   FYEGDDVEKLVKTFVEGMRMLEDDYLGGSGTRGYGHIKFENLSFYVKPYESYYKDNQRK
FT                   EIGKSVALTDKDIVEELVKELKEVLKK"
FT   gene            201935..202936
FT                   /gene="csm4"
FT                   /locus_tag="DICTH_0185"
FT   CDS_pept        201935..202936
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="csm4"
FT                   /locus_tag="DICTH_0185"
FT                   /product="CRISPR-associated RAMP protein, Csm4 family"
FT                   /note="identified by match to protein family HMM TIGR01903"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19650"
FT                   /db_xref="InterPro:IPR005510"
FT                   /db_xref="InterPro:IPR040932"
FT                   /db_xref="UniProtKB/TrEMBL:B5YBK2"
FT                   /protein_id="ACI19650.1"
FT                   /translation="MRVEIFKLFKEGPILLHIGLRRMDRTSTIVHSDTLFSALSNSLVK
FT                   LLGEEKFKTFEEKLIISSLFIGLRMPNFDILFVPMPDIFIKLPRDRSDQHKRYKKIQWI
FT                   SLKALGKILSFFDKENLSINLENLDDFSFLNSKFLVAKEEFEEIKEEIDFIGTILEPKV
FT                   SVNRESSVSENLFFQENLILWPIKTSDNVEIRPFLYFFKKEEPNLDSIFIPVLNLFIEE
FT                   GIGGERSTGKGTFDYYEKELTDLPDEGNLEITLSLTTPMREEVNNLIYYQIIKRDGFVF
FT                   YNAPKGFRKKVHYKVKEGALVKSPYIGENIDVSPVEELRVISYGKNLGYKFS"
FT   gene            202956..204032
FT                   /gene="csm5"
FT                   /locus_tag="DICTH_0186"
FT   CDS_pept        202956..204032
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="csm5"
FT                   /locus_tag="DICTH_0186"
FT                   /product="CRISPR-associated RAMP protein, Csm5 family"
FT                   /note="identified by match to protein family HMM PF03787;
FT                   match to protein family HMM TIGR01899"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18862"
FT                   /db_xref="InterPro:IPR005537"
FT                   /db_xref="InterPro:IPR010173"
FT                   /db_xref="UniProtKB/TrEMBL:B5YBK3"
FT                   /protein_id="ACI18862.1"
FT                   /translation="MKLNITTITPTIVRSGEEISTVSECIIEGDNLYIVNKDKLINFLK
FT                   TKKDNVKIIEELSKTVLEGQNLKGFLDKNNIPINEVCEPPLKLSERMDDYRRKSVYLPM
FT                   TSLKRAFIPGSTIKGILRSALLFHYYLSTKKEPPHRGDSKKDNSPYIGEDVLRNENKIS
FT                   TDIMKYVIVRDSSSINFEELRAYKIQRIPHRKLWQIIIAIPPQRKFSIEICIKKDKNYN
FT                   GPDFWKEFFEKDPEVKLWEYLKDYSNRLIDKELEILENLRRKNSGNENDGERKKIFDDF
FT                   IKHYKKVKEVMSQKDVIFIPIGFGKTYYFNSLGYFLGSNVPIRRKNVDLKFYPSTRWAV
FT                   EINEKYYPLGWCALTRSE"
FT   gene            204025..205308
FT                   /locus_tag="DICTH_0187"
FT   CDS_pept        204025..205308
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0187"
FT                   /product="CRISPR-associated DxTHG motif protein"
FT                   /note="identified by match to protein family HMM TIGR02549"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19511"
FT                   /db_xref="UniProtKB/TrEMBL:B5YBK4"
FT                   /protein_id="ACI19511.1"
FT                   /translation="MNKLIVGFVPKDSREFAYVVDSKKYKGYSTIEALASYFLQDSVNF
FT                   RILLLRPESLDESWEEDLKSRLISIGMKEENIVVCKFPTNGSYEGKRFITDPKIISDFI
FT                   FLALKENYKEEKEVILDVSRGLNFLVLSAVEAYRRFIVAIKAKNILNRGNIPNFKYVYL
FT                   TPLGEGGGLSEIRLEKIDAHFFFDYFKNYDRLPFDFETEKKEELCMKFNFIKKYITQIV
FT                   NTCIYTVKRGFVLAFLTIIDWKKVEEFLKEAEDKLNFLALMDLDSELSEWEKTSEGEEI
FT                   IKRKYAMNYPLGNLWIYINLLKAFLEIYYEYRDKIFIENDLKWVKIETLKDFNERIING
FT                   VFKEYGTNVILCNELEKFEFSFKRGEIRESKGGHSDILRNFNAHAGLILDFLEQDPKKG
FT                   AITYKKEIHNKINSFLREWQKEIETYKS"
FT   gene            205329..206357
FT                   /locus_tag="DICTH_0188"
FT   CDS_pept        205329..206357
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0188"
FT                   /product="alcohol dehydrogenase"
FT                   /EC_number="1.1.1.1"
FT                   /note="identified by match to protein family HMM PF08240;
FT                   match to protein family HMM TIGR02822"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18697"
FT                   /db_xref="GOA:B5YBK5"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR014187"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B5YBK5"
FT                   /protein_id="ACI18697.1"
FT                   /translation="MKAMLLREVKDLTVWQDPLSLEEVSIPIPKEKEILIKVSACGVCR
FT                   TDLDIVEGRLPPTKLPLILGHQIVGTVVDKGKDANKFQIGDRVGVAWINHSCGVCRFCR
FT                   SGQENLCDDFKATGKDVDGGYAEYTVVSEDYAYKIPQNYSDEEAAPLLCAGAIGYRSVK
FT                   LSNIKNGDNIGLSGFGASGHLVLKIIKYLYPDSKIFVFARSERERELAKELGSYWTGDF
FT                   GEVTPFKLNAIIDTTPVWKTIVLVLRNLEKGGRLVINAIRKENQDKDFLINLNYERDLW
FT                   MEKEIKSVANITRRDVEEFLTLAEKVDLKPVVEVYKLEEANKALRDLKEGRIRGAKVLK
FT                   MS"
FT   gene            206493..207716
FT                   /locus_tag="DICTH_0189"
FT   CDS_pept        206493..207716
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0189"
FT                   /product="sensory box protein"
FT                   /note="identified by match to protein family HMM PF01814;
FT                   match to protein family HMM PF04282; match to protein
FT                   family HMM PF08448; match to protein family HMM TIGR00229"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19569"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR007380"
FT                   /db_xref="InterPro:IPR012312"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:B5YBK6"
FT                   /protein_id="ACI19569.1"
FT                   /translation="MSELFGFRKDRKEMLKELIRKIHKGEDPEKLKAQFRELFGSVTTT
FT                   EIAQIEQELIQEGMPREEVMRLCEVHLAVFQEALDKDKPSAQLGHPVNILMEEHKKLIE
FT                   FSDKLKKAIEELREIGDYDRGKDKILEIKEITDHFKESEKHYLREENVLFPYLEKHGIT
FT                   EPPAIMWMDHDKIRAIKKDLYKIVDNYNSMSFDEFIRRIGVVAIELGDMLASHFYKENN
FT                   ILFPMGLHVISEEEWKDIRLQFDEIGYCCFTPPDVITPIEVEKKEVSSVQQGMVNLPTG
FT                   SLSLIELEAILNTLPVDITFVDKNDEVRYFSETKDRIFVRTKAVIGRKVQQCHPQKSVH
FT                   IVEKILEEFKKGTKDHAEFWINMNGRLIYIRYFAVRDREGNYLGTLEVTQDVTEIKKLE
FT                   GERRLLDW"
FT   gene            207872..208321
FT                   /locus_tag="DICTH_0190"
FT   CDS_pept        207872..208321
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0190"
FT                   /product="hypothetical acetyltransferase"
FT                   /EC_number="2.3.1.-"
FT                   /note="identified by match to protein family HMM PF00583"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18603"
FT                   /db_xref="GOA:B5YBK7"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR017255"
FT                   /db_xref="UniProtKB/TrEMBL:B5YBK7"
FT                   /protein_id="ACI18603.1"
FT                   /translation="MEKVLIRAVNKKDIDSIYNLLKELYETIEDKSGLDIDRAYENLQF
FT                   FISNDNNLTFVAEWEGNIVGFISVFIRKTILHTLPSALIEELVVDKNYRGKGIGKRLIE
FT                   AVIKKCEELNIGEIEVSTEITNINAREFYKSIGFKEKGILLEMDL"
FT   gene            208467..209288
FT                   /locus_tag="DICTH_0191"
FT   CDS_pept        208467..209288
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0191"
FT                   /product="pyrroline-5-carboxylate reductase"
FT                   /note="identified by match to protein family HMM PF03446;
FT                   match to protein family HMM PF03807"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18953"
FT                   /db_xref="GOA:B5YBK8"
FT                   /db_xref="InterPro:IPR000304"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR028939"
FT                   /db_xref="InterPro:IPR029036"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B5YBK8"
FT                   /protein_id="ACI18953.1"
FT                   /translation="MVGFIGYGNMGSMLIRKFIEEKALKPQEIIVSTRTKSKLQNLKEI
FT                   YKDINIAEDNKDLAKRAKYIFICVKQPEVKGVLDEIKDFLDSDRHIISLAGAITIENIE
FT                   KIFPGQVSKVTPTVLSEINEGVTLIAHNEKVKEENKKYIESLFEKISKVKRITEEDFPF
FT                   AVEITSCAPGFLSSIFNEFMKSSLKHNKTLREDEVKDMLVYTIYSTAKLIYERNLAFED
FT                   VIEKVATKGGITEEGVKVLEKHLTPIFDEVFEKTLEKRRMIKEKADELFKS"
FT   gene            complement(209586..209753)
FT                   /locus_tag="DICTH_0192"
FT   CDS_pept        complement(209586..209753)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0192"
FT                   /product="nucleotidyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19811"
FT                   /db_xref="GOA:B5YBK9"
FT                   /db_xref="UniProtKB/TrEMBL:B5YBK9"
FT                   /protein_id="ACI19811.1"
FT                   /translation="MNEAPISLKGRILENKIVIVDRDPSFRYSFESITLREFLDFSIKE
FT                   KQILFRRYKV"
FT   gene            210149..210787
FT                   /locus_tag="DICTH_0193"
FT   CDS_pept        210149..210787
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0193"
FT                   /product="methyltransferase, putative"
FT                   /note="identified by match to protein family HMM PF03848;
FT                   match to protein family HMM PF08241; match to protein
FT                   family HMM PF08242"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19161"
FT                   /db_xref="GOA:B5YBL0"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:B5YBL0"
FT                   /protein_id="ACI19161.1"
FT                   /translation="MKHQGWDWKEIKEERWDTPAEEVYYLLNRWKDQGKSRFLDLGCGR
FT                   GRHSIFFAKHGFEVYATDISESGIEILKEKAKLQNLNINAEVCDMHNLPYSNEFFDCML
FT                   AFHVIYHTNREGIRRVISEIYRVLKKDGECFLTFNSKFSKSFNNPNNILLEDGTVIKKE
FT                   GIEAGIPHYYVDKEEVLELMNNFEIISFKYVEEILPKRSNKFFVLATKK"
FT   gene            complement(211143..212570)
FT                   /locus_tag="DICTH_0194"
FT   CDS_pept        complement(211143..212570)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0194"
FT                   /product="cell surface protein"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ACI20040"
FT                   /db_xref="InterPro:IPR002372"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR018391"
FT                   /db_xref="InterPro:IPR025666"
FT                   /db_xref="UniProtKB/TrEMBL:B5YBL1"
FT                   /protein_id="ACI20040.1"
FT                   /translation="MKGISRIFLITLILTLFIGGCVTKKNPQISILNPKNEDIVSGTVN
FT                   IEVQVTVDEKNSISSVEFYVDDTKIGTKTQAPYTCSWNTEGFETGNHTITVKAYDNKGN
FT                   TSSASINVGKNAFLKWIIGTGYIYACPAIGDDGTIYVIGSKLYAINPDGSIKWGKSLEN
FT                   EYFNVQCSPVIGNDGTIYVVSSGDNAQLYAVNPGDGSTKWSTLISKLNNHIGNISLTLD
FT                   SKGNIYLGNAAGYLYSLDSNGNIRWTYTCGQGITSYPVVDKDDNIYTFCKNTGSGGVFY
FT                   SINSDGNYRWSYSFPINEWCTAPPSIDSEGNIYLPISSGTYGKIYKYDKEGTLQWTTQV
FT                   SGNIYYSPIFDNSGYLYVCDESKNIYKISTNNGSIVESTNIGYHSSLVISKEGIIYAIG
FT                   IDSSKYVIRAIDASDLSIKWNYTAPQTYYTTLSNDGILYFGTLGSELFAIKVDSTGLMD
FT                   SPWPKYRKDLKNTGKAD"
FT   gene            212776..213795
FT                   /locus_tag="DICTH_0195"
FT   CDS_pept        212776..213795
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0195"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18518"
FT                   /db_xref="InterPro:IPR007562"
FT                   /db_xref="UniProtKB/TrEMBL:B5YBL2"
FT                   /protein_id="ACI18518.1"
FT                   /translation="MKKRFFLILLSVLLLTSPIISEAKYIKEEDLWRYNLEKAILFALN
FT                   PQNLSSISNLAIKLKGSDIKESAWNILKWEEENIEYDIEKAELPPSLIRIYSTGRIEVV
FT                   QGEENVFQLPSETISKGKGICGDYALLTAGLLLKMDYQPVYILDIEFENDPIKHVVTGI
FT                   IVNGWLFILDQHPPVMDAGTFYKYWLKHEGKIIKDITLYEISYEEDIVVKKYGVDKEVF
FT                   MGLDYDFSTRDLEAIGGYLMLKIKDNFKNLVIDPQIASLDKLVYLPRGYTQGKIYSFQF
FT                   PEFLDYYNPIFHFQFIDYLYGEILDDKNILENMKNFKYFFVRADALQEDLVIILNLAK"
FT   gene            214043..214222
FT                   /locus_tag="DICTH_0196"
FT   CDS_pept        214043..214222
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0196"
FT                   /product="prepilin-type N-terminal cleavage/methylation
FT                   domain protein"
FT                   /note="identified by match to protein family HMM PF07963;
FT                   match to protein family HMM TIGR02532"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19351"
FT                   /db_xref="GOA:B5YBL3"
FT                   /db_xref="InterPro:IPR000983"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:B5YBL3"
FT                   /protein_id="ACI19351.1"
FT                   /translation="MSKRGFSLIELLVVIGILGVLVAVGIFMYFEAVRQAKRTVHFYNI
FT                   KLIKEALEIYYLKK"
FT   gene            214503..215621
FT                   /locus_tag="DICTH_0197"
FT   CDS_pept        214503..215621
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0197"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18975"
FT                   /db_xref="GOA:B5YBL4"
FT                   /db_xref="UniProtKB/TrEMBL:B5YBL4"
FT                   /protein_id="ACI18975.1"
FT                   /translation="MDFYGAKDFILTILDTYPKEYGKIVESNNTQDERLIIIIKQNPKN
FT                   IKVYFSILPILKYLINMCPIGLIAIEGGVEGKFPAELNSLLFKTIPDNKVKRLIVEKFF
FT                   RRGLLTPAEYLHILDDIPFVLYGPEEASSYLEGLELFFVYNDITYYMEKSMKEDWTPLG
FT                   LFKKYKNAKNFEKRFYHEVLKVLYGEFWYLKELGFLRAKYYSLTEARDKIVVDTNSFHQ
FT                   VVTLVVIWLIVIFLTDLFYKNIEIMFKTRNKEKVKFIRIDISKLDSYYYKLEEIDVGLE
FT                   TLGEIFYDLKNMIPFREYDKLLELVEALIKFPDFSKVRSIKIVKNLLEKMEELKVDSSI
FT                   FICTPYFSDYVKKRLKEYNISYVVIEPEYVDI"
FT   gene            215659..216813
FT                   /locus_tag="DICTH_0198"
FT   CDS_pept        215659..216813
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0198"
FT                   /product="O-Antigen Polymerase family"
FT                   /note="identified by match to protein family HMM PF04932"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ACI20096"
FT                   /db_xref="GOA:B5YBL5"
FT                   /db_xref="InterPro:IPR007016"
FT                   /db_xref="UniProtKB/TrEMBL:B5YBL5"
FT                   /protein_id="ACI20096.1"
FT                   /translation="MLIEKLGTVLSSFSYFFQIPFALYLTSKVKNFWEKFFEDRQDKII
FT                   LGLLFISGIISSLLSVKKLEAFLASLIPFVFVWFYVLGKHSIKLNIKSILYYILIGSSM
FT                   LGFVLVFSKLLDLSWYIGSFAIFDGKVPRGLVMGVKAQGLALLLEFGILAGLGLLIIEK
FT                   DKKSIFKILFLLIFCIIGFMIAETRGGILGLIFGFLTILFSEKSFREIKKRLGFVLIIL
FT                   LLLLVLFFTVFNQFSQRLSVALEKGRVGSIYERVYIYLGTLRMIKDHLLFGVGPGCFVY
FT                   VYPEYALKDFPYIPEELKEELANAVTTHNIYLYFLSGWGIMGTFLFFWWLFRKIYKGMK
FT                   YEYSFEKHLILAILMVYFGHIILDDLFSIHIPLLIGILNRKGIK"
FT   gene            217232..217588
FT                   /locus_tag="DICTH_0199"
FT   CDS_pept        217232..217588
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0199"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18816"
FT                   /db_xref="UniProtKB/TrEMBL:B5YBL6"
FT                   /protein_id="ACI18816.1"
FT                   /translation="MGVYKFSEIDPIKASLEIVSAEIKTDTNQLITAFGQACAYKLFSH
FT                   KVYLVIPNAEQDVGRIESLCLIFGIGLVLFDPQNPENPKFTIRTRAVKSEPDYYYLNRY
FT                   IRSLNQEDIKKLLG"
FT   gene            217934..219004
FT                   /locus_tag="DICTH_0200"
FT   CDS_pept        217934..219004
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0200"
FT                   /product="lipoprotein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19880"
FT                   /db_xref="InterPro:IPR010496"
FT                   /db_xref="UniProtKB/TrEMBL:B5YBL7"
FT                   /protein_id="ACI19880.1"
FT                   /translation="MRPNKTTKILILILLIILIAGCTPREIVSVGLEIAKEQVREEAKI
FT                   REEIRNRYQKAIEIEPEEEIERELHEFLRPIFNSIFGEAKLIDITYTDLPAFGIKAFVP
FT                   LLTYILPRLVSEDDITKIKASIEDKGYIAKKYESIEGSILLVFGRNGDPLFGVSTTINA
FT                   QEILAGGSLSKTYIELLFFDDFEDYGLGQEAPFGYWKKKGGGRIEQVVEKNKKLGKVLS
FT                   FKSLGEKFGVYIDKMWENYFLQFEAKGEDVFAYFKVTKTADAGYYLYSGWMSDIKVVKF
FT                   SGKDEQVIASVKRTFDYKEWSVFLIKLVGSKISIYVNGVKMIDIVDDDPLLRVGGIGFG
FT                   GEDWAYVNNVRVFKVK"
FT   gene            219213..219710
FT                   /locus_tag="DICTH_0201"
FT   CDS_pept        219213..219710
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0201"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19524"
FT                   /db_xref="UniProtKB/TrEMBL:B5YBL8"
FT                   /protein_id="ACI19524.1"
FT                   /translation="MKRLIKFLIVILFLTIIVFASTFKNKDYTGSNFPYKGALFLHDGD
FT                   YVIFECAEGYNGFYYMTRKGETPVEVIDNNTGKQIGYLFLQENYYTTGESFDYAGFKWV
FT                   DLQQGFKGKILKIVLRENRKIYNKTYGDRDLLIKFKSGTKIIYWHGVDLTDWCDLDYVA
FT                   YY"
FT   gene            219828..219947
FT                   /locus_tag="DICTH_0202"
FT   CDS_pept        219828..219947
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0202"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18769"
FT                   /db_xref="UniProtKB/TrEMBL:B5YBL9"
FT                   /protein_id="ACI18769.1"
FT                   /translation="MQLYSVRKECEKDFDYNKLKILRGEDFLPPCAVPFLFLI"
FT   gene            complement(220202..220816)
FT                   /locus_tag="DICTH_0203"
FT   CDS_pept        complement(220202..220816)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0203"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19226"
FT                   /db_xref="UniProtKB/TrEMBL:B5YBM0"
FT                   /protein_id="ACI19226.1"
FT                   /translation="MSKKFYIIGLRGKTLVCFLLVFLLLGTIVWGNAEEVKTIMLNGKV
FT                   YNLIPLSQIPTGKKVIWVNSIEEAERILSAISNIKVTYKKDPQKKILTYDLSSRTGYGS
FT                   LYDSAEYVGNIGPLQYGGSVVLVGSFTYNYDTRKVISVRANVVASSGIFTEVSTSCSYG
FT                   TVGSNTAWARGQANFRVYIAIQGVGITIGTFSLSVSDSVSL"
FT   gene            complement(221034..221840)
FT                   /locus_tag="DICTH_0204"
FT   CDS_pept        complement(221034..221840)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0204"
FT                   /product="ABC transporter permease protein"
FT                   /note="identified by match to protein family HMM PF06182"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18492"
FT                   /db_xref="GOA:B5YBM1"
FT                   /db_xref="InterPro:IPR010390"
FT                   /db_xref="UniProtKB/TrEMBL:B5YBM1"
FT                   /protein_id="ACI18492.1"
FT                   /translation="MGAKSRLKYYIKVYFWFIAQDIKGRMQYRVDFFISTIGMVITNLL
FT                   GLLSIYVIFKSIPNILGWSYYEILFIYGFSLLALSPLQLFFDNLWNLPSYLISGDFIKY
FT                   YLKPLNIFFFYFAEVFDMKGLSQLIIGIITLSHAWVKLNLEFNLLKFIILIISLISSSL
FT                   VMISLMVIGSAIAFWVLNVTPLLNFIFRLREYTRYPTDIFDSFFKFIFSFVIPIAFVAF
FT                   YPSQIFLRPQNSNILVFISPFVGIFLFIIAYKLWIRGTRRYKGTGV"
FT   gene            complement(221830..222624)
FT                   /locus_tag="DICTH_0205"
FT   CDS_pept        complement(221830..222624)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0205"
FT                   /product="membrane protein, putative"
FT                   /note="identified by match to protein family HMM PF06182"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18307"
FT                   /db_xref="GOA:B5YBM2"
FT                   /db_xref="InterPro:IPR010390"
FT                   /db_xref="UniProtKB/TrEMBL:B5YBM2"
FT                   /protein_id="ACI18307.1"
FT                   /translation="MKKYIYIAKGFLLERMVYRFSLFFNALEKYIYILLIFFLWKAIYK
FT                   SLGQENLSMNFESTFTYLSLATAIFGLFQTWVDWDISQLMISGNLSIILTKPLDFQIYM
FT                   FFKRITWVILNLLTITLPVLVLLKFILRMPINMGINFLFFVISVIISYLIYFNIDFIVG
FT                   VTAFFTESIWGLSVTKDSIILFLSGGIIPIPLFPENLRKILEILPFKTIYHMPIEILIN
FT                   KSLTIFDYLNSLAIQIFWLFVFLTLSRIYYKLTERFIKINGG"
FT   gene            complement(222621..223646)
FT                   /locus_tag="DICTH_0206"
FT   CDS_pept        complement(222621..223646)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0206"
FT                   /product="ABC transporter ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19338"
FT                   /db_xref="GOA:B5YBM3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B5YBM3"
FT                   /protein_id="ACI19338.1"
FT                   /translation="MVDSVIKVSNLRKYFKVLNRREGFWGTVKDLFSQDYFYVKAVDGI
FT                   SMEIKEGEIVGFLGPNGAGKSTTIKIMTGVLEPDGGEVLINNVIPYKDRIKNAKNIGVV
FT                   FGQRTQLWWSLPLIESFKILKEIYEIDERTFKENLELFEEIIGIEALYRKPVRQMSLGQ
FT                   RVLCDILASFLHNPKVVFLDEPTIGLDILIKDKVRKLIKELNRRKNTTILLATHDMNDV
FT                   EALCPRIIVIDKGKIIYDGLLEDLKEKFKMYRKAKIRVGDNVDEEEINKIKVLLLEKFN
FT                   DVISDCAIKSYWLDISFKKQDVNLLEILRFITNFIPIEDIHTEDIQTEEVIKLIYEESR
FT                   K"
FT   gene            complement(223640..224725)
FT                   /locus_tag="DICTH_0207"
FT   CDS_pept        complement(223640..224725)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0207"
FT                   /product="glycosyltransferase"
FT                   /note="identified by match to protein family HMM PF00535"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19210"
FT                   /db_xref="GOA:B5YBY2"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:B5YBY2"
FT                   /protein_id="ACI19210.1"
FT                   /translation="MQPEVSIIIPTYNREKLLPRAIESVRRQTYENWELLIVDDRSSDN
FT                   TESLVKKYLSIDNRIRYLKNERKKGPAGARNFGILNSKGKYIAFLDSDDEWSELHLEES
FT                   IDVLENYDVKVSFALWITVKEDGEVRRVFDSEIPEERARLKRIISIFNPKIEGKYIFFG
FT                   DNFYEESFLKGGSYCTHINTLVIERDVIEKIGLFNEDLLVCEDSDFVYRVILDYSFCLI
FT                   DNYHLYYYQGPDNIYNFFDRRDVKIDDVLENRRFIEKFTFVGLGQIKLNSIHKKLIKSS
FT                   QKIVRKRECINRIKDIIGRKYFTLGFMNHKINKFKAILFVFKSLFYKFNFTRLLFLIKL
FT                   LFPFIPIKLEEEKIRKDLSLW"
FT   gene            complement(224715..225914)
FT                   /locus_tag="DICTH_0208"
FT   CDS_pept        complement(224715..225914)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0208"
FT                   /product="glycosyltransferases involved in cell wall
FT                   biogenesis, putative"
FT                   /note="identified by match to protein family HMM PF00515;
FT                   match to protein family HMM PF00535; match to protein
FT                   family HMM PF07719"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18619"
FT                   /db_xref="GOA:B5YBY3"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:B5YBY3"
FT                   /protein_id="ACI18619.1"
FT                   /translation="MTSKVGITACILAKNEEKVISNCLKSIVNYVDEIILVDNGSNDKT
FT                   VEIAKDFGSKIINAESFTFDSARNLYIEAASYPWIFVIDADEVITPEGGLELRKLVREV
FT                   SDNIMAFYLPHLNYFGEGKWANFLMCRLFRKHPQIKYNDRPIHASVVPSIKALNGAFAR
FT                   GSVLLHHFDLLYCEEKSLSKRFRNINLLESEIAKNPQDHNLHYYLGLEYWALDRLDEAE
FT                   REFKLAISLDHNRSPLAQFFLAQLYLSMNEIEKSETIVENLLSFDIGIKDKIYTLLAEI
FT                   SLKRQELDKALSFTKEALLYDPMSPNLNLNFASLLERFDPISAIRHLQIALKYNPFLLN
FT                   SIIYKEIKVANIYKIQKSGTFLSSTKTIFDHMINCWERIGDYEKAQEWRKKKINITYAT
FT                   "
FT   gene            complement(225904..227094)
FT                   /locus_tag="DICTH_0209"
FT   CDS_pept        complement(225904..227094)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0209"
FT                   /product="RIO1 family"
FT                   /note="identified by match to protein family HMM PF01163"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19632"
FT                   /db_xref="GOA:B5YBY4"
FT                   /db_xref="InterPro:IPR008266"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:B5YBY4"
FT                   /protein_id="ACI19632.1"
FT                   /translation="MWDSSIFIEKIRTKRSIIYFSTDGFYTAKQYLDYSYQISHTDIGT
FT                   YTSISNFLKNYRLLIQFKIYNIPRIYGFSLSNKIIIMENIKARVLSEIHNPTSYLGIIL
FT                   ETLYSWDRAKLLHGDLSRNNILIDEKNCYIIDLDNICFLGNKYNIGLLSNILDFERKSL
FT                   TKYLFTDNQLTKEEKINLLKHYCEIVSVILSRNWYKFNAASEVIELAKWYKEISNSKFL
FT                   VEMFYKNLLCTYGILKAIYVSGIKRSELQLYEAEIICKLLKLLREDKDILNNLHFNLVI
FT                   NFSPWNTVKDLNTAKLICPLSFIGTRSLLLIIFYGKLYRYLMKFLSLIDKKTWKSYYKA
FT                   FIIDMNNFSDLLSQYNINDIMLVINYNNYSINEFLKKWAKLLFENSKMGIFLKDDF"
FT   gene            complement(227141..228337)
FT                   /locus_tag="DICTH_0210"
FT   CDS_pept        complement(227141..228337)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0210"
FT                   /product="glycosyl transferase, group 1"
FT                   /note="identified by match to protein family HMM PF00534"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18893"
FT                   /db_xref="GOA:B5YBY5"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="UniProtKB/TrEMBL:B5YBY5"
FT                   /protein_id="ACI18893.1"
FT                   /translation="MSRSNLEITIIVSPSLPVPPFKGYGGTQRGVWELIKYLREDYKIR
FT                   LFAPGSSSVEVDTLMTNIPFGLWEEGINLSKEERAILQKSYDRFVIDSLNSNPPQLINI
FT                   HYDSPFIIRQILQRFNCPIIYSPHNQINTEIRLILEDLIAGRIKREAPFIIIALSLSHY
FT                   HEIIKGIPMNFNKNKYIKIIPIYYGCDVEDFPFSPFVLTDSPEEPSIKILKSLKRKNIN
FT                   YFITIGRICKIKGQLTAIKLIKEIKGCLIIAGSVFEREKEQEMDYYKKVLEQCDGKDII
FT                   YYGTANEDEKRELMKYAVASLYFGGSEDPYWREPFGRVLVESLAVGTPVIAWNQGAITE
FT                   VIIDGLVGFVVKTFDECILKINHVKSIDRYLCRMYVDKIFSSRRVAREYKSLIKDVLV"
FT   gene            complement(228334..228972)
FT                   /locus_tag="DICTH_0211"
FT   CDS_pept        complement(228334..228972)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0211"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19691"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:B5YBY6"
FT                   /protein_id="ACI19691.1"
FT                   /translation="MKEKGIVIVTAGSYDILHRGHRDVLKQVWNLAQAFGNSFFHTLVW
FT                   SVNPSKVYLLTPKERVYIIKNFYISEGIKSNIHIFPVLYEEHDPEADKYFKELIGLSRY
FT                   DSNLLFITGIKEEDVKSFQVKLNKFHRNSGIESAKIVFVVSGWVNPIFNSSSKIKEFLY
FT                   KHAFSHKAYLEAIEFLLKEDIIDTYTANILINCRIRLLNMREFKNKRSL"
FT   gene            229208..230731
FT                   /locus_tag="DICTH_0212"
FT   CDS_pept        229208..230731
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0212"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19100"
FT                   /db_xref="UniProtKB/TrEMBL:B5YBY7"
FT                   /protein_id="ACI19100.1"
FT                   /translation="MPKEISYINRIISAYGSYAKPFLNWILETGRISSAWKTYFLALKL
FT                   YWKGEYFLALSKLEKALNKCNNSKTLYYLVLTQKLAFLSRVNSKEGVELFHKLKQEFPY
FT                   IPSYVRNIAVSSLLHYYATIFPSNLPKFRIWSNSYHLDSSSQVFIFLGKAREEIKKENI
FT                   RKAIFYYVKAFRTSLSIPHPTGIINSLNNLSWNLKERHPKFSLSLAKKAVYYCALYRED
FT                   LSYDFAVLDTLFEVQRINNDLSICETSMIIKHYYKFLSDSSGNYNKQHYRKTFESSKRF
FT                   CFDLEPSFYKNNGELRDLNKVSNIKPDFNNLPLEVLIELRRINILKNFQRTIEKLNNVS
FT                   KDARENLILSSFMSLCDRKSLFPSTYKKIKNILDFSENIKRLINFAKRDFEVIRFLSYI
FT                   SNDHPFFEARMDLAKKFLETLLPEKREFFISFYLSLKEKEKELIDAFVRNYVRYDRDWH
FT                   IKIPTPAEIVSFVKGFQLKELPSSLAYFCFERRERRNFNKIINEMMVNA"
FT   gene            complement(231197..232906)
FT                   /locus_tag="DICTH_0213"
FT   CDS_pept        complement(231197..232906)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0213"
FT                   /product="ABC-type transport system,membrane ATPase
FT                   component, putative"
FT                   /note="identified by match to protein family HMM PF00005;
FT                   match to protein family HMM PF00664"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19979"
FT                   /db_xref="GOA:B5YBY8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:B5YBY8"
FT                   /protein_id="ACI19979.1"
FT                   /translation="MKEDFDFLIPKKEDISFSKLKILLPYFKIHLGNFIIASIFLIISS
FT                   FITIPVPYLTKIVIDKVLLGSKNAKLLVNLVIIMAILHIARSVFSGITQYLFTKLNQEI
FT                   IATLKSELFKKILKLPFSFYDQAQTGYLLSRIGEIEGLGFFFSSTLVSQLIRLGEFIFA
FT                   LFMLFYLNWKLTLIALSILPFYYLGLKPLSQRITYITKDLLESSAKLMGKVEERISGAE
FT                   VIKLFATEEREAMEIEKGFKEISRKNILQSIIFTLFSEFNITLIALGGLLILWRGGLDI
FT                   INGSFTLGSYIAFTSYVQRLYGPIQSLATFNFTIYPALVSLKRVTEIMEMAKEEEGEIT
FT                   INKLREGISFVNVSFSYDGKNKVLENINLDIKVGEKVAIVGPNGSGKTTLIRLLLRMYK
FT                   PLEGKIFIDGIDLDKIKLSSLREKIGIVSQNIFLFNDTVRNNISYANPNISDNEINNLL
FT                   KEIDLYHFFMEGFPNGLDTIIGERGVRISGGQKKVIAFLRAILKNPEILILDEATSEID
FT                   TRVEEKIFKFIKEKMKDTTCVIITPKDLPKETFINKIVYLENGKIVNIVTMI"
FT   gene            complement(232909..233661)
FT                   /locus_tag="DICTH_0214"
FT   CDS_pept        complement(232909..233661)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0214"
FT                   /product="membrane protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19354"
FT                   /db_xref="GOA:B5YBY9"
FT                   /db_xref="UniProtKB/TrEMBL:B5YBY9"
FT                   /protein_id="ACI19354.1"
FT                   /translation="MLGILYKEMKQFRKFLYISLFYSIFFLFVFNTTIVKGEDNLFRIP
FT                   HIVREMANSPNTKIFFSNFVSKLINYIPIGTMIFVGTFHITLLFITEYYTKNIIPLLST
FT                   PLTLVDFWLGKVIYVSLAIYVMSLSSLFGLLLYLILLGVSVRITLQNVFHIIVVAPIIN
FT                   FGILSFIGCLSLLFVDKLIPTRILITYAYSILFIAFFYFMEPDKLERIHFLLKPNLIFI
FT                   LAGLVLFIISYYLVKNTSIEKILQKGSS"
FT   gene            complement(233662..234591)
FT                   /locus_tag="DICTH_0215"
FT   CDS_pept        complement(233662..234591)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0215"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18268"
FT                   /db_xref="GOA:B5YBZ0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR025302"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B5YBZ0"
FT                   /protein_id="ACI18268.1"
FT                   /translation="MGDFVISFNNVVKKYEKTLALNKASFQVKKGEIFGYIGPNGAGKT
FT                   TTIRILLGLLKPNDGEVKVFGYDISELDKIKGRIGFMLEERGLYENLTGYENLEFYSIL
FT                   YKVPKKIRENRIKELIELVGLSGREKEKVKNYSTGMRQRLCLARSLLHEPELLLLDEPT
FT                   TGLDVEGQKFIRDFLVNLANNKNVTIFITSHNLYEISQICTRIGIINKGEIVACGTLSE
FT                   LQRAFDRKEVEISIDKPLQEVEVPLRNLPFVQNVKEEEGKIIVSLENKDKLPDLLLWFT
FT                   QNNIKVWKINEIKNSLEDIYLSIVKEEK"
FT   gene            complement(234596..235012)
FT                   /locus_tag="DICTH_0216"
FT   CDS_pept        complement(234596..235012)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0216"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19664"
FT                   /db_xref="GOA:B5YBZ1"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:B5YBZ1"
FT                   /protein_id="ACI19664.1"
FT                   /translation="MTTDLNINKQNISESYMFDHYIEKNDILPVFVSDFELRKIYNPCL
FT                   KGKITITLEGKYLLCPMLRNLVLGSVKESKIPDLFIKGTIDRFYELSKEKLYPCKYCEF
FT                   RYACLDCRAFELLKGSSLGEVKFCKYNPLEGIWG"
FT   gene            complement(235160..235849)
FT                   /locus_tag="DICTH_0217"
FT   CDS_pept        complement(235160..235849)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0217"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19937"
FT                   /db_xref="GOA:B5YBZ2"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:B5YBZ2"
FT                   /protein_id="ACI19937.1"
FT                   /translation="MSTYYRLSPEIYFVKGRKKSALYNTLQGEIIHLCEERTRIIELLD
FT                   KMPFEEILNIINGLSKTEIMEFVRVLKQNGIIRKYENKAYIDKLSLGFPLFMQKHLFNK
FT                   PAPNLDIAFIEVSSTCDFSCYFCKNYPIKFGCLGCTQISYKKRISEELWLEILQEVNNL
FT                   RCKTLVILGGDPFLEITSLVNFCRNLDKFNFENIFILTHGINIATKKSRNLIKHYNLKP
FT                   IISIFLP"
FT   gene            complement(235833..237245)
FT                   /locus_tag="DICTH_0218"
FT   CDS_pept        complement(235833..237245)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0218"
FT                   /product="putative regulatory protein"
FT                   /note="identified by match to protein family HMM PF04055"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18811"
FT                   /db_xref="GOA:B5YBZ3"
FT                   /db_xref="InterPro:IPR000385"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:B5YBZ3"
FT                   /protein_id="ACI18811.1"
FT                   /translation="MDNIKIIEFSTENTTYIYNDDTGLTFPKKDIDKLKEIINLLKHNN
FT                   MKEKPVLREVDIQHFLLYEGFTQLILSVTENCNFRCKYCYYYSGMYDYAPIFNRKNMNF
FT                   DIAKKAVDYYFNNIFQVLKYNPYRKPCVTFYGGEPLLNFDLIKSIVTYIRKKFPNINVL
FT                   YNITTNGYLLTKDIVDFLIDNDFYIAVSLDGYKENHDRNRTTIKGQKTFDKILQNLEYI
FT                   RFHYPRYFYENISLICCYDWKTDLFKLEEFFSTNKNLPPLVRVNAAAPYFSKYYQIFTK
FT                   EDFLNHQCQIQKLKDVYFEQIKKKKKTSAFLDIFFGSNYRTLLIREKITKSKGVFNFLH
FT                   GSCVPGVKIFIDTDGNFHICEKVNYSFPIGNIEEGLNYKKIIQVLNKYKEEITYECKKC
FT                   PISRLCTMCFATFMTNNRFSKDPENICELLIKQTLSDFSELYSLLESDPSFEEKLFHLN
FT                   TKNKRRNYEHIL"
FT   gene            complement(237517..237705)
FT                   /locus_tag="DICTH_0219"
FT   CDS_pept        complement(237517..237705)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0219"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19866"
FT                   /db_xref="UniProtKB/TrEMBL:B5YBZ4"
FT                   /protein_id="ACI19866.1"
FT                   /translation="MEYIVKKEEVSLASKWCPFVCGLGCGAICAAGCYVDTPGIPLMDV
FT                   VAGTRGSYAAYGKAKVL"
FT   gene            complement(238180..238872)
FT                   /locus_tag="DICTH_0220"
FT   CDS_pept        complement(238180..238872)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0220"
FT                   /product="membrane protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19497"
FT                   /db_xref="GOA:B5YBZ5"
FT                   /db_xref="UniProtKB/TrEMBL:B5YBZ5"
FT                   /protein_id="ACI19497.1"
FT                   /translation="MGKIIKYNLQNVFKNSTFYFQVIFLTGVVSYTLFALLKDMPFNVS
FT                   YFIFSRILLLMGSSILAFTTSMILSDLIVYEKITGRIEFLLSNGVGVRSYLFGSIISLW
FT                   IITEFILIFCVFIANFILFLLLKKSINFFDLIKILGIISIFNIGLASMMCTLVLRIRKV
FT                   NLINNLLWIIGFSIIFGWNYIMQKIPLNAKYDSFIFLGLALLGIILILVSFVFGKRINN
FT                   ETVVLTIP"
FT   gene            complement(238875..239576)
FT                   /locus_tag="DICTH_0221"
FT   CDS_pept        complement(238875..239576)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0221"
FT                   /product="ABC transporter ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18311"
FT                   /db_xref="GOA:B5YBZ6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B5YBZ6"
FT                   /protein_id="ACI18311.1"
FT                   /translation="MEKRISEKLISIRNLSKEINGKKILKNISFDIVRGEITALLGPNG
FT                   AGKTTILRCLTGIFNVTSGNIEKVNNLIISVMLEKDLLWEKYSGWENIKIYAELLGRGV
FT                   EKNDIEVYAEKLGILDFLSQKVYTYSKGTKRKLSFLLALLKNPDLLVLDEPMSGLDPIS
FT                   RKNMRELILDLNQKGKSVILTSHDLGELEKLAHRVILIKEGKILVDDMKSEILGKYRDL
FT                   EELFLDVIGGG"
FT   gene            complement(239519..240916)
FT                   /locus_tag="DICTH_0222"
FT   CDS_pept        complement(239519..240916)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0222"
FT                   /product="radical SAM domain protein"
FT                   /note="identified by match to protein family HMM PF04055"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19224"
FT                   /db_xref="GOA:B5YBZ7"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR008792"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:B5YBZ7"
FT                   /protein_id="ACI19224.1"
FT                   /translation="MNLDSNVYLKLDVDNLRLHLQPQYAFLCFDSKKLPKRGRLKQQAA
FT                   IKLNKVAGEIIEKMYEPLSLSEIVNYFCRKYNDTEENVFRNISIFFERLYNRYGISVIE
FT                   CKNKYEIKNSCFTKTGSWDYLVPFGLVLELTYRCNYQCKHCYNNSSIYMLSEMKTDVIL
FT                   SILEEAYKLGIREIELTGGEPTVYSNIEEFLKKLFTYNFELIGLLTNGSNLSEEICQLL
FT                   YYNRERVVVQIDLHGSSPEYVRWFTGNEKAYYSAIDSIKKLSDLGIVVRVVCNVTSLNV
FT                   EQMADVAEIAYKLGATAVAFGPIAPIGRAKSNNDLIISLDDKAFAMFEKNIENLIEKYG
FT                   KNFISVIEEEIMSDSINCGVGRSGITLSPNLDVKICQMSDMSIGNLKFSGNSLKNFLQT
FT                   YSMYFEIISQIPAPNKRICKECENLWFCNNCLVRGLMKAYGEGEDKCVWRKEFLKNSFL
FT                   LEIFQKK"
FT   gene            complement(240985..241122)
FT                   /locus_tag="DICTH_0223"
FT   CDS_pept        complement(240985..241122)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0223"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18398"
FT                   /db_xref="UniProtKB/TrEMBL:B5YBZ8"
FT                   /protein_id="ACI18398.1"
FT                   /translation="MPEPQIIGVEKNWCAGCTGCGFCRWCPGKVQAAWIATFVGFVGLR
FT                   "
FT   gene            complement(241209..241340)
FT                   /locus_tag="DICTH_0224"
FT   CDS_pept        complement(241209..241340)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0224"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ACI20113"
FT                   /db_xref="UniProtKB/TrEMBL:B5YBZ9"
FT                   /protein_id="ACI20113.1"
FT                   /translation="MKKKDKNIFLSILLIIFMLILSIKVIYADPLEDDNKKKESKIL"
FT   gene            241560..241970
FT                   /locus_tag="DICTH_0225"
FT   CDS_pept        241560..241970
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0225"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18745"
FT                   /db_xref="UniProtKB/TrEMBL:B5YC00"
FT                   /protein_id="ACI18745.1"
FT                   /translation="MPKEISYINKIISTYGSYAKPFLNWILETGKISSTWKAYFWALKL
FT                   YWKGEYLLALSKLEKALNKCNNSKTLYYLVLTQKLAFLLRVNSKEGVELFHKLKREFPY
FT                   IPSYVRNITSSTLINYYNSFLSSNSSKFRIWT"
FT   gene            complement(242063..242314)
FT                   /locus_tag="DICTH_0226"
FT   CDS_pept        complement(242063..242314)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0226"
FT                   /product="ABC-type multidrug transport system, permease
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ACI20132"
FT                   /db_xref="GOA:B5YC01"
FT                   /db_xref="UniProtKB/TrEMBL:B5YC01"
FT                   /protein_id="ACI20132.1"
FT                   /translation="MLSWFFLLFAPVYYSTDNLHPIYTSVLLINPITHCLNLVRSTLGF
FT                   NSIISIFWSFIYLMILIVILGIYSLKTFKSVYILEKFY"
FT   gene            242543..242887
FT                   /locus_tag="DICTH_0227"
FT   CDS_pept        242543..242887
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0227"
FT                   /product="nucleotidyltransferase domain, putative"
FT                   /note="identified by match to protein family HMM PF01909"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19229"
FT                   /db_xref="GOA:B5YC02"
FT                   /db_xref="InterPro:IPR002934"
FT                   /db_xref="UniProtKB/TrEMBL:B5YC02"
FT                   /protein_id="ACI19229.1"
FT                   /translation="MDKTINYLNEVEKAILKELKVKLLELLGSNFISMVLFGSKARGDY
FT                   DEDSDIDVVIIVNYLDKDIKDKILLKVTELETKYGIVLSTLILSKEDFEYLKQRERRIA
FT                   LDIEREGIEI"
FT   gene            242884..243288
FT                   /locus_tag="DICTH_0228"
FT   CDS_pept        242884..243288
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0228"
FT                   /product="protein of unknown function"
FT                   /note="identified by match to protein family HMM PF05168"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18565"
FT                   /db_xref="InterPro:IPR007842"
FT                   /db_xref="UniProtKB/TrEMBL:B5YC03"
FT                   /protein_id="ACI18565.1"
FT                   /translation="MKEENIRISVKEEIERAKEAYKSANILFENDLIKDAISRLYYYAL
FT                   HMVRALLFTRGFEPKSHEGALRLLSLYFVKEGIFEPEIAHIFSRLMKYREEADYNPFYV
FT                   FSKEDFLNYRKEAEILASEIEKYLAKVGLL"
FT   gene            complement(243334..243585)
FT                   /locus_tag="DICTH_0229"
FT   CDS_pept        complement(243334..243585)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0229"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19779"
FT                   /db_xref="GOA:B5YC04"
FT                   /db_xref="UniProtKB/TrEMBL:B5YC04"
FT                   /protein_id="ACI19779.1"
FT                   /translation="MILLSGVNIPISRFPTFLKYLSQIFPLSHLMEGLNLIIQDKISMA
FT                   IPYIVSEIGLLIMYFLLGQFIIKFLERKARHIGNINLY"
FT   gene            complement(243691..244065)
FT                   /locus_tag="DICTH_0230"
FT   CDS_pept        complement(243691..244065)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0230"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19481"
FT                   /db_xref="GOA:B5YC05"
FT                   /db_xref="UniProtKB/TrEMBL:B5YC05"
FT                   /protein_id="ACI19481.1"
FT                   /translation="MWLNPKAYMIEKVINPIFRFLFYSFLILYGYKEKTNIAVFILGNA
FT                   ILLSSISALKGIGIIYFSERQQGTLMYFIVSPRSRLRIIAQKIFFHIINAFITVLIGLT
FT                   IILTGFKYTIPHINLYLFSY"
FT   gene            complement(244125..244886)
FT                   /locus_tag="DICTH_0231"
FT   CDS_pept        complement(244125..244886)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0231"
FT                   /product="ABC-2 type transporter superfamily"
FT                   /note="identified by match to protein family HMM PF01061"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19947"
FT                   /db_xref="GOA:B5YC06"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:B5YC06"
FT                   /protein_id="ACI19947.1"
FT                   /translation="MTYFRALFSIFKIHYKISFSRNLYKFSIFIMPIFFSTLLYFIYSG
FT                   KEMVYIIWGSGIASLWGLACYSSAIEIERERLSGTLEAVSVTPIRFEFIIFSKILANTL
FT                   IGFISFAIVIIYSILILRIPLIISRIDLFLLSLFSLLLSLLAISFLTATLFTLSRNAFA
FT                   LISSILYPIYFISGILFPVEILPSWVQYISNILPIRWSVSFLKNSVQKCNSIEKEFYYS
FT                   IILSVLYLLVGHFLFKYIERKNRKDATFGGI"
FT   gene            complement(244893..245243)
FT                   /locus_tag="DICTH_0232"
FT   CDS_pept        complement(244893..245243)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0232"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19168"
FT                   /db_xref="GOA:B5YC07"
FT                   /db_xref="UniProtKB/TrEMBL:B5YC07"
FT                   /protein_id="ACI19168.1"
FT                   /translation="MQEVEELCDRIAFLKSEEIITIDTPASLKSKYSESFEIKLLIDKH
FT                   FKAKLNELEKLKYVKNLKIHENENFLEVILVITPESTAISNIFTNLKGIPIHDLIVKKI
FT                   SLEDVYLKLLGE"
FT   gene            complement(245231..245584)
FT                   /locus_tag="DICTH_0233"
FT   CDS_pept        complement(245231..245584)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0233"
FT                   /product="ABC-type multidrug transport system, ATPase
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18388"
FT                   /db_xref="GOA:B5YC08"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B5YC08"
FT                   /protein_id="ACI18388.1"
FT                   /translation="MGGERNLYTRLSAIENLEYFADLYGVPYKNRKEKIKELLEIVGLP
FT                   SNRLKDKVETYSKGMKQKLQIARGLINDPEIIFLDEPTIGLDPIGAREIRNIIKRLKNM
FT                   KKPLFLRVITCRK"
FT   gene            245770..245937
FT                   /locus_tag="DICTH_0234"
FT   CDS_pept        245770..245937
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0234"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19982"
FT                   /db_xref="UniProtKB/TrEMBL:B5YC09"
FT                   /protein_id="ACI19982.1"
FT                   /translation="MRAIIFSGFFLKSNILIFIKYFLYKSLTSIIDSFYDLPQPISFKA
FT                   SSALSPQKML"
FT   gene            complement(246497..246874)
FT                   /locus_tag="DICTH_0235"
FT   CDS_pept        complement(246497..246874)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0235"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18610"
FT                   /db_xref="GOA:B5YC10"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:B5YC10"
FT                   /protein_id="ACI18610.1"
FT                   /translation="MNLPLYLDFDNKKIHPNGWEVVYFLNPSCSGSCAHCWSYNKFLGF
FT                   YLPTEWHINFWRKVDFNKLREIRLTGGEPLEYKGLSEVIKILTYKNFERSIPIYIFTSG
FT                   RRCHLFKKRKGRSKRDHRKFS"
FT   gene            complement(246881..247033)
FT                   /locus_tag="DICTH_0236"
FT   CDS_pept        complement(246881..247033)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0236"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19669"
FT                   /db_xref="UniProtKB/TrEMBL:B5YC11"
FT                   /protein_id="ACI19669.1"
FT                   /translation="MVLIISGALIGFLEIFNFKGRKEGKRILPIFAKQVIEGLIWKKYE
FT                   YYHNT"
FT   gene            complement(247460..247792)
FT                   /locus_tag="DICTH_0237"
FT   CDS_pept        complement(247460..247792)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0237"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ACI20028"
FT                   /db_xref="UniProtKB/TrEMBL:B5YC12"
FT                   /protein_id="ACI20028.1"
FT                   /translation="MWEKTFGGKSDDVAASVQQTSDGGYIVAGGTASFGAGRVDVYIIK
FT                   LDKDGNKMWEKTFGGSDNDLACSIQQTSDGGYIVAGGTTSFGAGGIDVYIIKLDSNGNT
FT                   GPYPTK"
FT   gene            complement(247806..249182)
FT                   /locus_tag="DICTH_0238"
FT   CDS_pept        complement(247806..249182)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0238"
FT                   /product="lipoprotein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19141"
FT                   /db_xref="InterPro:IPR013431"
FT                   /db_xref="UniProtKB/TrEMBL:B5YC13"
FT                   /protein_id="ACI19141.1"
FT                   /translation="MNLKGYIKIIPLILILLLSCGFSNPTQSSSSQEGITWQKVFGGKS
FT                   DDGAYSIQQTSDGGYIIAGVTTSFGAGGNDFYIIKLDKDGNKMWEKTFGGKSDDVAASV
FT                   QQTSDGGYIVAGGTYSFGAGRADVYIIKLDKDGNKMWEKTFGGSDNDLACSIQQTSDGG
FT                   YIVAGGTYSFGAGEEDVYIIKLDSNGNKMWEKTFGGKSDDVANSIQQTSDGGYIVAGYT
FT                   PSFGAGGEDIYIIKLDRNGNKMWEKTFGGSGNDYANSIQQTSDGGYIVAGGTTSFGAGG
FT                   IDVYIIKLDAGESSKPTQPSSSQEVITWQKVFGGKSDDGAYSIQQTSDGGYIVAGGTYS
FT                   FGAGGVDVYIIKLDSNGNKMWEKYFGGKGDDGAASIQQTSDGGYIVAGGTTSFGAGGID
FT                   VYIIKLDKDGNKMWEKTFGGKSDDRAWSIQQTSDGGYIVAGVYNLLWCRRKRFLHNKTG
FT                   "
FT   gene            249613..251124
FT                   /locus_tag="DICTH_0239"
FT   CDS_pept        249613..251124
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0239"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19605"
FT                   /db_xref="UniProtKB/TrEMBL:B5YC14"
FT                   /protein_id="ACI19605.1"
FT                   /translation="MPKEISYINKIISTYGSYAKPFLNWILETGKISSTWKAYFWALKL
FT                   YWKGEYFLALSKLEKALNKGNNSKTLYYLVLTQKLAFLSRVNSKEGVELFHKLKREFPY
FT                   IPSYVRNITSSTLINYYNSFLSSNSSKFRIWSNRYYSNPSSLAFVFLGKAGEELRKGNL
FT                   RRAIFYYVKAFRTSLSIPHPTGIINSLNNISWNLKERHPKFSLSLAKKAVYYCALYRED
FT                   LSYDFAVLDTLFEVQKINNDLSICETSMIIKHYYNFLSDSSGNYNKQHYKKTLEFSKRF
FT                   CFDLSSSKNNEKWLDLNEDIKPDFNNLSLDILAELKRISIFKDFWRTIELLNNISKEER
FT                   KILILSAFMSLCNRKKLFPSTSKKIKDILDFSENIKRLINFAKRDFEVMKFLSYISNDH
FT                   PFFKARMDLAKKFLEDLYPEKRDLFIDFYLSLEEKGREFIDTFVRNYVRYDRDWHIKIP
FT                   TPEEIVPFVKEFQLKELPSSLAYFCFEKRERRNFNKIINEMMVNA"
FT   gene            complement(251134..251550)
FT                   /locus_tag="DICTH_0240"
FT   CDS_pept        complement(251134..251550)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0240"
FT                   /product="protein of unknown function"
FT                   /note="identified by match to protein family HMM PF01934"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18491"
FT                   /db_xref="InterPro:IPR008201"
FT                   /db_xref="InterPro:IPR037038"
FT                   /db_xref="UniProtKB/TrEMBL:B5YC15"
FT                   /protein_id="ACI18491.1"
FT                   /translation="MQIDIEKIKQRISDINESLEEIQKLTSLDVNEFWSDKRNIAALKY
FT                   FLLQAIEALGGICVHICAKRFNKGVSSLGECIEILEKEKVLDKDLSERLRNMIRFRNKL
FT                   VHRYWEIEDQKVYEYAKKDIKDFTDFIEAIKRIF"
FT   gene            complement(251550..251978)
FT                   /locus_tag="DICTH_0241"
FT   CDS_pept        complement(251550..251978)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0241"
FT                   /product="nucleotidyltransferase"
FT                   /note="identified by match to protein family HMM PF01909"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18880"
FT                   /db_xref="GOA:B5YC16"
FT                   /db_xref="InterPro:IPR041633"
FT                   /db_xref="UniProtKB/TrEMBL:B5YC16"
FT                   /protein_id="ACI18880.1"
FT                   /translation="MNKEFYSLDEKERKRIIDEIRKILQEEENIIFAYLYGSFLNALSF
FT                   RDIDIGIYLNKIDEKNIEELELKMIKEISKKINLPFEIIDLRVLNYAKNSFLNNIFRTG
FT                   LLLFTRDEKFLTDLIETTSLEAISNEYISYLSLKELLP"
FT   gene            complement(251986..253767)
FT                   /locus_tag="DICTH_0242"
FT   CDS_pept        complement(251986..253767)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0242"
FT                   /product="ABC-type transport system,membrane ATPase
FT                   component, putative"
FT                   /note="identified by match to protein family HMM PF00005;
FT                   match to protein family HMM PF00664"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18705"
FT                   /db_xref="GOA:B5YC17"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:B5YC17"
FT                   /protein_id="ACI18705.1"
FT                   /translation="MFIISFYLVKNKYRKNYTKREFIKMKEDFNFLTPKKEDISLAKLK
FT                   ILLPYFKIHLGSFVIASIFLIISSFITIPVPYLTKIVIDKVLLGSKNAKLLVNLVIIMA
FT                   ILHIARSIFSGMTQYLFTKLNQEIIATLKSELFKKILKLPFSFYDQAQTGYLLSRIGEI
FT                   EGLGFFFSSTLVSQLIRLGEFIFALFMLFYLNWKLTLVALSILPFYYLALKPLSQRITY
FT                   ITKDVLESSAKLMGKVQERISGAEVIKLFATEEREAMEIEKGFKEISRKNVLQSIIFTL
FT                   FSEFNITLIALGGLLILWRGGLDIINGSFTLGSYIAFTAYAQRLYGPIQSLATFNFTIY
FT                   PALVSLKRVTEIMEMAKEEEGEITINKLKEGISFVNVYFSYDGKNKVLENINLDIKVGE
FT                   KVAIVGPNGSGKTTLIRLLLRMYKPSEGKIFIDSIDLGKIKLSSLREKIGIVSQNIFLF
FT                   NDTVRNNISYANPNISDNEINNLLKEMDLYQFLMEGFPNGLDTIIGERGVKTSGGQNKI
FT                   IAFLRAILKNPEILILDEATSEIDTRVEEKIFKFIKEKMKDTTCVIITPKDLPKETFIN
FT                   KIVYLENGKIVNIVTMI"
FT   gene            253946..254059
FT                   /locus_tag="DICTH_0244"
FT   CDS_pept        253946..254059
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0244"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19924"
FT                   /db_xref="UniProtKB/TrEMBL:B5YC18"
FT                   /protein_id="ACI19924.1"
FT                   /translation="MKKIRELMTSFEISRLNELKGIFSTLFIFLIMKLLDV"
FT   gene            complement(254025..254474)
FT                   /locus_tag="DICTH_0243"
FT   CDS_pept        complement(254025..254474)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0243"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19127"
FT                   /db_xref="GOA:B5YC19"
FT                   /db_xref="UniProtKB/TrEMBL:B5YC19"
FT                   /protein_id="ACI19127.1"
FT                   /translation="MIGYIIWFFVISAIDSIPEDIGKEVNYGTFEHLHLSCSDIKSILL
FT                   VRAFINALKNIFYIAIIVSLIHRVTIISNPLSFLIFFILVFGLYGFAFMLAGLVLVVKS
FT                   MGNWLGVLNLILLIPLIIQEKLLTPEIKEILSYFPIHQGASLLKK"
FT   gene            complement(254540..254665)
FT                   /locus_tag="DICTH_0245"
FT   CDS_pept        complement(254540..254665)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0245"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19092"
FT                   /db_xref="GOA:B5YC20"
FT                   /db_xref="UniProtKB/TrEMBL:B5YC20"
FT                   /protein_id="ACI19092.1"
FT                   /translation="MKYLLQTELRNFVKFLKKSPLSHLPIFYFSLHLLLAYLNVL"
FT   gene            complement(254668..254814)
FT                   /locus_tag="DICTH_0246"
FT   CDS_pept        complement(254668..254814)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0246"
FT                   /product="ABC-type multidrug transport system, ATPase
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19737"
FT                   /db_xref="UniProtKB/TrEMBL:B5YC21"
FT                   /protein_id="ACI19737.1"
FT                   /translation="MLEITLSSPELIYNLFDELKRNLVVPIEIHNLGEPFEEIFRSFVE
FT                   RRN"
FT   gene            complement(254823..255500)
FT                   /locus_tag="DICTH_0247"
FT   CDS_pept        complement(254823..255500)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0247"
FT                   /product="ABC-type multidrug transport system, ATPase
FT                   component"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19738"
FT                   /db_xref="GOA:B5YC22"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B5YC22"
FT                   /protein_id="ACI19738.1"
FT                   /translation="MRDETILKVENLEKTFGKGNKKVKVVNEVSFQVKNNEIFALLGPN
FT                   GAGKTTTIKMILDLVTPDKGEIEILSMKMPKYKKDIMREIGVILEGSRNLYWNTSLREN
FT                   VYYFANLKGSGMQQKSAIICAISTSPKILILDELLLGLDILTRFEIEKIVKELREVSTL
FT                   IISSHDLRFIEKVSDRILIINKGSVVVEGTTKELIGKISFAKYRLILNNSGNREYLKEI
FT                   EKD"
FT   gene            complement(255834..256622)
FT                   /locus_tag="DICTH_0248"
FT   CDS_pept        complement(255834..256622)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0248"
FT                   /product="ABC transporter permease protein"
FT                   /note="identified by match to protein family HMM PF06182"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18912"
FT                   /db_xref="GOA:B5YC23"
FT                   /db_xref="InterPro:IPR010390"
FT                   /db_xref="UniProtKB/TrEMBL:B5YC23"
FT                   /protein_id="ACI18912.1"
FT                   /translation="MVVKSRLKYYIKVYFWFIAQDIKGRMQYRVDFFISTIGMVITNLL
FT                   GLLSIYVIFQSIPNILGWSYYEILFIYGFSLLALSPLQLFFDNLWNLPSYLISGDFIKY
FT                   YLKPLNIFFFYFAEVFDMKGLSQLVIGIITLSYAWVKLNLEFNLLKFIILIISLISSSL
FT                   VMISLMVMGSAVAFWVLNVTPLLNFIFRLREYTRYPTDIFDPFFRFIFSFVIPIAFVAF
FT                   YPSQIFLRPKNSNILVFISPFIGIFLFIIAYKLWIRGTRI"
FT   gene            complement(256612..257406)
FT                   /locus_tag="DICTH_0249"
FT   CDS_pept        complement(256612..257406)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0249"
FT                   /product="membrane protein, putative"
FT                   /note="identified by match to protein family HMM PF06182"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18840"
FT                   /db_xref="GOA:B5YC24"
FT                   /db_xref="InterPro:IPR010390"
FT                   /db_xref="UniProtKB/TrEMBL:B5YC24"
FT                   /protein_id="ACI18840.1"
FT                   /translation="MKKYIYIAKGFLLERMVYRFSLFFNALEKYIYILLIFFLWKAIYK
FT                   SLGQENLSMNFESTFTYLSLATAIFGLFQTWVDWDISQLMISGNLSIILTKPLDFQIYM
FT                   FFKRITWVILNLLTITLPVLVLLKFILRMPINMGINFVFFVISIIISYLIYFNIDFIVG
FT                   VTAFFTESIWGLSVTKDSIILFLSGGIIPIPLFPENLRRILEILPFKTIYHMPIEILIN
FT                   KNLTIFDYLNSLVVQIFWLFVFLALSRTYYKLTERFIKINGG"
FT   gene            complement(257403..258059)
FT                   /locus_tag="DICTH_0250"
FT   CDS_pept        complement(257403..258059)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0250"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ACI20153"
FT                   /db_xref="GOA:B5YC25"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B5YC25"
FT                   /protein_id="ACI20153.1"
FT                   /translation="MKEIYEIDERTFKENLELFEEIIGIEALYRKPVRQMSLGQRVLCD
FT                   ILASFLHNPKVVFLDEPTIGLDILIKDKVRKLIKELNRRKNTTILLATHDMNDVEALCP
FT                   RIIVIDKGKIIYDGLLEDLKEKFKMYRKAKIRIKDDVNEEEINKIKVLLLEKFNDVISD
FT                   CAIKSYWLDISFKKQDVNLLEILRFITNFIPIEDIHTEDIQTEEVIKLIYEESRK"
FT   gene            complement(258073..258429)
FT                   /locus_tag="DICTH_0251"
FT   CDS_pept        complement(258073..258429)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0251"
FT                   /product="ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18402"
FT                   /db_xref="GOA:B5YC26"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B5YC26"
FT                   /protein_id="ACI18402.1"
FT                   /translation="MVDSVIKVNNLRKYFKVLNRREGFWGTVKDLFSQDYFYVKAVDGI
FT                   SMEIKEGEIVGFLGPNGAGKSTTIKIMTGVLEPDGGEVLINNVIPYKDRIKNAKKYWGS
FT                   FWSKNSTLVVTTPY"
FT   gene            complement(258460..259509)
FT                   /locus_tag="DICTH_0252"
FT   CDS_pept        complement(258460..259509)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0252"
FT                   /product="glycosyltransferase"
FT                   /note="identified by match to protein family HMM PF00535"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19235"
FT                   /db_xref="GOA:B5YC27"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:B5YC27"
FT                   /protein_id="ACI19235.1"
FT                   /translation="MFPEVSIIIPTYNRERLLPRAIESVRRQTYKNWELLIVDDRSTDN
FT                   TESLVKKYISLDDRIIYLKNERKKGPAGARNFGILNSKGKYIAFLDSDDEWSEIHLEES
FT                   IDVLKNYDIKVSFALWIAVKEDGEVRRVFDPEISEERARLERTISIFNPKIEGKYIFFG
FT                   DNFYEESFLKGGSYCTNINTLVIERDVIEKVGLFNEDLLVCEDSDFVYRVILDYPFCLI
FT                   DNYHLYYYQGSDNIYNFFDRRDVKIDDVLENRKFIEKFTFVGLGQIKLNSIHKNLIKSS
FT                   QKIVRKKECINRIKDIIGRKYFTFGFMNHKINKFKAILFVFKSLFYKFNFTRLLFLIKL
FT                   LFPLYSYKT"
FT   gene            complement(260425..261354)
FT                   /locus_tag="DICTH_0253"
FT   CDS_pept        complement(260425..261354)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0253"
FT                   /product="m4C-methyltransferase"
FT                   /note="identified by match to protein family HMM PF01555"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19507"
FT                   /db_xref="GOA:B5YC28"
FT                   /db_xref="InterPro:IPR001091"
FT                   /db_xref="InterPro:IPR002941"
FT                   /db_xref="InterPro:IPR017985"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B5YC28"
FT                   /protein_id="ACI19507.1"
FT                   /translation="MKDKKYKRGTKTSSFGAPGRINHDSTLFYSSNLYKDLPKEKKVKH
FT                   QESEIPKEALNQIFCKSSEKMEEIPDNSIHLMVTSPPYNVGKEYDENLTLKEYREFLKR
FT                   VWKEVYRVLVPGGRVCINIANLGRKPYIPLHCYIIEDMLEIGFLMRGEIIWNKASSASP
FT                   STAWGSWLSPANPTLRDIHEYILVFSKDTFTRKNLRNRKSTITKEEFLEFTKSVWTFPA
FT                   ESAKKIGHPAPFPIELPYRCIQLYTFEGEVVLDPFMGSGQTAIAALKAKRFYIGYEINK
FT                   VYVNLANRRIREFLSSQNILSLFEETNK"
FT   gene            complement(261344..262243)
FT                   /locus_tag="DICTH_0254"
FT   CDS_pept        complement(261344..262243)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0254"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18653"
FT                   /db_xref="UniProtKB/TrEMBL:B5YC29"
FT                   /protein_id="ACI18653.1"
FT                   /translation="MINISRLWSKNIEKEFFTKTLKVAVPEQLFYITEDGRYIAYWPKN
FT                   YKGIKATLQSRNAFIGSFTEKWTKELLEETAEELGAFTVQGVICEDIGLSAKSPADVAI
FT                   CKTRDQHQKPENILMIIEVKMSIVWNWEYNPSTGELKSIGDYTTHQGNPGLLRSDTILK
FT                   AIGKSINIRVSSFKSAQIPIVILGNTPITDSYYEKVDHLKKTGVIQGFYSTNPQPLDDP
FT                   IHKNNIKSTPGRGFLRFDSYEEMKQELINLISEEQEFFSGMKTKKELGKIIEIANLEPT
FT                   YEKKAEMFLKLLRDENER"
FT   gene            complement(262738..264000)
FT                   /locus_tag="DICTH_0255"
FT   CDS_pept        complement(262738..264000)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0255"
FT                   /product="permease, putative"
FT                   /note="identified by match to protein family HMM PF05977;
FT                   match to protein family HMM PF07690"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19152"
FT                   /db_xref="GOA:B5YC30"
FT                   /db_xref="InterPro:IPR010290"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B5YC30"
FT                   /protein_id="ACI19152.1"
FT                   /translation="MRNFKLFRFVEFLRENPSFFKVWLGYSQSTIGSTFTMIARTVLFY
FT                   QLTNSPSAVAIFSIFSMLPSILMSPIAGWLSDFISRKKILIFSQAVNGFLVLGYIIAKD
FT                   PVVFYILVFLQGILGVFFSTSFYSVIPQTVKNKDDIVTANSLNNFSENLVDVLGPSLGA
FT                   IIVKFWGLIPAFIIDSITFFINAFLLSITFISEEEAVEKKVKINSVISSFYNDTKEAIK
FT                   FLVNEGKYVNYILVTEFLLLLAGGTINSLLVVFTKEALHSSEVMYGYLLSAGSIGALIG
FT                   SFILGNLNMKIPSYKLYFTGLIAIGIFLTMFSFANNILLGLIIFLLNGIANALLQIGFM
FT                   SAIMANVLSEVRGKIFSFYILASTLGSVISLLISQKLLTIFNIQTVYRIGSIIILIISI
FT                   IRFIRLQIFLKSKKEPWISIE"
FT   gene            264222..264617
FT                   /locus_tag="DICTH_0256"
FT   CDS_pept        264222..264617
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0256"
FT                   /product="nucleotidyltransferase"
FT                   /note="identified by match to protein family HMM PF01909"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19832"
FT                   /db_xref="GOA:B5YC31"
FT                   /db_xref="InterPro:IPR041633"
FT                   /db_xref="UniProtKB/TrEMBL:B5YC31"
FT                   /protein_id="ACI19832.1"
FT                   /translation="MKEKIIEIIKEELEKRENILFAYIFGSFVDSEKYNDIDIAIYVSD
FT                   FNREKVLDMEFELERILEDKLKIPFDVRIINEAPLGFVYNVLKNKIIVLDRDSLLRSDF
FT                   ESLIFRKYFDYQHLIDEYLREIKNASI"
FT   gene            264604..264783
FT                   /locus_tag="DICTH_0257"
FT   CDS_pept        264604..264783
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0257"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ACI20006"
FT                   /db_xref="InterPro:IPR008201"
FT                   /db_xref="UniProtKB/TrEMBL:B5YC32"
FT                   /protein_id="ACI20006.1"
FT                   /translation="MLRYNKDKVSKLIFEMQKALNRLDSISKIEKEEFLSNPDKIDSAK
FT                   YNFILAIESAIDIL"
FT   gene            264842..266170
FT                   /locus_tag="DICTH_0258"
FT   CDS_pept        264842..266170
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0258"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19155"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR024749"
FT                   /db_xref="InterPro:IPR025277"
FT                   /db_xref="UniProtKB/TrEMBL:B5YC33"
FT                   /protein_id="ACI19155.1"
FT                   /translation="MSLPSVKVSENGRFLITEDGSPFFYLGDTAWELFHRLTLEEADLY
FT                   LTVRSNQGFNVIQAVILAELDGLHTPNANGHIPLIGDDPTKPNEYYFRHVDSIIKLAEK
FT                   KGIYMGILPTWGDKVHSELWGIGPAIFDRSNAYLYGKFLGERYRDFNNIIWILGGDRPG
FT                   EGYEDIWTSMAKGISEGLGRKPIITYHPTGGQSSSQWFHNMEWLSFNMWQSGHCLVDAP
FT                   NWDMIRSDYDKTPIKPVIDGEPNYEGHPIDPYLRKWKPEYGRFTDYEVRKQAYRAVFSG
FT                   ACGHTYGHHSVWQMYDERYKPTTFPSVYWYEAIYAPGAKQMIHLKNLLLSFPYFTRIPA
FT                   QDMLIGITPPPSPKDIDDRINDKRASYPVATRDKEGSYALIYFTFANQTLNIDTSSLLG
FT                   HVIKASWFDPRTGERYYIGEFSKGTLKFTSPLGGPDWVLILEV"
FT   gene            266290..266991
FT                   /locus_tag="DICTH_0259"
FT   CDS_pept        266290..266991
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0259"
FT                   /product="class II glutamine amidotransferase, putative"
FT                   /note="identified by match to protein family HMM PF00310"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19790"
FT                   /db_xref="GOA:B5YC34"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR026869"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:B5YC34"
FT                   /protein_id="ACI19790.1"
FT                   /translation="MCRLFGLISPIEKKVEYYMLYARNNFKKQSERHPHGFGFGWYENG
FT                   APKIKKSGEKALESDLFDKLAKEVSSQIIIAHIRDASDGAIKEENSHPFSYENFIFAHN
FT                   GTLHKKDKIFDMLEYPYNKDFTSDGIDSEIYFRFLVQNIKNEKDVILGLQKGIRKIIYL
FT                   NIGSANFLLSDGERLYAFKYGRSLFYSLMEDCLIVSSEIIGRDKNRWKKFEEGLLLVVD
FT                   KSLELREIKIE"
FT   gene            267314..268432
FT                   /locus_tag="DICTH_0260"
FT   CDS_pept        267314..268432
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0260"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18885"
FT                   /db_xref="UniProtKB/TrEMBL:B5YC35"
FT                   /protein_id="ACI18885.1"
FT                   /translation="MGNSKEELIEKLISEILRVIKEGIFNENIIRYRELLYILGHLLHE
FT                   KGFLKRNTEEERSILEEAINQLAQKYGDTSEKFLDNIYDKVLDELKEVRRTEPEFQSFF
FT                   VLFTYNLSEEDMQLLSGVKFMQIPIEIVKFDDYRFILNHCQSFVKYSGRYYNDFWVKIK
FT                   VKAHSINEALKCGWRYAENLRSLANFFLTKNTYALYQFPPQPLSVILPSKFYFVLDDNE
FT                   KYCTHGLNSGEYEFRTTYLNVDKMREVIDFVNKFDDFQEEKIKEILLECIWLYCIALDL
FT                   TGVDYPYSYGLLWSVIEKIVKKIFGENKKFISFLKSLYHNDNILSELINALWKKRNLFA
FT                   HEGTILDVELEDMNWVRLIVCDLINKAISKYF"
FT   gene            268494..268631
FT                   /locus_tag="DICTH_0261"
FT   CDS_pept        268494..268631
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0261"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19899"
FT                   /db_xref="UniProtKB/TrEMBL:B5YC36"
FT                   /protein_id="ACI19899.1"
FT                   /translation="MLFTIFTQRLDSEELLSKEYVKERIVNFLCYDLYKKKIVKGEYYD
FT                   "
FT   gene            268624..270393
FT                   /locus_tag="DICTH_0262"
FT   CDS_pept        268624..270393
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0262"
FT                   /product="beta-D-glucosidase"
FT                   /note="identified by match to protein family HMM PF00933;
FT                   match to protein family HMM PF01915"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18764"
FT                   /db_xref="GOA:B5YC37"
FT                   /db_xref="InterPro:IPR001764"
FT                   /db_xref="InterPro:IPR002772"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR019800"
FT                   /db_xref="InterPro:IPR036881"
FT                   /db_xref="InterPro:IPR036962"
FT                   /db_xref="UniProtKB/TrEMBL:B5YC37"
FT                   /protein_id="ACI18764.1"
FT                   /translation="MIKKTFLLLLIFLLFVSFIFSSEESIEEKVERLLSQMTLEEKVGQ
FT                   MTQVDSSYLYNPEDVKRYFIGSVLSGGNSGPSNPTPANWVEYVNRFQYYALQTRLRIPI
FT                   LYGIDAVHGNAKVYSAVVFPHNIGLGCTRNEKLVEDCARITAIETSAIGIRWSFAPCVA
FT                   VVQDVRWGRTYESFSENPDVVALLGSAVVRGFQGGSLSNKDSILACPKHFVGDGGTKFG
FT                   TSINGLLDQGDTRISEKELRNIHLKPYIFAIKNSAKSIMVSFSSWNGIKMHANKYLLTD
FT                   VLKKELGFDGFLVSDWKAIEQLPGNYEDQVAMSINAGIDMIMVPDNYVRFINTLISCVQ
FT                   KGRVPISRIDDAVRRILKVKFLLGLFENPYANKDLINKIGSKEHREVARRAVRESVVVL
FT                   QNKNKILPLSKNLKHICVVGPKANDIGSQCGGWTISWQGQKGNITVGTTILEAIKKSVS
FT                   NNTKVTFSPYGDNIPKDAEVIVAVVGEKPYAESMGDTFKPEIEYSDHLILQNIFKEKKP
FT                   IVMILLVGRPVDIENYLSKTFGVICAWLPGTEGEGITDILFGDFNPKGRLSFTWYTVDR
FT                   NKATFPYGYGLSY"
FT   gene            270399..271457
FT                   /locus_tag="DICTH_0263"
FT   CDS_pept        270399..271457
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0263"
FT                   /product="pyruvate-formate lyase-activating enzyme"
FT                   /note="identified by match to protein family HMM PF04055"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ACI20109"
FT                   /db_xref="GOA:B5YC38"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR016431"
FT                   /db_xref="InterPro:IPR034457"
FT                   /db_xref="UniProtKB/TrEMBL:B5YC38"
FT                   /protein_id="ACI20109.1"
FT                   /translation="MVDFPKEGRCKICGKESILISSFLGICRDCILNRFEEALPIIESA
FT                   HKRARAYFNLSYPAYSQKPYCNLCIHKCALNSEKSFCGLIENGSRWAGSSEKGLLEWYY
FT                   DPLPTNCVASFVCPEKDHYGYKNLAVFYASCNFNCLFCQNWHFHDYLKRKSPLYSVEDL
FT                   IEKIDSKTSCICFFGGDPTTQVAHALALAKKVKDRVRVCWETNGSMDSKILKEIFYISV
FT                   ESGGIIKFDLKAFDERIHIALTGVANKNTLENFRWAGEESKKIKDRVVVVASTLLVPGY
FT                   VNEEEVEKIADFIARINPDIPYSLLGFSPNFFFDNLPTTSKRHAERSFRVAKEKGLKYV
FT                   NIGNRFLLSNYY"
FT   gene            complement(271517..272716)
FT                   /locus_tag="DICTH_0264"
FT   CDS_pept        complement(271517..272716)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0264"
FT                   /product="phospholipase/carboxylesterase family"
FT                   /note="identified by match to protein family HMM PF02230"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19429"
FT                   /db_xref="GOA:B5YC39"
FT                   /db_xref="InterPro:IPR001375"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR041172"
FT                   /db_xref="UniProtKB/TrEMBL:B5YC39"
FT                   /protein_id="ACI19429.1"
FT                   /translation="MKSSLLNFLNRFLPFSITYAQEVPKATIVTRVMPIGERVVAVTLE
FT                   YSSEINANNLKPDMFSVETKLEGNFVKRTIKKVYANNNGALLPAPFTNQGKFLVLELDP
FT                   YEPSAVTATHDPQRLISKRLKLEYKVEQKVSIRSVDGKEFSPFSLTTSEEKHLIIDEFK
FT                   ALVYEDKELGVTIPYRFYVPKNVDKNKKYPLVVFLHGAGERGNDNFLHIAWYRGAVTFA
FT                   EPGQQAEHPCFVLAPQCPAGSSWTELLTGGNPFKPTRNLIAVANLIKKILKEENIDPDR
FT                   VYVTGLSMGGFGTFAILIEYPELFAAAIPICGGGDVNRLERIKDIPLWIFHAEDDNVVL
FT                   VEFSRAVVRRLVEIGGKVKYTEFLWGEMERQGYHPHASWIPVYDNEEVIDWLFQQKKSK
FT                   "
FT   gene            complement(272832..274658)
FT                   /locus_tag="DICTH_0265"
FT   CDS_pept        complement(272832..274658)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0265"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19422"
FT                   /db_xref="UniProtKB/TrEMBL:B5YC40"
FT                   /protein_id="ACI19422.1"
FT                   /translation="MLKKFLIISALFLIFNQMVYSNQISLPQNPPLKITPSDPILFEKV
FT                   EISNDINMQYTINLKNNSSYTISVKDLKVEIYHVGSNFRGAWAPSIELRKPSLDTQIQP
FT                   KASFQLIYKCNNSREEILKQMDEGILIYNSPNHFRISIKYKDRYYTYEGDFLWKPQLAD
FT                   LKVNNVEIEDLHEIKSGFHFNYLKVSIELENIGDMSPIFLKDKNKKTLETSFVKIIVRR
FT                   KSDKKIVAVLNAYPEINNERENNLSIYIDTNLMIPPKEKRKLTFKAEYSDPFSLIGDFD
FT                   ITIGFDAKIEESNIIYYHFFGDKNWQNNIVTKSVSFGSNSFEIISFYPEKLSSISPAPA
FT                   TPKEFPRKENNLMYIRVNSYLPLTLANENEIKVYFNNEPLRIFSIKFLDFTKNYSKYLI
FT                   WIEKPRKIERGQFKIDILGISKFSNYLEIDNKFTGITTSSSAPFYFDSVPIYYASLDDS
FT                   KSPYGLCPISIEDINLRGNAPMNLSIILRPKNLIWLEQGKGWSDVQKENPNADLSKYVS
FT                   SMASVYKVYVYVRPKDKIAWNFIDGAESPITLGPDKRNIINFSIDEVKNILKGNLKGGV
FT                   NEILIFVTYTYKDEEIVKEVISDMYWTEFTIK"
FT   gene            complement(274685..275227)
FT                   /locus_tag="DICTH_0266"
FT   CDS_pept        complement(274685..275227)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0266"
FT                   /product="chitinase 3"
FT                   /EC_number="3.2.1.14"
FT                   /note="identified by match to protein family HMM PF00877"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18317"
FT                   /db_xref="GOA:B5YC41"
FT                   /db_xref="InterPro:IPR000064"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:B5YC41"
FT                   /protein_id="ACI18317.1"
FT                   /translation="MRKKEYFFYFFLLVILLLISGCALKYSSREVTYEESKKALEFALK
FT                   QIGKPYVYGGQDPKVGFDCSGLVIWSYQQVIPNAMFFNNGKLYPDATVEALYNENTRHI
FT                   ETDELREGDIVFFADEENNIEHCGLYVERTNENNIKVIHASGGLNKVVLEECNPNEPLR
FT                   GYRICGFGRLIVSLVLR"
FT   gene            complement(275392..275607)
FT                   /locus_tag="DICTH_0267"
FT   CDS_pept        complement(275392..275607)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0267"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ACI20100"
FT                   /db_xref="UniProtKB/TrEMBL:B5YC42"
FT                   /protein_id="ACI20100.1"
FT                   /translation="MILPFYEALLPFQEFQLDTKHLLDKNSLPTDVYNHLVKFNLPQYE
FT                   WNIIDAKTRTRCNAYFFIIFHHIEYL"
FT   gene            275785..275898
FT                   /locus_tag="DICTH_0268"
FT   CDS_pept        275785..275898
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0268"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18746"
FT                   /db_xref="UniProtKB/TrEMBL:B5YC43"
FT                   /protein_id="ACI18746.1"
FT                   /translation="MIFLDIKEILYTIIINKLNKIFKSKIGGTKNEKDYFF"
FT   gene            275922..277349
FT                   /locus_tag="DICTH_0269"
FT   CDS_pept        275922..277349
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0269"
FT                   /product="parallel beta-helix repeat"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19062"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR039448"
FT                   /db_xref="UniProtKB/TrEMBL:B5YC44"
FT                   /protein_id="ACI19062.1"
FT                   /translation="MSSISCSKNQPPPPPPPGDTTGNVYYVSLNGNDNNPGTYDQPWRN
FT                   PGYASRQLKPGDTLIILGGTYILRQYDDDIIKPPSGNPNAWITIKGQENNRPILAGREA
FT                   LATAIDLSGVSYVRIENLEITHDPNAQGEAVYFWDGILIQGSPASHIILKDLYIHHIDG
FT                   MGMNFQDVEDLQILNCNIEYCGFGAIGGPEGAYGGWKNVRIEKCRLAYSGRYYQGVFDN
FT                   PENPYDRSDGFGIESSEGLIYIIDTIIAEYNKGDGLDSKAERTLISGCIVANNTCDGVK
FT                   LWGDGSRIENTLIYGRRYGDPTPAPWAAIVISSVSRSNARFEIVNVTVDDCVGENYLMY
FT                   FQYPDESDPNTLLPIPVLLRNNIFCGRGPECPIYMGECVTPTIDHNLFYFPNSLWVLQH
FT                   GENQYTSQDISSLGPGNKYGDPLFENPAILGQVGDYHLRNGSPAIDSGTSEGAPNKDLD
FT                   KNSRPQGNGYDMGCYER"
FT   gene            complement(277623..277976)
FT                   /locus_tag="DICTH_0270"
FT   CDS_pept        complement(277623..277976)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0270"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19695"
FT                   /db_xref="UniProtKB/TrEMBL:B5YC45"
FT                   /protein_id="ACI19695.1"
FT                   /translation="MKGLLLCVCQGTCPSFQNMNIFEILNTLRREGLVDFVAIHPQLCA
FT                   DDGDNFLSQIAKDGNSIEKLYIAGCDPKMQAKMFRDAFEKAGFDRIKHVGVDIRNMNTE
FT                   QALEAIRKLIQES"
FT   gene            complement(277973..278209)
FT                   /locus_tag="DICTH_0271"
FT   CDS_pept        complement(277973..278209)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0271"
FT                   /product="DNA-directed RNA polymerase subunit D"
FT                   /EC_number="2.7.7.6"
FT                   /note="identified by match to protein family HMM PF00037"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19326"
FT                   /db_xref="GOA:B5YC46"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:B5YC46"
FT                   /protein_id="ACI19326.1"
FT                   /translation="MSKTWYPVIDYEKCISCLACVNFCPHGVYDVQDGKPVVVRPEECV
FT                   DFCKGCLKGACPTGAISFVGDKVKTITDGGEAQ"
FT   gene            complement(278224..278385)
FT                   /locus_tag="DICTH_0272"
FT   CDS_pept        complement(278224..278385)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0272"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19960"
FT                   /db_xref="UniProtKB/TrEMBL:B5YC47"
FT                   /protein_id="ACI19960.1"
FT                   /translation="MKNLYDAILSIKNEDLEKAKELLKLRVSLREENKCVMRKHPKWEE
FT                   IVKEVKIK"
FT   gene            complement(278405..278620)
FT                   /locus_tag="DICTH_0273"
FT   CDS_pept        complement(278405..278620)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0273"
FT                   /product="transcriptional regulator, ArsR family"
FT                   /note="identified by match to protein family HMM PF01022"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18445"
FT                   /db_xref="GOA:B5YC48"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B5YC48"
FT                   /protein_id="ACI18445.1"
FT                   /translation="MKRYERILKALSEEKRLKVFALLLHMGGEYYVCEIADALEEFHYN
FT                   VSKYLKELKMVDLVEENRIVKEFYIQ"
FT   gene            complement(278788..279249)
FT                   /locus_tag="DICTH_0274"
FT   CDS_pept        complement(278788..279249)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0274"
FT                   /product="TPR repeat protein"
FT                   /note="identified by match to protein family HMM PF00515;
FT                   match to protein family HMM PF07719"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19329"
FT                   /db_xref="GOA:B5YC49"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:B5YC49"
FT                   /protein_id="ACI19329.1"
FT                   /translation="MNNKIRKWLPYIIVAVIVIIVIGVIVSTSKKPAEQVTTTPETQTP
FT                   IVQETTTTPTEETKTAKTPDEEAYEKARDLYYEGKYKEAIEAYRKFLKDYPKSEYADDA
FT                   QYEIALCYEFTEDYKKAIEEYEKLIKNYPNSEYVEAAKSSIEYLKEYAK"
FT   gene            complement(279362..280651)
FT                   /locus_tag="DICTH_0275"
FT   CDS_pept        complement(279362..280651)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0275"
FT                   /product="alpha-galactosidase"
FT                   /EC_number="3.2.1.22"
FT                   /note="identified by match to protein family HMM PF02056"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18714"
FT                   /db_xref="GOA:B5YC50"
FT                   /db_xref="InterPro:IPR001088"
FT                   /db_xref="InterPro:IPR015955"
FT                   /db_xref="InterPro:IPR022616"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B5YC50"
FT                   /protein_id="ACI18714.1"
FT                   /translation="MPKIAFIGAGSVVFAKRLIMDILSYPELSDAEIALMDINKERLEL
FT                   IYELTKKIIEKLNSPAKVIATLDRREALDGANYVINMIQVGGLEMFEKDVEIPRKYGID
FT                   QTVGDTIGPGGVFRGLRTIPVLLDIARDMEELCPDALFINYSNPMAINCWALNKATKIK
FT                   NVGLCHSVQGTAMQLASYIGVPYEEVYYWVAGINHMAWFLEFKRNGEDLYPRLWQAMEN
FT                   PEIYKKDAVRFEIMKYFGYFVTESTHHMSEYVPYFRKNPERIKELIPERWDYLEICKNG
FT                   WQPHYERIKKEIKGEEPIIIERSHEYASSIIYSMETNNPCRINGNVNNDNLITNLPKDC
FT                   CVEVPCLVDKSGIHPCFVGDLPPQLAALNRTNINVQELAVLGALEKDPNKIYQAIMLDP
FT                   LTSAILELREVKKMVDEMLEAEKEWIKIFE"
FT   gene            280796..281689
FT                   /locus_tag="DICTH_0277"
FT   CDS_pept        280796..281689
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0277"
FT                   /product="2-hydroxyhepta-2,4-diene-1,7-dioate isomerase"
FT                   /note="identified by match to protein family HMM PF01557"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19798"
FT                   /db_xref="GOA:B5YC51"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/TrEMBL:B5YC51"
FT                   /protein_id="ACI19798.1"
FT                   /translation="MKIANLISGDRFFIGLLFEDKILNLTKAILMYSSIYDKTLKHMEK
FT                   IDDLLYIDNLYEYLNKVQDFILEHNLIYSLAEEKYKFLPPILKPQKILALGRNYVEHAK
FT                   ELGHKVPKEPVFFSKALSSLLAHEGKIVYPSFLTRVDPEVELGVIIRKRGKYIKEDEAF
FT                   DYVLGYTVVNDVTARDMQAEDFSNTNPWFRSKSFDTFCPVGPFLVLKESIKDPHNLNIE
FT                   LRVNGEVRQKDNTKNMLFKIPQIISYISKHLTLEAGDIIATGTPSGIAPIYPGDVVECI
FT                   VEKIGVLRNKVVKEDL"
FT   gene            complement(281684..282145)
FT                   /locus_tag="DICTH_0276"
FT   CDS_pept        complement(281684..282145)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0276"
FT                   /product="bacterioferritin comigratory protein"
FT                   /note="identified by match to protein family HMM PF00578;
FT                   match to protein family HMM PF08534"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19755"
FT                   /db_xref="GOA:B5YC52"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR024706"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B5YC52"
FT                   /protein_id="ACI19755.1"
FT                   /translation="MEKKAPNFTLPDQNGKEISLSDYKGKWVILYFYPKDMTSGCTKEA
FT                   VGFSEKIDEFTKRNAVVIGISKDSVESHKKFADKYNLKITLLSDKDAKVIKEYGAWGKK
FT                   KMYGKETEGTIRSTFIISPEGEILHEWKNVKVDGHVEEVIKKLDELIAS"
FT   gene            complement(282161..283234)
FT                   /locus_tag="DICTH_0278"
FT   CDS_pept        complement(282161..283234)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0278"
FT                   /product="oxidoreductase, 2-nitropropane dioxygenase
FT                   family"
FT                   /note="identified by match to protein family HMM PF03060"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18925"
FT                   /db_xref="GOA:B5YC53"
FT                   /db_xref="InterPro:IPR004136"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:B5YC53"
FT                   /protein_id="ACI18925.1"
FT                   /translation="MKLPSLKIGNLIASVPIVQGGMAVGISLSGLASAVAEEGGIGVIG
FT                   TAGIGMEEEDFFENFIEANIRALRKEIRKAKEKTKGIIGVNILVALSNFADMVKTALEE
FT                   KIDIIFSGAGLPLDLPKYLKKGDKTKLVPIVSSGRAARIIAKNWIEKYNYIPDAFVVEG
FT                   PLAGGHLGFKKEELKDPEITLESRLKEVLDEVKILEEKYDKEIPVIAGGGIYDGKDIAK
FT                   FLKLGAKGVQMATRFVATYECDADEKFKEAYLKCKKEDIVIIDSPVGLPGRAIKNEFLE
FT                   AVERGEKKPYKCPFHCIRTCDYQNSPYCIAIALLNAKKGNFKYGFAFAGANAYRIEKIV
FT                   KVKDLMAELVKEAEENM"
FT   gene            complement(283260..284027)
FT                   /locus_tag="DICTH_0279"
FT   CDS_pept        complement(283260..284027)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0279"
FT                   /product="enoyl-[acyl-carrier-protein] reductase (NADH)"
FT                   /EC_number="1.3.1.9"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18549"
FT                   /db_xref="GOA:B5YC54"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR014358"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B5YC54"
FT                   /protein_id="ACI18549.1"
FT                   /translation="MLLQGKKIAVFNVANKKSIAWAIAQSIMKFGGEVIIGYQNERLKE
FT                   NVEELIADLNPKPLILECDVSKDENIEKVVKEIESNVGKIDGFVHSIAFAPSEALKNPF
FT                   IETSREAFLTAMEVSVYSFVAMSRIFKPILNTNSSIITLTYYGSEKVIPNYNVMGVAKA
FT                   ALEASVRYLAYDLGSENIRVNAISAGPLSTLAARGIARFTDMLEYHKERAPLRRNIEHR
FT                   EVGDTAVFLLSDLSSGITGEVIYVDAGYNIMGM"
FT   gene            complement(284097..284870)
FT                   /locus_tag="DICTH_0280"
FT   CDS_pept        complement(284097..284870)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0280"
FT                   /product="DeoR-family transcriptional regulator"
FT                   /note="identified by match to protein family HMM PF00455;
FT                   match to protein family HMM PF01022; match to protein
FT                   family HMM PF08220; match to protein family HMM PF08279"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19791"
FT                   /db_xref="GOA:B5YC55"
FT                   /db_xref="InterPro:IPR001034"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR014036"
FT                   /db_xref="InterPro:IPR018356"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:B5YC55"
FT                   /protein_id="ACI19791.1"
FT                   /translation="MLPEERRTKILELLEKERGVKVSDLVKIFNVTGATIRRDLETLEK
FT                   EGLLKRTHGGAVLPHSFSFEPLYITKKRQNLKEKQAIGKVAAELINDGESVFIETGSTT
FT                   LQIAKNIKHKHDVTVITNSIEVARELLSARGVEVILTGGLLRKETVALIGPLAERVLKE
FT                   FRVDKVFLGISGIIPSKGMYTASIAEAQIKKLIIEMGREIIGVSDHSKFGKECFAFVAP
FT                   TKAMNKIIVDEKVPTHYIDELKNQGVEVIIAPVED"
FT   gene            complement(285129..285407)
FT                   /locus_tag="DICTH_0281"
FT   CDS_pept        complement(285129..285407)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0281"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18424"
FT                   /db_xref="GOA:B5YC56"
FT                   /db_xref="UniProtKB/TrEMBL:B5YC56"
FT                   /protein_id="ACI18424.1"
FT                   /translation="MITLEAKRTGFSYRRLKALILRKYSLSISENTIKKHLLDKTSLPT
FT                   DVYNHLVKFNLPQYEWNIIDAKTRTRFTAYSFIIFVVLWLRAHNVRH"
FT   gene            complement(285404..285550)
FT                   /locus_tag="DICTH_0282"
FT   CDS_pept        complement(285404..285550)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0282"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19391"
FT                   /db_xref="UniProtKB/TrEMBL:B5YC57"
FT                   /protein_id="ACI19391.1"
FT                   /translation="MILSYHEIRNLSPEKAREIVIRAINGPLHDLHKNPYSSPNKLLLP
FT                   SKT"
FT   gene            complement(285562..285744)
FT                   /locus_tag="DICTH_0283"
FT   CDS_pept        complement(285562..285744)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0283"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19425"
FT                   /db_xref="UniProtKB/TrEMBL:B5YC58"
FT                   /protein_id="ACI19425.1"
FT                   /translation="MSIRNNFNQPYRYGDRYQYEEYRNNNEDKKIKRIEAVSRLLGIIK
FT                   KLNLSFFRSLNPFQG"
FT   gene            285883..287772
FT                   /locus_tag="DICTH_0284"
FT   CDS_pept        285883..287772
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0284"
FT                   /product="oligopeptide ABC transporter, periplasmic
FT                   oligopeptide-binding protein"
FT                   /note="identified by match to protein family HMM PF00496"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18647"
FT                   /db_xref="GOA:B5YC59"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:B5YC59"
FT                   /protein_id="ACI18647.1"
FT                   /translation="MKKFLITSLLLTFLFLMGGNVFSQGLPAGIERTETFIVDQIYRHS
FT                   NTLKYNVWVPNGGETPISHALLTDTLWFVDQQTGKWINSLAKEPPKYNSDFTEMTVNLR
FT                   NNIYWSDGVRFTADDLVFTVQTIMNTPGMLWNAELTKYVKSVEKLNDFSVRFKLKEPNP
FT                   RFHYYFTVRWNGVYMMPKHVWEKVKDPLQFTFWPPVSLGAYVIKDADPQGYWILYQLRD
FT                   DWKRTTSGIITGRSGPKYILQIFYGPNEKKVAAMLGHNLDVLMDLDIEAFLALIKRNPY
FT                   ARSWYKDFPWAWPDELDSRIFAFNNEKYPFNLKDVRWALTLALDIVKLNTEYVGGVSKV
FT                   NPIPQPPVPFLMKYYHKPLKTWLKAFRLDLGDGQYFKPFDDTIPQKIADWAKKQGYTVS
FT                   GNPEDVFGIGWWKYAPDVAEKLLIKNGFKKVGGKWYLPDGKPWKFSIVAAPDEVDAFRL
FT                   ALGAADQWKKFGIDVTVEALERTPYYERVQLGDFDVSSSWSDACSACAANAVIDKWQYI
FT                   QGLHSTYYAPIGQRSLTGNSLRVKDKKLDEIIEKLSKISPNDPKTLEYGREFMKLWVEN
FT                   MYGIITHGFKKFITIDTYYWTGYPTAESPKVQPNYWFMGGKFTFPYLEPTGRK"
FT   gene            287848..288849
FT                   /locus_tag="DICTH_0285"
FT   CDS_pept        287848..288849
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0285"
FT                   /product="oligopeptide ABC transporter, permease protein"
FT                   /note="identified by match to protein family HMM PF00528"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19135"
FT                   /db_xref="GOA:B5YC60"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B5YC60"
FT                   /protein_id="ACI19135.1"
FT                   /translation="MENYVKYIITRFIQTLIVIFIGITIVFFAPRFTPMDPVQSVIMRA
FT                   YSQSTVDASVIQGLVETLKDLYGLRGTIWEQYIRFWKHLLKGDLGPSFTMFPTPVIQII
FT                   FKALPWTIGLLLTSTLIAWLLGIILGTLVGYFPNKSFSKILSIIITCIYPIPYYIIALI
FT                   LIFIFCYIFPIFPLMGGVQIGLKPSFSLTYILSVIKHGFLPALSLIIGTTCFIFMTQRA
FT                   LVSTLIASDFIVFSEVAGLSRKRIFLYLIRNSMLPQITDLALFLGGIFGGALMTEIVFS
FT                   YPGIGQILYSAILQSDFNLIMGISIFSVVGVAFAAFILDLIYPLLDPRIRVK"
FT   gene            288861..289727
FT                   /locus_tag="DICTH_0286"
FT   CDS_pept        288861..289727
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0286"
FT                   /product="oligopeptide ABC transporter, permease protein"
FT                   /note="identified by match to protein family HMM PF00528"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18324"
FT                   /db_xref="GOA:B5YC61"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B5YC61"
FT                   /protein_id="ACI18324.1"
FT                   /translation="MKVIRDLLKYDKNFLVGFIFLVFALLLAILSFFSPYSPQERYVVE
FT                   RDKPPSFSHILGTNSLGQDVFWYLTFAIRNSLIIGLLAVILGRAVAVVVGLLSGYLGGR
FT                   FDRIVTTITDSFIVLPRLPILILLSFTIKGNMNFITMALLIAFFDWAWPSKRYRSQILS
FT                   LKEMEFTNTAKFSGRRIFQIVFKEHMPFLIPYLLADSISGFLFAIGMEITLSVLGLTNL
FT                   DIPTIGTMIFWANYYQSMLNGTWWWISSPVLILIITVLGFYLLSVSIGTFLDPRVRLQK
FT                   ISVGENK"
FT   gene            289724..290740
FT                   /locus_tag="DICTH_0287"
FT   CDS_pept        289724..290740
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0287"
FT                   /product="ABC transporter"
FT                   /note="identified by match to protein family HMM PF00005;
FT                   match to protein family HMM PF08352; match to protein
FT                   family HMM TIGR01727"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19250"
FT                   /db_xref="GOA:B5YC62"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B5YC62"
FT                   /protein_id="ACI19250.1"
FT                   /translation="MMSRDSKDLLVDVDNLKAYYVTRLYGINRIVKAVDNVSFEIYKNE
FT                   ILGIAGESGCGKSTLLKVLLRIIKPPLFVYDGSVNYFLQDKEYINIISLGEEEIKSLRW
FT                   KLMSYIPQGSMNVLNPVRKIKNTFRDFIKEHFKEEFEEVNINKLIKEHLESLGLPSEVL
FT                   DLYPHQLSGGMKQRVTIALSTLFKPKIIFADEPTTALDVIVQRGVLQLLKKIQREEKNT
FT                   IVIVSHDMGIHAYVSQRIAIMYAGKIIEIADKREIYTNPLHPYTKYLINSLPRIGDKSY
FT                   KASIPGTPPSLANPPMGCRFHERCPEAQNVCREQEPLLEDVGNNHKVACHFVKGGKL"
FT   gene            290737..291723
FT                   /locus_tag="DICTH_0288"
FT   CDS_pept        290737..291723
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0288"
FT                   /product="oligopeptide ABC transporter, ATP-binding
FT                   protein"
FT                   /note="identified by match to protein family HMM PF00005;
FT                   match to protein family HMM PF08352; match to protein
FT                   family HMM TIGR01727"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19035"
FT                   /db_xref="GOA:B5YC63"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B5YC63"
FT                   /protein_id="ACI19035.1"
FT                   /translation="MRQEDFLIVRNLKKVFSVGSLLLKTNIYAVNNVSFEIDLTRPEIF
FT                   TLAGESGSGKSTLARMLLGLIKPTFGEILYKGRDITKLSSQKDWYNFSKEVQPIFQNPF
FT                   ETFNPLVKVETYLYDTALNYKVVSSLNSHDYIEEILITVGLTLEEIKNRYPHEFSGGQL
FT                   QRLSIARALITRPTLLIADEPVSMIDASLRMSIVNLFKELKEKFNVTVIYITHDLATAY
FT                   YISDRIAIMLRGNIVELGPVERVLLNPLHPYTKLLKSSIPEPTAELSWDEEVKLTVLEE
FT                   KEFGLGGCKFAYRCTEASDICFEREPIESFVDERIVKCHMYSSHKFI"
FT   gene            291766..294531
FT                   /locus_tag="DICTH_0289"
FT   CDS_pept        291766..294531
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0289"
FT                   /product="alpha-rhamnosidase"
FT                   /note="identified by match to protein family HMM PF05592;
FT                   match to protein family HMM PF08531"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19983"
FT                   /db_xref="GOA:B5YC64"
FT                   /db_xref="InterPro:IPR008902"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="InterPro:IPR013737"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR016007"
FT                   /db_xref="InterPro:IPR035396"
FT                   /db_xref="InterPro:IPR035398"
FT                   /db_xref="PDB:6I60"
FT                   /db_xref="UniProtKB/TrEMBL:B5YC64"
FT                   /protein_id="ACI19983.1"
FT                   /translation="MKSSNIYSPFDLKCEFTTNPLGVDKKNPIFSWKLRHLEKNEKQTA
FT                   YQVIVSSSLETINDNIGDVWDTGKVLSSEQVIKYEGKELEPCKVYFWKVRWWDSKDQES
FT                   PFSVVNTFETGLMNEENWKAKWITKKEHKYEVYSPDGAPFGLNYTIAYAPMFRKSFSIS
FT                   KKIKRARVYIAGLGLYELYINGERIGDRVLDPGQTDYKKRVLYTVYDVSKNIRDGKNAI
FT                   GVILGNGRYVKEYGYDFPKLIIQVLVEYEDDSIEWIVSDESWKTTYGPITLNSLYHGEI
FT                   YDGRKEIKGWNLPDFDDSTWENAILAEPPGGKLYSEIYPPIRITKTIKPIKMWSPEPGT
FT                   YVYDFGQNYTGWIKIKVRTNESGKEIRIRHAELTYEDGTLNYSTNRTALATDVYITKGE
FT                   GYEEYEPRFTYHGFRYVEILGYPGVPTLEDIEGKVVHTAVESNGEFICSNELINKIHHN
FT                   IIWGQLSNLMSIPTDCPQRDERMGWMGDAQLSAEEAIFNFDMIGFYRKYLNDIRDAQKE
FT                   NGSLSDVIPPYWSIYPGDPAWSTAYITIAWYLYQYYGDKYVLEEHYEGFKKYVEFLKKL
FT                   APDYIVSFYKYGDWCQPGTVRPKDNSGELTSTFYFYHDVITLSKIAKLLGKEADYKYYS
FT                   ELADKIKSAFNKKFLKEKAYASIPTELSEENVKALLEKYPEDIKDFLRQQFTILSSLGM
FT                   FTSQTLNTLPLYLNLVPEDKVQDVLKTLLEDIIIRHDYHLDTGIVATRYIFDVLTSYGY
FT                   DEVAYKIVNQKTYPSFGYMIEEGATTLWERWEKLTSTGMNSHNHIMFGSVDAWFYRVIA
FT                   GVRVGEPGWNKIIFEPHPVGDLKYAKARLNTIKGEVEINWQKTENIFSMRISVPVNSEG
FT                   EVHVPKLFERFVVKEGDNIIYEKKGDLEENEKYIVIRVGSGSYNFYMEKI"
FT   gene            294491..294610
FT                   /locus_tag="DICTH_0290"
FT   CDS_pept        294491..294610
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0290"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18805"
FT                   /db_xref="UniProtKB/TrEMBL:B5YC65"
FT                   /protein_id="ACI18805.1"
FT                   /translation="MDPDHTTFIWKRYKTKNNLSFYLTGGYFYKCPPVFNGTW"
FT   gene            295052..296080
FT                   /locus_tag="DICTH_0291"
FT   CDS_pept        295052..296080
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0291"
FT                   /product="transcriptional regulator"
FT                   /note="identified by match to protein family HMM PF00356;
FT                   match to protein family HMM PF00532"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18710"
FT                   /db_xref="GOA:B5YC66"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:B5YC66"
FT                   /protein_id="ACI18710.1"
FT                   /translation="MVTIKDVAKKAGVSVMTVSRVINGSKNVKESTREKVLRAIEELGY
FT                   VPNSVARSLILNKTLTIGLVISDITNPFFTTIARGVEDTAISKHFTVILCNTDEDPEKE
FT                   MMYAEVLARSKVDGVIYASASGKKAPLKSLFLKKIPIVLIDRTIEGVNDLDIVRGDSVL
FT                   GAYLLTKHLIDLGHRRIGIIVGSHFISTARDRIEGYKKALNEANIPIDESLIKINENSK
FT                   FSKEDGYRLTKELLNLENPPTAIFGGNNLMAVGALLAIRERGLEIPEDISLVSFDDIES
FT                   LSEVYPFLTVVKQPAYTMGVIATEILIRRIENRDKIKEKREILLTPELIIRKSTAPPKR
FT                   KI"
FT   gene            296101..297921
FT                   /gene="fucI"
FT                   /locus_tag="DICTH_0292"
FT   CDS_pept        296101..297921
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fucI"
FT                   /locus_tag="DICTH_0292"
FT                   /product="L-fucose isomerase"
FT                   /EC_number="5.3.1.25"
FT                   /note="identified by match to protein family HMM PF02952;
FT                   match to protein family HMM PF07881; match to protein
FT                   family HMM PF07882; match to protein family HMM TIGR01089"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19515"
FT                   /db_xref="GOA:B5YC67"
FT                   /db_xref="InterPro:IPR004216"
FT                   /db_xref="InterPro:IPR005763"
FT                   /db_xref="InterPro:IPR009015"
FT                   /db_xref="InterPro:IPR012888"
FT                   /db_xref="InterPro:IPR012889"
FT                   /db_xref="InterPro:IPR015888"
FT                   /db_xref="InterPro:IPR038391"
FT                   /db_xref="InterPro:IPR038392"
FT                   /db_xref="InterPro:IPR038393"
FT                   /db_xref="UniProtKB/TrEMBL:B5YC67"
FT                   /protein_id="ACI19515.1"
FT                   /translation="MNRIFPVRVGEKRFIEEYPKVGIRPTIDGRYGGVRESLEEQTMNL
FT                   AKAVAEFIENNVYLPNGEKVKCVIPQRCIGGVAEARMADELFRKEGVGVSITVTPCWCY
FT                   GAETMEMSLDVPKAVWGFNGTERPGAVYLAAVSAAHNQKGLPIFKIYGKDVQDKDDYSI
FT                   PSDVKEKILKFVKSALAVAIMKNKSYLSIGSVSMGIAGSIVDPDFFEDYLGMRVEYVDM
FT                   TEIIRRIERKIYDEEEFKRAMEWVKKYCKEGEDPNPPDKRVDEKKKQEVWEFVVKMTLI
FT                   IRDLMVGNKKLEELGYPEESLGHNAIVAGFQGQRQWTDHFPNGDFTEAILNTSFDWNGL
FT                   RQPYILATENDSLNGVVMLFGHLLTNTAQIFADVRTYWSPEAIYRVTGWKPEGLAQNGI
FT                   IHLINSGPAALDGTGQQEIEGRPAIKPFWEISDEEVIKCLDATKFCYANLGYFRGGGFS
FT                   TKFITRGGMPITISRLNIVKGLGPVLQIAEGYTVELPPHVHEILDRRTDPTWPTTWFVP
FT                   KLTGKGAFKSVYSVMENWGANHCAITYGHVGDLFITLASILRIPVNMHNVEEERIFRPS
FT                   AWSMFGTEDLEGADFRACVNFGPLYKKVAK"
FT   gene            297966..299450
FT                   /locus_tag="DICTH_0293"
FT   CDS_pept        297966..299450
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0293"
FT                   /product="ABC sugar transporter, ATPase subunit"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18440"
FT                   /db_xref="GOA:B5YC68"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR015861"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B5YC68"
FT                   /protein_id="ACI18440.1"
FT                   /translation="MENINKSFPGVQALKDAYFELNRGEVHALVGENGAGKSTLMKILV
FT                   GAYRKDSGRIIYKGKEVDIPNPRVAQEMGISMVFQELNLMPHLTVAQNIFIGREPKRKN
FT                   IPIFLDDNEINKRTKELLDMLHLKVEPNVKVSNLSVGKQQMVEIAKALSFNSEVIIFDE
FT                   PTAALSEAETEELFNVIRKLKSQGIGIIYISHRLEELKEIADRVTVMRDGQYIATDYMK
FT                   NLTIEKIISMMVGREIYETLREREVDENAEVVLEVRNLKRGKVFKDISFSLRKGEILGF
FT                   AGLIGAGRTEVARAIFGADPIDSGEIYVKGKRVSIKNPWDAINHRIAYLSEDRKRYGLM
FT                   PDLDVKSNIILPSMRDFLRALGFVDDKKAESVSNEYVKRLKIRTPSVKQKVKNLSGGNQ
FT                   QKVVVAKWLLKNCDILIFDEPTRGIDVGAKNEIYKLLNELIAEGKSIIMISSELPEILR
FT                   MSHRIVVMCEGRITGILDANEATEEKILKYATMYED"
FT   gene            299468..300454
FT                   /locus_tag="DICTH_0294"
FT   CDS_pept        299468..300454
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0294"
FT                   /product="ribose transport system permease protein RbsC"
FT                   /EC_number="3.6.3.17"
FT                   /note="identified by match to protein family HMM PF02653"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19275"
FT                   /db_xref="GOA:B5YC69"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:B5YC69"
FT                   /protein_id="ACI19275.1"
FT                   /translation="MAEKLSALFSKSGLRQILMFASLFLLFAFFSLASPNFLTYENVIA
FT                   ILLATCVNGLLALGVTFVIITGGIDLSIGTVMTISSVMSGVFITFWKLPVFVGVLGGIL
FT                   TGVLAGFINGTVISKMKLPPFIATLGMMMIAKGLALVVSGCKPIYFNDAPIFNKIAMGS
FT                   ILGSIFPGLGEFPNAILWFILFIIIAHIILTRTALGRYTFAIGSNEEAARLSGLNVDKW
FT                   KTIIYALCGMFVGIAGVIMASRLNSAQPALGQGYELDAIAAVVIGGTSLRGGEGSIIGT
FT                   VIGALIMSTLTNGLRILSVPQEWQIVVSGIIIIGAVYLDIIRRSREV"
FT   gene            300524..301462
FT                   /locus_tag="DICTH_0295"
FT   CDS_pept        300524..301462
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0295"
FT                   /product="ABC sugar transporter, periplasmic ligand binding
FT                   protein"
FT                   /note="identified by match to protein family HMM PF00532"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18444"
FT                   /db_xref="GOA:B5YC70"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:B5YC70"
FT                   /protein_id="ACI18444.1"
FT                   /translation="MKRFLIVTLISLFLIGFSITSAQRPYIAMISKGFQHQFWQAVKMG
FT                   AEKAAKDLNVTITFEGPESEAMVDKQIEMLQAALAKKPAALCIAALDSKAVIPYLEKAH
FT                   SMGIPVIGFDSGVDSDIPVTTVATDNIKAAGYAADMMAKFINRVGEVALVVHDQTSRTG
FT                   IDRRDGFVNRIKQKYPLIKIVAIQYGGGDHLKSTDLAKAIIQAHPRLKGIFGANEGSAI
FT                   GVINAVREMNKVGKIVVIGYDSGKQQIDAIKSGLMAGAITQNPVGMGYMAVEAAVKAIK
FT                   GEKLPKFIDSGFYWYDKTNIDDPKIKQCLYE"
FT   gene            301696..302700
FT                   /gene="rhaS"
FT                   /locus_tag="DICTH_0296"
FT   CDS_pept        301696..302700
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rhaS"
FT                   /locus_tag="DICTH_0296"
FT                   /product="rhamnose ABC transporter, rhamnose-binding
FT                   protein"
FT                   /note="identified by match to protein family HMM PF00532;
FT                   match to protein family HMM TIGR02637"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19263"
FT                   /db_xref="GOA:B5YC71"
FT                   /db_xref="InterPro:IPR013459"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="InterPro:IPR030159"
FT                   /db_xref="UniProtKB/TrEMBL:B5YC71"
FT                   /protein_id="ACI19263.1"
FT                   /translation="MKKFLIFVLLVLLIVLGTESFAQKKYVIGLVTKTAGNPFFEAVNK
FT                   GAQEAAKELGITVIHQAPAASSVQGQIDIINSMIAQKVSAICISANDPDALVPACRKAQ
FT                   LRGIPVVTFDSAVKPQGRKLFVNQADMEQIGRIQVQLLAKMINYEGEIAILSAASTMAN
FT                   QNTWIAWMKEELKKPEYSKMKLVAIVYGDDIREKSYNEAMGLFKSYPNLKGIIAPTTVG
FT                   IAAAARAIEDAGLSGKVQLTGLGLPSEMAEYVKRGTCKAFALWNPIDLGYATIYATYRL
FT                   LTREIKGNVGEKVNLGKLGERTIVDEGNGGRMIILGPPFVFDASNIDYWSKVY"
FT   gene            302772..304286
FT                   /locus_tag="DICTH_0297"
FT   CDS_pept        302772..304286
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0297"
FT                   /product="ribose transport ATP-binding protein RbsA"
FT                   /EC_number="3.6.3.17"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19595"
FT                   /db_xref="GOA:B5YC72"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR015861"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030281"
FT                   /db_xref="UniProtKB/TrEMBL:B5YC72"
FT                   /protein_id="ACI19595.1"
FT                   /translation="MEEYILEVRNIYKSFTGTKPVLEGVSFSLKKGEIHALLGENGAGK
FT                   STLIKIISGVLQPDHGDILLKGKKVHFSNPLDAQRHGIAAVFQELALFPELSVAENIFI
FT                   GHYKYKTPFKSINWKDLYKEAKDFLSSLGIEIDPKVPVKNLSIAERQIVEIARVLSINP
FT                   EILIMDEPTSSLTLEETQRLFSIIKSLKERGTSIIFISHRLEEVFEIADRVTVLRDGQY
FT                   IGTKNVSETNVDELIQMMVGRKLEDMYPKVEAKRGELLLKVDGLTRSGEFYDVSFELFE
FT                   GEVLGIAGLVGSGRTEVAQTIFGIRKKDKGKIYVRGREVDIKSPKDAISLGIVYVPEDR
FT                   HQHGLLLPMDIVCNITLPVLESLASRGIIDRREEEILTKRYFEILDIRASGIRQKVMSL
FT                   SGGNQQKVVLAKWLATKPKVLILDEPTRGIDVGAKVAIYQLINKLAQEGYGIILISSEM
FT                   PEIIGMSDRILVMHEGRIVGTISRKEATQEKILSMALGRKIYSKSL"
FT   gene            304302..305309
FT                   /locus_tag="DICTH_0298"
FT   CDS_pept        304302..305309
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0298"
FT                   /product="ribose transport system permease protein RbsC"
FT                   /EC_number="3.6.3.17"
FT                   /note="identified by match to protein family HMM PF02653"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18368"
FT                   /db_xref="GOA:B5YC73"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:B5YC73"
FT                   /protein_id="ACI18368.1"
FT                   /translation="MGRVGSVNELKEKTYDISRLREIGIIFPLFLFGLIIALRNPYFIS
FT                   WENLRYIFLDASILTIVAVGEMMVILTGGIDLSVGSNLALTGMIVSMLYRDLPNFPVIL
FT                   APLIGILIGGICGTINGLFVAKGKVIPIIATLSTMYIFRGIVYIISKGRWVNAHEMPEG
FT                   YKLLTRVEILGIPILVIYAIIVFLLFYYLLNYKAIGRSIYAVGNNPQSAVYIGINRVKV
FT                   LFLVYLISGILAGLGGVLYTSRFASAESSAAMGFELSAISAVVIGGVKTTGGAGKIGGV
FT                   VLGALLLTMIVNGLNVMKISPFYKLALQGLMFLIAVIVDSLIAERYQKGYRRRA"
FT   gene            305306..306262
FT                   /locus_tag="DICTH_0299"
FT   CDS_pept        305306..306262
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0299"
FT                   /product="ribose transport system permease protein RbsC"
FT                   /EC_number="3.6.3.17"
FT                   /note="identified by match to protein family HMM PF02653"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18969"
FT                   /db_xref="GOA:B5YC74"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:B5YC74"
FT                   /protein_id="ACI18969.1"
FT                   /translation="MKIKLKITWEIILLILIILVFLVSSFLSPYFLDIVNLLDTTTNFM
FT                   EKGLISLAMTYIIISGNIDISVASNMGMASAFMGVLHRMGTNIWICALIGLIIATLGGY
FT                   LNGYLIVRFKLPAIAVTLGTYALYRGIAYILLQDTAVGVDSESFMYLGQGYIAGTPIPF
FT                   SLVLYIIFAIIFGFILHKTTFGRYVYSIGNNEQACKFSAIPVEKIKIILFTITGFMSGL
FT                   GAILLTSRLSSIRPDIGSGLELEVIATVVLGGVSILGGSGNMIGVVLSLFLIGFLTYSL
FT                   NLLNIPSQVITIIMGSLLVGTVLISNLLEQRRVKVGK"
FT   gene            306285..306659
FT                   /locus_tag="DICTH_0300"
FT   CDS_pept        306285..306659
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0300"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19823"
FT                   /db_xref="InterPro:IPR009794"
FT                   /db_xref="InterPro:IPR036698"
FT                   /db_xref="UniProtKB/TrEMBL:B5YC75"
FT                   /protein_id="ACI19823.1"
FT                   /translation="MDREIGARIWLIPDAYLPEIGDPNLPSHESTCILNVNDKPAKVKF
FT                   TFYFEDKDPIESKEIIVPPKRTWHVRLDKSEEILGVKLERNVPFAIKVESDVKIVVQHS
FT                   RLDTRQPNLSYMTAIAWDVD"
FT   gene            306724..309099
FT                   /locus_tag="DICTH_0301"
FT   CDS_pept        306724..309099
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0301"
FT                   /product="pyruvate dehydrogenase E1 component, beta
FT                   subunit"
FT                   /EC_number="1.2.4.1"
FT                   /note="identified by match to protein family HMM PF00676;
FT                   match to protein family HMM PF02779; match to protein
FT                   family HMM PF02780"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18744"
FT                   /db_xref="GOA:B5YC76"
FT                   /db_xref="InterPro:IPR001017"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/TrEMBL:B5YC76"
FT                   /protein_id="ACI18744.1"
FT                   /translation="MPKEIPILPEFEPGYIEVGGKIPKFQYRKSLKEELKEGNITKEES
FT                   IDLFKCMLMIRNFEEMIYELRVNKGKYGNIRYLYIGATHLSIGQEAVPTGGISVIKKDD
FT                   YITSTHRGHGDAIAKSYFGLKDMSEEELIAFIENNREIASFLGYEWKNKDRNTLYQYAL
FT                   DIELFKAIGELFGKEWGACKGRGGSMHIADFSVGHLGANAIVGGSMGIAVGSAMASRYM
FT                   EDGRVTLCFIGDGAMNTGIAHEAINMACMSQFTNGLMSKRFGVPVIFMVMNNQYGESGQ
FT                   QRGEVTGIDYIAERGFAYSKNGMNAEIVNAMNVLAVRDAVKRAVEKARKGEGPILLEFW
FT                   GYRFMGHSLSDTLEKPEDGTYRTYDELQAWKKYDPLELYAKELIDAEVLTPEEIENLKK
FT                   EYRQRNENIAAKVIESPNPDPKDMTKYVFKEDSIDSFVPEKFRNVTVLKEPKFKDRDPD
FT                   VEINYKEAIIEALYQEMKRDGRVLMWGEDIADYGGSFGETKGLLEIFGRDRIFNTAISE
FT                   AAIVGAGVGAAMRGLRPIVEIMYIDFILIAMDQIANQAAKMRYMSGGQAEIPLTIITTI
FT                   GGGKGYAGQHSQSIESILTHFPGLKVVAPSDAYDAKGLLIASIRDKNPVIYIEHQNLLQ
FT                   DPLLLSLSKRKVPKEDYIVPIGKADIKRKAKNYDKSVTVVSWSAMIYAVLKAAEELEKE
FT                   GIELEVVDLRSLYPLDIDTIIDSVKRTGRFAVVTQAVEFMSLSSEIITQLYQKASSFLV
FT                   RPPIRIGAPFCPPPASPVLEKAYLPNDKRIIEEIKKLF"
FT   gene            309117..309377
FT                   /locus_tag="DICTH_0302"
FT   CDS_pept        309117..309377
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0302"
FT                   /product="pyruvate dehydrogenase E1 component, beta
FT                   subunit"
FT                   /EC_number="1.2.4.1"
FT                   /note="identified by match to protein family HMM PF00364"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19975"
FT                   /db_xref="GOA:B5YC77"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR003016"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="UniProtKB/TrEMBL:B5YC77"
FT                   /protein_id="ACI19975.1"
FT                   /translation="MVKNVIMPKVSDVMENGTVASWLKKEGDKVEKGEPLLEIEVEKAI
FT                   MEIESEYDGYLRKILVKEGETVPVGTILAYITDTLDENIPE"
FT   gene            309391..310095
FT                   /locus_tag="DICTH_0303"
FT   CDS_pept        309391..310095
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0303"
FT                   /product="dihydrolipoyllysine-residue acetyltransferase
FT                   component of pyruvatedehydrogenase complex"
FT                   /EC_number="2.3.1.12"
FT                   /note="identified by match to protein family HMM PF00198"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19091"
FT                   /db_xref="GOA:B5YC78"
FT                   /db_xref="InterPro:IPR001078"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="UniProtKB/TrEMBL:B5YC78"
FT                   /protein_id="ACI19091.1"
FT                   /translation="MNENNVSKRIPLNTVRRTIAERLSKSKQSIPHFYAVAEVDATNLV
FT                   EARANFVNEKNIKISYDDFIIKATALSMKEFPLINARFRETEIELLEHINIGFAVALGE
FT                   EGVVVPVIRDADKKAITQIFEERISLVEKARNRKLRVEDISDRSITVNNVGVFGVRSIL
FT                   AIINPPEVAIVTCGAIQDRVVVVNGEVRIRKMMDITLSADHRVIDGAYGSKFLMKIKEF
FT                   LESPDLLVSREE"
FT   gene            310098..311369
FT                   /locus_tag="DICTH_0304"
FT   CDS_pept        310098..311369
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0304"
FT                   /product="L-sorbose 1-phosphate reductase"
FT                   /EC_number="1.1.1.-"
FT                   /note="identified by match to protein family HMM PF08240"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19938"
FT                   /db_xref="GOA:B5YC79"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B5YC79"
FT                   /protein_id="ACI19938.1"
FT                   /translation="METIALRMYGKMDLRLEKFELPQIKEDEILAEIISDTSCPSTYKE
FT                   ILQGPDHPRVPKDVDKNPVIVGHEMAGVILKVGSKWKGKYEEGQKFTIQPALLYEKGPV
FT                   GVLSAPGYSYKYLGGLATKVIIPNEVMEQDCLLIYEGDAFYKASLVEPLSCVVGAVNAQ
FT                   YHTKENSYEHIMGIKRGGKTAILGGAGPMGLAFLAYLIYGPQNPSLLVITDIDDMKLQR
FT                   AMRAFPKEEVNKRGIDIRFVNPTKDQSYKDIRYDDIFVLYPSPKLVEEADSLLARDGCL
FT                   NFFAGPTDHNFTACVNFYKVHYDKHHFVATSGGNADDMKIALDLVQRKIIDPSPMITHV
FT                   GGLNVAKDVLLNFPNIPGGKKLIYTHIRFPLSEIEDFERLSVEGPKELRDIYRDLAQIV
FT                   RSNNGWWCKEAEEYLLTRGEKIDV"
FT   gene            311362..312159
FT                   /locus_tag="DICTH_0305"
FT   CDS_pept        311362..312159
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0305"
FT                   /product="sorbitol-6-phosphate 2-dehydrogenase"
FT                   /EC_number="1.1.1.140"
FT                   /note="identified by match to protein family HMM PF00106"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18373"
FT                   /db_xref="GOA:B5YC80"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B5YC80"
FT                   /protein_id="ACI18373.1"
FT                   /translation="MCECQRLKDRVAIVTGAAQGLGEALSYRLAKEGCNVTVADIKIEK
FT                   LQEVAKRIEEEYGRKALAVKCDVTSEEDVKNMVEKTVEAFGKLDIMVANAGILIAHDIT
FT                   EFPLEDWKKVIDVNLTGYFLCAREAAKVMVKQKSGVIIQINSKSGKKGSFRNSAYSASK
FT                   FGGIGFTQSIALDLAPYNVRVVAVCPGDLLDSPLWKESLYDQYAKRLGISKEEVRERYL
FT                   KQVPLGRACTYDDVANVVVFLASDEASYITGDAVNVSGGVEMR"
FT   gene            312164..313153
FT                   /locus_tag="DICTH_0306"
FT   CDS_pept        312164..313153
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0306"
FT                   /product="AP endonuclease, family 2"
FT                   /note="identified by match to protein family HMM PF01261"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19644"
FT                   /db_xref="GOA:B5YC81"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:B5YC81"
FT                   /protein_id="ACI19644.1"
FT                   /translation="MKVHIDIGINGAFLTRRWENPENFIKLTKELGYDYHSFCSDVLDP
FT                   FFSGDKSYQIETAKEVREYAEKYKVEIWDYYTGMATHRFHGLSHSDERVRQRMKEWIIS
FT                   AMDIVKEMGAKYLGGHWDALSVEVLQDLEKTKERIEYVYKTFKELAKIAKEKGLLGISN
FT                   EQMYIPSEKPWTLKEAEEFLIEVNKENDGVPVYITIDVGHQAGMHYGLSGEDLSYEEWL
FT                   KRFAVFSPIIHLQQTTRDASAHWPFTEEYNAIGHVKIDKVLSAIEYSFKHYKENPVSQY
FT                   LRPVEEIILIVEVIPSSTKTEEKLLKELKETAEYLRKYIPQGGIYYEF"
FT   gene            313143..313811
FT                   /locus_tag="DICTH_0307"
FT   CDS_pept        313143..313811
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0307"
FT                   /product="fuculose-1-phosphate aldolase"
FT                   /note="identified by match to protein family HMM PF00596"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ACI20122"
FT                   /db_xref="InterPro:IPR001303"
FT                   /db_xref="InterPro:IPR036409"
FT                   /db_xref="UniProtKB/TrEMBL:B5YC82"
FT                   /protein_id="ACI20122.1"
FT                   /translation="MNSEVEKIKRELVEIGKRIAQENLIVGPGGNISAKIEDKVYIKAS
FT                   GVSFEDATEDDYIGVDLNSGRVIEGDKRPSSEIWMHLECYKVREDVRAVVHTHPIYSIA
FT                   YAFQDEPLKLFTPDMVALLGGEIPVVEYVVPGGKEFARVVGEVIKNHNGVLVKNHGLVT
FT                   VGSNLKEALYRTLLIENSIKTIFIAKLFGNMRFFTKEQIEEIDNLEVEKYRRKLLKEKG
FT                   "
FT   gene            complement(313812..314537)
FT                   /locus_tag="DICTH_0308"
FT   CDS_pept        complement(313812..314537)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0308"
FT                   /product="3-oxoacyl-[acyl-carrier protein] reductase"
FT                   /note="identified by match to protein family HMM PF00106"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18329"
FT                   /db_xref="GOA:B5YC83"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B5YC83"
FT                   /protein_id="ACI18329.1"
FT                   /translation="MISLENKIILITGASRGIGEEIVRRLSKERANLALIARDAKRLKE
FT                   LKEELEKENTNVFTLPIDLREKNAPRIVVGEVIKYFGKLDILINNAGTALSKPLIETSE
FT                   EEWDEIMTINAKVPYFLCKYAIPYLKNSEIPTIINISSVVGYKGYVNQSAYTASKHALH
FT                   GFTKVLAQEVYEYGIRVHLISPGGVATDLVNKVRPDLQKASLIQPFEIAEIIVFLLKFR
FT                   NNAVIDEIQIRRKDNIPWR"
FT   gene            314729..315997
FT                   /locus_tag="DICTH_0309"
FT   CDS_pept        314729..315997
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0309"
FT                   /product="lactose ABC transporter substrate-binding
FT                   protein"
FT                   /note="identified by match to protein family HMM PF01547"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19399"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:B5YC84"
FT                   /protein_id="ACI19399.1"
FT                   /translation="MRFKKFIVLFLLLLIVFTVSYSQQPINLRVAWWGSQTRHNQTLEV
FT                   IKLFEKRYPYIKITPEYTSWSDYWTKLNTQAAAQNLPDVIQHDYQYITEWVNRGLLLPL
FT                   DDFVKNNVINLKDVAPNYIKPGIVNGKLYGINLGVNALGLVYDPEIFKQAGVPTPKNDW
FT                   TWDEFKDTVIRIKNKLGIYGVEGFTGQIECFKIWLIENGEWLYASDGKSIGFSKDTFVK
FT                   WWKMMLDIEDAGAAPNIAVDVSRSGLGVEDQFIVTKKSAMSLAWSNQLIAISRAAGRPL
FT                   KMVLFPRLDKKSKSGTYLKASMFFSINARTKYPKESAMFIDFFTNSLEAHKIMKAERGV
FT                   PISSRVQTFLKPYLEAPQKEAFAFVKLAEKEGSPTPPPDIPKHAEVSNNVIAPIWEQIR
FT                   YKKISIEDAYNNLKKEAERILNR"
FT   gene            316078..316986
FT                   /locus_tag="DICTH_0310"
FT   CDS_pept        316078..316986
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0310"
FT                   /product="putatice transporter permease protein YesP"
FT                   /note="identified by match to protein family HMM PF00528"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18606"
FT                   /db_xref="GOA:B5YC85"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B5YC85"
FT                   /protein_id="ACI18606.1"
FT                   /translation="MRLSKKKMSNIIAGYFFISPWIIGFLVFILFPLVASFLLSFTKYD
FT                   VLGTPKFIGLENWQRMFFEDRRFYNALRATFKYVVFAVPFRLLFAFIVALVLNLVEHKI
FT                   IRLYRAIYYVPSLVGGSVAVAVMWKQIFGMDGLVNYILQNFFGFSEKIMWLGDPRFAIW
FT                   TLILLAMWQFGSPMLIFLAGLKQIPVELYEAASIDGASFWRQLFKITIPLLSPVIFFNL
FT                   VMQTIGGFMVFTQAYIITGGAPLDTTLFYALYVYQKAFRDYDMGYASAMAWFMLVIVAI
FT                   VTFLLFRSSKKWVYYEAGEVK"
FT   gene            316990..317835
FT                   /locus_tag="DICTH_0311"
FT   CDS_pept        316990..317835
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0311"
FT                   /product="lactose transport system"
FT                   /note="identified by match to protein family HMM PF00528"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18611"
FT                   /db_xref="GOA:B5YC86"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B5YC86"
FT                   /protein_id="ACI18611.1"
FT                   /translation="MIKKSLSFYIIYYILITIFAFVMVYPLLWLIGSSFKTHQEIFSNM
FT                   TSLIPKKITFENYIEGWKGFGGITFATFFKNSFILSTGVTIGVLISSTMIAYGLSRIAF
FT                   PGRNFWFTTIMLTLLLPGQVLIVPRYILFYKLGWVNSFKPLIIPAFFGGPFFIFLMMQF
FT                   IRGIPYEYDEAASIDGASKYQIFWYIILPGLKPAIITSIIFAFYWTWDDFMGPLLYLNK
FT                   PELYPVALALKAFADPTTITNWGAVFAMSVLSLVPIFFIFVFFQKYMEAGIATTSVSKL
FT                   "
FT   gene            317947..319140
FT                   /gene="rhaI"
FT                   /locus_tag="DICTH_0312"
FT   CDS_pept        317947..319140
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rhaI"
FT                   /locus_tag="DICTH_0312"
FT                   /product="L-rhamnose isomerase"
FT                   /EC_number="5.3.1.14"
FT                   /note="identified by match to protein family HMM PF01261;
FT                   match to protein family HMM TIGR02635"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19345"
FT                   /db_xref="GOA:B5YC87"
FT                   /db_xref="InterPro:IPR009308"
FT                   /db_xref="InterPro:IPR013457"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:B5YC87"
FT                   /protein_id="ACI19345.1"
FT                   /translation="MKDYEKRYEILRKMLEEEGIEVDEVEKKLKSFKVETPSWGYGNSG
FT                   TRFYVFKQKGAARNVKEKLQDAAMVHKLTGICPTVALHIPWDMYDDWDELLRYAESLGV
FT                   RPGAINPNLFQDDDYKFGSLTHPDKRVREKAIKHILDCIEIAKKLGSRDISLWLADGTN
FT                   HPGQDDFRLRKHRLEESLKEVYSHLEPNMRLLIEYKFFEPAFYHTDISDWGTAIILSKK
FT                   LGDKAYVLVDLGHHPLGTNIEQIVAILLDEGKLGGFHFNNKKYADDDLTTGSINPYELF
FT                   LIFNELVSAEQDGLKMDIAYMIDESHNLKNKIEEMIQSVENIFRTYAKALIVNRKVLRK
FT                   YQEEQDIVMAENTLVKAFETDVMPLIYKVREEMGVPLDPLKAFRESGYMEKVIKERG"
FT   gene            319152..320633
FT                   /locus_tag="DICTH_0313"
FT   CDS_pept        319152..320633
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0313"
FT                   /product="L-fuculose kinase"
FT                   /note="identified by match to protein family HMM PF00370;
FT                   match to protein family HMM PF02782"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18353"
FT                   /db_xref="GOA:B5YC88"
FT                   /db_xref="InterPro:IPR000577"
FT                   /db_xref="InterPro:IPR013449"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/TrEMBL:B5YC88"
FT                   /protein_id="ACI18353.1"
FT                   /translation="MEDRKFLAIDLGAESGRVIVGILKDGKLTIEEVHRFINRPVDILG
FT                   RLYWNVTQIFQDIKDGLVKAFSKYRDIESIGIDTWGVDFGLVTKEGYFAGIPVCYRDHR
FT                   TDGILEKAFEVMSRERIYELTGIQIMQINTLFQLYSMVLEKSSLFNSAYKLLFMPDLFN
FT                   FMLTGEMKTEFSIATTSQMYNPIRDGWEEEILEKFGIPKDLMPEVLPPGTVIGNLNKSI
FT                   EEELGVKNISVIAPCEHDTGCAVVGVPGEGEDWAYISSGTWSLMGVELKSPIINNESLK
FT                   ANFTNEGGYNKTFRFLKNIMGLWLLQRVKREWAKEGEDLSYNEITRLAEQEKSFQYFIN
FT                   PDDVSFLNPPSMIKAIQYYCKKTGQEIPEKKGEIARCILESLAFRYKDVFTDLERILNK
FT                   KISVLHIVGGGSQNQLLSQFTANILGIPVITGPIEATALGNIVVQAITKGAIKDVVEAR
FT                   KIIRDSSEMKVYQPQNTEEWIRNYEKYKEVTEKKN"
FT   gene            320711..321100
FT                   /locus_tag="DICTH_0314"
FT   CDS_pept        320711..321100
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0314"
FT                   /product="neelaredoxin"
FT                   /EC_number="1.15.1.1"
FT                   /note="identified by match to protein family HMM PF01880;
FT                   match to protein family HMM TIGR00332"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ACI20135"
FT                   /db_xref="GOA:B5YCD9"
FT                   /db_xref="InterPro:IPR002742"
FT                   /db_xref="InterPro:IPR036073"
FT                   /db_xref="UniProtKB/TrEMBL:B5YCD9"
FT                   /protein_id="ACI20135.1"
FT                   /translation="MASVKDLFQSADWTKEKHVPVIEILEKDKEKGVRVRVSVGKEIPH
FT                   PNTTAHHIVWIEVYFQPEGDKYPYHVGRFEFVAHGATVQGPDTSTVYSEPVVEFVFKTQ
FT                   KDGVIFATSYCNIHGLWENSTELKL"
FT   gene            321238..322245
FT                   /locus_tag="DICTH_0315"
FT   CDS_pept        321238..322245
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0315"
FT                   /product="pectate lyase, Polysaccharide Lyase Family 1"
FT                   /note="identified by match to protein family HMM PF00544"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19128"
FT                   /db_xref="GOA:B5YCE0"
FT                   /db_xref="InterPro:IPR002022"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="InterPro:IPR018082"
FT                   /db_xref="UniProtKB/TrEMBL:B5YCE0"
FT                   /protein_id="ACI19128.1"
FT                   /translation="MKKYLIVFMILLGLILTLGFSQEEFKENVLTLNDKPVGFGESTTG
FT                   GAGGKIVTVDNISDFKKYAQAQEPYIILVKGVIDTSKEEGQVKIGSNKTIIGITPDASI
FT                   IGWGLYLKEVNNVIIRNLTIKNKVENPKNDAITVEASQNVWIDHCTLSSDMVVVPEREK
FT                   DKDKVDALLDIIKGSKGITVSWNIFENSWKCTQVGSSDSSTIDAEARVTYHHNIFRNTN
FT                   SRNPSVRFGVVHIYNNYYQNILLYAIASRMGAKVLVENNYFDTVALPITTQFESPQDGY
FT                   VKESGNLYWDCGDNNITQELKELKVPYNYELDEADVLSYLLEKGAGAGKEVEIK"
FT   gene            322533..323807
FT                   /locus_tag="DICTH_0316"
FT   CDS_pept        322533..323807
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0316"
FT                   /product="YesO"
FT                   /note="identified by match to protein family HMM PF01547"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19215"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:B5YCE1"
FT                   /protein_id="ACI19215.1"
FT                   /translation="MKKYFKLVVLMLILVSFILVISPAQQQITLRIIWWGSQDRHNRTL
FT                   KVIDLFQKKYPNIKIVSEYTGWSEYYTKLTTMAAGGNLPDIMQQDHAYIRGWVEKGLLL
FT                   PLDDLVAQGVINLKDVSKSIVDSGRLGGKLYAINLGNNSQAFAIDPELFRKAGVPLPPI
FT                   LWTWDDFKRIARIIHRKLGIYGAAENLGDHNVFRVWTIENGGYLFSEDGKSLGYEDDNV
FT                   YASFYKMLLELQDEGVIPSRDVEVARGSVSPEQRFLCLGKSAMQFTWSNQLTAMSTALK
FT                   GKPLKLYMLPTLNGKVGNFLKPSMFFAINAKTKYPKEAAMFINFFINDIEAAKILMAER
FT                   GVPVSKRVQLALKPLLTPVEKEMFNFIATVEKYGAPTPPPDPERWQEIYNNVYTPLYDQ
FT                   IMYKKITPEEAAKKFREQVTQILRK"
FT   gene            323870..324778
FT                   /locus_tag="DICTH_0317"
FT   CDS_pept        323870..324778
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0317"
FT                   /product="lactose transport system"
FT                   /note="identified by match to protein family HMM PF00528"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18640"
FT                   /db_xref="GOA:B5YCE2"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B5YCE2"
FT                   /protein_id="ACI18640.1"
FT                   /translation="MKKLTKKKKHDILMGYLFTSPWILGFLFFIVFPLVTSLYLSFTRY
FT                   DILSAPRWIGLQNWVRMFTQDPRFWNATKATFKYVIFEVPLRLLFAFIVALIFSQRESK
FT                   ILNLYRAIYYIPSLIGGSVAIAVVWRQIWGYPDGIVNAILSIFGLRGINWLGDTRTAIW
FT                   TLILLAVWQFGSPMLIFLAALKQVPTELYEAATIDGANFWGRLFKITIPMVTPVILFNL
FT                   INQMIHAFMAFTQSYIITQGGPLDSTLFYAVYMYRKAFNDFEMGYASALAWFMLALVGI
FT                   FTVIIFKTSNRWVYYEAEEGV"
FT   gene            324778..325617
FT                   /locus_tag="DICTH_0318"
FT   CDS_pept        324778..325617
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0318"
FT                   /product="lactose ABC transporter permease"
FT                   /note="identified by match to protein family HMM PF00528"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19475"
FT                   /db_xref="GOA:B5YCE3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B5YCE3"
FT                   /protein_id="ACI19475.1"
FT                   /translation="MKRKTLNTIIYYTVVTLIAIFMVYPALWMLSSSFKQPWEIFGDIL
FT                   NLIPKEPTLNNYKEGWQGFGGITFATFFKNSFIIAGLNTIGTVISSTIVAYGLSRIPFP
FT                   GRRIIFTTVILTLMLPMQVQIVPRYILFSKIGWINTFYPLIVPAFLGGPFFIFMVMQFI
FT                   RGIPKELDESAFIDGADRIKIFYHIILPNLKPVITTAAIFAFYWAWNDFMGPLVYLNSP
FT                   EKYPVSVALRAFSDPSAVTNWGAVFAMSTLSLIPVLVIFVLFQKYIVQGVTTTGLRG"
FT   gene            325633..327015
FT                   /locus_tag="DICTH_0319"
FT   CDS_pept        325633..327015
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0319"
FT                   /product="hidrolytic enzyme"
FT                   /note="identified by match to protein family HMM PF02056"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18372"
FT                   /db_xref="GOA:B5YCE4"
FT                   /db_xref="InterPro:IPR001088"
FT                   /db_xref="InterPro:IPR015955"
FT                   /db_xref="InterPro:IPR022616"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B5YCE4"
FT                   /protein_id="ACI18372.1"
FT                   /translation="MDNVKIAYIGGGSKGWAWKFMADLALEESFSGEVRLYDINFEAAK
FT                   TNEIIGNRISEQKDAKSKWRYRAVKEIGEALDGADFVIISILPGTLDEMEVDVHLPEKY
FT                   GIYQAVGDTPGPGGVIRSLRTIPIYIEFAEAIKKYAPSAWVINYTNPMALCVRTLYVTF
FT                   PKVKAIGCCHEVFKIPKILSLMLKEKEGINADPSEIKQNVLGINHFTWVDKISYKNKDL
FT                   LPVYGEFAEKYYEEGFEEEKDRWKRDYFASANRVKFDLYRRYKIIAAAGDRHLAEFFPA
FT                   NWYLENPEKVREWKFSLTPVSFRREQAKELYEMSQKLAKGEMEFPIKPSGEVGVQIMKA
FT                   LLGLSDFITNVNYPNVGQMDNVPQDVIVETNVYITRDSIRPIYAGKLPNDVNSWVLRHI
FT                   MNQEMILEAVLNKDLELAFRAFYNDPIVESKLDFDTARKLFKEMIEGTKRYLPKYFGGE
FT                   KD"
FT   gene            327028..328164
FT                   /locus_tag="DICTH_0320"
FT   CDS_pept        327028..328164
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0320"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19324"
FT                   /db_xref="InterPro:IPR013431"
FT                   /db_xref="UniProtKB/TrEMBL:B5YCE5"
FT                   /protein_id="ACI19324.1"
FT                   /translation="MKRILILSLFILLILIPALSQDKFLGGWDKVYGGPKSEKGYGIVK
FT                   VKDGYLLVGETTSFGSGGKDIYLLKIDRNGNKIFEKAIGGQKDDYAFSILEGKEGYFIV
FT                   GATRSFGVGNSDVYIVKVKEDGEILWQKTYGGKGFEEGWRITRDNEGNYVVVGRTNSFG
FT                   NGQYDLYLLKIDEDGNLIWEKAYGREMSEYGYGICADNDGYVAVGITNSFSEGQDVYVV
FT                   KVDKNGNLSWEKVYGGKGYDYAYDVTNCEDGYLMVGNSNSFSDSVDLYVLKIDKNGGKI
FT                   WEKTYGSKGYDTGFFVLQDDDKFLIVGGSNSQGAGNSDVYIVELDNNGKLLWEKYFGGA
FT                   DLDEGWGIILDDGWFVVVGRSESFSTANSELYVVKFRE"
FT   gene            328183..329142
FT                   /locus_tag="DICTH_0321"
FT   CDS_pept        328183..329142
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0321"
FT                   /product="2-keto-3-deoxygluconate kinase"
FT                   /note="identified by match to protein family HMM PF00294"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19878"
FT                   /db_xref="GOA:B5YCE6"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:B5YCE6"
FT                   /protein_id="ACI19878.1"
FT                   /translation="MVDVISYGEVMLRFTPERYRTFLNSNTWNVEVGGTEANVLASLSL
FT                   LGLKTEFISFFPDNFLGFKAISELKKYGVGVDKVRLVQEGRMGLYFVELHHRSKGIRVL
FT                   YDRRDSSFSRGVLSDTDLEFIRKARLIHLTGVTPSLSDICKTNVIKICTSKKDSQILSF
FT                   DINYRKKLWSEKECRRFLDIILPFVDILFVKKEDYNLLFEEENDEEKILSKLQKSYGKE
FT                   KIYILTQGEEGCSVLFKDEYFSQQAYNTDVVDRIGAGDAFVAGFLYGYLTGKTLKESAK
FT                   YGSLLASIKMSLFGDFPTLDRKTLLELLESENNRSVER"
FT   gene            329139..329903
FT                   /locus_tag="DICTH_0322"
FT   CDS_pept        329139..329903
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0322"
FT                   /product="transcriptional regulator, IclR family"
FT                   /note="identified by match to protein family HMM PF01614;
FT                   match to protein family HMM PF01978; match to protein
FT                   family HMM PF08279; match to protein family HMM PF09339"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19071"
FT                   /db_xref="GOA:B5YCE7"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B5YCE7"
FT                   /protein_id="ACI19071.1"
FT                   /translation="MKQKIGISSANQTLEILEYIVLSGREVSLKEIAEEIGLHVSTVHR
FT                   YLSSLLEKGYVRRTPNGLYKPGFRILELSSYILQSLDLREIARPYLIELMENTKQTVHL
FT                   TIRDGYEGVYIDKVEGPGTLPMMSRIGMRMPLYSTSFGKVLLAYSPESFINEYLKKVPL
FT                   IPRTENTITDPEKLREELLKVRKQGYAFDNEENERGIKCMGAPIFDFSGNVVAAVSISG
FT                   YYKNFEGENGERLLRELLNTCEKISSAMRSKA"
FT   gene            329916..331088
FT                   /locus_tag="DICTH_0323"
FT   CDS_pept        329916..331088
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0323"
FT                   /product="dihydroorotate dehydrogenase superfamily"
FT                   /note="identified by match to protein family HMM PF00037;
FT                   match to protein family HMM PF01180"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19767"
FT                   /db_xref="GOA:B5YCE8"
FT                   /db_xref="InterPro:IPR005720"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:B5YCE8"
FT                   /protein_id="ACI19767.1"
FT                   /translation="MDLSVNYVGLKLRNPVIIASSGLTENLKNMKKCEENGAGALVVKS
FT                   LFEEEVCRVSPTPRFEIINRSMGPLRSQTFYSFEQASPFGPEEYFKEINKALDVLSIPV
FT                   IPSINCITDEGWLKYSKMAEEAGAPALELNVSCPHASISFRGQDVDDTILHVARLVRDN
FT                   VKIPIIVKLPMQLSSPLAVAKALENIGIDGVVMFNRLTGLDIDLETEKPILHGGYAGHG
FT                   GPWAFNYVLRWISTSRPHLKLSIAGSGGVGSGDDVAKYILTGADVVQICSIVYLMGYEI
FT                   IPRIIDGLKRFMEKKGYNTLSEFRGKVSGRVILGNNEIDRRHLYEAYINPDLCTSCGIC
FT                   KKVCIYDAPVEKEGKYIITDLCDGCGLCVKLCPVRAISMVFVGGRENAKN"
FT   gene            331075..332841
FT                   /locus_tag="DICTH_0324"
FT   CDS_pept        331075..332841
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0324"
FT                   /product="succinate dehydrogenase"
FT                   /note="identified by match to protein family HMM PF00890;
FT                   match to protein family HMM PF01266; match to protein
FT                   family HMM PF02910; match to protein family HMM PF03486;
FT                   match to protein family HMM PF07992"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18983"
FT                   /db_xref="GOA:B5YCE9"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR015939"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR037099"
FT                   /db_xref="UniProtKB/TrEMBL:B5YCE9"
FT                   /protein_id="ACI18983.1"
FT                   /translation="MQKIKGDVIVIGAGGAGLKSAISAYEKDPSLKILLISKKPIGVGG
FT                   VTANAFSDRMAFHATLSYTLPYENNYLYHALDIYKIGGEVSDYNLAEILARRSEEEINY
FT                   LISIGVPFVRREDGKIDQFLTDGSEYPRACYVGPNTAIEISKALMKRLRETKVEIYENI
FT                   MVYDFIVKDNRVIGAKAINVLSQEKYLIQGKAFILATGGAGELYHQNVFTSEMTGDGYA
FT                   AALRAGAELVNIEFMQIGICHPNILFAESGSMFRALPKIVDENGREFLLDYLKEDRKNL
FT                   CVLEFKKGAHWPVSYESPTKVIDLAVYYHIKNGHKVFMNFMENPSYLDYENIPEEILKW
FT                   SEKIGKEVFKGTTPYERLQKINPQIIEWLKEYNIDLSKELLPIQNALQHFQGGVKIREN
FT                   AETSLKGLFAAGEVAGGQHGANRPGGNSLLDTQVFGRIAGESAVNYAKNNDFVDFEIEE
FT                   EKIEGEIPATFARKKIKDIVSEYGFLVRIEEDIKKGISELRNIREKGIFPDEKGLAYYY
FT                   ETVNMLDIAEVILHAILIRDESRGPHLRFYRFSPPIMEFVPKKPEWNKYIVFSKKDGEL
FT                   RFEIREPVRPKL"
FT   gene            332844..333929
FT                   /locus_tag="DICTH_0326"
FT   CDS_pept        332844..333929
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0326"
FT                   /product="5-exo-alcohol dehydrogenase"
FT                   /EC_number="1.1.1.-"
FT                   /note="identified by match to protein family HMM PF00107;
FT                   match to protein family HMM PF08240"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18756"
FT                   /db_xref="GOA:B5YCF0"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B5YCF0"
FT                   /protein_id="ACI18756.1"
FT                   /translation="MKAKAAILEEFKKPLVIRYVDIPPLLEGGILVKMVSSGICGSDIH
FT                   MVDGEDPRVPVPIILGHEGVGEIVEINGDKRDLNGEILKKGDLIIWNRGVVCGECYFCK
FT                   VLKMPYLCENRKIYGINRSFKEYPHLSGAFAEFIILEEKTEILRLSPNTDPNVIVMAGC
FT                   SGATAVHAIDALEDNLLDKTVVVQGGGPLGIFALSLAKFQGAKNTILITGSSFRKEIAE
FT                   KIGIDMILDRNTSAEERLNKILDITYGRGADVVIEATGTNKAVPEGLRFLRKGGTYIIA
FT                   GVASPQEKVPIDFYEVSSKNITIKGVWVSDAEHFKKAVSFVEKHQDLFATLITHKISLD
FT                   EINYGLDLVRERKAGKVVITY"
FT   gene            complement(333926..334675)
FT                   /locus_tag="DICTH_0325"
FT   CDS_pept        complement(333926..334675)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0325"
FT                   /product="bacilysin biosynthesis oxidoreductase BacC"
FT                   /EC_number="1.-.-.-"
FT                   /note="identified by match to protein family HMM PF00106;
FT                   match to protein family HMM PF08659"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19528"
FT                   /db_xref="GOA:B5YCF1"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B5YCF1"
FT                   /protein_id="ACI19528.1"
FT                   /translation="MDKVAIVTGGGQGIGKAIARRFLENNISVVIAEIDEEAGKETEEE
FT                   YSSLGKIKFVKTDVSKEEDVINMVEETVKTFGKINYLINNAGISINKPISELTLEEWNK
FT                   VLGVNLTGAFLCAKYTSPYLRKEKGVIINISSTRAFMSEPNTEAYSASKGGIYALTHAL
FT                   AISLGPEVRVNCISPGWIETSEWKKKALRRKPELTELDHTQHPAGRVGKPEDIASLVMF
FT                   LISEEAEFITGANFIVDGGMTRKMIYL"
FT   gene            334753..334893
FT                   /locus_tag="DICTH_0327"
FT   CDS_pept        334753..334893
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0327"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19773"
FT                   /db_xref="UniProtKB/TrEMBL:B5YCF2"
FT                   /protein_id="ACI19773.1"
FT                   /translation="MWRFKKVYYKIKTSYSVKKKGDDFLKNPIGRHFVVILEDEEEKIK
FT                   N"
FT   gene            334924..335769
FT                   /gene="rfbD_2"
FT                   /locus_tag="DICTH_0328"
FT   CDS_pept        334924..335769
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rfbD_2"
FT                   /locus_tag="DICTH_0328"
FT                   /product="dTDP-4-dehydrorhamnose reductase"
FT                   /EC_number="1.1.1.133"
FT                   /note="identified by match to protein family HMM PF01073;
FT                   match to protein family HMM PF01370; match to protein
FT                   family HMM PF02719; match to protein family HMM PF04321;
FT                   match to protein family HMM PF07993; match to protein
FT                   family HMM TIGR01214"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19143"
FT                   /db_xref="GOA:B5YCF3"
FT                   /db_xref="InterPro:IPR005913"
FT                   /db_xref="InterPro:IPR029903"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B5YCF3"
FT                   /protein_id="ACI19143.1"
FT                   /translation="MKKRILITGAKGFLGQYFVKEFEDEEVIPITHQDINLEDKNAIEK
FT                   ITSLKPDLVIHPAAIRSPDICEEDPEKAWKVNAVGTKHVAIACSLLDIPLIYISTDYVF
FT                   SGGKDTPYTEFYPPNPINLYGKTKLYGEIFTKEFCKKHFIIRTSYVFGEYGNNALTQIY
FT                   NSLKEGKEIKLSNYHFASCTYAKDLVRKVKELSFTNLYGTYHIVNKGIITRYDFACKVA
FT                   EIAGFSKEKVIPLNSETFKAPAKRPLYSVLRNYMLEIYNMDDLPYYEESLRKAMRLFKK
FT                   "
FT   gene            335879..335995
FT                   /locus_tag="DICTH_0329"
FT   CDS_pept        335879..335995
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0329"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19746"
FT                   /db_xref="UniProtKB/TrEMBL:B5YCF4"
FT                   /protein_id="ACI19746.1"
FT                   /translation="MKERIKDKGKVEVIVDFIIDFRRIYRNIKEMIKVKEEG"
FT   gene            336042..336746
FT                   /locus_tag="DICTH_0330"
FT   CDS_pept        336042..336746
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0330"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18930"
FT                   /db_xref="GOA:B5YCF5"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="UniProtKB/TrEMBL:B5YCF5"
FT                   /protein_id="ACI18930.1"
FT                   /translation="MIGCGFTYREVARLINRVLGVKIHISNIYYRLKEMEGLEEVVNKV
FT                   IRSINVEKVKGRCRGLLVDGAGFGYNFKIKQRLYFGREIREKRDHVKCELLVLVDERGK
FT                   SYIVGVFVDDGYKDERKILKSKFEEVKKLKEEVDFRKVYGDRLYNRDIELLREFEKEGV
FT                   EMILPVEDGIHNKVKSEERKRVKESYNRKRHAYNRNRYKIEQKIGNIKRFMGTYLNTKD
FT                   KEVSKNLVLLGV"
FT   gene            336833..337282
FT                   /gene="rplI_1"
FT                   /locus_tag="DICTH_0331"
FT   CDS_pept        336833..337282
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplI_1"
FT                   /locus_tag="DICTH_0331"
FT                   /product="ribosomal protein L9"
FT                   /note="identified by match to protein family HMM PF01281;
FT                   match to protein family HMM PF03948; match to protein
FT                   family HMM TIGR00158"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19988"
FT                   /db_xref="GOA:B5YCF6"
FT                   /db_xref="InterPro:IPR000244"
FT                   /db_xref="InterPro:IPR009027"
FT                   /db_xref="InterPro:IPR020069"
FT                   /db_xref="InterPro:IPR020070"
FT                   /db_xref="InterPro:IPR020594"
FT                   /db_xref="InterPro:IPR036791"
FT                   /db_xref="InterPro:IPR036935"
FT                   /db_xref="UniProtKB/TrEMBL:B5YCF6"
FT                   /protein_id="ACI19988.1"
FT                   /translation="MKVILLKDVKGLGKLGEIKNVADGYARNFLIKNKLALEATESNIK
FT                   YVKSQLDALQKKNERKFENAKELKEVIESLNVVIKAKAGESGKLFGSITSEDIALALKE
FT                   QHNLEIDKKIIETEPIKLVGEYIVDVRLGMNVIAKLKVKIESDCP"
FT   gene            337279..338772
FT                   /gene="ppcA"
FT                   /locus_tag="DICTH_0332"
FT   CDS_pept        337279..338772
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ppcA"
FT                   /locus_tag="DICTH_0332"
FT                   /product="phosphoenolpyruvate carboxylase"
FT                   /EC_number="4.1.1.31"
FT                   /note="identified by match to protein family HMM PF04477;
FT                   match to protein family HMM TIGR02751"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19088"
FT                   /db_xref="GOA:B5YCF7"
FT                   /db_xref="InterPro:IPR007566"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="UniProtKB/TrEMBL:B5YCF7"
FT                   /protein_id="ACI19088.1"
FT                   /translation="MTRKIPRTMSTQHPDNANVPFFSNNPVLQGDDEIKEAYYAFSYLG
FT                   VDEVMWDVEGKETDEFVIRKLVSDYPEFFKQKVIGKDIFITLRVPNPNYEKAEGKLLIE
FT                   TLESIPRSYDTAYVFYQDESVVPIFEVIVPMADTETCNRVYYYYKNVVAGKEDKPFCDT
FT                   NPQLKLKDWIGEFRPKKINVIPLFEDIDNIINVDKNLKEFLKDKLDEVEYQRVFLARSD
FT                   PAMNYSSLSVIIAIKLALEKLYELQESLKLPIYPILGCGTAPFRGNFSPNTYRYVINNY
FT                   PSVATFTIQSAFKYDFPVKEVQRAIENINLTPVKSPNSISSKDRVESIMYKVSSEYKKQ
FT                   LAEIAPLVNNIAVFVPKRRARKIHVGLFGYSRQTDEGITLPRVISFCAVLYSLGLPPDI
FT                   LGLSALTDEDIKYVESVFPRFKEEMSEILSMWNEDVLDLLPVSIRSEIKQTVKRFDFEI
FT                   NQEHLSFSKDLVKRIKENKFDTKITDLIVASAKVRNFLG"
FT   gene            338920..339894
FT                   /locus_tag="DICTH_0333"
FT   CDS_pept        338920..339894
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0333"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19678"
FT                   /db_xref="GOA:B5YCF8"
FT                   /db_xref="UniProtKB/TrEMBL:B5YCF8"
FT                   /protein_id="ACI19678.1"
FT                   /translation="MLKVEKIEGEYCFTSKVDAWVNKIIGVILESPEFKTLVLENFISA
FT                   NTKAIDLVEEVEYKKQNDNLILINGEDIEILLNDNIVNGTIMLVSENFRSLATKEIPTL
FT                   GKLAQDYRMEIKDNKFEVVYRNPKYTSKLISFLIYRKIGIVPSDLLVEKLSTLLQDNIP
FT                   QNFEKLELKIEKFGKYILPNKILLSIKLIIDGKVNYYLLKYERGRWSIKSINLQKGSIN
FT                   FFHKLLVQLTESVGVFLSSKGWFYRLVDTFRKIDKFITSNAFLKYSILIFALIVGVYIV
FT                   LKVRLLLILLFLYILWLLYKRFCLFLVFNREVDYYGRLQRGRS"
FT   gene            339866..340054
FT                   /locus_tag="DICTH_0334"
FT   CDS_pept        339866..340054
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0334"
FT                   /product="phosphoribosylformylglycinamidine cyclo-ligase"
FT                   /EC_number="6.3.3.1"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18355"
FT                   /db_xref="GOA:B5YCF9"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/TrEMBL:B5YCF9"
FT                   /protein_id="ACI18355.1"
FT                   /translation="MADYREAGVDIDKANSLINKLKEEISSTNNEYVITGVGGFGAIID
FT                   VNLKEFKNPIISVSTDG"
FT   gene            340120..340422
FT                   /locus_tag="DICTH_0335"
FT   CDS_pept        340120..340422
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0335"
FT                   /product="phosphoribosylformylglycinamidine cyclo-ligase"
FT                   /EC_number="6.3.3.1"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18843"
FT                   /db_xref="GOA:B5YCG0"
FT                   /db_xref="InterPro:IPR004733"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/TrEMBL:B5YCG0"
FT                   /protein_id="ACI18843.1"
FT                   /translation="MNVDDVVCTGAKPVAFVDYYACGKLDEGVYSKVIRSIVEGCKIAK
FT                   VALVGGETAEMPGMYAEGDFDLNGTAIGIAEKDNILPKNIKEGRCFGSTGIKWIS"
FT   gene            340391..340852
FT                   /locus_tag="DICTH_0336"
FT   CDS_pept        340391..340852
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0336"
FT                   /product="phosphoribosylformylglycinamidine cyclo-ligase"
FT                   /EC_number="6.3.3.1"
FT                   /note="identified by match to protein family HMM PF02769"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18515"
FT                   /db_xref="GOA:B5YCG1"
FT                   /db_xref="InterPro:IPR004733"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="UniProtKB/TrEMBL:B5YCG1"
FT                   /protein_id="ACI18515.1"
FT                   /translation="MVALESSGFHSNGYSLIRKILKDKEIDPTKDYGFGRPLVDLLLEP
FT                   TRIYCHVVYPLIEKGLVKALSHVRGGGIVENTLRVTMGRGVKLFKEKIKTQEFMKFIIK
FT                   EGNVSEEEAMRVFNMGVGMVITTNNEDRLLEELKNQNLDYDFYLVGKVV"
FT   gene            340963..341976
FT                   /locus_tag="DICTH_0337"
FT   CDS_pept        340963..341976
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0337"
FT                   /product="penicillin-binding protein 2"
FT                   /note="identified by match to protein family HMM PF03717"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18943"
FT                   /db_xref="GOA:B5YCG2"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR005311"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR036138"
FT                   /db_xref="UniProtKB/TrEMBL:B5YCG2"
FT                   /protein_id="ACI18943.1"
FT                   /translation="MQILNREKFVKLAMVINMAQQIYIPAKRGTIFDRNGEIISLSDEI
FT                   IGVFVIQKYLPQNEAQKLVVLSKLSAIIDKDIKVILQNIERRKWDLYGPIFISEITKEQ
FT                   AIKILEKQGELPGIVVDTTYSRYNYYPYETAHLMGYLGAISQDEMKKLSEAYKEIYHSS
FT                   SMIGKDGIEKVYDRILRGKDGKLFRYIDAKNNIVGTEIAEIPVEGNSIRLSIDIDIQRL
FT                   GYKLLKNYRSSLVMLKPATGEIIALVSSPSFDPNRLSIGDNAYFLSLSTDNKNFPLFNR
FT                   SIQGTYQPGSTFKLVTAATALKNNKWDPNRSENCTGALRIGKRYSMIGRYMVLLRI"
FT   gene            342018..342194
FT                   /locus_tag="DICTH_0338"
FT   CDS_pept        342018..342194
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0338"
FT                   /product="penicillin-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19535"
FT                   /db_xref="UniProtKB/TrEMBL:B5YCG3"
FT                   /protein_id="ACI19535.1"
FT                   /translation="MGLSLDPDDLIKTSKEFGVGEPTFIDLPNEKLGYRISVEAHKRKY
FT                   NRDILGGTWQTWQ"
FT   gene            342176..342664
FT                   /locus_tag="DICTH_0339"
FT   CDS_pept        342176..342664
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0339"
FT                   /product="cell division protein FtsI/penicillin-binding
FT                   protein 2"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18890"
FT                   /db_xref="GOA:B5YCG4"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:B5YCG4"
FT                   /protein_id="ACI18890.1"
FT                   /translation="MANLAIGQGDWLLTPLQLALVGAFIYNEGVVFKPHIVKEILSSDG
FT                   KEVIKRIEPEVLRKSTDISHEIFSIIKEGMINVFESGTARALKYITKYPIAGKTGTAEN
FT                   PHGKPHSIFLCYGPTDGVDPNDAVVSVIIENVGSGSAYAGPVAAKLIDAYFDKYGYKK"
FT   gene            343067..343585
FT                   /gene="purE_2"
FT                   /locus_tag="DICTH_0340"
FT   CDS_pept        343067..343585
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purE_2"
FT                   /locus_tag="DICTH_0340"
FT                   /product="phosphoribosylaminoimidazole carboxylase,
FT                   catalytic subunit"
FT                   /EC_number="4.1.1.21"
FT                   /note="identified by match to protein family HMM PF00731;
FT                   match to protein family HMM TIGR01162"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19716"
FT                   /db_xref="GOA:B5YCG5"
FT                   /db_xref="InterPro:IPR000031"
FT                   /db_xref="InterPro:IPR024694"
FT                   /db_xref="InterPro:IPR033747"
FT                   /db_xref="InterPro:IPR035893"
FT                   /db_xref="UniProtKB/TrEMBL:B5YCG5"
FT                   /protein_id="ACI19716.1"
FT                   /translation="MRVGIVMGSDSDLEIMSEAAKVLEEFGVDYEIHVMSAHRTPEKVF
FT                   DYTKTAEERGIEVFIAGAGGAAHLPGVIAALTTFPVIGVPIKTSSLNGLDSLLSIVQMP
FT                   SGIPVATVAINGSKNAGLLALQILSIKYPEIKQKLKEFKDKMKEEVTSKDEKLQSLGYK
FT                   NYLSSVKKS"
FT   gene            343686..344555
FT                   /locus_tag="DICTH_0341"
FT   CDS_pept        343686..344555
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0341"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19072"
FT                   /db_xref="GOA:B5YCG6"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="UniProtKB/TrEMBL:B5YCG6"
FT                   /protein_id="ACI19072.1"
FT                   /translation="MQVKKRIKDKGKVDFIIDFRRIYRNIKEMIKVKEERRRGRKKKYD
FT                   DGLIILAGMLMIGCGFTYREVARLINRVLGVKIHISNIYYRLKEMEGLEGVVNKVIRSI
FT                   NVEKVKGRCRGLLVDGAGFGYNFKIKQRLYFGREIREKRDHVKCELLVLVDERGKSYIV
FT                   GVFVDDGYKDERKILKSKFEEVKKLKEEVDFRKVYGDRLYNRDIELLREFEKEGVEMIL
FT                   PVEDGIHNKVKSEERKRVKESYNRKRHAYNRNRYKIEQKIGNIKRFMGTYLNTKDKEVS
FT                   KNLVLLGV"
FT   gene            344667..344867
FT                   /locus_tag="DICTH_0342"
FT   CDS_pept        344667..344867
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0342"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18480"
FT                   /db_xref="UniProtKB/TrEMBL:B5YCG7"
FT                   /protein_id="ACI18480.1"
FT                   /translation="MFDLSLWEEKISKEYEMRSEEKKILFLEVFYATKTVSQNITPVKE
FT                   ESPSEFKKKCVFIPCKIGERL"
FT   gene            complement(345034..345228)
FT                   /locus_tag="DICTH_0343"
FT   CDS_pept        complement(345034..345228)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0343"
FT                   /product="membrane protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19318"
FT                   /db_xref="GOA:B5YCG8"
FT                   /db_xref="InterPro:IPR021309"
FT                   /db_xref="UniProtKB/TrEMBL:B5YCG8"
FT                   /protein_id="ACI19318.1"
FT                   /translation="MNVGKTDAIIRVIIGLILPHLTKWGVLSGTAWAVILHIIGTILVF
FT                   TAAIRYCPLYRLINKSTAK"
FT   gene            345357..346388
FT                   /locus_tag="DICTH_0344"
FT   CDS_pept        345357..346388
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0344"
FT                   /product="Low-specificity L-threonine aldolase"
FT                   /EC_number="4.1.2.5"
FT                   /note="identified by match to protein family HMM PF00266;
FT                   match to protein family HMM PF01212"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18623"
FT                   /db_xref="GOA:B5YCG9"
FT                   /db_xref="InterPro:IPR001597"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR023603"
FT                   /db_xref="UniProtKB/TrEMBL:B5YCG9"
FT                   /protein_id="ACI18623.1"
FT                   /translation="MGFIDLRSDTVTKPTEEMRKAMYSAEVGDDGYGEDPTVNFLEEKA
FT                   AEILGKEAGLFVVSGTMGNQVALLTWTRPGDEVILESESHIYYYEAGGMAANSGVQPFL
FT                   IDGKDGMMPIEEIRKAIRPKGRVFPNTSLIVLENTHNRAGGKVLPLGYMKEVYELSREH
FT                   NIPIHLDGARIFNAAIHLKVSAKEIAKYADSVMFCLSKGLSCPMGSLLVGPKEFIEEAR
FT                   RKRQRLGGGLRQAGVVAACGIVALEKMIDRLEEDHEKAKILYEFLKDMEIFNVERPDTN
FT                   ILKVKIKINKKAREFLAEFKKYGLLATSFDDETLRFVTHKDVSFEDIEKAKGIIYKVCK
FT                   LMD"
FT   gene            346460..347167
FT                   /locus_tag="DICTH_0345"
FT   CDS_pept        346460..347167
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0345"
FT                   /product="xylanase"
FT                   /note="identified by match to protein family HMM PF01522"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19526"
FT                   /db_xref="GOA:B5YCH0"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:B5YCH0"
FT                   /protein_id="ACI19526.1"
FT                   /translation="MKKLVMVLLLSLFFVPSLATQEYPKPDKLCALTFDDGPDARLTPR
FT                   VLDKLEKYNVVATFFLVGQRINDSVKPVLDRMVAMGCEFGNHSWDYNPMDKMDPEKIKE
FT                   YIKRTNEAIEKYTGKTPRFFRPPNLAVSPVMFEVINMPFASGVLGFDWAGCDRTPENIA
FT                   NNVLKGIRDGAIILLHDVQPEPHPTPEALDILIPELKKRGYEFVTLSELFKRKGVDPTD
FT                   PKYKNKMWVYVEP"
FT   gene            complement(347249..349138)
FT                   /locus_tag="DICTH_0346"
FT   CDS_pept        complement(347249..349138)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0346"
FT                   /product="laminarinase"
FT                   /note="identified by match to protein family HMM PF00722;
FT                   match to protein family HMM PF02018"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18772"
FT                   /db_xref="GOA:B5YCH1"
FT                   /db_xref="InterPro:IPR000757"
FT                   /db_xref="InterPro:IPR003305"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="UniProtKB/TrEMBL:B5YCH1"
FT                   /protein_id="ACI18772.1"
FT                   /translation="MKRYFSILLLTLLILLIAGCAPRTQASTEVNILQNGDFSKPLIYI
FT                   SDTYPELPNGDFNTQGTWLFRTGDGAVATGTVENGVLKVEITNGGPNTWSVQLLQSPIT
FT                   VEYLGIYRVSFEAWATKNRRIGVKIGANGYKGWTPYNPPPSGQPADQSGGYAIDITPQR
FT                   QTYTFEFTMKQATDTAARFEFQLGRDDGTIYIDNVKLVKVGTAEPPPPPPALGQKYWYA
FT                   VVWEQNFDNNTIDENTWSFEIGNGGPNLPGWGNGESEYYKRENAYVENGVLVIEAKQET
FT                   VTADDNQDGTPETYNYTSARMKTQGKFDVKFGRIEFRAKLPKGKGIWPALWMLGENITQ
FT                   VGWPTCGEIDVMELVGHEPNKVYGTIHGPGYSGASGKGGNYTLPSGDFSQDFHIFAIEW
FT                   DPIGISWYVDDQKFFTITRTEVPGDWVFDHPFFIIMNVAVGGYWPGYPDNTTVFPQKMY
FT                   VDYIKVYKGVTMEEINNGTFEFPFTNDQTNWPDDWFLWYGSPYGMGGTATATIDTANKM
FT                   AIVDVTDTGWESWHVQFNQWVGLTAGNTYRLTFQAKADTPRDINVKFLNPTTYALYANT
FT                   TCNLTTNWQTFTLEFTFNNNQDPRANLSFELGKTSNPATGKVYFKDVKLEKIQ"
FT   gene            complement(349324..349647)
FT                   /locus_tag="DICTH_0347"
FT   CDS_pept        complement(349324..349647)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0347"
FT                   /product="conserved protein"
FT                   /note="identified by match to protein family HMM PF01906"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18635"
FT                   /db_xref="InterPro:IPR002765"
FT                   /db_xref="InterPro:IPR035439"
FT                   /db_xref="UniProtKB/TrEMBL:B5YCH2"
FT                   /protein_id="ACI18635.1"
FT                   /translation="MIITTTEYVPGYEVIEILGIVKGSTARTRHVGKDILASLRNLVGG
FT                   EVVEYTKLIGEAREQALDRMIEEAKRLGADAVIGVRFGTTQIMQGVAEILAYGTAVRLK
FT                   KKE"
FT   gene            complement(349661..349864)
FT                   /locus_tag="DICTH_0348"
FT   CDS_pept        complement(349661..349864)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0348"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19489"
FT                   /db_xref="GOA:B5YCH3"
FT                   /db_xref="UniProtKB/TrEMBL:B5YCH3"
FT                   /protein_id="ACI19489.1"
FT                   /translation="MERIAYLILSIIVIIWLLAIIFGLILAFPVGLIGLLLILAFGLLF
FT                   IKVLKDRIKSKSEDEKYKDVRW"
FT   gene            complement(349884..349972)
FT                   /locus_tag="DICTH_0349"
FT   tRNA            complement(349884..349972)
FT                   /locus_tag="DICTH_0349"
FT                   /product="tRNA-Leu"
FT   gene            complement(349995..350942)
FT                   /locus_tag="DICTH_0350"
FT   CDS_pept        complement(349995..350942)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0350"
FT                   /product="malate transport protein"
FT                   /note="identified by match to protein family HMM PF03547"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19885"
FT                   /db_xref="GOA:B5YCH4"
FT                   /db_xref="InterPro:IPR002657"
FT                   /db_xref="InterPro:IPR004776"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:B5YCH4"
FT                   /protein_id="ACI19885.1"
FT                   /translation="MRVFFSALQGVLEIVIIIAIGYLLTHKRWFEEKTADLFAKIVLNL
FT                   SLPLGMIVNISSFFTKNDLINSAKGLIIPFLSILISYFLGYFLALIFKTKKGRRGLLAG
FT                   IFSLSNSIFIGLPMSQALFGEIATPYTLLYYMANTTIWWSLGVYGVILDTQEKKEKIFN
FT                   IETLKRILNPPFLGFLVGVGIVIMDLKLPKFLFDSFKLIGNLTTPLSLFYVSIIMYNMG
FT                   FEKFKLDKDAILTFLGRFLITPLLVILLEFFIPIPKLMRDVFVIMSAMPVMVNSAIVAR
FT                   MYGGDYEFAVSMITYTTLFSIIIMPLYMVLLSKI"
FT   gene            350958..351074
FT                   /locus_tag="DICTH_0351"
FT   CDS_pept        350958..351074
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0351"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18784"
FT                   /db_xref="UniProtKB/TrEMBL:B5YCH5"
FT                   /protein_id="ACI18784.1"
FT                   /translation="MKRITQIEFLNEDEKIREGLEAIYDYCMFTSFKDFLET"
FT   gene            complement(351113..351238)
FT                   /locus_tag="DICTH_0352"
FT   CDS_pept        complement(351113..351238)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0352"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18861"
FT                   /db_xref="UniProtKB/TrEMBL:B5YCH6"
FT                   /protein_id="ACI18861.1"
FT                   /translation="MISRSGKDKDHYSYEDRIKLYYYMKEKKIETREENKKEDNS"
FT   gene            351329..352723
FT                   /locus_tag="DICTH_0353"
FT   CDS_pept        351329..352723
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0353"
FT                   /product="ggdef domain protein"
FT                   /note="identified by match to protein family HMM PF00989;
FT                   match to protein family HMM PF00990; match to protein
FT                   family HMM PF08447; match to protein family HMM PF08448;
FT                   match to protein family HMM TIGR00229; match to protein
FT                   family HMM TIGR00254"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ACI20157"
FT                   /db_xref="GOA:B5YCH7"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR033425"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:B5YCH7"
FT                   /protein_id="ACI20157.1"
FT                   /translation="MNIFPFVNTANYATQFWISARYLEAVSLFLSPFFIKRKLKLIPTY
FT                   LGYFLYFIASLLSIFYFKNFPACYIEGFGLTTFKIASEYIISLILLLAIYNHWKNKDYF
FT                   YPYVLKLLIFSIVSTIISEMFFTLYVDVYGMMNAMGHIFKLISFYLIYMSIVETSLRSP
FT                   YRTIFYEFLKESKSFKDYIEYAGIMFLILDTKGNIILINKRGEEILGYKREEIIGRNWF
FT                   ENFVPEEIRDELRKYFEFLIRNNAFEQEDKFKENPVKTRDGIKIIRWYNTILRDEKGKI
FT                   VGVISSGEDITEKKKEEDFLKYLASVDPLTGVYNKRVGFEIFQKEMGLSLVRNSPLAVV
FT                   FVDIDDLKKVNDNFGHNEGDVYIKIITEAIKKNIRKTDTLFRFGGDEFVLILPHCDRET
FT                   AERIIEKILVNLKKLREELNKPYEFSFSYGIAVFYPKEGKSIDDLVREADMKMYEMKKT
FT                   KNKEGE"
FT   gene            complement(352726..353748)
FT                   /locus_tag="DICTH_0354"
FT   CDS_pept        complement(352726..353748)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0354"
FT                   /product="oxidoreductase, aldo/keto reductase family"
FT                   /note="identified by match to protein family HMM PF00037;
FT                   match to protein family HMM PF00248"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18330"
FT                   /db_xref="GOA:B5YCH8"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:B5YCH8"
FT                   /protein_id="ACI18330.1"
FT                   /translation="MKLRRLGRTNLEVFPIAFGGIPIQRVDEDTAIKIIRRAIELGINL
FT                   IDTARGYTDSEIKIGKALKGIDKKVYLSSKSQNRTKDGIYEDVKTSLRNLGVEKIEIYH
FT                   IHGVNNREAFNKIFEPDGAYYGLLKAKEEGLIDFIAVSSHSNDILADLIATDKFDVIQV
FT                   SYNFIEREPEEKIFPMALEKDIGIIAMKPMAGGVIPNPKLALKFALQKEFLVPDPGIES
FT                   IKELEEDVEIAMNLTPLTDEEWKEIEKTIEEMGSTFCRKCDYCQPCPVGIPISTVIRSE
FT                   SFLKRLPDETIRRGWFYDAYLKAQNCTKCGTCMTRCPYNLPIPDLIEKNIATVREYLGE
FT                   "
FT   gene            353936..354379
FT                   /locus_tag="DICTH_0355"
FT   CDS_pept        353936..354379
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0355"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19394"
FT                   /db_xref="UniProtKB/TrEMBL:B5YCH9"
FT                   /protein_id="ACI19394.1"
FT                   /translation="MKFKGLAILSLVILGLFSLSYAYGPRFGGYLANNVQLTKISGTVT
FT                   KIANNPALTVTVKTTSGDKEVILGPAWLQIKELKVGSKIEIEGFESPVTKNFKAVRVVV
FT                   DGKEVLNLSKNTAWGNPNYGNLRGRGRGLQNYPNCPCWNLQTN"
FT   gene            354508..355707
FT                   /locus_tag="DICTH_0357"
FT   CDS_pept        354508..355707
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0357"
FT                   /product="oxalate/formate antiporter"
FT                   /note="identified by match to protein family HMM PF07690"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18434"
FT                   /db_xref="GOA:B5YCI0"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B5YCI0"
FT                   /protein_id="ACI18434.1"
FT                   /translation="MNSTNLLKRRWFLIPLGIIIYICLGTVYSWSVFRKPLENILQISA
FT                   FQSGLPYMLFLFFFALFMALSGKYVSKYPRLIIFIGGLIVGLGWILSGFFRDIKIIAIT
FT                   YGIIAGSGVGIVYGVPITVISKWFPDKRGLAMGLVISGFGLSPLITAPLARYLIELYGP
FT                   FETFKILGLIFLILLSLLSLAFKLPPLDFSVGALKTTKRKILAELNTREMLKSSKFYGL
FT                   WLCYTLGTLIGLMIIGITSPVGEEIVGLDPKFTASLVSFFAIFNAVGRPLFGWITDRIF
FT                   PRKASIVSYLLAMLASLLMISTGGSNLGVYIISFSLFWLILGSWLAIAPASTIILFGER
FT                   NYGQNYGIVFTAYGVGAILGGTISGILRDLLGSYFYVFYVIIGLSIVGILITLALLKEN
FT                   "
FT   gene            complement(355704..356357)
FT                   /locus_tag="DICTH_0356"
FT   CDS_pept        complement(355704..356357)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0356"
FT                   /product="phosphorylated carbohydrates phosphatase"
FT                   /EC_number="3.1.3.-"
FT                   /note="identified by match to protein family HMM PF00702;
FT                   match to protein family HMM TIGR01509; match to protein
FT                   family HMM TIGR01549"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19287"
FT                   /db_xref="GOA:B5YCI1"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:B5YCI1"
FT                   /protein_id="ACI19287.1"
FT                   /translation="MKVSAVIFDMDGVIFDTERLGYILWKKACEEFGYIMTEEIYNETV
FT                   GVNILETERIFKKYLGDIPFDKIYKRKIELTEEYIEKNGIPIKDGLFELLDFLDEKKMP
FT                   RGIATSTERERAIPLLQRANILNRFDVIVCGDEVEKSKPEPDIFLLTAKKLKVDPKECI
FT                   VLEDSDNGVLAATRAGMTPLLILDFKPPRPETLSRAYKVFNSLIEVKEYLKEII"
FT   gene            356518..357774
FT                   /locus_tag="DICTH_0359"
FT   CDS_pept        356518..357774
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0359"
FT                   /product="beta-glucosidase A"
FT                   /EC_number="3.2.1.21"
FT                   /note="identified by match to protein family HMM PF00232"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18700"
FT                   /db_xref="GOA:B5YCI2"
FT                   /db_xref="InterPro:IPR001360"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR018120"
FT                   /db_xref="UniProtKB/TrEMBL:B5YCI2"
FT                   /protein_id="ACI18700.1"
FT                   /translation="MLKYRFPEGFLWGTATASHQIEGDNFYNDWWEFEQKGKVKNGQIS
FT                   GKACDSWNRYEEDFDLIEKLNNNAYRFSIEWSRVEPEEGRFDQSAIERYRAMLLSLRRR
FT                   NIEPFVTLHHFTNPLWIAKKGGWLNSEIIDYYLRYVERIVSEFKDLVNYWMTINEPNAY
FT                   AFMAYLYGQFPPQKRSLMKMLRVLNNMVKAHAKAYQVIHKISPNSKVGIAYNVIYFEPK
FT                   NPKSFIDRKLTNFADRIYNRVFIETLTTGRFSSPFIKEEIPYAKDTLDYLGVNYYTRIL
FT                   MGLRMTPPSGEKSDFGWEIYPEGIYKVVKRFYKLTGKPIYITENGISDAKDEKRPKYLI
FT                   SHLIQLHKAIEDGVDIKGYFHWSLVDNFEWAEGFLQRFGLFETDFNNFERKWRKSARIY
FT                   SEIAKNNGITEEMEKEFLK"
FT   gene            complement(357767..358777)
FT                   /locus_tag="DICTH_0358"
FT   CDS_pept        complement(357767..358777)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0358"
FT                   /product="DNA repair photolyase"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18629"
FT                   /db_xref="GOA:B5YCI3"
FT                   /db_xref="UniProtKB/TrEMBL:B5YCI3"
FT                   /protein_id="ACI18629.1"
FT                   /translation="MKNSKKFSLSKPFSHIYVEKEVISHHITQEILKKFTHSKVIPINH
FT                   YKEVFSRPRQSYKLQELSKKLILAKRRDTFLSPASPLCQNFGYHYFYYTNLIINCIFNC
FT                   DYCFLKGMYSSANIVIFVNIEDYFQEIENMLKKHPLYLSISYETDLLAMEGIAPFFSQF
FT                   VNFTYSKEDLILEVRTKSVNYMVLKSLKPSPNVILAWTLLPQEIIERFEPQTPRLPIRI
FT                   NTIKKAIHDGWRVRLSFDPIIFVEDWREIYERFIDYVFRKIPSSQIQDISVGVFRIPKE
FT                   YLKKMRKTFENEITLFPYIEDKEAYTYPSPIKEELLNFIISKIKNYIPENKIFTI"
FT   gene            complement(358746..359582)
FT                   /locus_tag="DICTH_0360"
FT   CDS_pept        complement(358746..359582)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0360"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19740"
FT                   /db_xref="GOA:B5YCI4"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="UniProtKB/TrEMBL:B5YCI4"
FT                   /protein_id="ACI19740.1"
FT                   /translation="MIYIVTASYTEGKVFIDHFKLEKLDNPSKFQVFNKDELFLIISGV
FT                   GIVNSAIATTYLLTKYGWRSEDIALNIGICGAIKTQFSKGDLILCNKIINHNSKKAFYP
FT                   DILINHSMKEAVLESFDFPVKKEHQEYVEGDIVDMEGAGFFEAVSSFLPPHNIHCIKTV
FT                   YDFLEYDKIDPKDIANILRKNIPHIEDFMNSLLAFNEKYLKIQKEDEKLNEILQKLKEN
FT                   LHLTKSMENELKRILKGYLVRNKELPEEIAEFINIKVNSKKEGKEYFEKLKKILAL"
FT   gene            complement(359579..360835)
FT                   /locus_tag="DICTH_0361"
FT   CDS_pept        complement(359579..360835)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0361"
FT                   /product="mn2+ and fe2+ transporters of the nramp family"
FT                   /note="identified by match to protein family HMM PF01566"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18896"
FT                   /db_xref="GOA:B5YCI5"
FT                   /db_xref="InterPro:IPR001046"
FT                   /db_xref="UniProtKB/TrEMBL:B5YCI5"
FT                   /protein_id="ACI18896.1"
FT                   /translation="MKTFLQKLFKGHKPKLGALEILKYIGPGFLVTVGFIDPGNWASNM
FT                   AAGSQFGYKLLWMVTLSTIMLIFLQHNAAHLGIATGLCLSEAISKYFPKFPRYFVLITA
FT                   MLASISTALAEILGAAIGLNMLFNLPLNIGALITTFVAILMLISNNYRKIEKYIIGFVS
FT                   IIGLSFLFELSLVKINWKSAIEGWIIPSFPQSSIPIIMSVLGAVVMPHNLFLHSEIIQS
FT                   RQWNLEDENTIKKQLKYEYLDTIGAMLVGWAINSSMILIAAETFYKNGIIITELPQAYV
FT                   TLKPILGHLASYVFAIALIFSGFSSSITAGMAGGTTWAGMFNEPFDIKDNHTRIGITIT
FT                   LLGALIVIFFVSNPFQGLIWSQIMLSIQLPLTVFSLIRLTSWEKVMGKFKNSRLDNIIL
FT                   LIIGIIVTILNITLFLSFL"
FT   gene            complement(360935..361093)
FT                   /locus_tag="DICTH_0362"
FT   CDS_pept        complement(360935..361093)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0362"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19971"
FT                   /db_xref="GOA:B5YCI6"
FT                   /db_xref="InterPro:IPR024419"
FT                   /db_xref="UniProtKB/TrEMBL:B5YCI6"
FT                   /protein_id="ACI19971.1"
FT                   /translation="MNEIAQLISNLGFPIVVSLILLIRIETRLENLTKAINELSQAILN
FT                   LSGKAST"
FT   gene            complement(361096..361428)
FT                   /locus_tag="DICTH_0363"
FT   CDS_pept        complement(361096..361428)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0363"
FT                   /product="gp46"
FT                   /note="identified by match to protein family HMM PF08291"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19117"
FT                   /db_xref="InterPro:IPR009045"
FT                   /db_xref="InterPro:IPR013230"
FT                   /db_xref="UniProtKB/TrEMBL:B5YCI7"
FT                   /protein_id="ACI19117.1"
FT                   /translation="MPKVNEIKISKNFYLKDFECPCCKRVMLHPDLLEKLERLILSGVK
FT                   IKITSGYRCEKHNTEVGGVPNSKHMKGMACDITSPELEKAYEIVQKLGFSYVKIDKLKK
FT                   YIHMEV"
FT   gene            complement(361421..361651)
FT                   /locus_tag="DICTH_0364"
FT   CDS_pept        complement(361421..361651)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0364"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19404"
FT                   /db_xref="UniProtKB/TrEMBL:B5YCI8"
FT                   /protein_id="ACI19404.1"
FT                   /translation="MLENIIKKVQFKFSFLYEIFPVYSCKICGKKKNFIFFIDETPICP
FT                   ECFPTFLEKQFLPLLISKIILSMEHREDKNA"
FT   gene            complement(361701..361931)
FT                   /locus_tag="DICTH_0365"
FT   CDS_pept        complement(361701..361931)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0365"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ACI20008"
FT                   /db_xref="InterPro:IPR021321"
FT                   /db_xref="UniProtKB/TrEMBL:B5YCI9"
FT                   /protein_id="ACI20008.1"
FT                   /translation="MANYSSRKYIRMIFKDNGGSNFTLRIPDPKDDITEQEILNAMDTI
FT                   INQNIFQGRTGDLVEKVDARVIETNISDYYD"
FT   gene            complement(361966..362187)
FT                   /locus_tag="DICTH_0366"
FT   CDS_pept        complement(361966..362187)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0366"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF07872"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18955"
FT                   /db_xref="InterPro:IPR012454"
FT                   /db_xref="UniProtKB/TrEMBL:B5YCJ0"
FT                   /protein_id="ACI18955.1"
FT                   /translation="MALQSLPYNSRLILRVQIGVQSGNPVLRNRSFNNVKPNAPDEAVY
FT                   VVAQTLGNLQKYPVVKVVRTNDEELVEV"
FT   gene            362295..363425
FT                   /locus_tag="DICTH_0367"
FT   CDS_pept        362295..363425
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0367"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19772"
FT                   /db_xref="UniProtKB/TrEMBL:B5YCJ1"
FT                   /protein_id="ACI19772.1"
FT                   /translation="MRYKVFVLAFLIFLITTVFSQTSLVIYQQNMGVLSFDKEVDLKKG
FT                   LNFVPLDEVVGNISYNNLFILSTSGNLIKEIVYPSLGIWIEAKEDCRDVLKIYLIVPNI
FT                   RWSADHMFLIDGDRVRFNTRVAIQNSSEVNFQRVKISLLSGSLNMAGGDEYRVFTKMAP
FT                   ATEEEYNLSLPTAESVQGYKIFDIPGEWSISKGTIKLIPLIDTWIKDPVKRYVLGYGGN
FT                   MRNAYILWNVENKKEKGLGVPIPSGKLSIFAIDNGKVVFLGSTNIQNIPEGEKIEVVQG
FT                   LDFDITADRKVLEEKKRVEGKYEITERTVAITIKNAKKEKVVVEVWEYISGGEIEIKSS
FT                   NFNYEKIDKNNFRFYVGIDSQKSSVLNYVCTIKNLK"
FT   gene            363469..364245
FT                   /locus_tag="DICTH_0368"
FT   CDS_pept        363469..364245
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0368"
FT                   /product="iron-sulfur cluster-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18785"
FT                   /db_xref="GOA:B5YCJ2"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:B5YCJ2"
FT                   /protein_id="ACI18785.1"
FT                   /translation="MRRRRSFLKLRSLWQSISLIIINSYFLAPWGKYIPIPVFNCYSCP
FT                   LASFACPIGTLQHFIVLHKFPFFTLGILFLAGILLGRFFCGWLCPFGFIQDLLYKIPTK
FT                   KLVIENRFATFIRWSIFIILVIIIPYITLEPWFCKLCPAGTLEAGIPQILLHPPLRSLI
FT                   GFLFAIKIFILTIFIISSIFISRPFCRFVCPLGTILSVFNKISFYQLEVKPTCSQCSLC
FT                   KPKCPVNIEVYEDPNSTHCIRCHECFSCGQVNWKIK"
FT   gene            364261..365808
FT                   /locus_tag="DICTH_0369"
FT   CDS_pept        364261..365808
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0369"
FT                   /product="cleavage and polyadenylation specificity factor"
FT                   /note="identified by match to protein family HMM PF00753;
FT                   match to protein family HMM PF07521"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18271"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR011108"
FT                   /db_xref="InterPro:IPR022712"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:B5YCJ3"
FT                   /protein_id="ACI18271.1"
FT                   /translation="MKITFYGAAGEVTGSCYLLENNFKYLVDCGIFQGKSERENESPFL
FT                   FDPKEIKAVILTHAHLDHSGRIPKLVKEGFKGKIYATYPTIELCEILWLDTVKLMKEEV
FT                   ERINRKNLRSGKPLVEPLYTEKEVEMAMKLFEPVPYDEVVDLSDIKIRFRDSAHILGAS
FT                   SLELWSDGTKIVFSGDIGPQNNVMEGQPSIIEGADYVIIESTYGDRLHKSLEETRSEFE
FT                   SVVLDAIKSQGKILIPSFVVDRAQRVMYELMLLTYKYPFLSKVPIFFDSPMGKKVTEVY
FT                   EKHSNLLSGEIQKYFLEGINPFELKNLRYLVTPDESKSINELDTGIIIAGSGMCTGGRI
FT                   LHHLKHNLWKENTHVIFVGYQAEGTLGRRIVDGEKTVHIMGEEITVRAKIHTINGFSAH
FT                   ADQSDLVKWTEYFKNDPIFVIVHGEPKASQALSQILQLKGKRTIIPSYAQSLDLEKKEI
FT                   VAPKVAPSFDIESLLEELSSYAVKLKSSTVPQDLETYSLLKSALHLLKEVSDRGKSL"
FT   gene            365805..367079
FT                   /locus_tag="DICTH_0370"
FT   CDS_pept        365805..367079
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0370"
FT                   /product="protein containing aminopeptidase domain,
FT                   putative"
FT                   /note="identified by match to protein family HMM PF04389"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19606"
FT                   /db_xref="GOA:B5YCJ4"
FT                   /db_xref="InterPro:IPR007484"
FT                   /db_xref="UniProtKB/TrEMBL:B5YCJ4"
FT                   /protein_id="ACI19606.1"
FT                   /translation="MKKINRVIIFLSLIILLLSSVRSNVRGDYALMIIRELSSAEYKGR
FT                   QAGTFENLEALKFIEGELKNLGLKDIFYQEFPVEVFYYDGAPEFLLKTEGRVLKRYEYR
FT                   KDFRDRFSGNYKVEAVIKNNVREIKGAFYLVKDRYADRNMLLAHIYGAKGVILGLPEDR
FT                   TELILQRSMFFLKEDMPVVYVTSEVFNEISNYMRSENKLRAYYRIGYVKEMAKAFNLYF
FT                   FIPSSRKTKKTVVLTAHIDHVGDDYDGSYFPGANDNASGVGVVLEIAKEIFEKGNNYPY
FT                   NFLFLITNGEEKGLLGSEYFVDYPPIPLEDIVLEVNFDCLGRGENLVISYNDYASKLVS
FT                   KIKSINLNNNVYFAKDYYLNESDQYPFHVHEKPFLFFIRVEKDEKISDLHQKTDTVDKI
FT                   SKDVVSSTIDTFFKILRSLSYDSLN"
FT   gene            367133..368041
FT                   /gene="pstC"
FT                   /locus_tag="DICTH_0371"
FT   CDS_pept        367133..368041
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pstC"
FT                   /locus_tag="DICTH_0371"
FT                   /product="phosphate ABC transporter, permease protein PstC"
FT                   /note="identified by match to protein family HMM PF00528;
FT                   match to protein family HMM TIGR02138"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19028"
FT                   /db_xref="GOA:B5YCJ5"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR011864"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B5YCJ5"
FT                   /protein_id="ACI19028.1"
FT                   /translation="MKRNLGDIIFKILAVLSSLALISLVLFLFVELVIYSVPSIKKFGI
FT                   KFLIEKIWDPVAEKYGALPAIYGTLVTSFFALLIAFPLSIGIAIFISELSPPLLQRPLS
FT                   FIIELLGAIPSLIYGMWGLFSLAPLIQLKVGPFLQRILGFLPLFQGYPIGVGYLTASIV
FT                   LSIMIIPTISSLSREILMAVPKDQREAGYALGMTKWEVIWRVVLGNAKSGIFAAGMLGL
FT                   GRALGEAVAVTMVIGNFYDISISLFSPGVTITSVIINEFAEATGQLKISVLMELALILF
FT                   IITFFVMGFARYYILKRIEGR"
FT   gene            368038..368868
FT                   /gene="pstA"
FT                   /locus_tag="DICTH_0372"
FT   CDS_pept        368038..368868
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pstA"
FT                   /locus_tag="DICTH_0372"
FT                   /product="phosphate ABC transporter, permease protein PstA"
FT                   /note="identified by match to protein family HMM PF00528;
FT                   match to protein family HMM TIGR00974"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19380"
FT                   /db_xref="GOA:B5YCJ6"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR005672"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B5YCJ6"
FT                   /protein_id="ACI19380.1"
FT                   /translation="MSYKRRKAINKVMIFISILTFLIGAFFLFWILGDIFLKGIRHINL
FT                   RMFVELPKPPGVPGGGIGNALVGTLILTILASIIGIPIGIMVGVYVNEYGRGKLAWWTK
FT                   FLSEVLTSFPTIIIGVFVYLIVVVPMKSFSALAGGIALGIIMLPIIAKSADESIKMVPN
FT                   SLREAAYALGVPKWRTILKVVIPSASSGIITGIMIAIARVMGETAPLLFTSLNNVYWSL
FT                   SLTKPIGSLTVTIFNYATSPYDDWRNMAYASALVLVFLILILNIIARIYGGRKK"
FT   gene            368890..369648
FT                   /gene="pstB"
FT                   /locus_tag="DICTH_0373"
FT   CDS_pept        368890..369648
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pstB"
FT                   /locus_tag="DICTH_0373"
FT                   /product="phosphate ABC transporter, ATP-binding protein"
FT                   /EC_number="3.6.3.27"
FT                   /note="identified by match to protein family HMM PF00005;
FT                   match to protein family HMM TIGR00972"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18834"
FT                   /db_xref="GOA:B5YCJ7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005670"
FT                   /db_xref="InterPro:IPR015850"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B5YCJ7"
FT                   /protein_id="ACI18834.1"
FT                   /translation="MEKIRVEKLNAWFGNMKVLKDVNVSMKEKHITAIIGPSGCGKTTL
FT                   LRCFNRLHELTPGAKVEGKIFLDDLNIYDKDVDPVMVRRRIGMVFQRPNLFNHMTIYDN
FT                   VIAGYILNSKKLPRDELDNIVEQSLKLAGIWEEVKNRLREYPSALSGGQQQRVCIARAL
FT                   AVKPEVLLMDEPTSALDPISTYRIEETIRELKEHITIIIVTHNMQQAARVSDDTIFMYM
FT                   GEVIEAGPTPQIFTNPKQKLTEDYITGKFG"
FT   gene            complement(369649..370305)
FT                   /gene="phoU_1"
FT                   /locus_tag="DICTH_0374"
FT   CDS_pept        complement(369649..370305)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phoU_1"
FT                   /locus_tag="DICTH_0374"
FT                   /product="phosphate transport system regulatory protein
FT                   PhoU"
FT                   /note="identified by match to protein family HMM PF01895;
FT                   match to protein family HMM TIGR02135"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19389"
FT                   /db_xref="GOA:B5YCJ8"
FT                   /db_xref="InterPro:IPR026022"
FT                   /db_xref="InterPro:IPR028366"
FT                   /db_xref="InterPro:IPR038078"
FT                   /db_xref="UniProtKB/TrEMBL:B5YCJ8"
FT                   /protein_id="ACI19389.1"
FT                   /translation="MLRHSFVEELRKLENSLLEMGNQVKEMLEKSKNALLERDENLAKK
FT                   VIEMDDIVDKYNWDIEDKCLKLLALQQPMAHDLRVIAAAMKIISDIERMGDYCVDIAKF
FT                   TIELIKMPPLPTNENLIKMFQLVEKILCDSLEAFVNRDINFIISVVEQDDAIDRTYYKI
FT                   YDEIVEEIEHAPETAPQQIRLLMIAKFLERVADHVTNVAERIYYMETGELKELHE"
FT   gene            complement(370474..371538)
FT                   /locus_tag="DICTH_0375"
FT   CDS_pept        complement(370474..371538)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0375"
FT                   /product="cell surface protein"
FT                   /note="identified by match to protein family HMM PF01011"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19575"
FT                   /db_xref="InterPro:IPR002372"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR018391"
FT                   /db_xref="UniProtKB/TrEMBL:B5YCJ9"
FT                   /protein_id="ACI19575.1"
FT                   /translation="MRRSVFNFLILILLFLFYGCAPKDTQPPTVSILSPADGETVSKTI
FT                   TITVEAIDDKGISKVELYIDSKKIIEKTKAPYTYTWDTTQYDEGLYLISAKAIDLAGNS
FT                   SISKIIRIFVSNMDKLKWAYQTEWSITSSPAIGSDGTIYVGDWDRYLYAINPDGTLKWK
FT                   YETEDRIHSSPAIGQDGTIYVGSWDNYLYAINPDGTLKWKYKTGDFINSSPTLGNKTVY
FT                   VGSDDGYLYAINSTSYGLAKSVWPKFRCNYQNTGYLAQIVDIILPTVSITYPTDGATLT
FT                   GTITIEATATDNLHVSRVEFYIDDELKYIDNLPPYAYTWNTNLCSNGEHTIMVKAYDEA
FT                   ENKRSISILVNVNN"
FT   gene            371716..372423
FT                   /locus_tag="DICTH_0376"
FT   CDS_pept        371716..372423
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0376"
FT                   /product="3-oxoacyl-[acyl-carrier protein] reductase"
FT                   /note="identified by match to protein family HMM PF00106"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18363"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B5YCK0"
FT                   /protein_id="ACI18363.1"
FT                   /translation="MAGILEGRRMVITGASRGIGFEICKLFLKEGASIIGVAKDEKRLK
FT                   EAEKLLREMGDFEGVAVDLEEDNFTSKIVEKVEKKWNALDVLFNNAGVMLAYGGFLEES
FT                   DEVFERTFKVNLYAPYKLVKAMLPFLLRGKEPRIINTSSGAGIFDEIRKKYDIASYRLS
FT                   KFALNGFTIILANELKGKIAVNAFDPGWVKTDLGGPNAPGSPEDSARGALAVVTLPFEV
FT                   TGKFFKDGREINF"
FT   gene            372489..373484
FT                   /locus_tag="DICTH_0377"
FT   CDS_pept        372489..373484
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0377"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18938"
FT                   /db_xref="UniProtKB/TrEMBL:B5YCK1"
FT                   /protein_id="ACI18938.1"
FT                   /translation="MKFPLGQEIYKKTPAPLVNLKELISWFRLEKFNGLLMGETSNIIT
FT                   EILVYDGKIPKAFTERNGEVLAEDCSAIEIFINDYLARVSSLSLFSYDKELITPILILY
FT                   FSTPNILHEETYLFVPERLIDESRKENTLSHILIEDLEDKVHFLFYNGIFKGYYSEKDG
FT                   VIREDLNFLFELFNKGNTFVSFYQTSIKDFERLDVSSLKFSFIEDEINKWVERLLEYVN
FT                   FIIGYYDEHGMHVENLNRVLEGLNILFNSLVCLDNKFIIKREIIGSYDEIENEIVELIK
FT                   RINKELSDLWGKKFVYQKYIQGYKSFMEKYKNDKVIMELLDRINPENIEF"
FT   gene            373497..374267
FT                   /locus_tag="DICTH_0378"
FT   CDS_pept        373497..374267
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0378"
FT                   /product="membrane protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19931"
FT                   /db_xref="GOA:B5YCK2"
FT                   /db_xref="UniProtKB/TrEMBL:B5YCK2"
FT                   /protein_id="ACI19931.1"
FT                   /translation="MSMSLGKKISIFFVFLFLIPFFIFLSVEFSNFKNEALYPIFYQIS
FT                   EGIALIIAVYYFLKIEKKWRGWLGWFLVVLSLVFLFIADSIWNFYAIFRGEEAPFPGIS
FT                   DIFYVLFYVFAFVFLVYFIRLLKLEFDPSEKFFISIIFLVIFVLLLQGILISIFGSKEM
FT                   DFWEKFLNIFYILGDFVLILLAFMLLMKLWGGKVAKNYIYFVLALSLTTIADVIFVYIF
FT                   KNYGISNWADLFYLASFLLLACAIISESLLHISK"
FT   gene            374291..375604
FT                   /locus_tag="DICTH_0379"
FT   CDS_pept        374291..375604
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0379"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18591"
FT                   /db_xref="GOA:B5YCK3"
FT                   /db_xref="InterPro:IPR002471"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR024981"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B5YCK3"
FT                   /protein_id="ACI18591.1"
FT                   /translation="MRKILIFLLLFLFLTIAYAQEDEKVIAEKFINLLVSGKYDEAVNL
FT                   FDPSVKPMIPADKLEEVWKSLEKQVGSFKSILGYRTQESGGYKIVFVTCEFNAMDIDVR
FT                   LVFANNKIVGMFFQPAPPRKSYTPPSYVDVNSFVEEDVKIGKEFPLSGKLVIPKGKGPF
FT                   PVIILVHGSGPNDMDESIGPNKPFRDIAWGLGTLGIATLRYDKRTKVYPEKFSEYKDGF
FT                   TVWEEVIEDVLFAIEFLKNREDIDKSKIFVLGHSLGGMLAPRIATYTKDLAGLIIMAGP
FT                   TRPLEDLILEQTEYLSNIDGNIDENEKAQLDVIKGEIQKIKDPNLLEKYPPNLMILGAP
FT                   VKYWADLKSYDPLLTLSNLEIPALILQGERDYQVTLKDFEGWSRLSSLERITLKLYPKL
FT                   NHLFMEGEGKSIPQEYYVEGHIPEYVIKDIAEWIKSLK"
FT   gene            complement(375632..377485)
FT                   /locus_tag="DICTH_0380"
FT   CDS_pept        complement(375632..377485)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0380"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF07944"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19626"
FT                   /db_xref="GOA:B5YCK4"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR012878"
FT                   /db_xref="UniProtKB/TrEMBL:B5YCK4"
FT                   /protein_id="ACI19626.1"
FT                   /translation="MPNTFLINTTNSPHSKLLPVAVSEVRITKGLLAERMRTIKEVTIP
FT                   TQYELLEQTQRLFNFRRAAGKAQGDYFGFFFNDTDVYKWVEAASYSLMWEWDDQLDKLL
FT                   DQVIEEIKSAQDEDGYLDTYFTFEKKKERWTNLKDMHELYCAGHLIQAGIAHHRATGKT
FT                   NLLEVAIKFADHINSVFGPGKKEGTCGHPEIEMALVELFRETRDYKYLGLARFFIDERG
FT                   KGLVGGDLYHIDHKPFRDLDEIVGHAVRSLYLNCGATDLYLEIGDRSILEALERLWHSF
FT                   TERKMYITGGAGARYEGEAFGEDYELPNETAYAETCAAIASFMWNYRMLFAMPEGRFAD
FT                   IMEQTLYNGLLSGISLDGMHYFYVNPLSDNGKHRRQKWFACACCPPNIARLIASLPGYV
FT                   YTKSYDGIWMHLYTENSAKIEWNNNVIELDVKTNYPWDGDINITVNSNAKFSLFLRIPG
FT                   WVKEYSILVNNHEEKPEIINRYAKLERNWEKGDRVKLSLNMKPEVIISNPKVKDNVGRV
FT                   AIKRGPIVYCIEQADNNFPIFDLEIDTEKELKSIYSENLKGLVVIKGKGYIPEKDIWEK
FT                   NLYLPIEDLRLKRNEVEFTAIPYYAWANREQGPMQVWIRKA"
FT   gene            complement(377489..379540)
FT                   /locus_tag="DICTH_0381"
FT   CDS_pept        complement(377489..379540)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0381"
FT                   /product="beta-galactosidase I"
FT                   /EC_number="3.2.1.23"
FT                   /note="identified by match to protein family HMM PF02449;
FT                   match to protein family HMM PF08532; match to protein
FT                   family HMM PF08533"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18435"
FT                   /db_xref="GOA:B5YCK5"
FT                   /db_xref="InterPro:IPR003476"
FT                   /db_xref="InterPro:IPR013529"
FT                   /db_xref="InterPro:IPR013738"
FT                   /db_xref="InterPro:IPR013739"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:B5YCK5"
FT                   /protein_id="ACI18435.1"
FT                   /translation="MINPKLPYIWYGGDYNPEQWDKEVWKEDIRLFKLAKINIATVNVF
FT                   SWSLLQPSEDVYDFSMLDEIIDNLWKNGIYICLATSTASQPHWMSVKYPEILPVDINGH
FT                   KREHGGRVNFCPNSKIYRYFAGKLVEKLAERYANHPGVLVWHIANEYGTYCFCENCVKE
FT                   FRDWLKKKYGTLEELNKRWYTTFWSQTFYDWNEINAPTLRSVMFHHWWTGKLSTVAQGM
FT                   VLDYYRFMSESILECYLNEYNIIKKYNPDIPVTTNLMGAFKPLNYFEWAKHMDVVSWDS
FT                   YPYLTDDYVNIAFRHSLMRGLKQGEPFMLMEQTPSQTNWQPYCYIKRPKVMRLQSYQAV
FT                   AHGADTVMFFQLRQSKGGPEKFHGAVISHAGHENTRVFKEVKELGEELHKLGDTLLGSR
FT                   VKSQTAVIFDWENWWALENSQGPSTAINYVEGVEKYFRALFENTLGVDVIGIEDNFEKY
FT                   KLIIAPLLYMVKEEWAEKIKDYVRKGGIFVTTTLSGLVDENDLVYLGGYPKPLRDLLGI
FT                   WVEEFDALPPEMKNEIIIQDEYRKEFTKEKYECNLVFDVIHLEDSTAKAIGVYSKDYYK
FT                   EQPCITVNKYGNGYAYYIGTFPSNEFLKEFVRYLSKIHQIEPILKDVPYGIEITQRIKN
FT                   GKTFTFVLNHSEETKTINIGPKKKDLLSGRELEGLIDLHPKEVLILEE"
FT   gene            complement(379602..380084)
FT                   /locus_tag="DICTH_0382"
FT   CDS_pept        complement(379602..380084)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0382"
FT                   /product="L-arabinose transport system permease protein
FT                   AraQ"
FT                   /EC_number="3.6.3.17"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18467"
FT                   /db_xref="GOA:B5YCK6"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B5YCK6"
FT                   /protein_id="ACI18467.1"
FT                   /translation="MMIPFAALMVPLFKLMTSFNLIDSHWGVILPMLSSVFLIFFFRQN
FT                   FKMYPKEIIMAARVDGANELKIFFSIVFPSMRSAYAAGAIWSFMNSWNSYLWPLVILQS
FT                   ENKKTMTLLISTLASGYTPDFGVIMTAVVIATLPMIIVFFTLQNYFIQSILGSMKQ"
FT   gene            380209..380445
FT                   /locus_tag="DICTH_0383"
FT   CDS_pept        380209..380445
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0383"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF01206"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19082"
FT                   /db_xref="InterPro:IPR001455"
FT                   /db_xref="InterPro:IPR036868"
FT                   /db_xref="UniProtKB/TrEMBL:B5YCK7"
FT                   /protein_id="ACI19082.1"
FT                   /translation="MDVKPNYTLDVRGEVCPVPDVETKRKLKTMQSGEVLEVLIDYPLS
FT                   KERIPQGVKEVGGEVLAIEEIGPSEWRILIKKL"
FT   gene            380468..381460
FT                   /locus_tag="DICTH_0384"
FT   CDS_pept        380468..381460
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0384"
FT                   /product="YeeE/YedE family protein"
FT                   /note="identified by match to protein family HMM PF04143"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ACI20064"
FT                   /db_xref="GOA:B5YCK8"
FT                   /db_xref="InterPro:IPR007272"
FT                   /db_xref="UniProtKB/TrEMBL:B5YCK8"
FT                   /protein_id="ACI20064.1"
FT                   /translation="MIWQGLLVGILFGVVLQRSRMCFNSAIRDIKFNKDNYLVKMAAVA
FT                   ILIETLGFHLVASLGWIKLNPLPFIPLAQIIGGFLFGMGMVLAGGCASGVTYRIGEGYI
FT                   TAILAGLFYGITASAVRGGVLNFVNSWFGSPITVTMQDPGIYNAVEGKVSPTIANVLGI
FT                   NPWIVAIVFAVLLAIYIWGTKTTERQVSGLNWLTGGVALGIVGILGYLSQKSYALGITG
FT                   GWVNLLRGTVSGVAYNWIGMEVLGIIIGAFVSALISKEFKLRVPKDPKTYLQVILGGIL
FT                   MGFGAGVAAGCNIGHILSGLPHLALSSILATIFFVLGNWFMFWYLYARK"
FT   gene            381473..381826
FT                   /locus_tag="DICTH_0385"
FT   CDS_pept        381473..381826
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0385"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF02635"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18770"
FT                   /db_xref="InterPro:IPR003787"
FT                   /db_xref="InterPro:IPR027396"
FT                   /db_xref="UniProtKB/TrEMBL:B5YCK9"
FT                   /protein_id="ACI18770.1"
FT                   /translation="MHIAIQVNVPPYTYEDLDTAIHLAEAALKRGHKVSIFLFADSVLS
FT                   VNSKVKPLRVDRNIPLKMKELCEKGVEVHICGLCAEYRGINSENTVEGPKFSGVPEMAS
FT                   LIFNADRYMNLMP"
FT   gene            381841..382200
FT                   /locus_tag="DICTH_0386"
FT   CDS_pept        381841..382200
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0386"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF02635"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19056"
FT                   /db_xref="InterPro:IPR003787"
FT                   /db_xref="InterPro:IPR017462"
FT                   /db_xref="InterPro:IPR027396"
FT                   /db_xref="UniProtKB/TrEMBL:B5YCL0"
FT                   /protein_id="ACI19056.1"
FT                   /translation="MKKVLFVVYQSPAGSIWVNEALRSAFGMYGEDLEPSILFMGDAVV
FT                   AVNKNTHPENLGCLSLSMSFKYLERYGTPIYVVKEDLEKRKIKEEDIEPTWKAKIISNN
FT                   ELSEFIHSFDRVIFF"
FT   gene            382216..382494
FT                   /locus_tag="DICTH_0387"
FT   CDS_pept        382216..382494
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0387"
FT                   /product="DsrH like protein"
FT                   /note="identified by match to protein family HMM PF04077;
FT                   match to protein family HMM TIGR03011"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19923"
FT                   /db_xref="GOA:B5YCL1"
FT                   /db_xref="InterPro:IPR007215"
FT                   /db_xref="InterPro:IPR027396"
FT                   /db_xref="UniProtKB/TrEMBL:B5YCL1"
FT                   /protein_id="ACI19923.1"
FT                   /translation="MALIIVKKSPTEDISRRMIDLAMEGDTILFVQDGVLHAIDENTKN
FT                   LVKNGVSVFVLKEDLEARGYSESLSLFSCVDYEGWVELIEKNEKIIS"
FT   gene            382509..383900
FT                   /gene="lpdA"
FT                   /locus_tag="DICTH_0388"
FT   CDS_pept        382509..383900
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lpdA"
FT                   /locus_tag="DICTH_0388"
FT                   /product="dihydrolipoamide dehydrogenase"
FT                   /EC_number="1.8.1.4"
FT                   /note="identified by match to protein family HMM PF00070;
FT                   match to protein family HMM PF01134; match to protein
FT                   family HMM PF02852; match to protein family HMM PF07992;
FT                   match to protein family HMM TIGR01350"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19169"
FT                   /db_xref="GOA:B5YCL2"
FT                   /db_xref="InterPro:IPR001100"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR006258"
FT                   /db_xref="InterPro:IPR012999"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B5YCL2"
FT                   /protein_id="ACI19169.1"
FT                   /translation="MERFDVIFLGAGSGGYVGAIRAADLGKKVCIIEARELGGTCLNRG
FT                   CIPTKALLKSAEVFHTVKDAKTFGINVDAYSFDVNGIYSWKENVVKKLVSGVEYLLKSR
FT                   KVVIKKGRGRIIDNETIEVETPEGKEIVQGDNIVIATGSEPAMIPTFKIDGKNVLTSDD
FT                   ALNLREIPKDIVIIGAGAIGIEFATFYSTFGTKVTIVEMMPQVVPTLKDKKVASYLQRI
FT                   LNKKGIEVKVGAKIESVEVKDGKVYSTLSTGEVLESEKVLVSIGRKLNSDNIGLENIGV
FT                   NVDRGRIVVDEYLRTNVKNVYAIGDVIGGLLLAHKAMKEGEVVAEIIAGENKKMDYRVV
FT                   PWAIFSSPEIAACGLTEEEAKEQGIEVVTGEFPFSANGKAVSMNATDGFVKVVAKKEDK
FT                   VIIGAQIIGPEASVMIAELALAIQNNLTLDDVADTVHTHPTLPEAVMEAVKVPLGSVVH
FT                   IYLRR"
FT   gene            384221..384706
FT                   /locus_tag="DICTH_0389"
FT   CDS_pept        384221..384706
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0389"
FT                   /product="HD superfamily hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19793"
FT                   /db_xref="GOA:B5YCL3"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="UniProtKB/TrEMBL:B5YCL3"
FT                   /protein_id="ACI19793.1"
FT                   /translation="MVIEDIYYDLVNYFGKDVKRINHATKVWVFARIIGKREALNEETQ
FT                   LILEISAILHDIGIKVCEERYGSTAGNLQELEGPKEAIKILEKYPLDNRILERVLFLIG
FT                   NHHSYEKIDNIDFQILVEADFLVNIFEDNIDKSTVEYIKEKYFKTETGKYLMNIMYG"
FT   gene            384819..385103
FT                   /locus_tag="DICTH_0390"
FT   CDS_pept        384819..385103
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0390"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18560"
FT                   /db_xref="GOA:B5YCL4"
FT                   /db_xref="UniProtKB/TrEMBL:B5YCL4"
FT                   /protein_id="ACI18560.1"
FT                   /translation="MIDKFLFIILSFFALGFIIYFESFYRKRERVKSYLKFLLVTGIQL
FT                   IILFLFQFTPYLLLRTPLSYKEAILLILELILGGLFIGFYIVHKKSRVL"
FT   gene            385223..385717
FT                   /locus_tag="DICTH_0391"
FT   CDS_pept        385223..385717
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0391"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19991"
FT                   /db_xref="UniProtKB/TrEMBL:B5YCL5"
FT                   /protein_id="ACI19991.1"
FT                   /translation="MKKYVNLLLSILLISLFLFTTGFAQTGTKVYINKVNSPDGGLIEP
FT                   AKSQLINKLMGKGFVITEKKDEANYLIDLVIVSANSKRSFNWLILIFPAWPLVPFTTVQ
FT                   GEAIVALRIYDQAGNEVLFDQTGAVRNGMWFFGDFVSGSSVIKGAVNDCINILTSRMNL
FT                   R"
FT   gene            385973..387130
FT                   /locus_tag="DICTH_0392"
FT   CDS_pept        385973..387130
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0392"
FT                   /product="ABC transporter, periplasmic ligand binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19361"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:B5YCL6"
FT                   /protein_id="ACI19361.1"
FT                   /translation="MKKKSILFGVLTVILFFLMIANLGAQTKKVRLSIIDVAGNLQLTK
FT                   PAIEAFKKANPDLIEDIEYLKATAPELPAKIKAQQMAGNITTTMVLTGYDAMASGLEMD
FT                   LWENIYPTYKQYFPNLESRYLPGAKAAFDLFKGYGIVVTYCPGGPMFTYNPEKVKKVPQ
FT                   TAEELLEWAKQNPGKFMYARPANSGPGRAFLQGLPYILGDKNPKDPKTWDKTWAYLKEL
FT                   DKYIDYYPTGTAITFRELAEGTRWIIASHLGWDMNQRILGVIPSNFKGFFLKNTTWVTD
FT                   AHFMCMPKGLDEARKKATLQLMAWLLRAEMQALTYDDGYFYPGPAIKGVPLSSAPKETQ
FT                   DKIKAAMRPEYEKAIKEFPSTTQLGAKELVEAFDMWDRMIGAKVK"
FT   gene            387194..388300
FT                   /locus_tag="DICTH_0393"
FT   CDS_pept        387194..388300
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0393"
FT                   /product="spermidine/putrescine import ATP-binding protein
FT                   PotA"
FT                   /EC_number="3.6.3.31"
FT                   /note="identified by match to protein family HMM PF00005;
FT                   match to protein family HMM PF08402"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18299"
FT                   /db_xref="GOA:B5YCL7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B5YCL7"
FT                   /protein_id="ACI18299.1"
FT                   /translation="MREFKELRITGLNKYYGNKKVVDNFNLTIKNGEFVTLLGPSGSGK
FT                   STVLNCIAGLIPIDGGSIYIDDECLDDGKNFVPPEKRNFGMVFQNYALFPHLSVFDNVA
FT                   FGLRLRKLPKEVIKEKVISALRMVHLEEHVNKYPRQLSGGEQQRVALARCIVMEPRVML
FT                   LDEPLSNLDALLRIEMRYELKALHERLKITTIYVTHDQQEALALSDRIVVLNKGKIQQI
FT                   GTPEEIYSYPSNLFVANFLGFRNIWEVKILKLEGDNVAYIKFGSVNLKATLQDKYKSHI
FT                   RNIFENNKRAYISVRPEDIEIGEGLENNIEIKIEVIEYLGHHKQFWGVTSDGINIEVSK
FT                   ESNISLEPGDSVKIWIPPERILIFSEED"
FT   gene            388303..389160
FT                   /locus_tag="DICTH_0394"
FT   CDS_pept        388303..389160
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0394"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane Component:Tumour necrosis factor
FT                   c/lymphotoxin-beta"
FT                   /note="identified by match to protein family HMM PF00528"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18837"
FT                   /db_xref="GOA:B5YCL8"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B5YCL8"
FT                   /protein_id="ACI18837.1"
FT                   /translation="MGRRNTLTIILFLLPAFVYLTFLFVYPFLYGLNLSLTDERGNFTL
FT                   NNFIRFFSDPWDANTIWITLKIAIPATLLSILIAIPLAYYMRHGIKGEKFITMLLILPI
FT                   TLGSVFIAEGMLTYMGPNGWLNRLLIFLKITDKPLKLTHNYLGVLIALIIQGFPFVFLM
FT                   LLGYISGIDPNLEKAASVLGANRWQIFWKVMFPLWLPGITMAMSLNFVMNFTVFPSAVL
FT                   LGQPSGPTRVISISAFQWAFEKFNFHMSSAVAIIMGIVELIFILIVMFIRQGLYRGSTV
FT                   AGKG"
FT   gene            389171..389986
FT                   /locus_tag="DICTH_0395"
FT   CDS_pept        389171..389986
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0395"
FT                   /product="ABC transporter, inner membrane subunit"
FT                   /note="identified by match to protein family HMM PF00528"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ACI20148"
FT                   /db_xref="GOA:B5YCL9"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B5YCL9"
FT                   /protein_id="ACI20148.1"
FT                   /translation="MRNRVGLSKALFWFAIVIYSFNILGIILTVVLNSLSKEWYGELLP
FT                   KIFTFEWYAYMAREHDLPQLLYATFVVAISVALIALIIGLPTAYVLARYDFRFKNVILS
FT                   LLLLPMLIPPMTYGIPLAALLYKLRLATRLPGVILANLVPVVPYVTLILTPFIEQIDVS
FT                   YESAARVLGANRLQTFLKILLPLTVPGIFTAALLSIVRTIAMFELTFLVAGPKSQTVVV
FT                   ALYYDAYAAGTRPPQAIDALAVVYFLITMTFLVIALRFASPTQFVYRGK"
FT   gene            complement(390029..391192)
FT                   /locus_tag="DICTH_0396"
FT   CDS_pept        complement(390029..391192)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0396"
FT                   /product="hypothetical conserved protein"
FT                   /note="identified by match to protein family HMM PF00583"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19874"
FT                   /db_xref="GOA:B5YCM0"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR025559"
FT                   /db_xref="InterPro:IPR036527"
FT                   /db_xref="InterPro:IPR041380"
FT                   /db_xref="UniProtKB/TrEMBL:B5YCM0"
FT                   /protein_id="ACI19874.1"
FT                   /translation="MEIIRLNPSYIDDLIELWSQSFAFPYEQVSTWVNEKSIRNCIGAI
FT                   ENNKLVSALSIIPMEGYVRGELFSFSGIGGVATLPEKRGKNYVHYLLREAIRISKENGS
FT                   TFSSLYPFSFEFYRTFGWELGGFQKRYRRKTYSIPKFPEMEKVKRIPLEDWKLIKPVYD
FT                   KFSKNFSGSIKRTDERWESLIFRTRTLTYLYIYEDKEIEGYLLYSVEKTNINRIVVREM
FT                   ITLNTSAYKGFLSLFSRQAMTIEEVEWTAPLDDPLPFILPNPRGECSIEPTFMIRVIDV
FT                   ERALSSLKYDENINIKIALKIKDEHGEWNDGIWNLEIENGKGNLEKKDGLEYDIAININ
FT                   TLSQIITGTISPKTAYNLGYIEVNNFNALNDFNKLFSEYPTFCWDYF"
FT   gene            complement(391195..392313)
FT                   /locus_tag="DICTH_0397"
FT   CDS_pept        complement(391195..392313)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0397"
FT                   /product="chitinase A1"
FT                   /EC_number="3.2.1.14"
FT                   /note="identified by match to protein family HMM PF00704"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18778"
FT                   /db_xref="GOA:B5YCM1"
FT                   /db_xref="InterPro:IPR001223"
FT                   /db_xref="InterPro:IPR001579"
FT                   /db_xref="InterPro:IPR011583"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR029070"
FT                   /db_xref="UniProtKB/TrEMBL:B5YCM1"
FT                   /protein_id="ACI18778.1"
FT                   /translation="MPQKRVVAYFPEWKVRDEYLGYSIEDIPWKFLTHINYAFAKIVDG
FT                   KVHPIDENLFYSNMKKIKEFKKEYKKVKVLISVGGWTDSGEFSDVALTEENRRKFAKSA
FT                   LELIKEFNLDGIDIDWEFPVSGGLPTNKARPEDKENFTLLLKTLREVLSEENKDLLLTI
FT                   AAPASYTQIHNTEPDKYHVFLDFINLMTYDFHGVWDKYTNHHSPLYGTPKDPDEKSRER
FT                   ANCDSAVREYLKFKVPSEKIVLGVPFYGKGWICEDEGYNGLFAKVKGIPYGIFDSEGHP
FT                   SGSNPFFFIRGVLENDPDYIKFRDEYAKVPWLWNPKEKIMYSYDDEESISEKCDYVIKN
FT                   NLGGIMFWEVTQDYPFKGYTLVELIHNKLMEG"
FT   gene            392460..394073
FT                   /locus_tag="DICTH_0398"
FT   CDS_pept        392460..394073
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0398"
FT                   /product="alkaline phosphatase III"
FT                   /EC_number="3.1.3.1"
FT                   /note="identified by match to protein family HMM PF00245"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18383"
FT                   /db_xref="GOA:B5YCM2"
FT                   /db_xref="InterPro:IPR001952"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:B5YCM2"
FT                   /protein_id="ACI18383.1"
FT                   /translation="MRFDRVFSKVLLIFILVLGFVFFSSSFGVALQSSSSLYKGKPVKY
FT                   IFWFIGDGMGLNHVYLTEAFLGRKSNSPSIEKLSFTQFPNVGLMTTYAADSYITDSASA
FT                   ITAMAAGKKTNDGVINMDPTLKFKYKSVAEEARDLGYKVGVLTSVSIDHATPAGMYAHQ
FT                   PSRNNYYAIALELFESNFDYFGGGGFLQPQGKDGKQKDVYEIAKEKGYKIVDKIEDFLK
FT                   LRKGDNKIVAINPILDSSKALPYAINRLRGANLGLSLADFTKKAIELLDNPKGFFIMVE
FT                   GGKIDWAAHANDAGSVIYDVLDFNEAIKVALEFYKKRPFETVIIVTADHETGGLSIGYA
FT                   GTRYEVYLDVLSRQKISYDEFTKVVNEYKSKVKREEAKLSDLLPQIKEYYGLEILSPEV
FT                   RKELENRAKAGDKEAKIRLQLALNESEIEELEKAFKLSMMDPKERPNDAKSYLLYGGYD
FT                   PLTITVTRILNQKAGISWTSYSHTGMPVPVYAIGAGSYIFNGYYDNTDLYKKLMSLIGK
FT                   DPYKDNVLSSAEVRELVFSK"
FT   gene            394121..394456
FT                   /locus_tag="DICTH_0399"
FT   CDS_pept        394121..394456
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0399"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19532"
FT                   /db_xref="InterPro:IPR025497"
FT                   /db_xref="UniProtKB/TrEMBL:B5YCM3"
FT                   /protein_id="ACI19532.1"
FT                   /translation="MIVQGSIEILDLLTLISFLSYSNKSGILMLNANHSEGAIFFSNGE
FT                   IVDAFLENKRGEEALVHLILNHSAVNFCFYQSNISRNNTINKKSEVLILELMKIFDENN
FT                   NKDLLLV"
FT   gene            394467..394925
FT                   /locus_tag="DICTH_0400"
FT   CDS_pept        394467..394925
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0400"
FT                   /product="arsenate reductase"
FT                   /EC_number="1.20.4.1"
FT                   /note="identified by match to protein family HMM PF01451"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19105"
FT                   /db_xref="GOA:B5YCM4"
FT                   /db_xref="InterPro:IPR023485"
FT                   /db_xref="InterPro:IPR036196"
FT                   /db_xref="UniProtKB/TrEMBL:B5YCM4"
FT                   /protein_id="ACI19105.1"
FT                   /translation="MAKKKILFVCTHNSARSQMAEGIVNALYGDEYEAYSAGTEPRGVN
FT                   PLAIEVLKEIGIDISHHRSKSIEEFKGQEFDYVVTVCDNAKENCPFFPGGKKYIHRGFM
FT                   DPASVEGSYEEKLYAFRKVRDEIMDWIKSYFIENKDEGVSFFTPINKI"
FT   gene            394939..395340
FT                   /locus_tag="DICTH_0401"
FT   CDS_pept        394939..395340
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0401"
FT                   /product="protein of unknown function"
FT                   /note="identified by match to protein family HMM PF01934"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19219"
FT                   /db_xref="InterPro:IPR008201"
FT                   /db_xref="InterPro:IPR037038"
FT                   /db_xref="UniProtKB/TrEMBL:B5YCM5"
FT                   /protein_id="ACI19219.1"
FT                   /translation="MVIRDRVKKLEENITILEDFKNRYSLENVKKDKIIQWALKYGLYL
FT                   CITGIGEIACGIVNERNLGNAKNYKECIAILGDNDILDRMSAEKLINYVNIRDMLKRPY
FT                   IDVDLEKLYSFTEKLDFFRDFVSKVKNFT"
FT   gene            complement(395344..395811)
FT                   /locus_tag="DICTH_0402"
FT   CDS_pept        complement(395344..395811)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0402"
FT                   /product="thioredoxin peroxidase"
FT                   /note="identified by match to protein family HMM PF00578;
FT                   match to protein family HMM PF08534"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18345"
FT                   /db_xref="GOA:B5YCM6"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR024706"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B5YCM6"
FT                   /protein_id="ACI18345.1"
FT                   /translation="MQKRGLEIGSQAPDFSLKDQNGDEFKLSNYKGKKILLSFHPLAWT
FT                   SICSKQMLSLEENYNKFLELNTIPVGVSVDPVPSKKAWAENLQLKNLKILSDFWPHGKV
FT                   AKLFNIFREEDGFSERANIIIDEEGKIVFFKIYPIRELPDINEIIEFLSNK"
FT   gene            395928..396830
FT                   /locus_tag="DICTH_0403"
FT   CDS_pept        395928..396830
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0403"
FT                   /product="sensory box/ggdef family protein"
FT                   /note="identified by match to protein family HMM PF00989;
FT                   match to protein family HMM PF00990; match to protein
FT                   family HMM PF08448; match to protein family HMM TIGR00229;
FT                   match to protein family HMM TIGR00254"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ACI20121"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:B5YCM7"
FT                   /protein_id="ACI20121.1"
FT                   /translation="MKLPEGFQEIFDRVSDGVYFVDTERKILYWNKQAEEIAGYKRKEI
FT                   INSHCYDNILRHMDDEGRELCKDKCPLVYAIENNKYIEKRVYLHHKNGQRVPVFVRVLP
FT                   LKDEENRIIGAIEIFNEAIEFTNLKKELEKLRELTYIDELTGVLNRRGLNFFLRKQINN
FT                   FKKNKKAFGVLFMDIDNFKEINDRYGHNVGDKVLKMLSETLKNNLRTEDMVARYGGDEF
FT                   VVILQVGDINTLESLTKRIKNLIENSFLEEAGRIIKITVSVGGTLIRENDTMNTLLKRA
FT                   DELMYQSKKEGKNLYKISL"
FT   gene            396857..398263
FT                   /locus_tag="DICTH_0404"
FT   CDS_pept        396857..398263
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0404"
FT                   /product="TldD"
FT                   /note="identified by match to protein family HMM PF01523"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18595"
FT                   /db_xref="GOA:B5YCM8"
FT                   /db_xref="InterPro:IPR002510"
FT                   /db_xref="InterPro:IPR025502"
FT                   /db_xref="InterPro:IPR035068"
FT                   /db_xref="InterPro:IPR036059"
FT                   /db_xref="UniProtKB/TrEMBL:B5YCM8"
FT                   /protein_id="ACI18595.1"
FT                   /translation="MTLRKSKGKEAKRRMFDVLRGLISKVSADYVDIRYEKMSETKIVL
FT                   NNREIFQLGTNTGDGFVVRILKNGGFSSVAFTRIEDAEKALKICLENAELISKNSKKKV
FT                   RLAEVEVVKDTFIPNLKEDPRAVSIDEKLELLMHYNEIPLKFENITTNMQYTEVVREKY
FT                   FVSSEGTEIREDLITTGIRGMLISRDGSLVQNVRVGIGGSDGFYRLRNREEEFEKKTKI
FT                   VLDLLKAEPVIGGVYNVILNPDMTGVFTHEAFGHFSEADLIEDNPSMRERMKIGAKLGN
FT                   DILTIIDDPTIPNQLGFYKYDDEGVRARRTYLLKDGVLVGRLHSRRTAAEFGEPVTGHC
FT                   VAEDYRYPPIVRMGNIFIEPKDKSFEELLELLGDGLYILDAKGGQTSGENFTFGAQYAF
FT                   EVKNGKIGKLLRDINISGNLYKTLMDIVAIGKDFELSEVGGCGKGQLNIRSCHGGPHIL
FT                   VKNVVIGGVK"
FT   gene            398263..399576
FT                   /locus_tag="DICTH_0405"
FT   CDS_pept        398263..399576
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0405"
FT                   /product="PmbA, putative"
FT                   /note="identified by match to protein family HMM PF01523"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19439"
FT                   /db_xref="GOA:B5YCM9"
FT                   /db_xref="InterPro:IPR002510"
FT                   /db_xref="InterPro:IPR035068"
FT                   /db_xref="InterPro:IPR036059"
FT                   /db_xref="UniProtKB/TrEMBL:B5YCM9"
FT                   /protein_id="ACI19439.1"
FT                   /translation="MLEKLIEIGKRYTDEVEIYQINSFSSGVSFENGILKDIDSSIQSG
FT                   ISLRIIKDGKLGFSYTKNLLDPEGLVKNAVDSLKGDIRVEFSFPERRELKVLNTYDPEI
FT                   ENLTNTKMVEEGQRISEILSQATNTQINVGVVKSVSEIRIINSKGVDYSTKNSSYMCYA
FT                   AAMYPGSYSSISRIIVDKKFKEFSKEDFEYITFLYNNSKKEVKAKSGRMKVMFLPTTMY
FT                   VLIWRLIYGTNGKNVYERTTPLIDKIGTQIFDSSITIYNDPFNDSLPGARAFDDEGVES
FT                   RVLPIVENGVLKNFYYDLYYGSKMGIGSTGNGYKVSDWGGEIIRVRPTPALEHLYMKPG
FT                   DKDFHEMIRLIDKGIIIAQALGAHSGNIPNGDFSIGLSPGLYVENGEIVGHVKDAMVAG
FT                   NIYEVMKKVVAIENKNYVGNMGVFPSTIFEDVSVAIRE"
FT   gene            399590..400579
FT                   /locus_tag="DICTH_0406"
FT   CDS_pept        399590..400579
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0406"
FT                   /product="oxidoreductase"
FT                   /note="identified by match to protein family HMM PF00248"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19563"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:B5YCN0"
FT                   /protein_id="ACI19563.1"
FT                   /translation="MIYVADPKRYENMIYRPCGRSGLKLPVISLGFWHNFGYNDSFENM
FT                   RNMVKKAFDLGITHFDLANNYGPPPGSAEENFGRILKLDLKPYRDEIVISTKAGYKMWD
FT                   GPYGDFGSKKYLIASLDQSLRRMGIDYVDIFYHHRPDPETPMEETMEALYQIVRQGKAL
FT                   YVGISNYGPEETRLAYETLSKMGVRLIVNQILYNMFFRKPEEKLFNVMEELGIGATIFS
FT                   PLAQGLLTEKYLNGIPEDSRVRKSGIFLKESDITPEKIEKVKKLSQITKERGQSVAQLA
FT                   ISWILRNKVVSSVIIGASRPEQIEENVKAIYNLDFSEEELKRIDEILG"
FT   gene            complement(400622..401212)
FT                   /locus_tag="DICTH_0407"
FT   CDS_pept        complement(400622..401212)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0407"
FT                   /product="laminarinase"
FT                   /note="identified by match to protein family HMM PF02018"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19696"
FT                   /db_xref="GOA:B5YCN1"
FT                   /db_xref="InterPro:IPR003305"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="UniProtKB/TrEMBL:B5YCN1"
FT                   /protein_id="ACI19696.1"
FT                   /translation="MKKIYIFLLLISFILFIAGCAGSPQVTQQETAPGVTEVTTPEGKA
FT                   QVINVTKLGVFNENLMFSAPSNWYIVVQGTAEVEEYGAKGGFFYVKIKNPGDAFWHIQF
FT                   GTHVPLPANKKYKLTFEAKADAERDLQVRVIQDQTWEIVESTTFNLTPEVQKFEWEFTP
FT                   KKDGHIIVFDMGKISEKSIATTIYIANVELVEE"
FT   gene            401467..403086
FT                   /locus_tag="DICTH_0408"
FT   CDS_pept        401467..403086
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0408"
FT                   /product="ferredoxin 2"
FT                   /note="identified by match to protein family HMM PF04060"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19285"
FT                   /db_xref="GOA:B5YCN2"
FT                   /db_xref="InterPro:IPR004108"
FT                   /db_xref="InterPro:IPR007202"
FT                   /db_xref="InterPro:IPR009016"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:B5YCN2"
FT                   /protein_id="ACI19285.1"
FT                   /translation="MILTQEISCQYCYKCLRNCPVKSIMFNRGKSYVIDDECILCGVCI
FT                   EVCPQRARTYVRSTHLLDSFKGKPFLVSIAPSFFAHFDEPFKVITFLKNLGAVAVQETA
FT                   VGADIVSHHYKKFIEGRKKTFITTACPVVFELAEKYYPEVIPYLAPFLSPMNVHAIFMK
FT                   NYFGDFPVVYFGPCIAKKRDGEDYVDLAMTYEELSSYIERSNVNIEELEESFPTPPYPQ
FT                   RGRVYPVSGGINSTLEGSWENYLVVEGVENIIRVFENISSYGEGFVIEASSCFGGCING
FT                   PAIRKDIGILEKRRRILSYMEKLREVEGESIKPQLIDLDIKRNFSSQKKIIEIPEERIR
FT                   KVLREMGKDNPKKELNCGACGYPTCRDKAIAVILGKAEKEMCITYLIDKVSSVSNAIIE
FT                   EFPNIVIIYKNGKPIYLNPAGEDFFYNKEALLDFVIEEIDSGKNPLEISIDGDEYYFFV
FT                   KTFNLPDDNGKVALLLDITNEKKREDELNKLKKESAEKIEELINRQMLLAQEIASLLGE
FT                   SIAETKSQFAQFRKVLEEDANL"
FT   gene            403088..404212
FT                   /locus_tag="DICTH_0409"
FT   CDS_pept        403088..404212
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0409"
FT                   /product="serine phosphatase"
FT                   /note="identified by match to protein family HMM PF07228"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18671"
FT                   /db_xref="GOA:B5YCN3"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:B5YCN3"
FT                   /protein_id="ACI18671.1"
FT                   /translation="MNFAFKSKEGEEVCGDSIKIKRNEDRVVVTVSDGLGSGIKASILS
FT                   TLTASLTTTMLFNDMPVDEVMKSILATLPKCKVRDISYANFCSVLFKAKENICYIAEYE
FT                   FPVVLLFRKDDFIELKKERLFVEDREIKESYFTPQEGDLLFIMTDGVSQAGLGSKLYPL
FT                   GLGIENIKREIFNLIRYKLSPKEIVNHLIDKAKRLDKGIKGDDALCCALHFRTFNRLNI
FT                   MVGPPSDSNLDEYVVNRFINMPGRRVICGGTTAQIVGKVIGREISLDLKTISEDSPPVG
FT                   YMEGVDLVTEGIITLTQVFRYLDGQTNKVGYGASLIVDFIEKADEVCFIVGKAINPAYQ
FT                   NPLFSYDMSLKFKIVNDIAKILERKGKIVNIEAY"
FT   gene            404226..404711
FT                   /locus_tag="DICTH_0410"
FT   CDS_pept        404226..404711
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0410"
FT                   /product="NADH-ubiquinone oxidoreductase 24 kda subunit"
FT                   /EC_number="1.6.5.3"
FT                   /EC_number="1.6.99.3"
FT                   /note="identified by match to protein family HMM PF01257"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19858"
FT                   /db_xref="GOA:B5YCN4"
FT                   /db_xref="InterPro:IPR002023"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR041921"
FT                   /db_xref="InterPro:IPR042128"
FT                   /db_xref="UniProtKB/TrEMBL:B5YCN4"
FT                   /protein_id="ACI19858.1"
FT                   /translation="MKLKRNFAKVEEILKKHGYRKDNLIKILLDVQKEYRYLPEDVINY
FT                   IGVALDISPAKIYGVATFYAQFSLKPKGKYTILVCDGTACHMAGSTSLIGAIKEELNIG
FT                   PGEVTEDLMFSLDQVGCLGACALAPVMVINEEVYGNLTPEKVKEILRNLKEREMENA"
FT   gene            404704..406578
FT                   /locus_tag="DICTH_0411"
FT   CDS_pept        404704..406578
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0411"
FT                   /product="Fe-hydrogenase beta subunit"
FT                   /note="identified by match to protein family HMM PF00037;
FT                   match to protein family HMM PF01512"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18759"
FT                   /db_xref="GOA:B5YCN5"
FT                   /db_xref="InterPro:IPR001949"
FT                   /db_xref="InterPro:IPR011538"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR019554"
FT                   /db_xref="InterPro:IPR019575"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR037207"
FT                   /db_xref="InterPro:IPR037225"
FT                   /db_xref="UniProtKB/TrEMBL:B5YCN5"
FT                   /protein_id="ACI18759.1"
FT                   /translation="MLRTIDEAIQYIEEKKIERKKKLEDLNVYVCVGTGCAAKGSLKVY
FT                   EALKKIFKENNVNVNLQKLDDNEERVRKTGCCGRCSSGPWVIVMPYGYFYSEVKPEDVK
FT                   EIYEETILKGKPVERLLFTDPATGERVERLEDAKFYKAQSFYIMEDIGKCECDSIDDYM
FT                   GRGGYLSFIKVLKEGNPDWVVKTIKDSGLRGRGGAGFPTGVKWEITKNSKGDRKFVVCN
FT                   GDEGDPGAFMNRTLLERDPHAVLEGMLIAAYTIGAQKGYAYIRAEYPVAVEMFRKAIED
FT                   AKRLGLVGENILGTGFSFDIEIKEGAGAFVCGEETALLASIEGKRGVPRPRPPYPAQVG
FT                   LWGYPTLINNVETYANVPKIIRDGAENYRKRGVPNSPGTKMFSVTGPVRLTGIIEVEFG
FT                   TTLRQIVYDICGGLTDDNEFKAVQIGGPSGACLSEAFLDLPLDYDSLKSAGAMVGSGGI
FT                   VVLSKKACMVEVARFFLDFTKRESCGKCIPCREGLMQSYRILERFTQGKGTYEDLENLE
FT                   FLAGLIKTASACGLGQTAPNPILSTLRLFRDEYIAHIEGICPSGMCTAFKKYVINPELC
FT                   KGCGLCARSCPQSAISGERGKPYVIDQEKCAKCGICVEKCKFKAIEIR"
FT   gene            406594..408594
FT                   /locus_tag="DICTH_0412"
FT   CDS_pept        406594..408594
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0412"
FT                   /product="periplasmic [Fe] hydrogenase 1"
FT                   /EC_number="1.12.7.2"
FT                   /note="identified by match to protein family HMM PF00037;
FT                   match to protein family HMM PF00111; match to protein
FT                   family HMM PF02256; match to protein family HMM PF02906;
FT                   match to protein family HMM TIGR02512"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ACI20052"
FT                   /db_xref="GOA:B5YCN6"
FT                   /db_xref="InterPro:IPR000283"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR003149"
FT                   /db_xref="InterPro:IPR004108"
FT                   /db_xref="InterPro:IPR009016"
FT                   /db_xref="InterPro:IPR013352"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR019574"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036991"
FT                   /db_xref="UniProtKB/TrEMBL:B5YCN6"
FT                   /protein_id="ACI20052.1"
FT                   /translation="MKIYVDGKEVIIRDDERNLLEALKNVGIEIPNLCYLSETSIYGAC
FT                   RLCLVEVDGKSIVTSCNLKPYEGMVVRTNTPEIYEIRKGILELLLASHNRDCTTCERNG
FT                   SCKLQEYAEAFGIRKIRFDNVIKDGGVDDKSPIVRDNTKCILCGDCVRVCEEVQGVAAI
FT                   DIAGRGFQSKVTPAFGHSLADVECVYCGQCVAYCPTGALSIRNDIDKLYRVLKSKKKVV
FT                   IGMIAPAVRSAIQEEFKLDSDLFIAGRLNTFLKMLGFSKVFEVPFGADLVAYEEAHEFL
FT                   DRLEKGEKLPQFTSCCPAWVKYVEEFYPTYIDNLSTVKSPQQAMGSVIKEIYSKEIGIP
FT                   KEDIYLVSIMPCTSKKFEAEREEHKGVVDLVITTKELAQMIKASGIDISSLKPEPFDKP
FT                   FNLYSQGGLDFGKTGGVLGTVLAVINHKVKIKNVKEEEIEKGIRLFNVELENGRNVRAM
FT                   AVHSLGKAKRVLRDIKEGILNVDIIEVMACSFGCIGGGGQPYPNDSKVRQRRAKILSDM
FT                   VNINPITSPQENPYLMELYEKYLEHPLSHKTHEILHTSYSPKRRVPEQEVEILPLPIPE
FT                   EEKIKVRICLGTSCYIKGSYKILSDLIEVVRKEDWAKNVEVVGTFCTENCSNAPNVLID
FT                   DILISGADTNKVKEMLREYVRRKQEGVSDVS"
FT   gene            408584..409210
FT                   /locus_tag="DICTH_0414"
FT   CDS_pept        408584..409210
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0414"
FT                   /product="redox-sensing transcriptional repressor rex 2"
FT                   /note="identified by match to protein family HMM PF02629;
FT                   match to protein family HMM PF06971; match to protein
FT                   family HMM PF08279"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18417"
FT                   /db_xref="GOA:B5YCN7"
FT                   /db_xref="InterPro:IPR003781"
FT                   /db_xref="InterPro:IPR009718"
FT                   /db_xref="InterPro:IPR022876"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B5YCN7"
FT                   /protein_id="ACI18417.1"
FT                   /translation="MFPKATLERLKLYHRLLSEEKEEYISSEELGKRLGIPPEQVRKDL
FT                   SYLEYKGKPKVGYHVKSLLEELNRLFGLDKNVKVIIVGAGNLGTALTNYPGFSNYNIEI
FT                   VGIFDNDPAKIGRKVGDLVVLPLEYLGRVIKRFDVEIGVICVPKESAQEVANLLVENGI
FT                   KAIWNFAPALIKVPEDVIVRNEDITLGLLTLKHMLEVKNTQVKQG"
FT   gene            complement(409197..409775)
FT                   /locus_tag="DICTH_0413"
FT   CDS_pept        complement(409197..409775)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0413"
FT                   /product="sulfate/thiosulfate import ATP-binding protein
FT                   CysA"
FT                   /EC_number="3.6.3.25"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18987"
FT                   /db_xref="GOA:B5YCN8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B5YCN8"
FT                   /protein_id="ACI18987.1"
FT                   /translation="MVFLRVNNVKKSFDGKKVLDRVFMEVNKGERVIIKGPNGIGKTTL
FT                   LKIIAGIITPDEGSVEFYEKPKISFQFQNAVFLPWLSMKENLALFAKDTEMLNNLIEYF
FT                   SLKDFLHLYPSELSGGYQQIFSFVRTLSVPHNLLILDEPFKSLDPEMKKKEKNILKKHL
FT                   EDKKITLLMVSHQEGEEDKEIADQIFTLA"
FT   gene            complement(409756..410508)
FT                   /locus_tag="DICTH_0415"
FT   CDS_pept        complement(409756..410508)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0415"
FT                   /product="abcb protein, putative"
FT                   /note="identified by match to protein family HMM PF00528"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19209"
FT                   /db_xref="GOA:B5YCN9"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B5YCN9"
FT                   /protein_id="ACI19209.1"
FT                   /translation="MRNSLVFKISFWIIFIFIWYLMGSAINSKLILPLPHKVLYKVLEL
FT                   FSERNFYHHLFITLLRSVGGFTLALFLGFLLGCIKNKFLYSAIRNIIDIFQSNPLIVWI
FT                   TIALFWFGFGNKTIVFTVFIVLFPNFYLITYNAINNIPKEYIELFKIYPISRKKYLTKF
FT                   LIPYLKPFLLPTLANSIISSLKITAMAEFLSGESGIGFLLSYAKTFLNTEEVYAYAVIL
FT                   FVFSKILEFIFIRLGILKGDRNYGFSES"
FT   gene            complement(410486..411385)
FT                   /locus_tag="DICTH_0416"
FT   CDS_pept        complement(410486..411385)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0416"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18486"
FT                   /db_xref="InterPro:IPR024533"
FT                   /db_xref="InterPro:IPR027024"
FT                   /db_xref="UniProtKB/TrEMBL:B5YCP0"
FT                   /protein_id="ACI18486.1"
FT                   /translation="MNKKLLLLAMLFLLLILNPVFSQNKKIEVLIPLGPTVIPFSTMML
FT                   ENPDFNFTIWRTIDELVIKAKDNKYDVIIAPFTTLVNLYNKGINIKYLATFNFASFYLV
FT                   SNKAKKFEEIIGDNVYIAQKGSTQDIIFNIYLQEKNLKDKINIYYSTPQEIASLFIAGK
FT                   INNALLPEPFVSMCVNNGGKIILDIQKTYREIAKARLLPITSIAVRGDIDKKEIKRIDL
FT                   IFRENFKRLSQNPKDYIEKASEILKLDKKIIELSLKRLSFIYQGISIKNDLMKYLEFIY
FT                   EKAPQTIGNIPDEKFFSF"
FT   gene            411500..413107
FT                   /gene="mviN"
FT                   /locus_tag="DICTH_0417"
FT   CDS_pept        411500..413107
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mviN"
FT                   /locus_tag="DICTH_0417"
FT                   /product="integral membrane protein MviN"
FT                   /note="identified by match to protein family HMM PF03023;
FT                   match to protein family HMM TIGR01695"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19323"
FT                   /db_xref="GOA:B5YCP1"
FT                   /db_xref="InterPro:IPR004268"
FT                   /db_xref="UniProtKB/TrEMBL:B5YCP1"
FT                   /protein_id="ACI19323.1"
FT                   /translation="MDKSNIIQRVKRIFIRQNVTEAAILITLLAAISRVIGFFREMMIA
FT                   AFFGAKKFTDSFVVAQAIPGILAGLVAGALSSVFVPLYAEWREKKGKEEAERFASILVS
FT                   DLFILLLGVTVFSYVISPLIIEILAPGFSGETRKLALDFTYIMLPGIIFWGTYGIITGL
FT                   YNSHKSFVIPNLAGVLGSIVFILAIFFLHNTFGAYILPWGYLANVVIQYLLLLPALRRI
FT                   GVKITWEINFRYEGLKKALVLITPIFLGQSIGLLNMAVDRIFGSFLPEGSISALNYASR
FT                   VYQLPINLFVNALATAIYTDLAFQAQSENLDQFKLSLNKSLRAALFFLIPASFGLIFLA
FT                   KPIVRLAFERGAFDALATKRTSESLIFYSLGLVFMSINMIITRGFFALHDTKTPVKNSI
FT                   IALLFNIVLNTIFIKPLAHMGLALATSLASLISSVLLIRSLRSKISGVFSKDLLVNVFK
FT                   FTLGGLFIGIVALLSFNFLYGHIFSHGQLGLAISLLVSVGIAVVIYLLLGLRWGIEESK
FT                   RIFNIIKKNLELIVHLVK"
FT   gene            413135..413485
FT                   /locus_tag="DICTH_0418"
FT   CDS_pept        413135..413485
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0418"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19843"
FT                   /db_xref="GOA:B5YCP2"
FT                   /db_xref="InterPro:IPR000390"
FT                   /db_xref="UniProtKB/TrEMBL:B5YCP2"
FT                   /protein_id="ACI19843.1"
FT                   /translation="MSKRYIAIFISFILCIIFTVVSNVSFKLSVQEKGDLKNFIFWQIV
FT                   GNLTGFLSVIAYTYLLTLVPFYIGYALTTAFGQIFVQVFGSKWFFKEEISFSQWIGIIL
FT                   IIIGTLFLVKTK"
FT   gene            413485..414033
FT                   /locus_tag="DICTH_0419"
FT   CDS_pept        413485..414033
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0419"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18771"
FT                   /db_xref="UniProtKB/TrEMBL:B5YCP3"
FT                   /protein_id="ACI18771.1"
FT                   /translation="MGKLLRLILIKFDHFLSKLQGVKTFTDNPECILRYKVIKKDGKIL
FT                   IELHLWNEHIPQVPPDGTDLFWGKRFQKLFFNSLKELMIFIENSSFKDADWFMGEIAFF
FT                   FKDQYKVVRFLKKIGFEVYPIEGRNIFQKFFIFLQNCYSFLLIYAYNPNSLKGKDFWKG
FT                   KRYKLFIRKDIIRSTYEET"
FT   gene            414020..415759
FT                   /locus_tag="DICTH_0420"
FT   CDS_pept        414020..415759
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0420"
FT                   /product="ABC transporter, ATP-binding/permease protein"
FT                   /note="identified by match to protein family HMM PF00005;
FT                   match to protein family HMM PF00664"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ACI20017"
FT                   /db_xref="GOA:B5YCP4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:B5YCP4"
FT                   /protein_id="ACI20017.1"
FT                   /translation="MKRLKKYIRHNLHFFISAIFCAILALSLDMFNPKIVELIVDRVII
FT                   KNNMELLPRLLLFMTLITFSRVILGYFKEYFMDLGGSRLAYELRVDLFEHLQKLPFSFF
FT                   DGINTGELMSRIKEDIDNVWFTFGFGLVFFIEQLFYFLIASVILFSINWKLTLIVLTLI
FT                   PFIGYIAYKLERENDEVYGEISDQGVRLNTTAQEDIAGIRVVKSFGREKYEIERFFEEN
FT                   KKNFELNVKQAKIFAKYFPWMDFLTNISIALAITLGGLWVIGDKMSVGTLVAYSGYVSM
FT                   IVWPVRLGGWIVNMLAQCVASLKKIERLFRERPEKDFIGERIEVKGIRGEVLFKNVSFK
FT                   YKDEYVLKNITFHIKPGKTLAIMGLTGSGKTTIVNLLGRFYEPWEGEILIDGMDIRKID
FT                   LKTLRENIAYVPQDVFLFSDTVRENIKLGKELDEKIIEKALKDAKALQFVRNLPEGLET
FT                   IIGERGLGLSGGQKQRLTIARALARVLIGSAKILVLDDVTSALDMETELYIQKALEEYN
FT                   LTKIIIAHRVSAVKNADEIIVLEKGEIVERGTHEELLSLKGRYYETYQEQYGKYVFMEE
FT                   EPV"
FT   gene            415760..417553
FT                   /locus_tag="DICTH_0421"
FT   CDS_pept        415760..417553
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0421"
FT                   /product="ABC transporter, ATP-binding/permease protein"
FT                   /note="identified by match to protein family HMM PF00005;
FT                   match to protein family HMM PF00664"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19025"
FT                   /db_xref="GOA:B5YCP5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:B5YCP5"
FT                   /protein_id="ACI19025.1"
FT                   /translation="MPYSLREDEKLEEKISIDILRRLFRYLKPYKKEILIVLLLIFVVM
FT                   IVDLANPYLMKIAIDRFIKNKDPRGLITVGFVVLLLNLISAFCAKKRTERIAGITHRVI
FT                   LNIRQDLFNHIQKLSFAFFDERPVGKILARVIGDVNSLTNLFNMSVTNLIPDTFTIIAT
FT                   AGIMFYLNARLATYGLLMFPFLLITLFSIQTISRKRWQVVRKKNSTLNAFTHENYSGIR
FT                   VVKYFNAENYRKNIFSELAWDVRQAFVRAVRINDLFWPMVEFSWGIGSIITFYFGIKMI
FT                   KSGSITVGLLIAFSNYIAMFWRPIMNLSNFYNNLVTSMASAERIFEIMDINPNIVEDED
FT                   ARDLEIKGEVEFRNVSFSYDGKKKVLKNVSFKVNPGERVALVGHTGAGKTTIVNLLCRF
FT                   YDPDEGEILIDGVNIKKIKLESLRRQVAVMFQDTFLFSGSIKENIRYGRLSASDEEVIS
FT                   TAKEVYAHDFIMSLEKGYDTKVQERGLRLSTGQRQLVSLARTLIADPKILILDEATASI
FT                   DTHTERLLQKGIEKLLKGRTSFIIAHRLSTIQNADRILVIEDGRVVEEGNHEELMRRKG
FT                   IYYNMFMSQFKFWEEEREVVS"
FT   gene            417543..417761
FT                   /locus_tag="DICTH_0422"
FT   CDS_pept        417543..417761
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0422"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18450"
FT                   /db_xref="GOA:B5YCP6"
FT                   /db_xref="UniProtKB/TrEMBL:B5YCP6"
FT                   /protein_id="ACI18450.1"
FT                   /translation="MYLKKINPLRGGTQGEGVRGGGVFAYLFSFFNFLDSQTLFFIPKI
FT                   FLYFRQLSLSKISNIEGGVNKIELKLY"
FT   gene            complement(417785..418249)
FT                   /locus_tag="DICTH_0423"
FT   CDS_pept        complement(417785..418249)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0423"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19311"
FT                   /db_xref="InterPro:IPR024775"
FT                   /db_xref="InterPro:IPR034660"
FT                   /db_xref="UniProtKB/TrEMBL:B5YCP7"
FT                   /protein_id="ACI19311.1"
FT                   /translation="MTTRIERILKYMDDAFKKDRGLWSHSVMDVLENVSSKEATFKKEN
FT                   THSIWEIVNHLIFGKEYLISILEGKELPSEDDFKTPTDTSEEAWKNTVKKLEETHNKLI
FT                   EILKSKTDEDLGKNLGEYGTLEDNLYGIISHDCYHAGQIVLLLQLMGINL"
FT   gene            418368..419540
FT                   /locus_tag="DICTH_0424"
FT   CDS_pept        418368..419540
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0424"
FT                   /product="transporter, major facilitator family"
FT                   /note="identified by match to protein family HMM PF01306;
FT                   match to protein family HMM PF03825; match to protein
FT                   family HMM PF07690"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19190"
FT                   /db_xref="GOA:B5YCP8"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR024989"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B5YCP8"
FT                   /protein_id="ACI19190.1"
FT                   /translation="MKREIFLLKIFFFIYFSAWVFIFSFIPVYLREVINFSIGMIGLLS
FT                   AISSLAGAIFQVYVGYLSDKLGKRKPFILISFVVLIFIYTFVFPYLKTFWSFLIIYFVA
FT                   GMATSIITTLANVLVMDYAVSNNTGSHYASVRIWGSIGFLLVMLATGFFPKLVEPKVMF
FT                   PMIGLIYLLGFIVSVMIKEPPIKSGISRVDFRSVKKLTFRPEIRNFLIFYIIYYIALLG
FT                   ASSNVNLLIRSLGGENRHISFAYSASSFSEIPFMLIWGYLSDKLGRKPILVFTSIILPI
FT                   RIFLYTLTNNPWHIILIQLMHSLTFAVIGTIPVVYMNDLVPPEERATAQGLLGMSMALS
FT                   STLGPLISGVVADLTGLVGMYRFLTFVALVSTILAITSLKESKNKGVPTN"
FT   gene            complement(419571..420248)
FT                   /locus_tag="DICTH_0425"
FT   CDS_pept        complement(419571..420248)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0425"
FT                   /product="antioxidant, AhpC/TSA family"
FT                   /note="identified by match to protein family HMM PF00578;
FT                   match to protein family HMM PF08534"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ACI20046"
FT                   /db_xref="GOA:B5YCP9"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR019479"
FT                   /db_xref="InterPro:IPR022915"
FT                   /db_xref="InterPro:IPR024706"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B5YCP9"
FT                   /protein_id="ACI20046.1"
FT                   /translation="MENLERKGIPLLGEPFPKIEVQTTHGVKNLPDDYKGKWFVLFSHP
FT                   ADFTPVCTTEFVAFQKRYDKFRALNTELIGLSIDQVFSHIKWVEWIKEKLGVEIEFPII
FT                   ADDTGKVAEKLGLIHPGKGTNTVRAVFVVDDKGIIRLILYYPQEVGRNIDEILRAVEAL
FT                   QVTDKYGVATPAQWPDSEVVGKDHVIIPPAKDVETAKQRLESAKKGEIECFDWWLCHKK
FT                   LER"
FT   gene            420442..422319
FT                   /locus_tag="DICTH_0426"
FT   CDS_pept        420442..422319
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0426"
FT                   /product="CapD protein"
FT                   /note="identified by match to protein family HMM PF01073;
FT                   match to protein family HMM PF01370; match to protein
FT                   family HMM PF02629; match to protein family HMM PF02719;
FT                   match to protein family HMM PF04321; match to protein
FT                   family HMM PF07993"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18562"
FT                   /db_xref="GOA:B5YCQ0"
FT                   /db_xref="InterPro:IPR003869"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B5YCQ0"
FT                   /protein_id="ACI18562.1"
FT                   /translation="MNVDKSSRVPFSTLIRVIIDYSLFIFAIFFSFLIRFEFALPPNYW
FT                   NILLQAIFRELAIFFFLYTFLFKLHRTLWEYFSLEALKELTLAVTLEKVIFFLSHLLLP
FT                   ISGLPRSIVVISYFTSLLFLFSVRAFSRWYHESSKIKSKNIYASPKRVVIVGAGDAGEK
FT                   ILREIKTNREINYEVAGFLDDDPKKIGKTIHGVKILGPISSLPKVVVEKRVQEILVAIP
FT                   SAPPSLLRNIVSMTSKLRIPVKTLPGIWELIDGKVTISKIRNVKIEDLLERDVINLDSE
FT                   RIGEYLRGKKVLVTGAGGSIGSEICRQVASYKPRKLILLGRGENSIFNIELELKSIYPK
FT                   LDIKSYIADIRDRDRIFYIFSVEKPDIVFHTAAHKHVPLMEENPDEAVFNNVFGTINLM
FT                   DASKEYGVSKFIFISTDKAVYPSNIMGATKRVGEILIKYYNSHSKTEYIAVRFGNVLGS
FT                   RGSVLEVFRKQLEKGGPITVTHEDMERYFMTIPEAVGLVLQAGAIGRSGDLFVLDMGKP
FT                   IKIIDLARNFIELSGYSLDDIEIKITGLRPGEKLKEDLWEKEEVVERTEHPKILRILAD
FT                   NNIDYYSIGEKIKELELIAGTRDKEKIWKALKEIVELSRKNYKSKEEVV"
FT   gene            422325..423410
FT                   /locus_tag="DICTH_0427"
FT   CDS_pept        422325..423410
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0427"
FT                   /product="UDP-N-acetylglucosamine 2-epimerase"
FT                   /EC_number="5.1.3.14"
FT                   /note="identified by match to protein family HMM PF02350;
FT                   match to protein family HMM TIGR00236"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19378"
FT                   /db_xref="GOA:B5YCQ1"
FT                   /db_xref="InterPro:IPR003331"
FT                   /db_xref="InterPro:IPR029767"
FT                   /db_xref="UniProtKB/TrEMBL:B5YCQ1"
FT                   /protein_id="ACI19378.1"
FT                   /translation="MKVVSIVGARPQFIKLAPFSAELRKNGIKEVILHTGQHYDENMSE
FT                   LFFKELEIPEPDYNLGIGSGSHGEQTGRMLIGIEEVLVKEKPDVVIVYGDTNSTLAGAL
FT                   ASAKIHIPLAHVEAGLRSFNKKMPEEINRIVADHLSDILFCPTETAVENLKREGIEKGV
FT                   YLVGDVMFDALMHFSKLAKEKSKILEKLSLNPKDYYLITVHRAENTDNPERLKNIFSAI
FT                   SELDKEVIFPIHPRTKNRLKELGLEGYLRGRVRIIDPVGYLDMIELEKNALAILTDSGG
FT                   VQKEAFWLRVPCITLREETEWVETLKYGWNILVGSNKERILEAIKNIKNGKEISFENDY
FT                   ASPKMREVLIKELERRREDDR"
FT   gene            423407..426160
FT                   /locus_tag="DICTH_0428"
FT   CDS_pept        423407..426160
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0428"
FT                   /product="lipopolysaccharide biosynthesis protein"
FT                   /note="identified by match to protein family HMM PF00984;
FT                   match to protein family HMM PF03720; match to protein
FT                   family HMM PF03721; match to protein family HMM TIGR01443;
FT                   match to protein family HMM TIGR01445; match to protein
FT                   family HMM TIGR03026"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19365"
FT                   /db_xref="GOA:B5YCQ2"
FT                   /db_xref="InterPro:IPR001732"
FT                   /db_xref="InterPro:IPR003586"
FT                   /db_xref="InterPro:IPR003587"
FT                   /db_xref="InterPro:IPR004042"
FT                   /db_xref="InterPro:IPR004860"
FT                   /db_xref="InterPro:IPR006141"
FT                   /db_xref="InterPro:IPR006142"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR014026"
FT                   /db_xref="InterPro:IPR014027"
FT                   /db_xref="InterPro:IPR017476"
FT                   /db_xref="InterPro:IPR027434"
FT                   /db_xref="InterPro:IPR030934"
FT                   /db_xref="InterPro:IPR036220"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036844"
FT                   /db_xref="UniProtKB/TrEMBL:B5YCQ2"
FT                   /protein_id="ACI19365.1"
FT                   /translation="MSFEKISVVGLGYVGLPLALEFAKAGLIVYGIEQNPKKVEMVNKG
FT                   ISYIDDVKSEELSEVVNKGVLKAFVDFGSVKDSDAVIICVPTPLGAHKEPDISYIVNVT
FT                   NEISKFLKKGQLIVLESTTYPGTTEEVVLPILEKSGLKGGEDFYLAFSPERVDPGNKKF
FT                   TTKDIPKVVGGINEVSTEKAAELYSLIVPQVHKVSSPKVAEMEKLLENIFRLVNISFIN
FT                   ELAILCGKMGIDVWEVIEAASTKPYGFMPFYPGPGLGGHCLLGKEKILVKNSKISNVYS
FT                   LEELFKLESKENKVYKIGDLEVLKTNDLFVNSLNDSNLSSSWMPVSYLFKRKYKGDLVK
FT                   IITEDNRKLIVTEKHPMLRLDNGSVEVVEARDLKVGDLLPLFKENFEEKIEIREVVVDL
FT                   IKELSEEWENRVRVKIINGSWVNYKAEIYSICKTDRKYDYIKGDYLPLGIFRRLEREKK
FT                   INIEHDSLILLTGRGPSTAKFPAVVKIDKDLARFIGYYLSEGCATKERGYYRIRLTINK
FT                   DEKELFSDIESILNKLGLTHSIYLSPKFKAKTIRINSPLLGWLLIDRLRCGKDSYSMRI
FT                   PDELMSASLDLKEELLKGLFRGDGDIHYRNERRNYIKNGKKYNHRNNSLVIGYFSISDV
FT                   LFYQIIYLLQEMGIYPSISKNKNHLKISGYDNLKKLTDWFLDEKGRKYSNYFRFSLKKI
FT                   NNKRNNFPIPLVSVKKIEFESVDNIDVYSLEVENTHTFAVGSGIYVHNCIPIDPFYLSW
FT                   KAKEYDLGVRFIELAGEINDNMPRYIVQLVMEALNKHKKAVNGSKILIIGVAYKPNVGD
FT                   PRESPALKIIPLLEELNGEVEFYDPYISEIKIENNKTKEVKYMKSCVLDEEKVRNADCV
FT                   LIITDHDNIDYEMIFKNSKLIVDTRNALRKRGIKVDDRVTILGVSK"
FT   gene            426188..426436
FT                   /locus_tag="DICTH_0429"
FT   CDS_pept        426188..426436
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0429"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18986"
FT                   /db_xref="InterPro:IPR035953"
FT                   /db_xref="UniProtKB/TrEMBL:B5YCQ3"
FT                   /protein_id="ACI18986.1"
FT                   /translation="MVDKRKLNEKKFKNWEEFEWGRRYWYEVEGKLGWKARYVKEVDIN
FT                   ENTLRFYQEIYDNDGRQIEVHHKYPIDEGHIRLKDKT"
FT   gene            426462..426731
FT                   /locus_tag="DICTH_0430"
FT   CDS_pept        426462..426731
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0430"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19675"
FT                   /db_xref="UniProtKB/TrEMBL:B5YCQ4"
FT                   /protein_id="ACI19675.1"
FT                   /translation="MITTRDLANKLIDYIYNKISLRELVDWAERAFMEEEFEEEHFDTI
FT                   REILAYIGLSDVAAFGLTWEDCKRFLERLGYGVNIEVYEKSSNK"
FT   gene            426795..427748
FT                   /locus_tag="DICTH_0431"
FT   CDS_pept        426795..427748
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0431"
FT                   /product="oxidoreductase, Gfo/Idh/MocA family/transferase
FT                   hexapeptide repeat protein"
FT                   /note="identified by match to protein family HMM PF01408;
FT                   match to protein family HMM PF02894"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18519"
FT                   /db_xref="GOA:B5YCQ5"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B5YCQ5"
FT                   /protein_id="ACI18519.1"
FT                   /translation="MDRFIGLIGLGYWGKNILRNLYELGVLHTACDFSHEVVEERRRSF
FT                   PEVSYTTDFNDLLSNSEIKAIAIATPAVTHYELAKKALLAGKDVFVEKPMTTSVKEGEE
FT                   LVKIAEEKNKIIMVGHILQYHPAVTKLKELISQGLIGEIIYIYSHRVNVGKIRIDENVW
FT                   WSLAPHDVSLILMLTGRMPKRIYYQGSSYITKGIDDIALASLEFDNGIRGHIFVSWWHP
FT                   YKEQKLVTIGSKGMLIFDDTTEEKLFLYPHKVEWNNGIPVAKKEEMQVIPVEKKEPLKE
FT                   ELLHFIECVKERKTPRTDGYEGLRVLKVLEKITSDG"
FT   gene            427745..428026
FT                   /locus_tag="DICTH_0432"
FT   CDS_pept        427745..428026
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0432"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18460"
FT                   /db_xref="UniProtKB/TrEMBL:B5YCQ6"
FT                   /protein_id="ACI18460.1"
FT                   /translation="MIDGEGKVKEIRFSNHALLKFKVLEAHGIIINEEFVKNTILYPDR
FT                   IEKGYKGRIIAQKHLDNEHVIRVIYEEFPDCIIVITFYPGRRDRYEKD"
FT   gene            428013..428222
FT                   /locus_tag="DICTH_0433"
FT   CDS_pept        428013..428222
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0433"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19464"
FT                   /db_xref="InterPro:IPR019270"
FT                   /db_xref="UniProtKB/TrEMBL:B5YCQ7"
FT                   /protein_id="ACI19464.1"
FT                   /translation="MRKIKYSKDVDILLIELSDKPIDYAEEEGQLIIHFSKEGEPVLIE
FT                   ILDAKDFIINSLSSLLKEEEVIIP"
FT   gene            428427..429011
FT                   /locus_tag="DICTH_0434"
FT   CDS_pept        428427..429011
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0434"
FT                   /product="transferase hexapeptide repeat"
FT                   /note="identified by match to protein family HMM PF00132"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18664"
FT                   /db_xref="GOA:B5YCQ8"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="UniProtKB/TrEMBL:B5YCQ8"
FT                   /protein_id="ACI18664.1"
FT                   /translation="MLTNKKYFVHESSYVDEPVEIGEGTKIWHFCHILPHTVIGKNCVI
FT                   GQNVMIGPRVKIGNNVKIQNNVSVYEGVEIEDDVFCGPSCVFTNVINPRAFIERKHEFK
FT                   KTIVKKGATIGANATIVCGVTIGEYAFVGAGAVVTKDVPPYALVVGVPARQIGWVCKCG
FT                   VRLEFDEKGEALCKSCGEKYRLVEGRVETTF"
FT   gene            429081..429317
FT                   /locus_tag="DICTH_0435"
FT   CDS_pept        429081..429317
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0435"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18741"
FT                   /db_xref="GOA:B5YCQ9"
FT                   /db_xref="UniProtKB/TrEMBL:B5YCQ9"
FT                   /protein_id="ACI18741.1"
FT                   /translation="MLKTFKDLTTEEEKRYREALIKREVKRKEALKRKLCKTWGLVKEI
FT                   SRILYEKYKVREVIVFLALLQMSYPLMNGLIII"
FT   gene            429777..431147
FT                   /locus_tag="DICTH_0436"
FT   CDS_pept        429777..431147
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0436"
FT                   /product="capsular polysaccharide biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18743"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:B5YCR0"
FT                   /protein_id="ACI18743.1"
FT                   /translation="MKGARMSTRSFLFRSYYKLRGSKVLDYYDEFKKSQYLTRDELIRN
FT                   QEKQLKRMIEFVYENVPYYKKLFKSLSISPDDINKVEDLQKLPILTKREIKRNWEDFFP
FT                   QNLNSIRYIKGKTGGSTGEPFKYRMSLEDYERGIALLYRGWGFAGYQLGDKVAVIGGSS
FT                   LVPSLRFSMKRKIQESLLNFRYYSSFDMSEENLLRYIEDMNCWNPKFIRGYASSIYLMA
FT                   KFIEQNRITLSFVPKAIFSTAEKLTFKMRESIERVFKTQVFDNYGLNDGGISAYECEQH
FT                   NGLHIDTERAILEVVDESGKQLKEGEGKILATSLYNFAMPLIRYDTGDIGIISSEFCKC
FT                   GRASYLLKGLVGRSQEFVVSSLGSKVHGEFFTHIFWEIDNVKQFQVIQENVGEVLINIV
FT                   PDDWDHIDRIDVKKITKILENKGFKVSIKLVNEESLSYTSGGKYKFVINKLSDYNES"
FT   gene            431153..432466
FT                   /locus_tag="DICTH_0437"
FT   CDS_pept        431153..432466
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0437"
FT                   /product="membrane protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19873"
FT                   /db_xref="GOA:B5YCR1"
FT                   /db_xref="UniProtKB/TrEMBL:B5YCR1"
FT                   /protein_id="ACI19873.1"
FT                   /translation="MKNGSSNKIELSVFFRSFLVIVLYRLVLDLSYILVISRFFNYEGY
FT                   YLIINKLKVLESYLFLIVLGAFILVFIYFRIRVFPSEFLLYLLFLFTYIPLGSLYALCD
FT                   KPRLFFYYSTFFWFLLIFMYYVFPIFKVRRVRFSKFLFLTCTILFNMAVLFLIFKYLGI
FT                   SFNFDLSLVYEIRSRYVESNIPFAGYLFNWVGYAINPLFLSYVFNKRQWLTFIFSIFIQ
FT                   LLLFSQTGLKSFLFVPILVLGVNWLYQKYGSKKLYLLTTLLIGLTVALGILSYFLMGDI
FT                   WVSSLLTRRTFYVPALLSFYYYDFFTSRGFTYLAQHRLFGGFLKYPYSLNPPHLIGSVY
FT                   FGTPEMGANNGILGDSYMNFGFLGAILWSFVLILFFKILDSFCDMDKNEVLIGPLAVFA
FT                   NAFTNSALLTVMTTHGFLILLLFSIIIPKNRIKYRSEG"
FT   gene            432463..433584
FT                   /locus_tag="DICTH_0438"
FT   CDS_pept        432463..433584
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0438"
FT                   /product="WbpH"
FT                   /note="identified by match to protein family HMM PF00534"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19705"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:B5YCR2"
FT                   /protein_id="ACI19705.1"
FT                   /translation="MIKLCHITTVHPSFDVRIFHKECKTLAKSGYYVYLIVQHHKEEVI
FT                   DGVHILPLPKVGSRLERVIKQPWRALRLALKTNSSIYHLHDPELIPIGLILKLLGKRVI
FT                   FDSHEDVPLQLLSKPYLNRFALRMLSQVFSIFEKYSCRYFDGIVCATPSITEKFLKINP
FT                   NSVNVNNYPLLEESKFLYHNYNENKMNEICYIGGISQIRGINELIKALEFVDNVRLNLA
FT                   GNFESAELEKRIKGMKGWKKVNYYGFVGRENVYEIMARSKAGVVIFSPLPNHINSQPNK
FT                   MFEYMSAGLPVITSNFPLWREIVERDNCGICVDPLNPKEIADAIRYIIAHPEEAKKMGD
FT                   NGRRAVLEKYNWEKESEKLLDLYKELLKGEIKT"
FT   gene            433613..434842
FT                   /locus_tag="DICTH_0439"
FT   CDS_pept        433613..434842
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0439"
FT                   /product="WblI protein"
FT                   /note="identified by match to protein family HMM PF00534"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19561"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:B5YCR3"
FT                   /protein_id="ACI19561.1"
FT                   /translation="MNILLINHYAGSPKYGMEYRPYYLGKEWVKNRHQVTIIASSFSHV
FT                   RSKNPEIDSEIKEELIDGMRYIWIKTPRYKGNGIKRVINIFSFVFKLIKNSRRFSKEIK
FT                   PDVVIASSTYPLDIYPAYLISRFSKAKLIFEVHDLWPLTPIELGGMPKWHPFIIILQIA
FT                   EDFAYRKCDKVVSILPKALDYMVSRGLKPEKFVHIPNGIDIEEWQSFTDPLPEEHKSVI
FT                   ERFKNEGKFLVGYAGSLGVANALDYFVKSAKYLKDLPVALVLVGQGPEKEKLQRYVEEN
FT                   KLDKVVFLPPVPKKSIPELLDKIDIFYIGWRRSPLYRFGVSPNKLFDYMMAGKPIIHAV
FT                   EAGNDLVAESGCGMSVPPEDPIAIANAIRKLISMSKDEREKMGLRGKEYVIKNHDYKIL
FT                   ARKFLEVINI"
FT   gene            434974..436131
FT                   /locus_tag="DICTH_0440"
FT   CDS_pept        434974..436131
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0440"
FT                   /product="UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate
FT                   aminotransferase
FT                   (UDP-(beta-L-threo-pentapyranosyl-4''-ulose
FT                   diphosphate)aminotransferase)"
FT                   /EC_number="2.6.1.-"
FT                   /note="identified by match to protein family HMM PF01041;
FT                   match to protein family HMM PF01212"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18597"
FT                   /db_xref="GOA:B5YCR4"
FT                   /db_xref="InterPro:IPR000653"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:B5YCR4"
FT                   /protein_id="ACI18597.1"
FT                   /translation="MRNKFIPFSPPWIGEEEINEVVDTLKSDWITTGPKVKKFEEEFCR
FT                   YFNSPSALALNSCTAALHTALVTLGIGPGDEVITTPMTFCASVNVIEHVGAKPVLVDVE
FT                   SDTLNIDPNKIESAITNKTKAILPVHYSGHPVELDTIYDIAEKYNLYVVEDAAHAIHAK
FT                   YKGRFIGSSNNPVCFSFYATKNLTTAEGGMLTGDPNFIERARIISLHGMSKDAWKRYSK
FT                   EGSWYYEVVYPGFKYNMTDIQASIGLWQLNKLENFQRRRREIVNMYNSAFKDIEALRTP
FT                   IERPEVEHSWHLYVLRLNLEMLRIDRNQFIEELKNRNIGTSVHFIPIHLHPYYRDKYGF
FT                   KPNDFPVAYENYLKIISLPLYPRMSNEDVYDVIEAVIDVVKKYRR"
FT   gene            436128..436727
FT                   /locus_tag="DICTH_0441"
FT   CDS_pept        436128..436727
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0441"
FT                   /product="glycosyltransferase"
FT                   /note="identified by match to protein family HMM PF02397"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19634"
FT                   /db_xref="GOA:B5YCR5"
FT                   /db_xref="InterPro:IPR003362"
FT                   /db_xref="UniProtKB/TrEMBL:B5YCR5"
FT                   /protein_id="ACI19634.1"
FT                   /translation="MKKSKRLFDFMLSLLGLFITIPIFLVVSLLIKLEDNGPIFYKQKR
FT                   VGYKGKEFHIWKFRTMVVNADSLGRLITVGKDPRITKVGFWLRKFRIDEIPQLINVLKG
FT                   EMSLVGPRPEVPKYLKFYDEEMRRILEYVPGMTDPTSLNFLDESEVLAKAEDPEEKYIK
FT                   EILPLKVKQSLKYLERSNLWTDFLVILKTIFNLIKI"
FT   gene            436724..436840
FT                   /locus_tag="DICTH_0442"
FT   CDS_pept        436724..436840
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0442"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19771"
FT                   /db_xref="GOA:B5YCR6"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="UniProtKB/TrEMBL:B5YCR6"
FT                   /protein_id="ACI19771.1"
FT                   /translation="MIKDISKRTLALPFHNNLSEAEVEEVVSVLEKVVSKFE"
FT   gene            436958..437080
FT                   /locus_tag="DICTH_0443"
FT   CDS_pept        436958..437080
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0443"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19624"
FT                   /db_xref="UniProtKB/TrEMBL:B5YCR7"
FT                   /protein_id="ACI19624.1"
FT                   /translation="MRVYEYFLSCELYIEFSIEMKFLRLMATTYITHMTHEYSK"
FT   gene            437293..437583
FT                   /locus_tag="DICTH_0444"
FT   CDS_pept        437293..437583
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0444"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ACI20019"
FT                   /db_xref="UniProtKB/TrEMBL:B5YCR8"
FT                   /protein_id="ACI20019.1"
FT                   /translation="MSIAEDLIKKIANDLGIDFEEITKESLKAFLQEKRRKMKIDILGI
FT                   LDRYKVSSSRELEEKIFKGEISEHPAWEDLILLENLEETIKIIEEDIRSIS"
FT   gene            437734..437937
FT                   /locus_tag="DICTH_0445"
FT   CDS_pept        437734..437937
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0445"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18908"
FT                   /db_xref="UniProtKB/TrEMBL:B5YCR9"
FT                   /protein_id="ACI18908.1"
FT                   /translation="MNLERRFIDSSIYRHDNAPHKNWKKVKTFPKHFHMGTEENVVESY
FT                   ISNNPEEAIREFLNFIRDKILE"
FT   gene            438652..438849
FT                   /locus_tag="DICTH_0446"
FT   CDS_pept        438652..438849
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0446"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18273"
FT                   /db_xref="UniProtKB/TrEMBL:B5YCS0"
FT                   /protein_id="ACI18273.1"
FT                   /translation="MKFLDNLLLQYFTKDDRVLTSPLVIFETIFMLQSYYKLPRKEIRD
FT                   LLIPILNLRGLKLDYKDIFE"
FT   gene            438942..439574
FT                   /locus_tag="DICTH_0447"
FT   CDS_pept        438942..439574
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0447"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19348"
FT                   /db_xref="UniProtKB/TrEMBL:B5YCS1"
FT                   /protein_id="ACI19348.1"
FT                   /translation="MRIGKLFLLGFVLFLVVVNISVSLSLSSFVDRKPVFTEKEEIING
FT                   LKLLDTKDRMLRKLGKPKNTKKEYWGAYGDEVEYCYYEWGYVLLSPPPAPHKDLERPIE
FT                   EIEITGKKIVGPRGIRIGEDYKRVIESFRCDVKEIYERAFHNVKLYEVKKNNEEKMLGF
FT                   VIYNDKGEINEIWYKVLNEKYSSEFGLRFELMKKKVVKIFAYYSPGD"
FT   gene            complement(439693..440055)
FT                   /locus_tag="DICTH_0448"
FT   CDS_pept        complement(439693..440055)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0448"
FT                   /product="nucleotidyltransferase domain, putative"
FT                   /note="identified by match to protein family HMM PF01909"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19435"
FT                   /db_xref="GOA:B5YCS2"
FT                   /db_xref="InterPro:IPR002934"
FT                   /db_xref="UniProtKB/TrEMBL:B5YCS2"
FT                   /protein_id="ACI19435.1"
FT                   /translation="MPVRSLNSSVLKWADRKKIEEELENWIDKVVKEKRGVIKIGYFGS
FT                   YARGDYGVGSDLDIIIILESSSLPFEKRGIEWDTTNFSVPVDLLIYTIEEWQKLEKENS
FT                   SFYKKVSKEVIWLFTA"
FT   gene            complement(440006..440398)
FT                   /locus_tag="DICTH_0449"
FT   CDS_pept        complement(440006..440398)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0449"
FT                   /product="hepn domain, putative"
FT                   /note="identified by match to protein family HMM PF05168"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18589"
FT                   /db_xref="InterPro:IPR007842"
FT                   /db_xref="UniProtKB/TrEMBL:B5YCS3"
FT                   /protein_id="ACI18589.1"
FT                   /translation="MNRAFDWLKQAKRDLEQAIDSQKAGRHEWACFSAQQSAEKAVKAL
FT                   HLFLNQEAWGHVIAKLLSELPEEISVPQELIEKAKVLDNFYIPTRYPNGHPEGAPFEHY
FT                   GPLQSKEAIEYASEILEFVSSKMGRP"
FT   gene            440563..442017
FT                   /locus_tag="DICTH_0450"
FT   CDS_pept        440563..442017
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0450"
FT                   /product="polysaccharide biosynthesis protein"
FT                   /note="identified by match to protein family HMM PF02563"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19015"
FT                   /db_xref="GOA:B5YCS4"
FT                   /db_xref="InterPro:IPR003715"
FT                   /db_xref="InterPro:IPR019554"
FT                   /db_xref="UniProtKB/TrEMBL:B5YCS4"
FT                   /protein_id="ACI19015.1"
FT                   /translation="MNKLRIILALVLFLFSCAFAQTTQGQTTTQSQTTVTGEIYFGRIA
FT                   EPDKYILGVGDVIRIYLIQQAGEPISFDAVVSPTGAVSLPLVGSLKIAGLTLSEATKEI
FT                   SRRLIRFYPKSTIFIDLVYPRKFKIYVLGEVEKAGTQLISALSTLDDAIKLAGLKPSAS
FT                   LRRIQIKRGNKTIEVDYLKFLKYGDTSQNPYVEEGDIIYVPLMGKSVKVLGEVKDPGIY
FT                   EIKEGEKLKDVLDMAGGLTEKADLFGSYIERQIDGNKQIISIDLLKLIYQKDDKENLEL
FT                   KDGDSIVIPLKVDKVYVIGYVAKPQVFTIVSGEFKNEVGGQSAIGESEIKEGAKISELI
FT                   SKAGGVLPNGSRRRVQVIRDGQVIKEVDLFKVLVKGDVEEEKVKLVPGDIVYVPLAEKT
FT                   VKVLGEVKDPGIYEIKPGERIKDVIEMAGGFTVRADLKNITVERYITEKKEVIQLDLTK
FT                   LYKEGDESVNIILEDGDIINIPIKTE"
FT   gene            442029..443792
FT                   /locus_tag="DICTH_0451"
FT   CDS_pept        442029..443792
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0451"
FT                   /product="polysaccharide biosynthesis/export protein,
FT                   putative"
FT                   /note="identified by match to protein family HMM PF02563"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18334"
FT                   /db_xref="GOA:B5YCS5"
FT                   /db_xref="InterPro:IPR003715"
FT                   /db_xref="InterPro:IPR019554"
FT                   /db_xref="UniProtKB/TrEMBL:B5YCS5"
FT                   /protein_id="ACI18334.1"
FT                   /translation="MKRAILVLILLIASFSLIYAQEAPSLGEVYSGKVIEPDKYVLGPG
FT                   DVLRIFVVQENNKTESFTVSVSPTGFIFLPLVGSIKVLNLTLSDATKEISRQLVRFYPR
FT                   SNIYVDLINVKKVNILITGEVANPGNYKVSALSTLDDVLKIAGGLKASASYRRIFIKRG
FT                   EKVLELDYLKFLKYGDTSQNPYVEEGDFIYVPLMGDRVKILGRVKSPGEYEVKDGERLK
FT                   DVLDMAGGLAINASLFDATLDRVDGTRIYLDLYGLYYGDKERKDKANIELKDGDSITVL
FT                   TETKRVYVLGFVANPGPIQLVEEIKTGPQGEEIGGVTQAVVGAKISELIKEAGGVLPNG
FT                   STRRIELRRGGKESDKIIIDLYRVLVLGEESEEDIKVNPGDVIYVPPVLKSVKILGQVR
FT                   NPGVYEIVEGDRIREILLKAGGLTEKAAREGGELVRLENGKKLTYKFNVVNALQGIEKD
FT                   NLELKDGDTLYIPELRRLVYVLGQVNNPAAYEYREGRKLTEYISMAGGFKDRADLSRIA
FT                   IVREINGETKVIPINVNEIVNKGRSDLDITIEENDIIFVPEVFIKGWQDIVNILSGIFY
FT                   VYSLLKPIVGW"
FT   gene            443817..444578
FT                   /locus_tag="DICTH_0453"
FT   CDS_pept        443817..444578
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0453"
FT                   /product="lysophospholipase"
FT                   /note="identified by match to protein family HMM PF00561"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19070"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B5YCS6"
FT                   /protein_id="ACI19070.1"
FT                   /translation="MIYSFRIGKPQKGWVVIVHGLGEHIGRYEKIVNDLVERNYGVIGF
FT                   DHPGHGRSDGKRGDTSIEEIVSIIDNLTSDIPKFHLFGHSLGGLIATRYAQERQDKIKS
FT                   LVISAPALGVKVDPVTNFIAKAFGKILPSVTINNKLDPQYLSRNKKVIEKCMNDPLMHS
FT                   KISFRLGLSMMENIKIAHEKASSLNVPILILVPTEDRYVDPNGAREFFKKLTHEDKKLI
FT                   EFPGGYHELFEDEEYKDEFYKNIYDWIESHN"
FT   gene            complement(444575..445282)
FT                   /locus_tag="DICTH_0452"
FT   CDS_pept        complement(444575..445282)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0452"
FT                   /product="YoaM"
FT                   /note="identified by match to protein family HMM PF02586"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19882"
FT                   /db_xref="GOA:B5YCS7"
FT                   /db_xref="InterPro:IPR003738"
FT                   /db_xref="InterPro:IPR036590"
FT                   /db_xref="UniProtKB/TrEMBL:B5YCS7"
FT                   /protein_id="ACI19882.1"
FT                   /translation="MCGRFTLVQVEKIPTRFNAQIIGEINLRKRYNISPNQPVPIVFQE
FT                   SPNKVEEMIWGLIPHWAEDPKIGNKLINARAETLLKKPAFKESFLRRRCLVPADGFYEW
FT                   KKLGKEKIPYYIKMKDSSLFAFAGLYDVWKSPDGRLIKTFTIITTEPNELVKEIHNRMP
FT                   VILRKEYEEIWINKEETDVKKLQSLLVPYPAEEMEAYPVSKKVNSPSYDSEDLIKPVKI
FT                   YIIPKNEQSQFDI"
FT   gene            complement(445384..446256)
FT                   /locus_tag="DICTH_0454"
FT   CDS_pept        complement(445384..446256)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0454"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19603"
FT                   /db_xref="InterPro:IPR042117"
FT                   /db_xref="UniProtKB/TrEMBL:B5YCS8"
FT                   /protein_id="ACI19603.1"
FT                   /translation="MKKSLIVGFLTIIFLLSITFASDTGGVFSPMIFNARSAGMGEAFT
FT                   AISEGLSGLVYNPAGLTFEEKAMVGFSHTQLPQSFTRVEFVGGAINFGVFNVGLGFQAT
FT                   GVTNPDELLFPYYDATLNLTLAKKINEKLSIGTSLHSYIAKLDTGEAEGLGVDIGTIYE
FT                   IIPNLKIGAVWYNPISYIKWNTGTVETAGRQDLVIGVSYKLTLGEFPLNFAFDFSLYDK
FT                   IYFYQRLHLGLETQIPKTPVFIRTGYNGEKNTISFGLGVNINNIEFDYAFLYTKDLSNQ
FT                   HLFSLSLKF"
FT   gene            complement(446288..449365)
FT                   /locus_tag="DICTH_0455"
FT   CDS_pept        complement(446288..449365)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0455"
FT                   /product="putative protease"
FT                   /note="identified by match to protein family HMM PF05547"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18735"
FT                   /db_xref="GOA:B5YCS9"
FT                   /db_xref="InterPro:IPR003961"
FT                   /db_xref="InterPro:IPR008757"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR025965"
FT                   /db_xref="InterPro:IPR036116"
FT                   /db_xref="UniProtKB/TrEMBL:B5YCS9"
FT                   /protein_id="ACI18735.1"
FT                   /translation="MGKKIVLILSLFLVLALILNTSFAQVLPLTKVHIMPPHEKLLEKK
FT                   VKLPKLPEVSPSNIPQGIKIYGTIERAQGTGKAIVIPVEFTDKPRQPENVIPSNYFDIL
FT                   FNSIGADWTTINPYNVGSVREFYKENSYNQFDITATVLPWYTATYTYGYYINDNNYGFN
FT                   GGVFVLVKEVLQNAVNQGYDLRNYDVIFVIHSGQGAEWTEDHNDIWSHASTIYVTIDGQ
FT                   KVPIRYSIEPEYMEDYDSQGNPVIVPQTVGVFVHEMGHSFGHLPDLYDRDYSSLGLGRW
FT                   SLMAGGSWNGPAGPGGYSLGGGPSHFDAWCKIQLGWVTPIVPKEDLSNVSIPPVETNPV
FT                   VYKLWTDGVEGPEYFLIENRQKIGFDEYLRGSGLLIYHVDENMRSFQNDYEWYPGLDPS
FT                   RHYLVALEQADRKWDLEKKVNSGDSGDPYPGSTNNTTFDENSTPNSKAYGEIPTSVAVR
FT                   NIQLSGENIICNIYVKTQNAPQSTSFIKHLAWTGDNPLTIRPLFKWEAIPYATNYRLQV
FT                   ATDSNFNNIVIEVTTEKTEYRPTLDETLYPGKTYFARVRAENESGASSWTTISFTTPTS
FT                   FEALLVADDGGEYGIAPYFEKALQDIGETYFIVDVYYDNAVPYASFMSNFNWVIWGGDW
FT                   GAIYDPSVQNEIINYLDSGGKLFISSQDLGWGYSAGYISSTFYNTYLRANFIQDNVGIY
FT                   SVKGTSTSEFADLSFTLNAEGSLKNQAYPDEIDPLEGARPILVYNPSGTSPIPIEIKLP
FT                   EKIKEQKSQIVINKEIASSGTAGLFYADPEKHYGVVYFAFGLEGLSPDISGEVLGRVKY
FT                   ALFSSPDITATVTSSFNPNNNENCNINLTVQDNVGYAYITVKIYSTLNNQKKDLIRTLV
FT                   ENTRVDNGTYNFAWDGKDENGKVNPGRYMVEISAKDELNNITTKTYYITIPYGVPLSFL
FT                   NVTKFSKTFNPNKEFAEIYFTITQDASVKFIVYSLAGVKLYEKDLGYLPAGDYSIIWEG
FT                   INLKGETLKNGLYVFQLVATSSEGEARINRFIGILK"
FT   gene            449448..450035
FT                   /locus_tag="DICTH_0457"
FT   CDS_pept        449448..450035
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0457"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19506"
FT                   /db_xref="UniProtKB/TrEMBL:B5YCT0"
FT                   /protein_id="ACI19506.1"
FT                   /translation="MEILRYFLILIIFLILIQVAFGNMIPVVENRSIVIAKVKAIVHKE
FT                   FPFSEIVVEVVRSESVEGFKNFAKVGDIIPLYPLSLNANLENVDDFRKKVLYTCYFLKP
FT                   GDLVKAEIEFVGDEAKRGWVIRDIERVIEVNEGLLKDVIYSFLKAKGFIKDKEELKYEV
FT                   VKDGENYRVEIILDNKKLTIILDKSYVILNYF"
FT   gene            complement(450016..450888)
FT                   /locus_tag="DICTH_0456"
FT   CDS_pept        complement(450016..450888)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0456"
FT                   /product="conserved protein"
FT                   /note="identified by match to protein family HMM PF01937"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18592"
FT                   /db_xref="InterPro:IPR002791"
FT                   /db_xref="InterPro:IPR014444"
FT                   /db_xref="InterPro:IPR036075"
FT                   /db_xref="UniProtKB/TrEMBL:B5YCT1"
FT                   /protein_id="ACI18592.1"
FT                   /translation="MKTRWECFTCFFRQAESALKRINIPNEKKIEIIKAIAKDLENFSP
FT                   EDTPSYNTYLIFKKIYELSGSTDPYFEEKKYYNQQGLKLYEALKNIVDSSQDPLYTAVK
FT                   VAIAGNVIDLGILNISKLNLGEYIKEIINIPLAIDHYFYFKNELSKTNEILYLLDNAGE
FT                   IVFDRILIEELSKEKKIIAVVNEYPIINDALMEDAIEVALNKYAKIITTGSGSVGKPPE
FT                   LGGEEYKEVFNNAKLIISKGQANYESLEGRGYNIFFLLKAKCEVVAENLGVKEGDLVFL
FT                   YEKAKNNLK"
FT   gene            complement(450946..452145)
FT                   /locus_tag="DICTH_0458"
FT   CDS_pept        complement(450946..452145)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0458"
FT                   /product="CRISPR-associated DxTHG motif protein"
FT                   /note="identified by match to protein family HMM TIGR02221;
FT                   match to protein family HMM TIGR02549"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19945"
FT                   /db_xref="InterPro:IPR011742"
FT                   /db_xref="InterPro:IPR013383"
FT                   /db_xref="InterPro:IPR019016"
FT                   /db_xref="UniProtKB/TrEMBL:B5YCT2"
FT                   /protein_id="ACI19945.1"
FT                   /translation="MGEVKNILLSLIGRGKVLENISQGYKRTSYRFKTGEIFETGFFGS
FT                   ALWKYISQKEKINYWYIFGTSTSSWSEIIYALDEQKMSKFQDLAYEIYEAENIGIKGDL
FT                   LKNWEEALSSEIPGIKLILIDPLDYKFFSEFLLENLPENDDLKIILDITHGYRYLPLIL
FT                   SFSIMYVKNFKNIKELKIYYGALEMSQDNAPVLEIDHINEIFQLSTAFELYKNSGYFPE
FT                   LLKNLGLNRREDVYFSIEMNERPREELEKIIEELESIKEKHKKVPAKALVEDLIPLCRE
FT                   RYLEDRMVERAKFFFKKKQYLKSLILLYEALTIIILKKAGYRDLSNIINRREKAREVYS
FT                   KVLTEEWTRETFNNLEKIRNSAVHGNLRESQSSIRNFEDFSNLFQKSLELYHHLRKSLN
FT                   "
FT   gene            452294..452671
FT                   /locus_tag="DICTH_0459"
FT   CDS_pept        452294..452671
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0459"
FT                   /product="6-pyruvoyl-tetrahydropterin synthase"
FT                   /note="identified by match to protein family HMM PF01242;
FT                   match to protein family HMM TIGR03367"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19334"
FT                   /db_xref="GOA:B5YCT3"
FT                   /db_xref="InterPro:IPR007115"
FT                   /db_xref="InterPro:IPR038418"
FT                   /db_xref="UniProtKB/TrEMBL:B5YCT3"
FT                   /protein_id="ACI19334.1"
FT                   /translation="MFVIRKFKFDAAHNLESYKGKCERLHGHTYRLVVIVEGIPDSEGM
FT                   IIDFVELKDIVKREVIDILDHSYINEIIKQPTAENIAIWIWQRLEEKLKRGNCHLYEIQ
FT                   VWETEDSGVIYRGEKIERRSE"
FT   gene            452652..453425
FT                   /locus_tag="DICTH_0460"
FT   CDS_pept        452652..453425
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0460"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF02649;
FT                   match to protein family HMM TIGR00294"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18288"
FT                   /db_xref="GOA:B5YCT4"
FT                   /db_xref="InterPro:IPR003801"
FT                   /db_xref="InterPro:IPR022838"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5YCT4"
FT                   /protein_id="ACI18288.1"
FT                   /translation="MRDVQNEKDYRGIYLRKVGIKNIHWPIKIVTKSGDYQSTVASIDI
FT                   SVDLREDLRGTHMSRFVEVLNGIDSLHPENLGKILQEVREKLRADSSHIKISFPYFIFK
FT                   KAPVSQISSPNMVECVIDAELSKKLDMIIGVKVPIHTLCPCSKEISEYGAHNQRGVAEI
FT                   YVRSKKLIWFEDLVEISEKSASAPIYSLLKRPDEKYITEMAYNNPKFVEDVVRDIVSEL
FT                   EKEPKISWYRVEVTSFESIHNHNAFACVEKGWVKK"
FT   gene            453422..454624
FT                   /locus_tag="DICTH_0461"
FT   CDS_pept        453422..454624
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0461"
FT                   /product="dihydropteroate synthase"
FT                   /EC_number="2.5.1.15"
FT                   /note="identified by match to protein family HMM PF00809;
FT                   match to protein family HMM TIGR01496"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19373"
FT                   /db_xref="GOA:B5YCT5"
FT                   /db_xref="InterPro:IPR000489"
FT                   /db_xref="InterPro:IPR006390"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="UniProtKB/TrEMBL:B5YCT5"
FT                   /protein_id="ACI19373.1"
FT                   /translation="MIVEITPEFLEKEMARVGAHPVSFEIFERKAQIIPLKIFNISSPT
FT                   ANIIKQEMLSLGGDAIVHKNVINCKVENSDIILLGTKKHYELLLQKLEKNNYFDLPRVF
FT                   QELKEYLLKEKVREISSPWGRVISFNRILVMGIINVTPDSFYSGSRKMQIDEILKTAED
FT                   MIMNGVDIIDIGGQSTRPGSEPVSLEEEISRVIPAIENIRRNYPDVLISVDTYYSQVAK
FT                   LAVEKGADIVNDISAFRFDESLVKVVAELKVPYILMHMKGTPKDMQKNPYYDDVIREII
FT                   EFFEERIEYANKNGVDPEKIIIDPGIGFGKRYEDNLEIMARLKEFKSLKKPILIGASRK
FT                   SFIGKALGDLPPEERLEGTLGITALCVLNDVDIIRVHDVKENKRVVKVLEEIKCIRSSL
FT                   Q"
FT   gene            454600..455067
FT                   /gene="folK"
FT                   /locus_tag="DICTH_0462"
FT   CDS_pept        454600..455067
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folK"
FT                   /locus_tag="DICTH_0462"
FT                   /product="2-amino-4-hydroxy-6-hydroxymethyldihydropteridine
FT                   pyrophosphokinase"
FT                   /EC_number="2.7.6.3"
FT                   /note="identified by match to protein family HMM PF01288;
FT                   match to protein family HMM TIGR01498"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19552"
FT                   /db_xref="GOA:B5YCT6"
FT                   /db_xref="InterPro:IPR000550"
FT                   /db_xref="InterPro:IPR035907"
FT                   /db_xref="UniProtKB/TrEMBL:B5YCT6"
FT                   /protein_id="ACI19552.1"
FT                   /translation="MHKVFIAIGSNLGDRMKNIEVALKKMEDYGLRIIKKSSIIETEPY
FT                   GFKEQGKFLNGVILIETDLDPFDLLNLLLNIEKEMGRERKIRWGPRNIDLDIIFYDDLV
FT                   INTDNLKIPHPDAHNRTFVMGPLSEIDPDFVHPVLNKKVKDIYLKLIEGNF"
FT   gene            455111..455836
FT                   /locus_tag="DICTH_0463"
FT   CDS_pept        455111..455836
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0463"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18968"
FT                   /db_xref="InterPro:IPR003785"
FT                   /db_xref="InterPro:IPR024087"
FT                   /db_xref="UniProtKB/TrEMBL:B5YCT7"
FT                   /protein_id="ACI18968.1"
FT                   /translation="MLKYRYEVMFPYQLREVLEKNPIVYLPVSPIEWHGEHLIFGTDPF
FT                   RARRVLEIVWERLGGVMMPTLYVGTDGTIVEDGEEFWGMEMFAKEKIPGSVFVRKETFY
FT                   NLLKDMLNFLERTGFKLCVLCTGHMAKPQVEVVEKLEEEYMERSMKVISWHWGKVKYPE
FT                   ELVTNNPLHAGVEESSEILSIDLSYVDLDRVGGMEVDRKVGLTKGNLENISEKLGESRF
FT                   NFEAEELIKKILKCYNKES"
FT   gene            455851..459009
FT                   /locus_tag="DICTH_0464"
FT   CDS_pept        455851..459009
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0464"
FT                   /product="diguanylate cyclase (ggdef) domain protein"
FT                   /note="identified by match to protein family HMM PF00990;
FT                   match to protein family HMM TIGR00254"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19734"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:B5YCT8"
FT                   /protein_id="ACI19734.1"
FT                   /translation="MDSVLENLNYIEEVLKKEPIVYLNLPTGSGRTYLLKSFFERNKSS
FT                   SLFTHYASHRTPVGEFFITLLSLIDKNSFLKEKGDIVGPILRRYIHPRFLSHLEKYKAE
FT                   EVISLDVEVAQIADIASFILEKRKIKYWIFDNWQEFLYYGDVFKELIPYLSKKYNMAFV
FT                   ITGKDFNMESYEIKIDDLLVPLNVDTTIKEMEKAFNLDNKEAVRLFEMSNGNWNNAIVI
FT                   YKNDFKSLWDIVWEKINSLSENEKKALYTLTFVGKTFSSTTVKAVKELYGPLKFIRDFV
FT                   DSKLMRWEYPLWRFVSEDVLNYVRESMPYNFSQLKEEFVKKLSSFNYSDIWGRVALLSE
FT                   EDEKYWKYAKIKEFRSSYNIQRKMEILEEIVEKGKDDGNIYKRRLINLLIDFQKFNKAI
FT                   NIIEFIEDKNLLDLANKVRCLSYLGKYEEAEKLIEEIIDSLEMDYNLPQILSRIVSYHF
FT                   LTKKVTDALFLLNKYLEDILRLTSSPKYLANFYNALGLLNLIDGKFEKAISVFENGLVL
FT                   AEKSGDKVVLHKLLNNLGDLRNYLYGPKSAVIINQRAYDISKSLSKNLMVISLGNLIKS
FT                   KMQYSNLKEVEDLLLELERLVSEIELEYFLYSGYRRLAIAYLNYGKREELDKVIKKLED
FT                   LKTISESKILVRILRSFFGEIEITEEEVLETKEEQIMTLYMKLVAEKGLRISKSLRDYP
FT                   TDYPIHNFLKGYILGESFFNLISYIDLMLERWEFLDAFYSYKLLMKNLERDKNLKVFVP
FT                   YIKLEVVGLAILLGLEKELEDQLKEISLDYTGLIKEHSKIKALEDYVGKAIMDSETEEE
FT                   AMELIYRVISDFIDNFLVVLRIGDRTLKRGNELIATNKFRFFYKKPPFSVSVYSLKNLS
FT                   PSLFFVIRNLLKSFIVFWERKYGIFDPLTGLFNRSYGERRLEEAFLDFVRENEDFSIIF
FT                   IDIDGFKKINDTLGHSYGDYVLKEIATAIRNSIRQSDSAVRWGGDEFLILLRRADYNEA
FT                   MKVVNRIKDRIESVSKGEIRISYGIETTSKETSSYRELIDRADVKMYAHKFRKLKDLEN
FT                   SKKE"
FT   gene            complement(459042..459908)
FT                   /locus_tag="DICTH_0465"
FT   CDS_pept        complement(459042..459908)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0465"
FT                   /product="endoglucanase"
FT                   /note="identified by match to protein family HMM PF01670"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19111"
FT                   /db_xref="GOA:B5YCT9"
FT                   /db_xref="InterPro:IPR002594"
FT                   /db_xref="InterPro:IPR013319"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="UniProtKB/TrEMBL:B5YCT9"
FT                   /protein_id="ACI19111.1"
FT                   /translation="MKKSLLSLILILLLITLSFSQTPKYKDAFILKAPSSGDVITKNLP
FT                   LTLELNFWNIANYEGNTWMAFYKEEDTVEYYADIKNIVLKDKNSWVHGYPEVYYGYKPW
FT                   AGHGNSIEKLALPKKVSEFPDVLFNLKYNIWYEKNLPINFAMETWITKEPYQKTVTSGD
FT                   IEMMVWLYANRLSPAGRKVGEVKIPIILNGTQKDIIWEVYLSPMSWDYVAYKSKENILQ
FT                   GQVKIPINEFLKHLRTILANNPSRITPEKFDQMYVTVWEIGTEFGDPYTTEAKFGWTFS
FT                   NFDIELK"
FT   gene            complement(459988..461283)
FT                   /locus_tag="DICTH_0466"
FT   CDS_pept        complement(459988..461283)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0466"
FT                   /product="beta-mannanase"
FT                   /note="identified by match to protein family HMM PF02156"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19014"
FT                   /db_xref="GOA:B5YCU0"
FT                   /db_xref="InterPro:IPR000805"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR022790"
FT                   /db_xref="UniProtKB/TrEMBL:B5YCU0"
FT                   /protein_id="ACI19014.1"
FT                   /translation="MRISKFEEKKIDLYSREIRILEAEFKIESFGYYDFYLNYEPIENF
FT                   SKSYVFINNLAYGEVQFYEGKNYSYLGELKLKPEKYTFQIAFPYEDFKINFLEIKEKDQ
FT                   SNSKIKNFKIRNNLSDNAKRILEFFQKIYANYIIAGQHTNTSAGPEIAYIEYITGEKPA
FT                   LRGFDLLSYTPATKTQEMTPHAIIEIEGNKGSIEKALEWGRDFGGIVTFCWHWYAPLGG
FT                   KDKTFYTINTDFDLEKALIEGTEENKALLRDIYMIGEKLSIFRGLDLPILWRPLHEADG
FT                   RWFWWGAKGPENYKKLYHLLYEILTEKFKLNNLIWIWNAPHPDWEIEEDLYDIAGIDNY
FT                   VPPGNHGPMKFSYDLLLKLTDYRKLVALTENGPIPDPDLLFEYEAYFLWFMPWFGDFVF
FT                   NESFNSKEHLKKVYNHEKVITLNKLRKLFSMR"
FT   gene            461399..461767
FT                   /locus_tag="DICTH_0467"
FT   CDS_pept        461399..461767
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0467"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="identified by match to protein family HMM PF00392"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19335"
FT                   /db_xref="GOA:B5YCU1"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B5YCU1"
FT                   /protein_id="ACI19335.1"
FT                   /translation="MIIEFDEKVPIYLQIMDFIKKEIVKGNLKGGDKLPSVRELAEMLK
FT                   VNPNTVQKAYQELEREGITYTLRGTGSFVTEDERKIEALKKQMAISILEKFYKDMKDIG
FT                   FSDDDIVNLLQSYIKEGK"
FT   gene            461767..462453
FT                   /locus_tag="DICTH_0468"
FT   CDS_pept        461767..462453
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0468"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19495"
FT                   /db_xref="GOA:B5YCU2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B5YCU2"
FT                   /protein_id="ACI19495.1"
FT                   /translation="MGILEVSNLYKDYGKKLALKNINLSFDLGQIVGLYGPNGSGKTTF
FT                   LKIIAGLLRPSKGKVILDGREIGVYTKSIVAYLPDRNILPLWMKVRDARNFYKDFFDFD
FT                   EARFKSLLEFFELREELNLRELSKGDLEKILLSLTLSRKAKVYLLDEPLGGMDPSTRDK
FT                   VITSILRSYHEESLMIIATHLIGEIENITERTIFIHNGELVLDDNTEKIREEKGVSINE
FT                   LFKKMF"
FT   gene            462466..463248
FT                   /locus_tag="DICTH_0469"
FT   CDS_pept        462466..463248
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0469"
FT                   /product="membrane protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18315"
FT                   /db_xref="GOA:B5YCU3"
FT                   /db_xref="UniProtKB/TrEMBL:B5YCU3"
FT                   /protein_id="ACI18315.1"
FT                   /translation="MIDRLLNLMKYEFLGKRKTYLIFLLIYLGLVFIIWTRFHNRISDK
FT                   DLELLTIYIFLTFFFSVGLVLIFIKNLRDINSEDLGYLSFSLPVTSYVLFLKRIKIVFS
FT                   ELVYFLLIVVLTGYFILHSYNTSFSVAISSYFSKYGTILLIDFLFSFIFIFLIVALIII
FT                   ARNLAYEKRFLRRLIYVGCTGYLVFGNYLHDFLAKCFPQKLLSIPPFEYQMTSQGLQEG
FT                   FDIPKTDYYVVGVLLKILLFILVIYLYNLLLEKYAERR"
FT   gene            463255..463914
FT                   /locus_tag="DICTH_0470"
FT   CDS_pept        463255..463914
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0470"
FT                   /product="ABC-type transporter, ATPase component"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19805"
FT                   /db_xref="GOA:B5YCU4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B5YCU4"
FT                   /protein_id="ACI19805.1"
FT                   /translation="MIKVENLYKYYPMGKEKYPALKNINLSINKGEFVAIIGPSGSGKS
FT                   TLLNIIGGLDKPSEGKVYVDGQDIFKLNDARISKYRNEKIGFVFQFFYLEPTYTVLENV
FT                   MLPLIFSKSNSRELKAKEAIEKVGLTHKIGNKGNELSGGERQRVAIARAIVNNPSILLC
FT                   DEPTGNLDSKTGISIMNLLKALNKEGKTIVLVTHNLEYLSFVDRVIKIKDGELEVN"
FT   gene            463917..465206
FT                   /locus_tag="DICTH_0471"
FT   CDS_pept        463917..465206
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0471"
FT                   /product="ABC transporter, permease protein"
FT                   /note="identified by match to protein family HMM PF02687"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18541"
FT                   /db_xref="GOA:B5YCU5"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR025857"
FT                   /db_xref="UniProtKB/TrEMBL:B5YCU5"
FT                   /protein_id="ACI18541.1"
FT                   /translation="MKIFDFIKLSFKNLKKRRLRMILNMLAIGIGTTLIMVMLGFGFGT
FT                   QNYLIEEIKKYDMFNEISVVPFKKSDNVKIGTSTGEITEKRELNKKITKDDVRAFKNIK
FT                   GVSAVRATVEVVFNEIRMNGKNLKFVTGLGYDRDFDLWFDNGKDKRIILGREISGKDSK
FT                   EVLIGEKLFEIMKIKNYKELLDKEVELIVVNPNMPNLPLKEKVKIVGIINGKSIFSDVI
FT                   VMPLDLAIKFKEYYLGDENYFEKYGYEAVYVRAESFREVKDIAKKIKDMGFTATTFQEA
FT                   LDDLNKYFRIFQGILGGFGAIVLFVAGLGVMNTMIMAVYERVKFIGLLRALGASQKDVR
FT                   NLFLVESGCLGFLGGLLGVFIGSGFNYLLNLFINKALIKDSSKFVRIFSVSPSLILGVI
FT                   LFSIILSCMAGFYPARRASKLDPVEALRYE"
FT   gene            465255..466265
FT                   /locus_tag="DICTH_0472"
FT   CDS_pept        465255..466265
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0472"
FT                   /product="alcohol dehydrogenase"
FT                   /note="identified by match to protein family HMM PF00107;
FT                   match to protein family HMM PF08240"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19683"
FT                   /db_xref="GOA:B5YCU6"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B5YCU6"
FT                   /protein_id="ACI19683.1"
FT                   /translation="MKTKAIVFAGPFQIEIKDFELRELREGEVLVKTIYTGVSPGTELR
FT                   VLSGKQVGGEFPLIPGYENVGKIVKVGKGVKDLKEGMIVFSSGTRFTGPYNRVWGGQVE
FT                   YSIVGEEEVIIVPEDLDPLYAVFTKTCAIALHGVKRARVSGKDKVAIVGQGLIGHLALQ
FT                   MSKINGAYVIAIDVVEERLKNSILAGADYGINAKEKDVYEEVMKITNGGVDVAIDVTGV
FT                   ASTVNNTANLIRPRPYVSKSSQDPDPPVGRLLILGSYTDPICFNYHPTLFDHEIDIIVS
FT                   RDCTYFDLLEAIDLIRNKKVNFNAIDFETFDFQSAEKGYQKLMNKEITKAIFKWE"
FT   gene            complement(466307..467488)
FT                   /locus_tag="DICTH_0473"
FT   CDS_pept        complement(466307..467488)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0473"
FT                   /product="Cna protein B-type domain"
FT                   /note="identified by match to protein family HMM PF05738"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18564"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:B5YCU7"
FT                   /protein_id="ACI18564.1"
FT                   /translation="MKKLILFSLILIVLGIFLSGCTPTTSTNPGEVNVDLGNSTLKGVV
FT                   NYFDKPINQSANIKVTLIAESEDSPVNLNSYYVITGNNGFYEFKNIPSGTYLLIAQDVN
FT                   KNYQPANIILTIGENETKTAETMILTKVIKHVIIFRESGSAWNEAGIPETVIGDILSSI
FT                   GMTQGTGQNQYEYRTLTGENPNLSFNMGDLIIVEGDQPQAFYDIYTTNKTIFDNFVYNG
FT                   GTIFWIACDMGWASGNFTSTLPGGVTWRDSYDSYNDIVYFEHPITKNFPTQLYGNYASH
FT                   GGFDNLNSTNIANLMIYVKETTGDGSIQYPTYVEYRYNMGRVLATTSPLEWYVVNGNMS
FT                   IPEGYSTTYKDLFKLMLVRSIKYIMNLEVSPDIPPSVESVYDQKIKLNLNSHK"
FT   gene            467696..468682
FT                   /locus_tag="DICTH_0474"
FT   CDS_pept        467696..468682
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0474"
FT                   /product="GTP-binding protein"
FT                   /note="identified by match to protein family HMM PF01926;
FT                   match to protein family HMM PF02824; match to protein
FT                   family HMM TIGR00231"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19867"
FT                   /db_xref="GOA:B5YCU8"
FT                   /db_xref="InterPro:IPR004095"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B5YCU8"
FT                   /protein_id="ACI19867.1"
FT                   /translation="MPANLPPQYFEAEKKFREAKTIEDKIQALKEMLAILPKHKGTDKM
FT                   KADLRRKLSQLMEEAEKRAKKGGGRSLDYIEKEGAGQVLLVGPPNTGKSKFFTLLTGVN
FT                   SLVAEYPFTTMDPIVGMLPYENIQIQLIDLPPLWEESEGWMYNLIRNADLIVLFLSMDL
FT                   DSIVDEYLKIRELLERKKIKLVRDNPNRDPYSPIKENRGIVVLNKIDIFTPEERRDEIE
FT                   IIEKDLNVFYVSAEEGINMEDIKRHMFDALHIVRVYTKKPGYPPDLSRPYILEKGSKVL
FT                   DVAEMVHKDIAKNMKFAKLYTKDGSVKGLPVEKNYEVKDEDILEFHI"
FT   gene            468695..469660
FT                   /locus_tag="DICTH_0475"
FT   CDS_pept        468695..469660
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0475"
FT                   /product="glucose--fructose oxidoreductase, putative"
FT                   /EC_number="1.1.99.28"
FT                   /note="identified by match to protein family HMM PF01118;
FT                   match to protein family HMM PF01408; match to protein
FT                   family HMM PF02894"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19031"
FT                   /db_xref="GOA:B5YCU9"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR004104"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B5YCU9"
FT                   /protein_id="ACI19031.1"
FT                   /translation="MRWGVVGTGRIVRNRFLPALEQIPEAKLTAIVTTNPKKAKDLSER
FT                   YGAKIYTNLEDIEDADVVYIATPNKFHKEQTIICAKKRINVLCEKPMAINVREAEEIIE
FT                   ECESNKVVLGVANMGRFNPFNIGAKKLIDENIIGKIGVIKASFSFVNTEKSGWRYSLEL
FT                   AGGGSIMDIGVHVINTLHFWFPNNRIKEIVAINEGYGYEVEENAGAVARFDNGMITLLD
FT                   ASYNTMLSVSFEIRGDKGILYVLDTLYQDYDGKVILRNFNNYTFYTFYGENQYVAEIKD
FT                   MERAIKEGKKPATSGLDALEDMRVIEGWYKSAMENKLIFL"
FT   gene            469713..470153
FT                   /locus_tag="DICTH_0476"
FT   CDS_pept        469713..470153
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0476"
FT                   /product="transcriptional regulator"
FT                   /note="identified by match to protein family HMM PF01047;
FT                   match to protein family HMM PF01325"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ACI20161"
FT                   /db_xref="GOA:B5YCV0"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR022689"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B5YCV0"
FT                   /protein_id="ACI20161.1"
FT                   /translation="MEKNNDLYGIFKEVIREHFIRREKLLSGLKLYRGQAPMLLLLSEK
FT                   GGLTQKEIAEEMKIKPSTVAIMVRRMRKRGLVITQRDEKDRRFSKVYLTDEGRKFICKL
FT                   KKIFKQLEEECFSNFSEEEREILKNYLERIRDNLKKFNEEKG"
FT   gene            470159..471892
FT                   /locus_tag="DICTH_0477"
FT   CDS_pept        470159..471892
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0477"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005;
FT                   match to protein family HMM PF00664"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19218"
FT                   /db_xref="GOA:B5YCV1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:B5YCV1"
FT                   /protein_id="ACI19218.1"
FT                   /translation="MKKLLKFLKPYTYAVVLAPLLMLVEVVCDLYQPTLLARIVDQGIL
FT                   KNNFQVIWNTGLIMIGIALIGMVGGIGCTVFASIASQNFGRDLRNELFKKVQKFSFHNI
FT                   DKFKTSSLITRLTNDVVQLQTLVMMSLRIMVRAPLLFIGGIIMAISLNKNLSFIFLLSI
FT                   PILILLFLFIMKKSFPLFSEVQKRIDYVNNVVRENLVGIRVVRAFRREDYEKERFRYAN
FT                   SALMNAVIKAIMLMIIAMPLFMLVMNLSILAVLWFGGLLVEKGNMQVGEVMAYINYMTQ
FT                   ILFSLMMIGNILMFISRASASASRVVEVLDEKIDIEDKKDSDTRPIETGKVKFEHVYFS
FT                   YSKDREPVLVDIDFEVKAGEIIGIIGTTGSGKSTLVNLIPRLYDVTSGRLLVDGRDVRS
FT                   INLKVLRSAISMVPQDTILFSGTIKENICWGKEDATDEEVIKAAKLAQAHDFIINLPDG
FT                   YDTVIGERGVTLSGGQKQRIAIARALIKNPKILILDDATSAVDFVTEQKIIKGLKEIMK
FT                   NCTTFLIAQRVSTMMNADKIIILDKGRIVGFGTHYELLERNPIYQEIYKSQIDEEVVKH
FT                   A"
FT   gene            471885..473747
FT                   /locus_tag="DICTH_0478"
FT   CDS_pept        471885..473747
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0478"
FT                   /product="multidrug resistance ABC transporter"
FT                   /note="identified by match to protein family HMM PF00005;
FT                   match to protein family HMM PF00664"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19905"
FT                   /db_xref="GOA:B5YCV2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:B5YCV2"
FT                   /protein_id="ACI19905.1"
FT                   /translation="MRRDDKTSRGQLPQRGFGPRPFGGPGRGGPHFNFEKVEIKDPWGT
FT                   LKKLLKYMVLYKWGFIFAFLLVVISSILGIIGPYLIGRAIDLYILPRRFEGFFNFLLLL
FT                   GGIYLLSSFLAWLQGYIMLKTTQSLVFTLRRDLFNKFHSLPIKFFDLRPYGDLMSRITN
FT                   DVDNISMVLATSVIQFLSAVVSLTGIIIMMLRISLPMTLVSLLNIPLTIILTNFISKKT
FT                   RNYFYANQTLLGKLNGIIEEDISGLKIIKIFNREEKEIRKFEEVNNDLTQVGIRAQIFS
FT                   GSIGPLMNLLNNLGFALIAGVGGFFAYRKMITVGDITVFINYSRQFTRPINELANQYNM
FT                   IQSAIASAERLFEIMDEEDEKDTVDGAVELQDIKGEVEFKNVWFSYVKEKPVIKNVSFH
FT                   VKPGEIFALVGPTGAGKTTIASLVARFYDVDEGEILIDGIDIRRIRRRDLRKYLGIVLQ
FT                   DTLLFSTTVRENIRYGRLDATDEEVEEAAKLAHAHDFIIKLPQGYDTVLSEDGGRLSQG
FT                   QRQLIAIARAILANPRILILDEATSNVDTVTEKYIQKAMLNLMSGRTSFVIAHRLSTVK
FT                   NADMILVINNGEIIERGTHEELIRKKGFYYHLYMSQFADEVEIK"
FT   gene            473838..474479
FT                   /locus_tag="DICTH_0479"
FT   CDS_pept        473838..474479
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0479"
FT                   /product="endo-1,4-beta-xylanase A"
FT                   /EC_number="3.2.1.8"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19612"
FT                   /db_xref="GOA:B5YCV3"
FT                   /db_xref="InterPro:IPR010502"
FT                   /db_xref="UniProtKB/TrEMBL:B5YCV3"
FT                   /protein_id="ACI19612.1"
FT                   /translation="MRRSLLLAILLIFGLFLSLTFGQTLTATAKYGKPKIDAEMDEVWK
FT                   NAEEYVTDRYVQGVKGKVAYAKFRVLWDEESIYVWAEVYDSVLNKDNTNPWEQDSVEIF
FT                   VDEGNEKATSYDNNDAQYRVNFENVQSYGTNASRDYFVTATKKTDFGYIVEAQVKMRTR
FT                   KLKEGDVIGFDVQVNDADRFGSRVGIIAWNETENENWRNPSYLGNLKLVK"
FT   gene            complement(474525..475385)
FT                   /locus_tag="DICTH_0480"
FT   CDS_pept        complement(474525..475385)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0480"
FT                   /product="membrane spanning protein, putative"
FT                   /note="identified by match to protein family HMM PF00892"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19387"
FT                   /db_xref="GOA:B5YCV4"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:B5YCV4"
FT                   /protein_id="ACI19387.1"
FT                   /translation="MKRIIGLILVIIACLFWSISFSVSKILLKTLSPFELAFIRFFLAS
FT                   IFSLIVFLPKIKKASFNRKYQKPLFIAGLFGVTLYFIFENTGLKFTDASEGALIVGSFP
FT                   ALGLLTEYILHKEKLPLNRILGVLLSISGVFLIMSDSGLNLKFNNLFGDFLILLSGVSW
FT                   VIYNWEIKKVNQKYPYEILTTFQMIWGSILFLPFLMFTGLKIPKTLDALIGIFFLSFFC
FT                   SGLGYLFYNYGLKTLSVSQVMNILNLIPLFGAIWGVIYLKETLTLIKIVGGILIILGVS
FT                   LSSSK"
FT   gene            475486..476322
FT                   /locus_tag="DICTH_0481"
FT   CDS_pept        475486..476322
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0481"
FT                   /product="lipoprotein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18294"
FT                   /db_xref="UniProtKB/TrEMBL:B5YCV5"
FT                   /protein_id="ACI18294.1"
FT                   /translation="MKKIIGLMLVIFLLFFVSGCVKQEPQPDKDLSNDDLNNIWETVEN
FT                   NGTSFGLYTIALSANLGFFSVSKPVPSNLIEKLPTAKSVDKLTIEANWQGPDADGWYTQ
FT                   TSNNDYVKVRYYSSLKKLEFKSRTDLTDILGFIVEENGSLIFNKNIRDETEGAYPVSGS
FT                   VSIYFLAPSTSDPNKMNKFGFTLSFSNVGITYLSQFKNIGILTGSMSLYVTLIDYDNNI
FT                   NVNNKLMASFTSQVQGADSEDPVLVISGSKDKDGDPTTDDGYDNFELNLHLAKLLL"
FT   gene            476511..477317
FT                   /locus_tag="DICTH_0482"
FT   CDS_pept        476511..477317
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0482"
FT                   /product="myo-inositol catabolism protein"
FT                   /note="identified by match to protein family HMM PF06845"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ACI20114"
FT                   /db_xref="GOA:B5YCV6"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR021120"
FT                   /db_xref="InterPro:IPR024203"
FT                   /db_xref="UniProtKB/TrEMBL:B5YCV6"
FT                   /protein_id="ACI20114.1"
FT                   /translation="MFKKVKLQTGLNNLVKPGEMQFIELDIFKGEKGDNYNFNSQDYEI
FT                   GLVILTGKCNVEIDGERYNLIGARRNVFDGNAYAFYIPNNKEVKIEALELLEVAICKTK
FT                   VKTEEEVKLIKPSDVVVRDVGVYNWRRDVKDIIDTRIRAKRLLIGETINPPGNWSSYPP
FT                   HKHDTDNYPEEVRMEEVYFYRVNPPSGFGLQRVYTAEGDIDEVFLIENDSLLLINRGYH
FT                   PVVAAPGYQLYYLWILAGEIRESIMYDDPKHKWLRAVEKIMKEAKR"
FT   gene            477330..477977
FT                   /locus_tag="DICTH_0483"
FT   CDS_pept        477330..477977
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0483"
FT                   /product="2-keto-3-deoxygluconate-6-phosphate aldolase"
FT                   /note="identified by match to protein family HMM PF01081;
FT                   match to protein family HMM TIGR01182"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19027"
FT                   /db_xref="GOA:B5YCV7"
FT                   /db_xref="InterPro:IPR000887"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR031338"
FT                   /db_xref="UniProtKB/TrEMBL:B5YCV7"
FT                   /protein_id="ACI19027.1"
FT                   /translation="MGNRFEILEKMIECGIVAVIRTDSPEDLIPVTKALKEGGIIALEV
FT                   TMTVPSAIEYLPKVKKELGNDAIVGMGTVLDPETARLAILAGADFIVSPVLKKEIINLC
FT                   HRYDKIAIPGAYTPTEILTAWEEGADVVKLFPADTLGPKYIKAIHGPMPYIRISPTGGV
FT                   SLENVGEFIKAGACFVGVGGNLVDKKVIAEKKFEILTERAKEYIEAIKKARS"
FT   gene            478180..480609
FT                   /locus_tag="DICTH_0484"
FT   CDS_pept        478180..480609
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0484"
FT                   /product="N,N'-diacetylchitobiose phosphorylase"
FT                   /note="identified by match to protein family HMM PF06165"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18860"
FT                   /db_xref="GOA:B5YCV8"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR009342"
FT                   /db_xref="InterPro:IPR010383"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="InterPro:IPR033432"
FT                   /db_xref="InterPro:IPR037018"
FT                   /db_xref="InterPro:IPR037828"
FT                   /db_xref="UniProtKB/TrEMBL:B5YCV8"
FT                   /protein_id="ACI18860.1"
FT                   /translation="MRFGYFDNERKEYVITRPDTPREWTNYLGSLEYGAIITNNAQGYS
FT                   FVKSGASGRILRGRFNVPPTTAPGRYIYLRDMENGDFWSASWLPVKKDLSKYESICRHG
FT                   VLYTIISSKYDGIETETLYYVPLNALYEVWAIKVRNKSGRKRKISLFSYAEFTNEPNEN
FT                   QDLVNMQYTLFISRTYYKDNLIIQTINENYSELGRVIPQEKGISGRRFNRFFGVIGSEV
FT                   VSFDGDRDTFIGSYRDYSNPIAVERGKCSNSLNYGKNSCAGTQVILDLDVDEEREIIYV
FT                   LGDGAEETGRKVMQKYKEKGIVEKEWEELKRYWHSKIENFKVKTPDENFDSMVGVWNAY
FT                   QCFITFFWSRAASMIYVGHRDGYGYRDTVQDIQGIIHLDPQSARERLKLMFAGQTSKGV
FT                   ALPLVFFDYQIKPNQGLSLENPYYVKRTGYTEYRCDDHLWLYITTRQYVRETGDLSFLD
FT                   EVIPYSDYGEDTVYEHLRKGILFSLSKLGKHGLTYGLDADWNDCLRLGEEGETVFASFQ
FT                   LYLALKIFAEFAEKKGRKDDVEWAEREASKLYENIQKYAWEGDRFVRGFIEDEVIGSKN
FT                   SSEASFWLNPQVWSVLSGVATSEQAKIAMDNVEKILNTDYGAMIMYPPVRTLGMPVFRM
FT                   ILFNPGMKENAGIFCHPQGWLIRAETMLGNGDRAYKYFQEINPANMNDKAEIREAEPYV
FT                   HCQFVEGKDSPFHGRAHVHWLTGTASSVMVACVEGILGLQPDYDGLRIDPCIPSHWKEF
FT                   YMERIFRGKKLRIKVENSAGVQKGVKKIIINGKELEGNFISESEMKDENDVLVIMG"
FT   gene            480625..483060
FT                   /locus_tag="DICTH_0485"
FT   CDS_pept        480625..483060
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0485"
FT                   /product="cellobiose phosphorylase"
FT                   /note="identified by match to protein family HMM PF06165;
FT                   match to protein family HMM PF06204; match to protein
FT                   family HMM PF06205"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19706"
FT                   /db_xref="GOA:B5YCV9"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR009342"
FT                   /db_xref="InterPro:IPR010383"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="InterPro:IPR033432"
FT                   /db_xref="InterPro:IPR037018"
FT                   /db_xref="InterPro:IPR037825"
FT                   /db_xref="UniProtKB/TrEMBL:B5YCV9"
FT                   /protein_id="ACI19706.1"
FT                   /translation="MRFGYFDDKNREYVITDPKTPFPWINYLGVDNFFSLISNTGGGYC
FT                   FYKDARLRRILRFRYNNVPIDNGGRYFYIWENGDFWSPTWKPVKKELDKYECRHGLSYT
FT                   RILGERNGISAQVLFFVPLKENCEIHYLKLRNNSGVRRSLKLFSFVEWCLWNAWDDQTN
FT                   FQRNLSTGEVEIEGSVIYHKTEYRERRNHYAFYSVNVPIQGFDTDRDTFIGMYNGFEAP
FT                   RAVVEGRPYNSVAEGWSPIASHYIEVDLEPGEVKDFVFVLGYVENPEEEKWERPGVINK
FT                   KRAYEIINKFKTSQDVEKAFWDLRNYWNDILSKYQVNHSDEILARMVNIWNQYQCMITF
FT                   NVARSASYFESGISRGIGFRDSNQDILGAVHMIPERVRERILDLASTMFEDGSCYHQYQ
FT                   PLTKRGNNEIGSGFNDDPLWIILSTGAYIKETGDYSILREVIPYNNDESKKGTLFEHIK
FT                   RAYHHVTNNLGPHGLPLIGRADWNDCLNLNCFSKNPDESFQTTSNVEGGTAESVFIAGL
FT                   FVFATPDYVRMCEEMGEKEEAEWAKKAAEDMINAINNYGWDGEWFLRAYDFFGRKVGSK
FT                   ECEEGKIFIEPQGICTMAGIGKEDGRAKLALDSCIKYLDTKYGMVLQQPAYSKYYLELG
FT                   EISSYPPGYKENAGIFCHNNPWVGIGETVIGRGWRAFEVYKKITPAYFEDESEIHRMEP
FT                   YVYCQMVAGKDAKRHGEGKNSWLTGTASWAFVLISQYILGIRPDYDGLRVDPCVPEDWK
FT                   EFRVVRKYRGSVYDIKVLNPEGRSKGVKRIFVDGKEISGNLLPIFNDGKVHEVVVEMG"
FT   gene            483192..485522
FT                   /locus_tag="DICTH_0486"
FT   CDS_pept        483192..485522
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0486"
FT                   /product="alpha-glucosidase 2"
FT                   /EC_number="3.2.1.20"
FT                   /note="identified by match to protein family HMM PF01055"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19410"
FT                   /db_xref="GOA:B5YCW0"
FT                   /db_xref="InterPro:IPR000322"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR025887"
FT                   /db_xref="InterPro:IPR030458"
FT                   /db_xref="InterPro:IPR032513"
FT                   /db_xref="InterPro:IPR033403"
FT                   /db_xref="UniProtKB/TrEMBL:B5YCW0"
FT                   /protein_id="ACI19410.1"
FT                   /translation="MNEMTLKVKDELLKVSFITPKIVNFHYSKNGVFNKDYSFCVEYQK
FT                   LKNSNVEVNFKEDEKYYYLSSEYLNIAISKELGKVSIYDKDGNLILSDYEDKGYVKEGS
FT                   KIFTYKEIKYGEAFFGFGERLGSLNKKGQVLINWNTDESNHSMNNDPLYQCHPFFISWH
FT                   PKASYGLFFDNTFFSYFDMGRENQSYYYFCAQDGELDYYFIYGPSPKEVIEGYTFLVGR
FT                   CHMPPLWSLGFHQSRWSYDSEKKVYEVAEKFRKRKIPCDAIYLDIDYMKGYRVFTVNRK
FT                   RFPNFDKMAEDLKRLGFKIVLIIDPGVKWDKRYEVFKEGIEKDFFCKRENGKIFTGYVW
FT                   PGKSVFPDFLREEARDFWGENHRKFINLGISGFWNDMNEPSIFSKIEYLAMKILFHILK
FT                   LKEPPKLKSPKSFEEKIKRIKKKTMDEGVIHKLNGKIFYHSEIHNIYGLLMNKATFEGF
FT                   LKIKPNERPFILTRSGFSGIQKYSAVWCGDNKSSWENLFSSIITLQNLSMSGVPFVGED
FT                   VGGFWGDCDKELFARWIELGVFYPFFRVHTAKNTKEQEPWSFGEEVERIAKELISLRYR
FT                   LIPYIYSLFYEAKEKGIPILRSLILEFPNIREVLNHEDEFMFGPFILVAPVYEKNHRER
FT                   NVYLPDGFWYDFYTGKRYRGGSSIKVNAPLNKIPLFIREGAIIPMWDVQSYVGEKNQEI
FT                   LTLEIYPGEGKFLYYEDDGTTWDYEKGIYNLVEFSTFKRGEQQVLSVRFVHRGYEGGAK
FT                   FLNVHYCKKEKKIDFTEGEFEIN"
FT   gene            complement(485526..486770)
FT                   /locus_tag="DICTH_0487"
FT   CDS_pept        complement(485526..486770)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0487"
FT                   /product="permeases of the major facilitator superfamily"
FT                   /note="identified by match to protein family HMM PF05977;
FT                   match to protein family HMM PF07690"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18559"
FT                   /db_xref="GOA:B5YCW1"
FT                   /db_xref="InterPro:IPR010290"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B5YCW1"
FT                   /protein_id="ACI18559.1"
FT                   /translation="MKKANLFRALRSRNYKLYFSGQAISLIGTWIQSTAMSWLVYRLTN
FT                   SSVLLGTTAFLSQIPNLFISPFVGVFLDRFSKHKILILTQTLLMFQALILSILTLTNTI
FT                   QTWHILLLSLILGIINSIDAPTRQSFVIEMVERPEDLNNAIALNSLLFNVARLIGPTIS
FT                   GFLIALIGEGMCFLINALSYLAVIIALLFMKIKVKIPVISENIIKDLKAGFSYAFNFIV
FT                   VRYILIFISLSSIFASIYSVLMPIFAKDILHGGPETLGILTGATGAGALIGAIYLAGRS
FT                   KVRGIESIISYSFGTAGIGLLIFSLSRNIYTSILALFVTGLSFMLNSVCSNTLIQNVIE
FT                   NHIRGRVMSIYVMFFMGSMPIGSYIGGLLAKHIGAVNTVLLSGILCLICSLIYKVRLPI
FT                   LRKHIYSILDKRGIN"
FT   gene            complement(486772..487941)
FT                   /locus_tag="DICTH_0488"
FT   CDS_pept        complement(486772..487941)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0488"
FT                   /product="Unk2"
FT                   /note="identified by match to protein family HMM PF07221"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18656"
FT                   /db_xref="GOA:B5YCW2"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="InterPro:IPR028584"
FT                   /db_xref="UniProtKB/TrEMBL:B5YCW2"
FT                   /protein_id="ACI18656.1"
FT                   /translation="MDLKHLKDEIFEQLNNKIIPFWENLKDENNGGYISYVGFDLKPDP
FT                   YAPKGLVLTSRILWFFSRLYNQLRKEEFIEFADHAYEFLTDKLLDKENGGFFWIVDYKG
FT                   DPLDKRKHLYGQAFALYGLSEYYKATKKKESLELSLELYKTIEERCKDNIGYKEEFDEK
FT                   WTPKENIIVSEYGIICEKSMNTLLHLLEAYTNLFTATYDLKVRKELENLIILFKEKIYN
FT                   PKTDHLYVFFDNKMKPIIDAISYGHDIEATWLIDEALRYIENNTLIKDMTEINLRIAER
FT                   VLEEAFENNSLLNEKVRGEVNKDRVWWVQAEALLGFLNAYQKTKSDKFLKAVLSLWEFI
FT                   NNFLLDKRPNGEWFNKLDENCIPFPMPEVDLWKCPYHNGRMYLEVIRRI"
FT   gene            488054..489691
FT                   /locus_tag="DICTH_0489"
FT   CDS_pept        488054..489691
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0489"
FT                   /product="permease, putative"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18732"
FT                   /db_xref="UniProtKB/TrEMBL:B5YCW3"
FT                   /protein_id="ACI18732.1"
FT                   /translation="MGYKNFGLAIYCTAPFLNRISIDELKNGLKFFQRYLHVDKVYLET
FT                   HRGKDDVSKEKMINFKNFFESEGIKVAGGITTTIDSLDDPVHDLRIFHTFCYSKDSLKK
FT                   RLQEIVEYTASLFDEIILDDFYFTSCSCEGCIKSKGDKSWQEYRLNLMTEVSQKYVVDP
FT                   AKRVNPKVNMIIKYPNWIESYHENGYNPETQKDIFDGIYVGTETRDPKYTQQDLPRYLS
FT                   YYLMRWFENVKPGKNKGGWFDSFECNLNQYLEQAYLTLFAKAKEITLFDFNSLRNTVYI
FT                   PPLGFELERLDNILSLLGDPMGVRVYHPFHSNGEDHLVDYLGMVGIPFEPSPYFSFQES
FT                   PIFITETSCGDRDILNKMKKALISGNTIIITSGVLRRLRGKGIEEFTSIRYTDRKVNID
FT                   FFAIDSAMIGFTKYVHSQEVLFPVLEYYTNSSWPMVVGIKGERNFPILLKDFYGSGKLY
FT                   ILNVPDNFSHIYNLPVEVLNEIRKIFMEKIGIYFEGESKISLFLYNNNYAIVESFLPHR
FT                   SEITLRFKDKSTKILLNPNGFKLINLSE"
FT   gene            489688..490089
FT                   /locus_tag="DICTH_0490"
FT   CDS_pept        489688..490089
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0490"
FT                   /product="conserved protein"
FT                   /note="identified by match to protein family HMM PF01986"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18633"
FT                   /db_xref="InterPro:IPR000305"
FT                   /db_xref="InterPro:IPR002837"
FT                   /db_xref="UniProtKB/TrEMBL:B5YCW4"
FT                   /protein_id="ACI18633.1"
FT                   /translation="MKGIYVLVVEVKDYIEESIGSLGKLSFEGGLYLYIGSAQSNLELR
FT                   VKRHLSKNKKLHWHIDYLLKNEKVRIKKVLFNKLDKSWECKIASLIEGKPMPKFGSSDC
FT                   GCISHLFKVDEGQIKFLNNLGFKDFEMGE"
FT   gene            490095..490724
FT                   /locus_tag="DICTH_0491"
FT   CDS_pept        490095..490724
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0491"
FT                   /product="translocator protein, LysE family"
FT                   /note="identified by match to protein family HMM PF01810"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19424"
FT                   /db_xref="GOA:B5YCW5"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:B5YCW5"
FT                   /protein_id="ACI19424.1"
FT                   /translation="MDLGIWSIFITSFLVGFSGASSPGPMLTMVLAQSSIKGWFESVKI
FT                   VTGHAILEGVLVILLLLGLQPFLQNQVFLKSFSFFGSIFLFYMGIGLLISLFKNEIHVK
FT                   NASPLKFPSVLGGILVSISNPYWLIWWITIGVSFLTQARNYLILGVLSFYFGHILSDYV
FT                   WYAFIGLIGQGLSLPFWKRIYKVILYIASIFLIFFGGYFMRYVFLG"
FT   gene            complement(490728..491189)
FT                   /locus_tag="DICTH_0492"
FT   CDS_pept        complement(490728..491189)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0492"
FT                   /product="membrane protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19403"
FT                   /db_xref="GOA:B5YCW6"
FT                   /db_xref="UniProtKB/TrEMBL:B5YCW6"
FT                   /protein_id="ACI19403.1"
FT                   /translation="MKNKSIGILLLLIGAFLLLANFNLLKGDVFLLLLSVIFIIAYFRM
FT                   NRSIGFLIPGCILFSIFLFNLFNNLFNINPIHSLTFIGLGFIAIYFIHYSGKKDITIGE
FT                   KYWSLYPGIILIAIGILISLIQNFPDYLRYLIPIVLIIIGVLLLFRRQK"
FT   gene            complement(491192..492289)
FT                   /locus_tag="DICTH_0493"
FT   CDS_pept        complement(491192..492289)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0493"
FT                   /product="poly-gamma-glutamic synthesis"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18278"
FT                   /db_xref="InterPro:IPR019079"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:B5YCW7"
FT                   /protein_id="ACI18278.1"
FT                   /translation="MIAHIGKINTKKINVVLFILVILLFISDFNSQEKPADIVSLAFAG
FT                   DLFIQSQLFKSYYDPNTKSYYFPEDIFEDIKEFINKDFSFIVIDTPVATNLYPPSGYPL
FT                   YNAPIEILDTLKKVGFNVMITSGNHSLDKGEKGLITTMENMIKKELYYVGTNRTKEESN
FT                   KYLILEKNNIKIGILAYTFSTNGIPLPKGKDYLVNLINKQKIKNDLKKIKNLCDFKIVY
FT                   LHWGNVEYLDEIEESQKTLAKEIISYGADLIVGSHPHAIKPYENINGKWCFYALGNFFT
FT                   DQYGVYRPEVKYGFILNISLLKYNDRVNLVSKEIIPIFIWRKNLGKRYEYKILRAEKVK
FT                   NLPNIDIKDKMYFKRVKKILKLEEE"
FT   gene            492311..494530
FT                   /locus_tag="DICTH_0495"
FT   CDS_pept        492311..494530
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0495"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF04041"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18993"
FT                   /db_xref="InterPro:IPR007184"
FT                   /db_xref="InterPro:IPR023296"
FT                   /db_xref="UniProtKB/TrEMBL:B5YCW8"
FT                   /protein_id="ACI18993.1"
FT                   /translation="MIFSPNFISYLPWNDKIDKGGRIALMVFTKGDVINIIGFNEFLIP
FT                   VVNYWEEEGYKVEISYDYRVKDKRNKIFLVVDNPKTQVPWRILLEELKNVEGKTLFLNY
FT                   PRVFKTPDHPVWKHHWDGIIAFFWEEYLPKNIYLVNFPSYPVMEKQATESRDDLGIPKN
FT                   KKAILVIADYSFENVLLYLAELKKQEDFYLIVFVSTWEKEVFLREFLKKKGIEVDRVVV
FT                   GGVWYDELQLVSAVDLVIVDGGKNVEPFHVYKLVGCGTPLIIKDKIFTNFLYNEVIKFD
FT                   GKEKTEIKGITRTELTTGVMKFKDKDELFYKINLIFTNEHLRNLVLGTSRAFAYAHSPE
FT                   RVGSQFLFIFKDILNPPIYVPSKKAVRYVNNPLFKARPNVYLNLRRKKIAWEKLVYNAG
FT                   AIRIGGTIYVFYRALGEDGVSRIGLWWSKDGYTQEGRLDYPIFGPKESYEMPKNPEQRR
FT                   RFHKRTFGMIREIGGTEDPRLSLIDGNLYMTYTAYGDVVQLALAKIPVEVFLKGVKSFK
FT                   GYEEWNNAWVRNGPIFKYLEDKDAVLYLVEERKEEYSNGKRAEDDFVNVFPELLDKKVA
FT                   LIHRIPPDMQILYTDELKKRSIKVGRTFLMPTPKFWDSIKIGAGAPPLKTKYGWLHIYH
FT                   GVGDWMGKKAYGLGVVLTPLDEPDKIIYRSAEPILQPEEIYEVEGWVPNVVFTCGVVPK
FT                   NKDSNEILDLDDEILIYYGGADEVMALAEIKVGDLLPIEITANIY"
FT   gene            complement(494524..495033)
FT                   /locus_tag="DICTH_0494"
FT   CDS_pept        complement(494524..495033)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0494"
FT                   /product="BioY family protein"
FT                   /note="identified by match to protein family HMM PF02632"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ACI20065"
FT                   /db_xref="GOA:B5YCW9"
FT                   /db_xref="InterPro:IPR003784"
FT                   /db_xref="UniProtKB/TrEMBL:B5YCW9"
FT                   /protein_id="ACI20065.1"
FT                   /translation="MKTKKIPYLALGLALLILGGYLSFHLPFTQVPFTLQVFFLFLISL
FT                   YFSPIETFYIVFAYLLLGGLGFPVFAGGRGGLNVLFGPTGGYLFGFLIAGITISVLKKY
FT                   SEILSLFLGILVIYLTGSIWLSFSLKINYYKALMTGVIPFIPYDFIKGIISYLIWQKLK
FT                   KQLKNQ"
FT   gene            495196..495441
FT                   /locus_tag="DICTH_0496"
FT   CDS_pept        495196..495441
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0496"
FT                   /product="transcription regulator, PspC family"
FT                   /note="identified by match to protein family HMM PF04024"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18780"
FT                   /db_xref="GOA:B5YCX0"
FT                   /db_xref="InterPro:IPR007168"
FT                   /db_xref="UniProtKB/TrEMBL:B5YCX0"
FT                   /protein_id="ACI18780.1"
FT                   /translation="MEKRLYRSKKNRVILGVCGGIAEYLNIDPTIVRLIFIFLFIPFHF
FT                   ALIIAYFLSALVIPEEPEDLEKKDDNITPSGPVQHL"
FT   gene            495456..495821
FT                   /locus_tag="DICTH_0497"
FT   CDS_pept        495456..495821
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0497"
FT                   /product="PspC domain family"
FT                   /note="identified by match to protein family HMM PF04024"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18584"
FT                   /db_xref="GOA:B5YCX1"
FT                   /db_xref="InterPro:IPR007168"
FT                   /db_xref="UniProtKB/TrEMBL:B5YCX1"
FT                   /protein_id="ACI18584.1"
FT                   /translation="MENKLYRSRRNRVFLGVCGGIGEYFGIDPVIIRLIFIFSVLFLGP
FT                   LSLLFYILCALVIPENPGNSELPSPLSKDGGETLGWVFLALGVYFLGRTFGIFQVSFTL
FT                   VLALLFILFGILIFFKK"
FT   gene            495834..496727
FT                   /locus_tag="DICTH_0498"
FT   CDS_pept        495834..496727
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0498"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18263"
FT                   /db_xref="GOA:B5YCX2"
FT                   /db_xref="InterPro:IPR024425"
FT                   /db_xref="UniProtKB/TrEMBL:B5YCX2"
FT                   /protein_id="ACI18263.1"
FT                   /translation="MRRMSLLGIFLILIGLLLLFSELGIIRFYWRDLLRLWPLIFIFWG
FT                   LDLLIGEKKWFGWLVVLIIFLLTIFIVFFSSYGRPFFRDRGPGFYYREWKYPFKEDIKG
FT                   LDLEISTGVRVVRLEALKDRENLLHISSNWDFYIDKLIEEKRDGELGLSLKVEGEKETG
FT                   FRIFGDDKKLDPINININPEIPLSLKFDVGVGDATLNMREFRLKDLSVKGGVGRLKIYL
FT                   PSSPCYVEIEGGVGSVEVYVPEDMILDLSAETGLGKISVDKEIKQEKGGEKGVIRLKVR
FT                   SGVGNIKILSEKKEVI"
FT   gene            complement(496730..497746)
FT                   /locus_tag="DICTH_0499"
FT   CDS_pept        complement(496730..497746)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0499"
FT                   /product="transcriptional regulator"
FT                   /note="identified by match to protein family HMM PF00356;
FT                   match to protein family HMM PF00532"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19347"
FT                   /db_xref="GOA:B5YCX3"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:B5YCX3"
FT                   /protein_id="ACI19347.1"
FT                   /translation="MRKVKINIRDIARLANVSVATVSRVINGSPNVSEKTRKKVLKIIQ
FT                   EYDYHPSAFAQKLSKTKTQIVALLIPYERGFVLSDAFFPPLIKGMTEIFDKKEYNIMLS
FT                   MIESPYIPQKYISLYKRGIVDGYILANVKKDDPFPEILYEENIPFVTVGRVSSKIKNYP
FT                   YVDTDNVRGAFEATTYFLEKGHKRIALLKGNSNYNFIQDRYEGYILALKKYGIKPDPKL
FT                   IVEDSLTIDGGYKAMKKLLKINNPPTAVLACSDYMAIGAMNAIFEENWEVPEDIAVIGF
FT                   DDLYIDGKIEPPLASVRQEIEEMGKEAAKLFLHILDNPNNFEPIILPATFIWRRSAG"
FT   gene            498014..499957
FT                   /locus_tag="DICTH_0500"
FT   CDS_pept        498014..499957
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0500"
FT                   /product="oligopeptide ABC transporter, periplasmic
FT                   oligopeptide-binding protein"
FT                   /note="identified by match to protein family HMM PF00496"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18449"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:B5YCX4"
FT                   /protein_id="ACI18449.1"
FT                   /translation="MRSKKGLIILFVLVSVLLLSGVINGQKEKVVSLPFWDTPGLVPYY
FT                   WQAQHILAQGTIFEGLYGYAPDPKSLGGVKVVPVIAQSYKVSKDYKVWTFKLRKDKKWS
FT                   NGDPVTAKDFEWSFKYYASPKIPDLPAWAGPLQFFENFWAVKSGAVDPDKLGVKALDDY
FT                   TLEIRLSTPRYDMKEWLCVAQAVPIHRKTVEADPQNWWRPGKIVVNGPYIPVSWTPGKD
FT                   MVLVKNPNYVGERGNVDRIVLKFGGLGIQQYQAGELDAALINNVAEYRYVTSDPKLSKE
FT                   FHEDVMDCFWNGYQWSRGFDPIMDNEKLRKALAMAIDREKLCKDVLGGRALPLNKYWPD
FT                   GNPIGDKLKGIPFDVNQAKKLLAEAGYPNGKGLKTLVFYITGGGDPVVEFIVDQWKKNL
FT                   GVNVIIENIESGLYWNSYVWPSFSPDAKAGFTVMGAPMNNLEIGALFKNSDHTPWFFDF
FT                   PTSARKRYYELQQEQDAWLRKDGGLTEADWKPLLEKRNTLYETYKKIVSTEPEKLWVAE
FT                   LTKSPTWYERFDELYEKWKAAKTNADKTNYWRLAGREIVGQEIFQNWYLNMTERARNAI
FT                   RWRYRAVNRPFSEAVKIVHYGLQLMQDAYYMVPVYLAKAQWVQNPKLEGLMLYKFSWGP
FT                   GFFNFKWLNLKD"
FT   gene            500030..500992
FT                   /locus_tag="DICTH_0501"
FT   CDS_pept        500030..500992
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0501"
FT                   /product="oligopeptide ABC transporter, permease protein"
FT                   /note="identified by match to protein family HMM PF00528"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19316"
FT                   /db_xref="GOA:B5YCX5"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B5YCX5"
FT                   /protein_id="ACI19316.1"
FT                   /translation="MGLLKYILRRLFTIFVSIIVVIIITYVLMWLAPGDFFNIAQFQAS
FT                   AGKIATLTPEQLQVLIKGFEEKYGLNVPLWKQIWNYLKDAFRFKFGPSFSNPNEPIEVQ
FT                   IARRFPVTATLAILAMALAVVVGIPLGVIAALKRNTWVDYVTMFISMIGSIIPAYLIGV
FT                   IMVIIFSVYLRWLPTSGWETPKQMIMPVITVAVGPMAIIARFTRSSLLDVLSQDYIRTA
FT                   YAKGGTDRAVIMRHALRNSLLPVVTVIGPQLAFLFTGTVWIENLFRVPGLGQLFVNAAS
FT                   MRDYPLLVTSTFILSLSVMLMNLLVDIIYAFLDPRIKYQ"
FT   gene            501033..501905
FT                   /locus_tag="DICTH_0502"
FT   CDS_pept        501033..501905
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0502"
FT                   /product="oligopeptide ABC transporter, permease protein"
FT                   /note="identified by match to protein family HMM PF00528"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19730"
FT                   /db_xref="GOA:B5YCX6"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR025966"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B5YCX6"
FT                   /protein_id="ACI19730.1"
FT                   /translation="MEVAIKQKTRRASYWSAAWRRFKRNKMAVAGLIYIIIITIAAIFT
FT                   PLIAPYPYDEPHYAYTFQPPSAKFWFGTDDLGRDMFSRNLYAMRNALLIGFGSQIVVLI
FT                   IGVIIGSIAGFRGGMVDTFLMRVTDIMYAFPTFLFNVILVTVMGRGLFTILVAVGLTGW
FT                   AGMARLVRGMVMYLKHAEFVEAARALGAKDSYIIRKYILPNMLGPIIVSLAFGIPNGIW
FT                   VESGLALIGMGVRPPMPSWGNMIGAGLGYIMAFPHMVIFPVLTFALTLLAFTYVGDGLR
FT                   DAFNPRSEV"
FT   gene            501910..502890
FT                   /locus_tag="DICTH_0503"
FT   CDS_pept        501910..502890
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0503"
FT                   /product="oligopeptide ABC transporter, ATP-binding
FT                   protein"
FT                   /note="identified by match to protein family HMM PF00005;
FT                   match to protein family HMM PF08352; match to protein
FT                   family HMM TIGR01727"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19503"
FT                   /db_xref="GOA:B5YCX7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B5YCX7"
FT                   /protein_id="ACI19503.1"
FT                   /translation="MAELLRVNNLKTYFDRYDGVVKAVDGVSYKLDYGETLAIVGESGS
FT                   GKTQSVLSLVRLIKGNGRIVDGEAIFEGKDLLKLSKEELRQIRGKDISIVFQDPMTSLN
FT                   PIMRVGIQIMEPIIWHKVMSDKEARERAIELLRVVGIPEYKTRVWDYPFQFSGGMRQRV
FT                   MIAIALACNPKLVIADEPTTALDVTVRAQILNLLSDMKEEFKTSVIFITHDITLAMNFA
FT                   DTIMVMYAGKIAEYAPIEKFIKNPLHPYSNGLITSTLDINAKEGSLRPIPGNPPSLVNP
FT                   PSGCRFHPRCQYAQDICKEVEPEYREVEDGHYVACHLVKGGKFNA"
FT   gene            502883..503830
FT                   /locus_tag="DICTH_0504"
FT   CDS_pept        502883..503830
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0504"
FT                   /product="oligopeptide ABC transporter, ATP-binding
FT                   protein"
FT                   /note="identified by match to protein family HMM PF00005;
FT                   match to protein family HMM PF08352; match to protein
FT                   family HMM TIGR01727"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18948"
FT                   /db_xref="GOA:B5YCX8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B5YCX8"
FT                   /protein_id="ACI18948.1"
FT                   /translation="MPELLVVKNLKKYFPVRGKLLKAVDNVSFSIEQGETLGLVGESGS
FT                   GKSTLGRSILRLIEPDDGEIIFDGVDIRKLSGEELRQKRRFMQIIFQDPLASLNPVMTI
FT                   GQNIEDPLIIHNIGTKEERRRAVEELLEIVGLGRDVIDAFPHEFSGGQQQRVGIARALA
FT                   LNPKFIVADEPVSSLDVSIQAQIVSLLYELKRRFKISYLFISHDLAVVRYLSDKVAVMY
FT                   LGAMMELAPKEELYQNPLHPYTRALLASVPKMPRDGERQTRFPALKGEVPSPIDLPPGC
FT                   RFQSRCEYVMDVCRKQEPAFREVSPGHFVACHLV"
FT   gene            503886..504884
FT                   /locus_tag="DICTH_0505"
FT   CDS_pept        503886..504884
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0505"
FT                   /product="endoglucanase H"
FT                   /EC_number="3.2.1.4"
FT                   /note="identified by match to protein family HMM PF00150"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19692"
FT                   /db_xref="GOA:B5YCX9"
FT                   /db_xref="InterPro:IPR001547"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR018087"
FT                   /db_xref="UniProtKB/TrEMBL:B5YCX9"
FT                   /protein_id="ACI19692.1"
FT                   /translation="MKKIVFLFLLVFFIFNINGYSQERLPIKRGVNLTGLEAPFEGSWG
FT                   VYVKDEYFELVKKAGFDHIRLPVRWNGHAAYEPPYTIRSYIFDRVDQIINLAFKNKLYV
FT                   IINIHNYEEIMQNPEKHKERFLALWKQIAEHYRNYPDSLWFELLNEPNTNLTPQLWNEY
FT                   LAEAIKVIRETNPTRKIVVDTANWANYSTISFLKLPEDKNLVVSFHYYNPFNFTHQGAD
FT                   WVQPQLPVGVKWTGSDQERKAIERELDFTVEWAKRNGNVPLYMGEFGAYHRADMESRVR
FT                   WTDFVARSAEKRGIAWAYWDFASAGFGVYDGLNKMWRMDLLKALIPDTKIK"
FT   gene            504906..505844
FT                   /locus_tag="DICTH_0506"
FT   CDS_pept        504906..505844
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0506"
FT                   /product="endoglucanase H"
FT                   /EC_number="3.2.1.4"
FT                   /note="identified by match to protein family HMM PF00150"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19154"
FT                   /db_xref="GOA:B5YCY0"
FT                   /db_xref="InterPro:IPR001547"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR018087"
FT                   /db_xref="UniProtKB/TrEMBL:B5YCY0"
FT                   /protein_id="ACI19154.1"
FT                   /translation="MGKIPIRRGINFGDTLEAPYEGAWGGHIIKDEYFKLIKDAGFDHV
FT                   RIPIKWSVYTQKEYPYSIEKRIFDRVDHLIEEGFKNSLYIVINIHHYDEIMEEPLREKD
FT                   RFLAIWRQISEHYKDYPDQLYFELLNEPTYNLNSDLWNQFLKEAVEVIRKTNPERKIII
FT                   GPDNWNNLYNLPKLEIPENDKNIIVTFHYYNPFPFTHQGAGWVKVNLPVGVKWLGTEEE
FT                   KKDVERELDMAVDWAKEHGDIPLYMGEFGAYSKADMESRVRWTDFVARSAEKRGIAWAY
FT                   WEFYSGFGVFDSEKNEWRKPLLKALIPETKI"
FT   gene            505865..506860
FT                   /locus_tag="DICTH_0508"
FT   CDS_pept        505865..506860
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0508"
FT                   /product="endoglucanase"
FT                   /note="identified by match to protein family HMM PF00150"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19118"
FT                   /db_xref="GOA:B5YCY1"
FT                   /db_xref="InterPro:IPR001547"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:B5YCY1"
FT                   /protein_id="ACI19118.1"
FT                   /translation="MKVKNIIPRWKGFNLTNMFLFHSARDFEEEDFKWISDWGFDFVRV
FT                   PLCYRLWIEDDDIYKINERFLEKIDKVVEWGQKYNIHVSLNFHRAPGYCVNNEFIEKFN
FT                   LWKDKDALDAFCFHWGVFAKRYKGISSKSLSFNLVNEPLHPSPEVMTRDDHNRVIRYTV
FT                   EYIRKIDSERLIIIDGISYGNVPLPELSDLNVVQSCRGYLPMGLTHYKANWVGGENWPE
FT                   PKWPGAWHYGEIWDRERLEKHYDEWAKLISMGIGVHCGEAGAYKFTPHKVVLAWLRDLL
FT                   EILKERDIGFALWNFKGPFGILDSDREDVDYEDWYGHKLDREMLKLLQEY"
FT   gene            complement(506857..508041)
FT                   /locus_tag="DICTH_0507"
FT   CDS_pept        complement(506857..508041)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0507"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ACI20041"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniProtKB/TrEMBL:B5YCY2"
FT                   /protein_id="ACI20041.1"
FT                   /translation="MKKIIIGSIALLTIGNILSQNFDVVPTKSIVIGTEALNYFLTYNN
FT                   SLIYAFQDQITLLDLNTFKETKLKVKSSKAQNFNTYIVKFKILSNGDIAVINNEPYIIL
FT                   WNPLKNNKIELPFNIEYNRKDKNNFLISKTEIIEDLDISNTAKFVFIKNHISQLFLNFI
FT                   PIEDYYEYKILSYPDLKEIISWSSKEINFDNIAFSTDDNFVILRNVTYPQELNKSYGLK
FT                   IYDLSKQKEYNLLPNTTVIDFDIAQNSKLIAISTEESGTKIFDLKTLNEVFKASISGYV
FT                   RFSPLENLLILEGNNTINIFDIKSKNLIETYLGSNPSLSPSQTYLAYAISKNFASLSKE
FT                   INIVNRYTKTQNKINFKEEYFVEDIQFSRDENFLITMLSGKDGYKIEIFKKTSP"
FT   gene            complement(508065..510017)
FT                   /locus_tag="DICTH_0509"
FT   CDS_pept        complement(508065..510017)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0509"
FT                   /product="ABC-type multidrug/protein/lipid transport
FT                   system, ATPase component"
FT                   /note="identified by match to protein family HMM PF00005;
FT                   match to protein family HMM PF00664"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19726"
FT                   /db_xref="GOA:B5YCY3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:B5YCY3"
FT                   /protein_id="ACI19726.1"
FT                   /translation="MNYYPEEEILGKAYDSRIMRRLLKYAKPYLRYLILALVLIILITL
FT                   LKLVNPYIIKNSIDKSINPIKTLSINGKEIRVYYIDEKIPIDLLQRYNGIIKNFEGKKY
FT                   ILLEDLNKLSLKDRTIVRFKDINNLKKSALNYFLILILIFILTYAQVYILNLTSQKIIF
FT                   DMRKELFEHILKLPLSFFDKNPVGRLVTRVTNDIETLQQMYNSVITSFVVDIFLILGLS
FT                   IVMLIINWKLALICIVSLPIVGYISFIFRKYAREAYRNFRIRLARLNAYLAEHINGVRV
FT                   TQVFAREKENEKEFKEINNKLLEAQLRNVFVNAIFRPAVSALGSIVSAFLIFFGGWQIM
FT                   NNQMSFGTIFLFLSYLGSFFQPIQDLAEKYDILQDAMASAERIFLLRDEKITIDSPPNP
FT                   IRLNNLRGEIEFKNVWFAYDKEWVLKDLSFKIEPGEKVAFVGATGAGKTSIINLITRFY
FT                   DVQKGEILIDGINIKDIDLRDLRRQISVVLQDVHLFATTILENIRLNRDDIPEEKVIEA
FT                   AKLVNADKFIRELPQGYYTPVQERGATLSAGQRQLIAFARALVFDPKILILDEATANID
FT                   TQTEKLIQDAIEKVIQGRTSIIIAHRLSTIKKVDTIYVMHKGRIVEKGNHQELIKKRGI
FT                   YYHLYKLQSLNYANK"
FT   gene            complement(510001..511770)
FT                   /locus_tag="DICTH_0510"
FT   CDS_pept        complement(510001..511770)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0510"
FT                   /product="ABC-type multidrug/protein/lipid transport
FT                   system, ATPase component"
FT                   /note="identified by match to protein family HMM PF00005;
FT                   match to protein family HMM PF00664"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18845"
FT                   /db_xref="GOA:B5YCY4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:B5YCY4"
FT                   /protein_id="ACI18845.1"
FT                   /translation="MNKPLFRHIKKLLWQYKWKYITGAFFLLLTDIFQLISPKLIGWGV
FT                   DYLNKGTLTFKSLLLVFIALLLLAILTAIFRFFWRMQILATARRLEAQIREKYFTHLQT
FT                   LSLNFFNYKKTGELMALATNDLGAVREMFAFGIVMLLDTIFLGTLSIFFLLSISPKLTL
FT                   YIAIPLPLITLTITFFGKITHRRFRLVQDSFAKLTDKAEETIAGIRVVKAYVQEEAELK
FT                   KFVERAQDLLNKNINLVKAWGFMFPTIELLAGFSVLFVFLFGGLEVIRGNISLGDFIAF
FT                   NSYLGLLIWPMNALGWVVNNFQRGKASLERINEVLDEVPDIKDSPNSIKRERLEGYITF
FT                   KNVYFKYPKSTKWVFEDISLEVKPGKFLGITGPVGSGKTSLVSLIPRLFDIQKGEILID
FT                   DIPIKNLSLYYLRKNIGFVPQDSFLFSDTIANNIRFAKPDLSDEEIYKLIKLVALEEDL
FT                   KEFPDGINTIVGERGVTLSGGQKQRIAIARALAINPPILILDDALSAVDSKTEKQILEN
FT                   LLELRQDKALIIIAQRLSVIQEADEIIVLKDGKIIERGDHNKLMRLRGFYAELFEQQKI
FT                   ESELEREEDELLS"
FT   gene            complement(511893..515030)
FT                   /locus_tag="DICTH_0511"
FT   CDS_pept        complement(511893..515030)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0511"
FT                   /product="glycoside hydrolase, family 57"
FT                   /note="identified by match to protein family HMM PF03065"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19496"
FT                   /db_xref="GOA:B5YCY5"
FT                   /db_xref="InterPro:IPR004300"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="InterPro:IPR019248"
FT                   /db_xref="UniProtKB/TrEMBL:B5YCY5"
FT                   /protein_id="ACI19496.1"
FT                   /translation="MKSTKKILIFSLLFLIISLISLSFSQDIPINVYNPKVQKVAKPLY
FT                   LAIIWHNHQPLYYDPEQNLNILPWVRMHAIKDYYDMAYILKNYPQVKANFNMVPSLLYQ
FT                   LELYTKKGIKDKYLLLTEKPADQLTLEDKEFILRRFFDVNWDRIIKRFPRYWELLNKRG
FT                   QSIDDTIIAKAIQTFTTQDFRDLQVWFNLAWFDPDFQKYDKDLSRLIEKGRDFTEEDKK
FT                   IVINKQYEIMSKIIPLYAELQKNKQIEVTTTPFFHPILPLLVDIKSAKIAVQDIALPNA
FT                   TINYADDASSQLSMAVNYYKKFFKSNPKGLWPSEGSVSQDIIPIVSSAGFMWMASDEDV
FT                   LAKSLNTPIIRDSRGNVVNTDILYQPYVVEEQGKKVYMVFRDKNLSDKIGFVYSGMKGE
FT                   NAAKDFVNRLESIYEKVKDDNKPYLVTVILDGENCWEYYENDGKEFLHTLYKLLTDSPY
FT                   IETVRLTDYLNKFPPIKKIEKLHAGSWLDGTFLTWVGEQEENKAWELLDKARTELIYET
FT                   LKQRKTISPVLNPDSLRNNIEKAWFELYAAEGSDWFWWYGDDQDSTNDLAFDELFRKHL
FT                   INVYKLIGKDIPQELFLPIVKIGEEKPLQNIQAKFTPNIDGLINPEDEWKNAAIYLAKK
FT                   GTGLSVKPADFIEKLYLGLDNDNVYFLVESKTNFKDYFGKPYYLAIYFSNPNQKEYNLY
FT                   PRNGNKTLGYGIAYEVLIDFSKINSTGELEAILNQALGNNSWKQQSTLKAGISEKYVEI
FT                   GVPFKELKVQGRDRIAINVVFGKEEPEDVVPYYAPIYLTVPEKKLDITYFSIDDPTGDD
FT                   YGWGKVVYPTAPVFKPGVFDIIHVEMGKSKDDIVFKVKIRGDLENPWGSPTGVSVQTID
FT                   IYINDGKEGPYYYQALPGRQANIPEGWNKAIWAEGWIQELVVPALDEKGEVQLKEIKGV
FT                   VQLTADPIERTITISVPEKYLGPVTPDWKILVILCGQEGYPRPGSWRVREVEEEAKQWR
FT                   FGGGDDFYGDPNIIDMIVPPGTKQEDILSKWVSSEDEEENVYVELPLIPLRILMNQ"
FT   gene            complement(515043..515915)
FT                   /locus_tag="DICTH_0512"
FT   CDS_pept        complement(515043..515915)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0512"
FT                   /product="pullulanase"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18384"
FT                   /db_xref="InterPro:IPR019248"
FT                   /db_xref="UniProtKB/TrEMBL:B5YCY6"
FT                   /protein_id="ACI18384.1"
FT                   /translation="MISKKLKGGENSPPLKRFKEGYKMKKLLILISLILLSTIVFAEPV
FT                   KYPLIFNDPVNDDKGPGTYTYPTDPVFKSGTFDMTKVVIDADNDNVYFKISFRVPIENP
FT                   WGSPLGISLQTIHIYIDKDHKKDSGFRDFIPGVRAQTTPESAWDLAILVEGWPTELKSS
FT                   VKNAAPEMYKYCVFPSKGVTVDGNTITIPVPKKTLGDNFQKGWGFQVFIMGQEGFPTQD
FT                   PVSCRIREVLSTAQQWRFSGGDDFYGDPNIIDLLDYEDINQFEILSKYKSDAKFEKNVY
FT                   AQVPFIYVK"
FT   gene            complement(515905..517311)
FT                   /locus_tag="DICTH_0513"
FT   CDS_pept        complement(515905..517311)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0513"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19300"
FT                   /db_xref="UniProtKB/TrEMBL:B5YCY7"
FT                   /protein_id="ACI19300.1"
FT                   /translation="MKKVLLLSLILIFIVSFAYAQGVTFYGYSEIGVHSEFLKDSNGNY
FT                   SNTLGPVNLDYWNTYFRVKAEPSSFLESYFELHLYPNYSDLFGPGIVEVQKAHLTVKSS
FT                   LLNLRVYYKENATPFDDPLLLNKPGDLPGSSWIWGNGIEVSGKVFDTNFLAGINSSDQI
FT                   SYLRLKRAFQNLTLGFTAMGANWGVANQGKSLFGVDVTGKLANVDVKAEGIYGKGSFDT
FT                   GSEGGMVLYGDFSTQLTPVVKIYGTAKKVDGGYINQFNWFKTDQTQLIPGESGSYGTYF
FT                   KLGSVITPLSNLSFEPIVELINRENINQKTTNLKGIVTYVVNKNLTVKGTVANSTVDSN
FT                   SSTNITLETTFVPLQNLSIYGKLYQPIGGNTEIYGNLSTTFDKLNVYLAGNYSASKSYL
FT                   YLNALYNLAKNVNLRAISQLLKDSSTTHNTYYLALELNNASLYFGNAPSEEGSVTDFVK
FT                   QIGAKISFDF"
FT   gene            complement(517512..517958)
FT                   /locus_tag="DICTH_0514"
FT   CDS_pept        complement(517512..517958)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0514"
FT                   /product="beta and gamma crystallin"
FT                   /note="identified by match to protein family HMM PF06114"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ACI20139"
FT                   /db_xref="InterPro:IPR010359"
FT                   /db_xref="UniProtKB/TrEMBL:B5YCY8"
FT                   /protein_id="ACI20139.1"
FT                   /translation="MYEELIKDLLSLFYIKKPPIKPEIIAYGLGVEVHFQELPSQISGI
FT                   LYNHNDHPMILINKRDNPLRQRFTIAHELGHFLLHHSNKQIYFDYPISKNPKLEKEANT
FT                   FAASLLLPDFFLKRYLNLPYQKISSIFQVSQKVIEIRLKDFKTI"
FT   gene            complement(517939..518256)
FT                   /locus_tag="DICTH_0515"
FT   CDS_pept        complement(517939..518256)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0515"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="identified by match to protein family HMM PF01381"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18979"
FT                   /db_xref="GOA:B5YCY9"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:B5YCY9"
FT                   /protein_id="ACI18979.1"
FT                   /translation="MNVGKRIRETRKKHNMKLEDLAEKTGLSLSYISLIERGLKNPSLK
FT                   ALERIAKAFNLPTSYFFSEDNDETIETFLRTKTSLDEDERRMIIQLIKSLESKKGVRRT
FT                   D"
FT   gene            complement(518335..519345)
FT                   /locus_tag="DICTH_0516"
FT   CDS_pept        complement(518335..519345)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0516"
FT                   /product="endoglucanase M"
FT                   /EC_number="3.2.1.4"
FT                   /note="identified by match to protein family HMM PF05343"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ACI20086"
FT                   /db_xref="GOA:B5YCZ0"
FT                   /db_xref="InterPro:IPR008007"
FT                   /db_xref="InterPro:IPR023367"
FT                   /db_xref="UniProtKB/TrEMBL:B5YCZ0"
FT                   /protein_id="ACI20086.1"
FT                   /translation="MKELIKKLTEIKSPSGREDNIRNAILEELKGYIDGYEIDKLGNLI
FT                   VWKKGKKDGKILLDAHMDEIGVLATYIDEKGFIRIEPIGGVSPYNLLGSSIAFPQAEGF
FT                   VGVEGETLEELSKNIKNLDFDKIFVDIGAKSREEAEKLVPPGTFGVYSANFKDLGERLV
FT                   SKAMDDRIGCAIIIEVFKRSNPYYTLYGTFSIQEEIGLVGASVVAFDIKPDLAIAIDVT
FT                   AHSDTPKGPKRMSLELGKGPAIKIKDSASISDRRIVEKLKNIAEKNGIPYQIEILLRGG
FT                   TNAAALQRTGEGIPAGTLSIPTRYVHSPHEMIDINDVENAIRILKILVESDESLL"
FT   gene            complement(519347..520351)
FT                   /locus_tag="DICTH_0517"
FT   CDS_pept        complement(519347..520351)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0517"
FT                   /product="endoglucanase M"
FT                   /EC_number="3.2.1.4"
FT                   /note="identified by match to protein family HMM PF02127;
FT                   match to protein family HMM PF05343"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18989"
FT                   /db_xref="GOA:B5YCZ1"
FT                   /db_xref="InterPro:IPR008007"
FT                   /db_xref="InterPro:IPR023367"
FT                   /db_xref="UniProtKB/TrEMBL:B5YCZ1"
FT                   /protein_id="ACI18989.1"
FT                   /translation="MKLFLKELSDIPGVSGFEGKVREFIKEKIKDKVDQIEVDKLGNLI
FT                   AFKKGKVNKKLMISAHMDEVGFIVSNIEEDGKLSILPLGSIDPRVVLGKKVVIGEKQIL
FT                   GVIGSKPIHLMEGYEKVSFENIKVDIGATKKQEAEAKVKIGDFVSFAPNAMIHGEWISG
FT                   KALDDRGGCSLLIDLILKDLDLYYDTFFAFVIQEETGLRGSGPCAFKIKPDLAIVVETT
FT                   TSGDNPEFPEARRSSELGKGPVITPAHRGYVNDERLFNFAVKVAEENKIPYQIKRRTAG
FT                   GTDAARIAITTGTPSLVISIPSRYIHSPICVLNINDYRNTFKLLSLILTKEVL"
FT   gene            complement(520348..521358)
FT                   /locus_tag="DICTH_0518"
FT   CDS_pept        complement(520348..521358)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0518"
FT                   /product="endoglucanase"
FT                   /note="identified by match to protein family HMM PF01546;
FT                   match to protein family HMM PF02127; match to protein
FT                   family HMM PF05343"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19687"
FT                   /db_xref="GOA:B5YCZ2"
FT                   /db_xref="InterPro:IPR008007"
FT                   /db_xref="InterPro:IPR023367"
FT                   /db_xref="UniProtKB/TrEMBL:B5YCZ2"
FT                   /protein_id="ACI19687.1"
FT                   /translation="MVEIKEVLKNLSNLDGPSGYEQLVLEYIENVAKKIADVETNIDKH
FT                   GNLIVRRPGKGKRIALFAHTDEIAFVITKKEFGNYFRIHTFGGVDPKVVISQRLRIHTK
FT                   EGISYGVVGMLEPHLQTEEIRQKNITFDDLFIDIVEKADKVQIGDLATFDSEAFELNEK
FT                   YIAGKALDNRASCTALLYTLELLNQFIVSGDIYFVFSVREEDGVSGAINASYQINPELA
FT                   IVLDVTHGDIQRPSYPKIETGKGPVLDIGPMIDYDYFNKIKNLAEKLSVNYQIEPNGNH
FT                   SSTDTDSIQIAREGISTLLISIPLRYMHTPYEVVNIRDIEETARLLSFFLARGGE"
FT   gene            521445..522077
FT                   /gene="nth"
FT                   /locus_tag="DICTH_0519"
FT   CDS_pept        521445..522077
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nth"
FT                   /locus_tag="DICTH_0519"
FT                   /product="endonuclease III"
FT                   /EC_number="4.2.99.18"
FT                   /note="identified by match to protein family HMM PF00633;
FT                   match to protein family HMM PF00730; match to protein
FT                   family HMM TIGR01083"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19108"
FT                   /db_xref="GOA:B5YCZ3"
FT                   /db_xref="InterPro:IPR000445"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR003651"
FT                   /db_xref="InterPro:IPR004035"
FT                   /db_xref="InterPro:IPR004036"
FT                   /db_xref="InterPro:IPR005759"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="InterPro:IPR023170"
FT                   /db_xref="UniProtKB/TrEMBL:B5YCZ3"
FT                   /protein_id="ACI19108.1"
FT                   /translation="MDKKEFVIEVLKRLRTLYEPKIALNFSNPWELLVATILSAQTTDE
FT                   RVNMVTEKLFKKYKTPEDYLKVPLEELEQDIKSINYYRTKAKNIRACAQIILEKYGGKV
FT                   PDTMEELLKLPGVARKTANVVLSAGYGKNEGIVVDTHVDRLSKRFNLSKEKNRDKLEQD
FT                   LMKIVPREEWANFSYLLIHHGRNVCKAKNPKCDECILNDICPSAFIK"
FT   gene            complement(522111..523241)
FT                   /locus_tag="DICTH_0520"
FT   CDS_pept        complement(522111..523241)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0520"
FT                   /product="oxidoreductase, aldo/keto reductase family"
FT                   /note="identified by match to protein family HMM PF00037;
FT                   match to protein family HMM PF00248"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19395"
FT                   /db_xref="GOA:B5YCZ4"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:B5YCZ4"
FT                   /protein_id="ACI19395.1"
FT                   /translation="MKYRKMGKLDVTVSVLGFGAMRLPTLGTESQIDEPKAIEMIRYAI
FT                   DHGVNYVDTAYGYHGGQSEIVVGKALKDGYRDKTYLATKLPVWLVNKKEDMDRLLNEQL
FT                   KKLDTDHIDFYLLHALNKDSWQKIYNLGAIEWGEKMKEKGLIRYFGFSFHDDLETFKKI
FT                   IDAHDWDFCQIQYNYMDIDYQAGREGLEYAGKKGIGVVVMEPLRGGRLARPPKDVMELI
FT                   EKYPIKRSPVEWALLWVWNHKEVSLALSGMSTLEQVKENLEIADKAEVNILSKEDLELI
FT                   EKLRLAFLGRKAIDCTQCRYCMPCPYGVDIPRNFYIYNEGIRYDDWGAPRWEYNYAMKP
FT                   EERAENCKKCGECETKCPQGLAIRDLLEMVHNTLSR"
FT   gene            523394..524407
FT                   /locus_tag="DICTH_0521"
FT   CDS_pept        523394..524407
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0521"
FT                   /product="zinc-containing alcohol dehydrogenase
FT                   superfamily"
FT                   /note="identified by match to protein family HMM PF00107;
FT                   match to protein family HMM PF08240"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18661"
FT                   /db_xref="GOA:B5YCZ5"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B5YCZ5"
FT                   /protein_id="ACI18661.1"
FT                   /translation="MIAAVWRGGKISLEELPNPVIKKEDEVIIKVLASGICGTDLHVFS
FT                   GKAYGKDGVIRGHEFSGRVVEIGKDVKGIKVGDLVAVDPNITCGHCYFCKRGEINLCEN
FT                   LVALGVDINGGFAEYCVVPYKQLYVFSEKISPIEGAMMEPVACALHGIERLNVGPGDTV
FT                   LIVGGGALGLVLLQLAKLSGASKVFLVEKVEWKRKIAKDLGADIVIDPLKENVEEIVKE
FT                   NTYGRGADVGIEAVGKTETVKTVLGSVRRGGKVLIFGVSSPEDLLSISPYDIYFRELTI
FT                   MGSFVNPFTNSRALSLIEEGKIDVKKIVSHRFSIEKIDEAIKVGLSGDALRVIINF"
FT   gene            524423..524839
FT                   /locus_tag="DICTH_0522"
FT   CDS_pept        524423..524839
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0522"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19856"
FT                   /db_xref="GOA:B5YCZ6"
FT                   /db_xref="UniProtKB/TrEMBL:B5YCZ6"
FT                   /protein_id="ACI19856.1"
FT                   /translation="MVFDIICAITVLGLALKGIKEVFFNRLALIVALIIAFTFSSVLMP
FT                   IYVKYVRLPINLSSNISSFVLTFVLAYLLLTLPGFFLKVAVGGFVLIIIYGVILNFIPM
FT                   GYQKMIVENSYIYSLIKPIIGFILMLFRFLKIVR"
FT   gene            524836..525702
FT                   /locus_tag="DICTH_0524"
FT   CDS_pept        524836..525702
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0524"
FT                   /product="Ser/Thr protein phosphatase family protein"
FT                   /note="identified by match to protein family HMM PF00149"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18716"
FT                   /db_xref="GOA:B5YCZ7"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:B5YCZ7"
FT                   /protein_id="ACI18716.1"
FT                   /translation="MRIFAVSDLHLDYLRIKKGLKVSEERELLKTLLNVVLDKNIDIFI
FT                   FAGDISAKIWEVELFLEVFSSFSGVKVFVPGNHDIWKEGEITSDQKYYKILPKLCKEYG
FT                   FAYLPFEPIKLNDLVIVGTMGWYDYSFGDSYYDKSDFDRGEYGGIKWREVYWGLARFCN
FT                   NGKILSNEEVYNLIYDEFKHHLLKIEKGKDKIVVSHFIPFEEILFIKNFFSAYLGSKKF
FT                   GEIILEHGINKVICGHEHRSGIFSVNGITIYKPTVGYAESTESLLSRYDQNSILIELSD
FT                   NHRFCVI"
FT   gene            complement(525673..526836)
FT                   /locus_tag="DICTH_0523"
FT   CDS_pept        complement(525673..526836)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0523"
FT                   /product="transcriptional repressor of the xylose operon,
FT                   putative"
FT                   /note="identified by match to protein family HMM PF00325;
FT                   match to protein family HMM PF00480; match to protein
FT                   family HMM PF01022; match to protein family HMM PF08279"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18730"
FT                   /db_xref="GOA:B5YCZ8"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR012318"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B5YCZ8"
FT                   /protein_id="ACI18730.1"
FT                   /translation="MKIGRPQLIDEVNKGQILKLLREEGPISRAEIARRLGLSRPTVST
FT                   HIKDLLKEGLVIEVGKGKSSKGRKGILLKYNARHGYFLAGDIEGSIMRFALSDLCGEIL
FT                   YEKVLSLNELRQKNMMKPENFINIMKEFLKENNVEEKNLKIIALGIAGIIEEGKLIFAP
FT                   NLPEWNHAPLQNLVKEGFPGTQVILENDVNMGVMGEMWKGAGKGLKNIVYLNLSTGVGA
FT                   GIVIDGKLYEGSNKFAGEVAYMVVDNHHENFPGVEYTPLGALEWVVSGARIIEKAKSFD
FT                   SKYTLLERIFDDYDKVDEIKVLIDKVGEYLGKAIVNIVSVIDPEVIIVGGIVGKFLNIL
FT                   MRKIKPTIEYYLPIPVKIIPSALYPKTVVYGAIYKALELYHTKPVIV"
FT   gene            527031..528068
FT                   /gene="trmU"
FT                   /locus_tag="DICTH_0525"
FT   CDS_pept        527031..528068
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trmU"
FT                   /locus_tag="DICTH_0525"
FT                   /product="tRNA
FT                   (5-methylaminomethyl-2-thiouridylate)-methyltransferase"
FT                   /EC_number="2.1.1.61"
FT                   /note="identified by match to protein family HMM PF03054;
FT                   match to protein family HMM PF06508; match to protein
FT                   family HMM TIGR00420"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19478"
FT                   /db_xref="GOA:B5YCZ9"
FT                   /db_xref="InterPro:IPR004506"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR023382"
FT                   /db_xref="UniProtKB/TrEMBL:B5YCZ9"
FT                   /protein_id="ACI19478.1"
FT                   /translation="MPIKVAVGMSGGVDSSTTAYLLKKEGYEVIGLTMNIAYSDSIKDA
FT                   EKIAKYLNIPHFYVDLRKEFEEQIIKYFIDSYKSGYTPNPCTFCNRIIKFGLLLKKAQE
FT                   LGAEYLATGHYVRKVWDEEKKVFLLKRAKDLKKDQSYFLAYLTQEQIEKSLFPLGDLTK
FT                   NEVRKLAEEIGLFVSDKEESQDICFLPDRDYRKFLSRYLVEKKGKIITEDGVEVGYHDG
FT                   VFSFTIGQRRGLRVALGKPVYVKKIIPEEGIVVVADREKIFSREVYAKNVNYPSGMPRE
FT                   KELEVKAMIRYNMEPQPALLKILSEKEIYLTFEEPQWAITPGQILVCYKDDYVLCGGVI
FT                   EEKEN"
FT   gene            528101..528232
FT                   /locus_tag="DICTH_0526"
FT   CDS_pept        528101..528232
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0526"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18483"
FT                   /db_xref="UniProtKB/TrEMBL:B5YD00"
FT                   /protein_id="ACI18483.1"
FT                   /translation="MTLFLFIILLRNFRGGDTLEKEKFFNFFPFFSLLFFSSYYKQL"
FT   gene            528404..528766
FT                   /locus_tag="DICTH_0527"
FT   CDS_pept        528404..528766
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0527"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19204"
FT                   /db_xref="UniProtKB/TrEMBL:B5YD01"
FT                   /protein_id="ACI19204.1"
FT                   /translation="MLREYYKKYMEPAKDYIENTSKLYEERLFVAAQIYGDRIDFAKDY
FT                   HCVIKIGEKIVQPIENESLKKDVAELTDKWPYSPAYKATNLYVFPTSEILRDAKVEIIL
FT                   IGDEEYIFKADLSKLK"
FT   gene            529105..529593
FT                   /locus_tag="DICTH_0528"
FT   CDS_pept        529105..529593
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0528"
FT                   /product="acetyltransferase, gnat family"
FT                   /note="identified by match to protein family HMM PF00583"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19438"
FT                   /db_xref="GOA:B5YD02"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:B5YD02"
FT                   /protein_id="ACI19438.1"
FT                   /translation="MYYKKLIGKRCYLSPIDIEDCQKYTRWVNDMEVVIGLTIASNLYT
FT                   EQKEREVLERLSKSDYNFAIVDLEREELIGNIGFVNLDLINKVGELGIFIGNKDYWGKG
FT                   YGMEAIQLLLDFGFNMLNLHNVYLRVFSFNKPAINCYKKIGFKEVGRIREAKQIAGEI"
FT   gene            530283..531728
FT                   /gene="trpE"
FT                   /locus_tag="DICTH_0529"
FT   CDS_pept        530283..531728
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trpE"
FT                   /locus_tag="DICTH_0529"
FT                   /product="anthranilate synthase component I"
FT                   /EC_number="4.1.3.27"
FT                   /note="identified by match to protein family HMM PF00425;
FT                   match to protein family HMM PF04715; match to protein
FT                   family HMM TIGR00564"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18352"
FT                   /db_xref="GOA:B5YD03"
FT                   /db_xref="InterPro:IPR005256"
FT                   /db_xref="InterPro:IPR005801"
FT                   /db_xref="InterPro:IPR006805"
FT                   /db_xref="InterPro:IPR015890"
FT                   /db_xref="InterPro:IPR019999"
FT                   /db_xref="UniProtKB/TrEMBL:B5YD03"
FT                   /protein_id="ACI18352.1"
FT                   /translation="MGFLKFFSREVVPIVEKVLSTKTYVPIIYDFPGDFETPSSLLFKV
FT                   KDEDFLFLLESAEGGERIGRYSFISWKPKEVLTFENNVDFDILTYLSRRFPVINVKDGK
FT                   NLPRFVGGLVGYFGYDLVRQWEKLPDLTYDPIGFPLAEFQLVDFLVVFDHLKRRISVIF
FT                   LIPEEEREDPEIKERIEEKLSEIKNVFKKPVDNIYKANDIANTRIENLTSQEEYEENVR
FT                   KAIEYIKAGEIFQVVYSQRFYTRYEADPYLLYRALRFVNPSPYMFFLKFKDRYLIGSSP
FT                   EALVKVEAGKAEIRPIAGTRRRGKDEEEDMALEKELLGDEKERAEHTMLLDLARNDLGR
FT                   VAKIGTVKCEDLMHVERYSHVMHLVSTVTCEVREDIHPFEVLRASFPAGTVSGAPKVRA
FT                   MEIIEELEKYRRGPYAGGVGYFSFNGNLDTCITIRTYFLKGQDLFIQTGAGIVYDSIPE
FT                   REYKECINKAKALFEAIKIVGDI"
FT   gene            531730..532308
FT                   /locus_tag="DICTH_0530"
FT   CDS_pept        531730..532308
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0530"
FT                   /product="anthranilate synthase component II"
FT                   /EC_number="4.1.3.27"
FT                   /EC_number="2.4.2.18"
FT                   /note="identified by match to protein family HMM PF00117;
FT                   match to protein family HMM TIGR00566"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19590"
FT                   /db_xref="GOA:B5YD04"
FT                   /db_xref="InterPro:IPR006221"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:B5YD04"
FT                   /protein_id="ACI19590.1"
FT                   /translation="MVLLIDNYDSFTYNLFQYVAEFCEVKVYRNDKITVEDIYKLKPQA
FT                   IIISPGPSIPENAGISIPVVKEFKDKLPILGICLGHQAIASAFGTKIIRAPIPVHGKVS
FT                   YIYYSQNPIFEGVENPFEATRYHSLVVDVESLNPSLKVIAWTQDKLIMGIQYEDKPVYG
FT                   LQFHPESIFTTSGKRIIKNFLKLGGVISG"
FT   gene            532301..533311
FT                   /gene="trpD"
FT                   /locus_tag="DICTH_0531"
FT   CDS_pept        532301..533311
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trpD"
FT                   /locus_tag="DICTH_0531"
FT                   /product="anthranilate phosphoribosyltransferase"
FT                   /EC_number="2.4.2.18"
FT                   /note="identified by match to protein family HMM PF00591;
FT                   match to protein family HMM PF02885; match to protein
FT                   family HMM TIGR01245"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18525"
FT                   /db_xref="GOA:B5YD05"
FT                   /db_xref="InterPro:IPR000312"
FT                   /db_xref="InterPro:IPR005940"
FT                   /db_xref="InterPro:IPR017459"
FT                   /db_xref="InterPro:IPR035902"
FT                   /db_xref="InterPro:IPR036320"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5YD05"
FT                   /protein_id="ACI18525.1"
FT                   /translation="MVKEYLKKISEGKHLTFDEAKEIVLSIDREEITEAQLGAVLLGLR
FT                   LKGENPEEIAGFVDVLHEKAKKIPNRTPAVDVCGTGGDKSNTFNISTAVAFTLASLGVR
FT                   VAKHGNRAMSSKAGSIDVIEALGFKCSDNPEEIARDIDEKGIGIIFAPYFHPVVGKAVK
FT                   VRRELGIGTIFNMAGPMLNPANLSGQILGVYSEKVMRNMAEASLILKKDNILFYHGKDD
FT                   GIDEISLSGKTIFAYLKNGKIDYFDFSPEDIGIKRYQKEEFKGGDAQENAKILEDIFKG
FT                   VAKESHIDIVAVNSAFALWVLGKVKSVKEGFDMVKEHIMKGKVYEFVETLRGRTA"
FT   gene            533308..534084
FT                   /gene="trpC"
FT                   /locus_tag="DICTH_0532"
FT   CDS_pept        533308..534084
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trpC"
FT                   /locus_tag="DICTH_0532"
FT                   /product="indole-3-glycerol phosphate synthase"
FT                   /EC_number="4.1.1.48"
FT                   /note="identified by match to protein family HMM PF00218"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19995"
FT                   /db_xref="GOA:B5YD06"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR013798"
FT                   /db_xref="UniProtKB/TrEMBL:B5YD06"
FT                   /protein_id="ACI19995.1"
FT                   /translation="MNILDKLVEEKRKVVFNKIYKIPTTFPEKEKDYFFKILNQNRFNI
FT                   IGEVKPASPIKGKLLSLPISEMAKIYDDAKEISAISVLTAESFSASMNNLSLVRKITKK
FT                   PILQKDFVIIPEQIYEGRILGADAVLLIARVLSEGDLKALYNLCLKLDVEPIIEVYDEK
FT                   DLEKVLNLRPRIIMINNRDLTTFKVDINNTLKLLPYIPSDILVISASGIKDKEEVRILY
FT                   ESGVRAILVGESIVTSQNPKKKIEELFEVCGLKSVE"
FT   gene            534060..534695
FT                   /gene="trpF"
FT                   /locus_tag="DICTH_0533"
FT   CDS_pept        534060..534695
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trpF"
FT                   /locus_tag="DICTH_0533"
FT                   /product="N-(5'phosphoribosyl)anthranilate isomerase"
FT                   /EC_number="5.3.1.24"
FT                   /note="identified by match to protein family HMM PF00697"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18876"
FT                   /db_xref="GOA:B5YD07"
FT                   /db_xref="InterPro:IPR001240"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:B5YD07"
FT                   /protein_id="ACI18876.1"
FT                   /translation="MWVKICGITDIISALHCEMEKVDAIGLVFVPWSPRFISRDKLTRM
FT                   APHLKRLNIMRIGVFADNSEEEIRSILEILPLDGIQFHGNEDVSFLKKFSKYFLIRALN
FT                   VDESDNLEAQIKKFSKIAYILLDKSKSSNISFDEFIEKAGKYIDNKTIIAGGINESNVE
FT                   KVLELKPFGLDLSSGVEIEKGKKDLVKISNFMRKVREYEKNRAEKSSR"
FT   gene            534661..535863
FT                   /gene="trpB"
FT                   /locus_tag="DICTH_0534"
FT   CDS_pept        534661..535863
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trpB"
FT                   /locus_tag="DICTH_0534"
FT                   /product="tryptophan synthase, beta subunit"
FT                   /EC_number="4.2.1.20"
FT                   /note="identified by match to protein family HMM PF00291;
FT                   match to protein family HMM TIGR00263"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18280"
FT                   /db_xref="GOA:B5YD08"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR006653"
FT                   /db_xref="InterPro:IPR006654"
FT                   /db_xref="InterPro:IPR023026"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:B5YD08"
FT                   /protein_id="ACI18280.1"
FT                   /translation="MRKIELKNLPDERGYFGEFGGRFVPETLMEPLLQLEEAYNKYKND
FT                   ERFKQELDYYLKTYVGRPTPLYFARNLSEKLKAKIYLKREDLCHTGAHKINNAIGQALL
FT                   AKYMEKKRLIAETGAGQHGVATATVAALFGFKCTVYMGEEDCERQKINVLRMKLLGAEV
FT                   IPVKVGSKTLKEAINEALRDWVAHPEDSYYLLGSVVGPHPYPVIVRDFQKIIGEEVKKQ
FT                   ILELENRLPDYLVASVGGGSNSIGLFYPFLEDDVKIIGVEGGGKGLESGLHSASINFGR
FT                   VGVLHGAKMYLIQDENGNVSPTHSISAGLDYPGVGPEHSFLAKIGRVKYDIATDDVALK
FT                   GFLALSELEGIIPALESAHAIGYVIEHRDEFPEKEPIIVINLSGRGDKDLEIISKYVGE
FT                   K"
FT   gene            535863..536624
FT                   /gene="trpA"
FT                   /locus_tag="DICTH_0535"
FT   CDS_pept        535863..536624
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trpA"
FT                   /locus_tag="DICTH_0535"
FT                   /product="tryptophan synthase, alpha subunit"
FT                   /EC_number="4.2.1.20"
FT                   /note="identified by match to protein family HMM PF00290;
FT                   match to protein family HMM TIGR00262"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19187"
FT                   /db_xref="GOA:B5YD09"
FT                   /db_xref="InterPro:IPR002028"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018204"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5YD09"
FT                   /protein_id="ACI19187.1"
FT                   /translation="MANLLEKFKNRDKSLLFVPFFVSGFPDFDFLEKFLFKNKDKIDIL
FT                   ELGVPFSDPVADGPILQEINYRAMVKGVNLNNTLDWLLDSGITKKIDVILLLYFNLIQN
FT                   KLEEKLKRFKEVGIKGLVIPDLPLEEAEKLIPLFNEHNLDLILFISPTTREERIRKILD
FT                   IAPSFLYCISVKGVTGERDRLPEEGVAFISRVKKETNKPLVWGFGLGSSYQINSLKGLV
FT                   DGVIVGSAIGKRLLNNEDIQDYFDELYKATL"
FT   gene            536652..537878
FT                   /locus_tag="DICTH_0537"
FT   CDS_pept        536652..537878
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0537"
FT                   /product="alcohol dehydrogenase, zinc-dependent"
FT                   /note="identified by match to protein family HMM PF00107;
FT                   match to protein family HMM PF08240"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19721"
FT                   /db_xref="GOA:B5YD10"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B5YD10"
FT                   /protein_id="ACI19721.1"
FT                   /translation="MKAVWFEESIPRYLISKALGRVHHSFYYNVFSCIRYGDYPEPKLP
FT                   SGKWVKIKTLMGGICGSDIGLIKLHDSPSTSPFASFPFVIGHENLGIIVEKGDEVEGFE
FT                   VGDRVIADPTLSCNAREIYPPCEKCQNFEFSQCMNFNEGIVSPALMIGSCRDTGGSWGE
FT                   YYVANEFQLFKVPDKVTNENAILVDAFCSALHPVMRNFPKDNDTVLVLGAGSIGINVVS
FT                   ALRALGSKARIIVLARYKFQGEFAKHYGADEILYTKGLSKWDLYKKVAELTSGKVLKPL
FT                   LGKPVMVGGADVVFECVGNDDSIDDALRFTKQGGTTVLVGLAGITKKVDWTFVWFKELR
FT                   VAGTNSSSGEIFRGERKRGYGIALQLMEEGLDLSPLLTHTFKLEDYKKAIEMNFFRGRY
FT                   GLVKSAFVF"
FT   gene            complement(537875..538528)
FT                   /locus_tag="DICTH_0536"
FT   CDS_pept        complement(537875..538528)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0536"
FT                   /product="methenyltetrahydrofolate cyclohydrolase"
FT                   /EC_number="3.5.4.9"
FT                   /note="identified by match to protein family HMM PF04961"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18789"
FT                   /db_xref="GOA:B5YD11"
FT                   /db_xref="InterPro:IPR007044"
FT                   /db_xref="InterPro:IPR036178"
FT                   /db_xref="UniProtKB/TrEMBL:B5YD11"
FT                   /protein_id="ACI18789.1"
FT                   /translation="MESSDKIKLIDRAITEFVELLASQEPAPGGGAASSLVGAIGVALS
FT                   SMVANLTIGKEKFKDKEELMLELIKENNKIQKELLELIEKDAEAFFKVAKALKMPKNTE
FT                   EEKNRRKEALENALKEATLVPLEIMRKSIKALRLLEKSLGNSNPNAVSDIGVGAVCLKA
FT                   ALQGAWLNVKINLVSIRDKDFVKNTQKEALSLLEEGTLLSDKIYEEVESILQIT"
FT   gene            complement(538515..539705)
FT                   /locus_tag="DICTH_0538"
FT   CDS_pept        complement(538515..539705)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0538"
FT                   /product="2-amino-3-ketobutyrate coenzyme A ligase"
FT                   /EC_number="2.3.1.29"
FT                   /note="identified by match to protein family HMM PF00155;
FT                   match to protein family HMM PF00202"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ACI20088"
FT                   /db_xref="GOA:B5YD12"
FT                   /db_xref="InterPro:IPR001917"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:B5YD12"
FT                   /protein_id="ACI20088.1"
FT                   /translation="MDLFDKIKKAEYLQEARIAIDQGIYPFFLPLEETEGTEVIINGRR
FT                   LIMLGSNNYLGLTTHPKVKEAAIKAIKEYGTSCTGSRFMNGTLKLHKELEEKLAEFLHK
FT                   EAALVFSTGYQTNLGTISALIGKGDIAITDKEDHASIIDGCRLSQGEMRRFKHNDMEDL
FT                   EKVLASCPDNAGKLVIVDGVFSMAGDIAPLPEIVKLCEKYGARLMVDDAHSIGVLGDHG
FT                   RGTANHFGLEDKVDIIMGTFSKSFASLGGFIAGDEEVIFYIQHTARSFIFSASMSPANT
FT                   AAALAALEVMQEEPERIDHLWKIANRMREGLKSLGFDIGNSCTPIIPIYIRDRWKTIYM
FT                   WKELFDLGVYCNPVLPPGVPPNQSLLRTSYMATHTEEQIDRALEIFEKAGKKVGII"
FT   gene            539911..540867
FT                   /locus_tag="DICTH_0539"
FT   CDS_pept        539911..540867
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0539"
FT                   /product="L-lactate dehydrogenase"
FT                   /EC_number="1.1.1.27"
FT                   /note="identified by match to protein family HMM PF00056;
FT                   match to protein family HMM PF02866; match to protein
FT                   family HMM TIGR01771"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18259"
FT                   /db_xref="GOA:B5YD13"
FT                   /db_xref="InterPro:IPR001236"
FT                   /db_xref="InterPro:IPR001557"
FT                   /db_xref="InterPro:IPR011304"
FT                   /db_xref="InterPro:IPR015955"
FT                   /db_xref="InterPro:IPR018177"
FT                   /db_xref="InterPro:IPR022383"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B5YD13"
FT                   /protein_id="ACI18259.1"
FT                   /translation="MKKILIVGAGAVGTSFAYSLIHKGLVEEIVLYDIDEKKAKGEALD
FT                   LAHGIYFTKPVEVRAGGLEEAKDSDIVVITAGAKQRPGETRLQLLDRNISIYKDLVPEI
FT                   VKNGFKGIFLIVTNPVDVLTYFAYTFSGFPRNRVIGSGTVLDSSRFAYLLSKHCDVDPR
FT                   SVNAYVIGEHGDTAVLAWSLTHIGGISISEFCPVCGRRCFDEDVKKAIIKEVRDSAYKI
FT                   IEYKGATYYAIGLALVNIVEAIVRDENRILPVSTVHPQIFEFKDVPLSLPSIVGRNGVK
FT                   KVLRVKLTEEEEKELYNSAKFIKEAIDSFSSLSLSSR"
FT   gene            540997..541911
FT                   /locus_tag="DICTH_0540"
FT   CDS_pept        540997..541911
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0540"
FT                   /product="RecA-superfamily ATPases implicated in signal
FT                   transduction"
FT                   /note="identified by match to protein family HMM PF06745"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18729"
FT                   /db_xref="GOA:B5YD14"
FT                   /db_xref="InterPro:IPR010624"
FT                   /db_xref="InterPro:IPR014774"
FT                   /db_xref="InterPro:IPR022373"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B5YD14"
FT                   /protein_id="ACI18729.1"
FT                   /translation="MDKEERSYQQQPQYEVVEDAILSLKDIGDRAVEIRGVPTGIEGLD
FT                   NLFFTTKIEKGKTKVVPLGGIPQYSVFNLTGISDTGKSLMGEQFAIKQASLGNAVAFIT
FT                   VESPAHFVATSMKSRAAAMGVEENVIDENIVFIDAASYSKLREDVPTLLATLAHAIKKY
FT                   KIKYTVIDSITGLYEAKEMMARVIVRQLFNFMKKWYQTAIFISQKRSSQEEFSAEAAGG
FT                   FAISHIVDGTMVLSKVLISSQYMERMYKRPMGELVRLFRIDGCRMCGHSTDTYLLEIDK
FT                   NGLVRIGQSLKELSKGVKVDANT"
FT   gene            541898..542281
FT                   /locus_tag="DICTH_0541"
FT   CDS_pept        541898..542281
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0541"
FT                   /product="putative protein"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19860"
FT                   /db_xref="InterPro:IPR022285"
FT                   /db_xref="UniProtKB/TrEMBL:B5YD15"
FT                   /protein_id="ACI19860.1"
FT                   /translation="MPILSGDELPVKEDELDNLAMKTFLKTLDILGGPRKLILYRNLTW
FT                   VPSLIEACYAVILRDRYMKTEAEIAEFLGLTKQTVRNILKADPDVVLDILEDELKKKEI
FT                   KTHVAGGLAKLAYRKVKEEFGIE"
FT   gene            542288..543634
FT                   /gene="rumA"
FT                   /locus_tag="DICTH_0542"
FT   CDS_pept        542288..543634
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rumA"
FT                   /locus_tag="DICTH_0542"
FT                   /product="23S rRNA (uracil-5-)-methyltransferase RumA"
FT                   /EC_number="2.1.1.-"
FT                   /note="identified by match to protein family HMM PF01938;
FT                   match to protein family HMM PF02475; match to protein
FT                   family HMM PF05958; match to protein family HMM TIGR00479"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19531"
FT                   /db_xref="GOA:B5YD16"
FT                   /db_xref="InterPro:IPR002792"
FT                   /db_xref="InterPro:IPR010280"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR030390"
FT                   /db_xref="InterPro:IPR030391"
FT                   /db_xref="UniProtKB/TrEMBL:B5YD16"
FT                   /protein_id="ACI19531.1"
FT                   /translation="MVKVGEEYQVRIEKINSQGQGIAYINSFVVFVDYALPGEVVKIKI
FT                   HTAKKDYAVGRIVEFIEKDPRRCDPVCEVFYECGGCHLMHVNYEYQLELKKMMVEDAFK
FT                   RIGKIEKEVNPVIGMENPYRYRNKAKIPVGKRRGKIVLGFYKPNTHYIVDINKCIVHHE
FT                   DTDKVIETTKEAIKKFHIEVYNELQHTGLLRFVVVRRSFAFDDLMVILVSKGMIDNAKK
FT                   VARFYKYKLKNLKSFYVNINPKRTNEIFGEESRLILGDETIRDKIGDFVFEISPVSFFQ
FT                   INSIQTEKLYNKALEYLSPNSRLVFDAYCGIGTISLFLSKKAEKVYGIEVERTAIEDAW
FT                   KNARLNKVKNVEFIWGRSEEVIPRLIEDGKIPDAVVLDPPRKGCDQNLLESIIRAKIRQ
FT                   IIYISCYPSTLARDINILLNAGYNLVDVQPVDMFPQTFHVETIALLEKD"
FT   gene            543694..544638
FT                   /locus_tag="DICTH_0543"
FT   CDS_pept        543694..544638
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0543"
FT                   /product="methanol dehydrogenase regulatory protein"
FT                   /note="identified by match to protein family HMM PF07726;
FT                   match to protein family HMM PF07728"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18627"
FT                   /db_xref="GOA:B5YD17"
FT                   /db_xref="InterPro:IPR011703"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041628"
FT                   /db_xref="UniProtKB/TrEMBL:B5YD17"
FT                   /protein_id="ACI18627.1"
FT                   /translation="MDIDRYVDFKEKVVKNVSKAIVGKEKIIELIAISFICGGHVLLED
FT                   VPGLGKTLMVKAFAKTVGGSFKRIQFTPDLLPSDLTGINFYNQKKAEFEFRPGPLFANI
FT                   ILADEINRATPRTQSSLLEAMEEKQVTVDGVTWKLPDPFMVLATQNPVETYGTFPLPEA
FT                   ELDRFFMRIKVGYPTREEEIEIINRNKKRDILEDVESVISLDEVYYLRDNFSEVRISRE
FT                   VMDYLLDIVEYTRNSDSILLGVSPRGSIALFKASQVYALFNGRDYVIPEDIKYLAPFVL
FT                   NHRIISIGASRTKDIYENINIILENIKVPLEEV"
FT   gene            544639..545778
FT                   /locus_tag="DICTH_0544"
FT   CDS_pept        544639..545778
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0544"
FT                   /product="protein of unknown function"
FT                   /note="identified by match to protein family HMM PF01882"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18370"
FT                   /db_xref="InterPro:IPR002881"
FT                   /db_xref="UniProtKB/TrEMBL:B5YD18"
FT                   /protein_id="ACI18370.1"
FT                   /translation="MVYLLLFLILLGILLNELSKKYTLDRVYFNRSFSKRVAEIGEDIY
FT                   IEITVENRKIIPVTFLQVIQELPSIIEYKFQVNKIRTKDFLYHTMTFFLLPYQRIRRKY
FT                   LATCTKRGRYVFGNVEICGGDFLGLNLKTKSISLVQDLVVLPKRKDLEKDLIPYGNFNG
FT                   DVSVKRWIIEDPTMIIGVKEYTGREPAKTIHWPLSLKHHKILVKNFDFTYENNAMIFLN
FT                   VECSKPYWIKMDENSIEECISVARSIGEIFHDRKVPFGFTTNSLIYGFSRDENTVYPGM
FT                   GDTHLQLFLEYLGRLSYNVNVPFEEIIKAFMRNNNFMISTYVIITPYLLREYIPYISAL
FT                   DTDLTKVIVISYYDENLGLLSPRVLKYSLRREKDVAFIS"
FT   gene            545759..547024
FT                   /locus_tag="DICTH_0545"
FT   CDS_pept        545759..547024
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0545"
FT                   /product="membrane protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19469"
FT                   /db_xref="GOA:B5YD19"
FT                   /db_xref="UniProtKB/TrEMBL:B5YD19"
FT                   /protein_id="ACI19469.1"
FT                   /translation="MWLLYLDLITRISFIFSLIMSAVIIMYNPFIPFYFYPLFIFLSFL
FT                   SYILKNIFKENLKFLSIIPYLAVLIIPVGIYEKILILIISSISLYLILTQKAISYGLAV
FT                   DHFKKTNPIAILIFIISFLMRYLSTSRFLNFEVTVLPSLLIYFVVSVFLLRTLRYMEHK
FT                   IEDRRLVSLNIRYAFGVILLSALLSVPAIRDKIFFITSNIFSILYFIFTTALAVIFIVI
FT                   GYVLSWIFYLILNFMSKGGFIGRLNTRDFTMDPNLSRLLRLLWDRREIRSEIIDTLLVI
FT                   SFYILIAGIIILIILWVIKRVFSSQTKGENYIEEREFLFSQVNPLNALRRLLERRNLGL
FT                   VREYYRKYLLESKGFGVDLRPSDTTQDVYKKTFNLFDSEILKRIREIYVHVRYNRLEST
FT                   KELDKEFISLYKRLFKNRGDQR"
FT   gene            547021..547566
FT                   /locus_tag="DICTH_0546"
FT   CDS_pept        547021..547566
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0546"
FT                   /product="YdaE"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19119"
FT                   /db_xref="InterPro:IPR010864"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:B5YD20"
FT                   /protein_id="ACI19119.1"
FT                   /translation="MKRSDYEKARMKAIQLLEKAHIVITEEEKNRIEVADFGLGRLDIF
FT                   GLQILTYVSTERVCAKELIMFPRQTCPEHRHPPFNGDPGKEETFRCRWGKVYLYVPGEA
FT                   VENPKAIIPEEKKKYFTVWHEIELNPGEQYTLYPNTPHWFQAGDEGAIVSEFSTRNSDE
FT                   YDIFTDPEIRRIPIIEED"
FT   gene            547569..548846
FT                   /locus_tag="DICTH_0547"
FT   CDS_pept        547569..548846
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0547"
FT                   /product="ribonuclease HII, putative"
FT                   /EC_number="3.1.26.4"
FT                   /note="identified by match to protein family HMM PF01351"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19307"
FT                   /db_xref="GOA:B5YD21"
FT                   /db_xref="InterPro:IPR001352"
FT                   /db_xref="InterPro:IPR012295"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR022898"
FT                   /db_xref="InterPro:IPR024567"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:B5YD21"
FT                   /protein_id="ACI19307.1"
FT                   /translation="MYGRTWKLNGNKSKEIRDYLLRKGGIEESPTNPYELWRLKLKGST
FT                   FVYYTSGKLYSTQSEEAEEIWKEIDSLVEDNFDLSKDYVLGFDEVGKGEVFGPIITCGV
FT                   LIKRDYISQIPSELKTPDTKKSHDFEYWTRILSIINRYISDVFFYAIDLIQPREIDRFN
FT                   INQLLDLSYTKLIKRLMEGLPSGVEARVVIDDYGVGEGLKKFLEKERKESNFEYIFAID
FT                   SEDKFLEVKLASLIAKAHRERILKFLQEIYEIPGNLIKGNMSNKELELFLVNYSYIDSW
FT                   FIRKSFGNKVKKEKPSFYNLISEEGKFRCFFCGKEGNEVFLRNYKFICPFCDKEMKDLD
FT                   LAMKYHSGVIKVDKENFEPIFEVVKNSHLLDGFGFIVDHALKEYFIYYESIGRILTLNK
FT                   TPSKFITSKIKGDRVVFSLFRNVDNI"
FT   gene            complement(549352..550197)
FT                   /locus_tag="DICTH_0548"
FT   CDS_pept        complement(549352..550197)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0548"
FT                   /product="maltose ABC transporter, permease protein"
FT                   /note="identified by match to protein family HMM PF00528"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0548"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19004"
FT                   /db_xref="GOA:B5YD22"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B5YD22"
FT                   /protein_id="ACI19004.1"
FT                   /translation="MRRNKFLDQVPKHLIIWFILIFTFFPVVWTISASLRAGGGLVGQR
FT                   LIPEVLTFEHYSNLKEIGFFNWIKNSLIVSLTTAILTVFFVSLAAYAFSRFNFWGKKYS
FT                   LLTLLILQMFPAVMGMVAVYLLLFHIGKYIPFLGLNTLSGLIMVYLGGGIPYNIWLMKG
FT                   FFDSIPDSLEESALIDGATRFQAYYKIILPLATPILAVVAINSFIGTYSDFLLASIILK
FT                   DPSKYTFAVGLRNFISGLYDVRWGDFAAASIVGALPIVILFLSLQNLIVSGLTRGAVKE
FT                   "
FT   gene            complement(550194..551711)
FT                   /locus_tag="DICTH_0549"
FT   CDS_pept        complement(550194..551711)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0549"
FT                   /product="MalF protein"
FT                   /note="identified by match to protein family HMM PF00528"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ACI20129"
FT                   /db_xref="GOA:B5YD23"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR029345"
FT                   /db_xref="InterPro:IPR030156"
FT                   /db_xref="InterPro:IPR032550"
FT                   /db_xref="InterPro:IPR035277"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B5YD23"
FT                   /protein_id="ACI20129.1"
FT                   /translation="MSFFISFLPIIYAGIVVVIGIFFSYILSMIAGFIWGLIFFLATFL
FT                   FALLIVNPKTYPWKYIVPAFLLMFMFMIYPIIYTIQIAFTNYGTGHILTKTQVIEQLEK
FT                   ETFLPENTQNFKYEIYKSKIGDILLLFKDENNNIYKVEDKKLIKIAEGDFPSEYAGYKL
FT                   LPQTQKYSEISKLQNLKIEIGNGIFLQMSDLNNFSTYKQRYKYIPEEDVLIDNLTGEKL
FT                   VPQNGFFVRPNGQEILPGFVTYVGLENFLRLFKDERVSKPFVRVFTWNVLWATLTTFIN
FT                   FAFGLFLALLMNDKNLKFKGIYRTLLIIPWAIPSFISLLIWVGLLNTEVGVVNRILSSL
FT                   FGVKIPWFLETKWARLALFIVNLWLGYPYAMTVCLGSLQSIPEELYEAAKVDGASYFQQ
FT                   LKNITLPLLLTAIGPLIVGTFAFNFNNFNVIYLLTGGKPPMADVSSVAGTTDILISYTY
FT                   KLAFEGGRGQDYGLAATISIIVFIIVASLSLFNFWISGMFKREVRYE"
FT   gene            complement(551783..552976)
FT                   /locus_tag="DICTH_0550"
FT   CDS_pept        complement(551783..552976)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0550"
FT                   /product="maltose ABC transporter, periplasmic
FT                   maltose-binding protein"
FT                   /note="identified by match to protein family HMM PF01547"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18792"
FT                   /db_xref="GOA:B5YD24"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="InterPro:IPR006060"
FT                   /db_xref="UniProtKB/TrEMBL:B5YD24"
FT                   /protein_id="ACI18792.1"
FT                   /translation="MKKILILSLLLIIVFSLSQAAVPGKITIWTSEAQVKALREFVKNF
FT                   SNKYGIPVEVNEVSFSDIKPKFITSAPTGEGPDIIVGAHDWIGELVINGLLLPIDFLPK
FT                   NVLDQFTPVTLQAMSYGGKLYGIPYSMEAVALIYNKNLVPNPPTTYESLVRIAKNLTKG
FT                   GIYGFLYDYNNFYFSFPFFSALGGYVFKETPNGLDPLDIGLANEGAIKGVEKLVNLFKE
FT                   GILKQGVDYQTTTSLFSEGKLGMMINGPWEIDNIKKAKINYGVAKLPKIDGKPMRPFVG
FT                   VQGFMINSRSPNIAILKTFALEVLATKELELKLFETDPRILARKDAYRVVSSNPDIKAF
FT                   GASAADGIPMPNIPEMGPVWSYMGDALTLITSGKKAPDVALKEAVAQIKDAILKARK"
FT   gene            553174..553650
FT                   /locus_tag="DICTH_0551"
FT   CDS_pept        553174..553650
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0551"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19896"
FT                   /db_xref="GOA:B5YD25"
FT                   /db_xref="InterPro:IPR025480"
FT                   /db_xref="UniProtKB/TrEMBL:B5YD25"
FT                   /protein_id="ACI19896.1"
FT                   /translation="MKLKINLFDVIVFIIILLGILGFFLVKEGKTPLAKVQGIEKDVEI
FT                   DMIVRNLPLNDKEVIKPGDKAFIRIKNQPFAWVTVKDVKIYDKKMLVPNFNGTYTFIDD
FT                   VNNPFNVDMLITFTSRGYVTEDSVVLGVKVKVGMPISVESYKLDVNGVVSALRY"
FT   gene            553654..555999
FT                   /locus_tag="DICTH_0553"
FT   CDS_pept        553654..555999
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0553"
FT                   /product="heptosyltransferase family"
FT                   /note="identified by match to protein family HMM PF01075;
FT                   match to protein family HMM PF04932"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18587"
FT                   /db_xref="GOA:B5YD26"
FT                   /db_xref="InterPro:IPR002201"
FT                   /db_xref="InterPro:IPR007016"
FT                   /db_xref="UniProtKB/TrEMBL:B5YD26"
FT                   /protein_id="ACI18587.1"
FT                   /translation="MEKLVQIWRESLIFRFLNSLEINIKSKIEPIITTSFFFPFFHFVL
FT                   EYYLYIFLFLLPFLSSGKIAIGIFIAFVLWLVDTFLAKDRRFFETLDTFTLLYIIFMLI
FT                   NLASTFFSPYLVPAIKGYLKFCVYFGLFLVFRDVFKDKEKIKRALFVILFSTFLLSLYC
FT                   LYQWIIKVPPLAGWEDVEFVGENVTRVYGTLQNPNLLGGYLIGVFPFILSSIFIFKFKS
FT                   VPIFATLLSFLSIIWTYSRGAYLGFLFSMLVYFYFIFRIIWGYLTKKQRKIIFAFIILL
FT                   FFVGLGILIKSSYLQKRILSAFTLWGHSSNATRIVIWQRSFKIFRDFFLTGIGLGNDVF
FT                   RRVYAFYMEPRFTALASYNLFMEIGIEGGIFALLVFLLMLYYLFSRFIRKYNLWNLDYK
FT                   VIGITAFASIVAPLFHGFVDTIWYRPYPQIIFWFSVSIIINLFKENKESKVLLFNLGGL
FT                   GDQILFLPVIKAIKEKLNPKITIITERRGRKIYDILRMNVIEFNPKEKLSLKDTLYLIA
FT                   KLHRENYDLSISTGKSPFVPIFMYLVGAPVRAGYYENPLSFLYTHKASSKRNEYMARVH
FT                   FRLVEAIFKDVSYSNPELELSEDIKEETKKNTEKYNLRPFEYVLLHPGISKMSIKRGID
FT                   RRWPMENWIELIKRLKENDIEHVIIYGPDEEDSIRDLKEELPNSKFVSPKSLEEFLGWI
FT                   YYSKVMACLDSAPLHLGVALKKPIVALFGPTNPMEIVPMEPIYQVVKIDLPCEPCLWDK
FT                   RKRVCEALDCMKIPVDLVWEKLMIFIKG"
FT   gene            complement(555976..556470)
FT                   /gene="rfaE_1"
FT                   /locus_tag="DICTH_0552"
FT   CDS_pept        complement(555976..556470)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rfaE_1"
FT                   /locus_tag="DICTH_0552"
FT                   /product="RfaE bifunctional protein, domain II"
FT                   /EC_number="2.7.7.-"
FT                   /note="identified by match to protein family HMM PF01467;
FT                   match to protein family HMM TIGR00125; match to protein
FT                   family HMM TIGR02199"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19902"
FT                   /db_xref="GOA:B5YD27"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR011914"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:B5YD27"
FT                   /protein_id="ACI19902.1"
FT                   /translation="MWNSERKIKTKEEISEIADNLRKENKIIVFTNGCFEILHPGHITL
FT                   LEKAKSLGDILIVGINSDESVKKIKGEKKLIFDEKSRLKIISSLECVDYTVLFDEETPE
FT                   NIIRTIKPHIHVKGGDYKEEDLPEAKIVKSYGGKVIIVPLLEGFSTTQIINRILTLYKD
FT                   H"
FT   gene            complement(556457..557458)
FT                   /gene="rfaE_2"
FT                   /locus_tag="DICTH_0554"
FT   CDS_pept        complement(556457..557458)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rfaE_2"
FT                   /locus_tag="DICTH_0554"
FT                   /product="RfaE bifunctional protein, domain I"
FT                   /EC_number="2.7.1.-"
FT                   /note="identified by match to protein family HMM PF00294;
FT                   match to protein family HMM TIGR02198"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19653"
FT                   /db_xref="GOA:B5YD28"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR011913"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:B5YD28"
FT                   /protein_id="ACI19653.1"
FT                   /translation="MDIRERLLEITQSWKGKRIAVIGDIMIDEYIIGKIERISPEAPVP
FT                   ILEIEEEKYVLGGAGNVANNIKSLGGEPILFGVVGDDQGAEKILNLLQQKEIENFMIKD
FT                   KERPTTTKTRLIALSQQVVRMDREKRHPIKGEIEINLLKKVEENIDKIDLFLLSDYAKG
FT                   VLTPSFTKKVIDLAKAKGKKILTDPKGKDFTKYKGVNYITPNEKEAKIATDMEENFDII
FT                   SCAQKLLEIIEGEGIIITRGEKGMLLYQKDSYYYIPALKVEVRDVTGAGDTVISALSLA
FT                   LSCGANSLEAALISNFAASVVVRKLGTSTVTPEEIVQVIPQNIKIDKNYVEF"
FT   gene            complement(557434..558504)
FT                   /locus_tag="DICTH_0555"
FT   CDS_pept        complement(557434..558504)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0555"
FT                   /product="phosphoheptose isomerase"
FT                   /EC_number="5.3.1.-"
FT                   /note="identified by match to protein family HMM PF00702;
FT                   match to protein family HMM PF01380; match to protein
FT                   family HMM PF08645; match to protein family HMM TIGR00441;
FT                   match to protein family HMM TIGR01549; match to protein
FT                   family HMM TIGR01656; match to protein family HMM
FT                   TIGR01662"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18365"
FT                   /db_xref="GOA:B5YD29"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR004515"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR006543"
FT                   /db_xref="InterPro:IPR006549"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR035461"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:B5YD29"
FT                   /protein_id="ACI18365.1"
FT                   /translation="MEERIKVRLKKHNFTLKLVEEYLLPDIKKAAKMIVEKYKKGKKVL
FT                   IFGNGGSAADAQHIVAELVGRFLKERKGIPAIALTTNSSNLTSISNDYGFDEVFERQVE
FT                   ALLEEEDVVIGISTSGNSPNVVKALKKAKELKGTTIALSGKNGGEMIKYADISIVVPFH
FT                   MTPHIQEAHITIGHILCDLIEEELFPSKNRAIFLDRDGTINEDKGYVYKPEDLIILPYV
FT                   IEALKLLQKKFLIIVVTNQSGVERGYYTTEDVDKFHRYLYYTLSKEEVYIDDFYYCPYL
FT                   EGECRKPNPGMLLQAAKDWNIDLEKSYMIGDKSSDVEAGKKAGCKTIILGKEDPLADFS
FT                   AKNLLEAAKWILEKDS"
FT   gene            complement(558504..559805)
FT                   /locus_tag="DICTH_0556"
FT   CDS_pept        complement(558504..559805)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0556"
FT                   /product="UDP-glucose 6-dehydrogenase"
FT                   /EC_number="1.1.1.22"
FT                   /note="identified by match to protein family HMM PF00984;
FT                   match to protein family HMM PF01210; match to protein
FT                   family HMM PF03720; match to protein family HMM PF03721;
FT                   match to protein family HMM TIGR03026"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18567"
FT                   /db_xref="GOA:B5YD30"
FT                   /db_xref="InterPro:IPR001732"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR014026"
FT                   /db_xref="InterPro:IPR014027"
FT                   /db_xref="InterPro:IPR017476"
FT                   /db_xref="InterPro:IPR028357"
FT                   /db_xref="InterPro:IPR036220"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B5YD30"
FT                   /protein_id="ACI18567.1"
FT                   /translation="MRKIGIVGTGYIGLVTGLGLADFGNKVTCFDVDYEKIEKLKNGIS
FT                   PIKEKNIDELLKRNIENKRITFTTNIQELLENSEIIFVCVNTPPKEDGNVDLSQIISVS
FT                   ENLAQNIKDKKIIAIKSTVPIGTLEKITLIFEKYGKRKDQDFELAVVPEFLREGNAVYD
FT                   FFNPSRIVIGAENPETIEKLKEVFLPLNAPIVVTSPNAAILIKYASNAFLAMRISFINE
FT                   IANIAEKFGIDIKEVIEGMKYDKRIGKDYLQPGIGFGGPCLGKDLMGLIKMAEKEGYHP
FT                   SLLISIFEKNEHQIRQIIYKIKFFLGEFLDNQTIGILGLTFKPDTNDVRNSLALRIIKM
FT                   LKNDGAKIKAYDPLGIDEAKKEIQDIEYYDNPYDVAKDSNCLVILTGWKEFKELDFRKI
FT                   KDVMKTPIIIDGVNLLDPKTIKEMGFIYKGVGRQ"
FT   gene            complement(559855..561039)
FT                   /locus_tag="DICTH_0557"
FT   CDS_pept        complement(559855..561039)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0557"
FT                   /product="aminotransferase, class V superfamily"
FT                   /note="identified by match to protein family HMM PF00266;
FT                   match to protein family HMM PF01212; match to protein
FT                   family HMM TIGR03402"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0557"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19232"
FT                   /db_xref="GOA:B5YD31"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR010240"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR016454"
FT                   /db_xref="InterPro:IPR017772"
FT                   /db_xref="InterPro:IPR020578"
FT                   /db_xref="UniProtKB/TrEMBL:B5YD31"
FT                   /protein_id="ACI19232.1"
FT                   /translation="MKRKVYLDYAATTPIRKEVYEEMKLFLKEKFGNPSSIHNFGREVK
FT                   KAIEEAREKIAKAIGAESDEIIFTSGGTESNNMAIKGVAFALSHKGRHIITSQIEHHAV
FT                   LEPCHFLEKIGFEITYLPVDKEGYVDPDDLKKAIRKDTILISIMHANNEIGTIEPIREI
FT                   SNIAKEHDIYFHTDAVQTVGHIPVNVNDLGVDLLSLSAHKFYGPKGIGALYIRKGTRIE
FT                   PIIHGGSQENNKRAGTENVAGIIGMGKALELAISEMEREQKRLTELRDYFINQVEKRIP
FT                   EVYLNGPRVNRLPNNINFSFAQIEGETLLLHLDLEGIAVSTGSACSSKSLEPSHVLSAI
FT                   KLPAKLAQGSIRFTIGLYTQKEDLDYTIKVLENTIEKLRSISPDRQEWRMSRTE"
FT   gene            complement(561095..561436)
FT                   /locus_tag="DICTH_0558"
FT   CDS_pept        complement(561095..561436)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0558"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18309"
FT                   /db_xref="UniProtKB/TrEMBL:B5YD32"
FT                   /protein_id="ACI18309.1"
FT                   /translation="MGIVENSHRQDDEYFLGIHAERCKNVKEFLVKAQRWQDTWNIARP
FT                   SFGIGMDGKTPYEKLISSNFLVHPHIFSFPVILMEDLLSQYGLFTKNLSLFLKSGTYVL
FT                   TTCLSLLFD"
FT   gene            complement(561537..561950)
FT                   /locus_tag="DICTH_0559"
FT   CDS_pept        complement(561537..561950)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0559"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19267"
FT                   /db_xref="GOA:B5YD33"
FT                   /db_xref="UniProtKB/TrEMBL:B5YD33"
FT                   /protein_id="ACI19267.1"
FT                   /translation="MILSYHEIRNLSPEKTREIVIRAINGPLHDLPKKPHSSPNKTPPS
FT                   LENLITLKAKRTGFSYRRLKALILRKYSLSISENTIKKSSLIKILFLLMCIIIWLSLIY
FT                   LSMNGILLMLKQEQDSLLTLLLSLWFCGGELIM"
FT   gene            562135..563118
FT                   /locus_tag="DICTH_0560"
FT   CDS_pept        562135..563118
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0560"
FT                   /product="undecaprenyl-phosphate
FT                   4-deoxy-4-formamido-L-arabinose transferase"
FT                   /EC_number="2.7.8.-"
FT                   /note="identified by match to protein family HMM PF00535"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19597"
FT                   /db_xref="GOA:B5YD34"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:B5YD34"
FT                   /protein_id="ACI19597.1"
FT                   /translation="MLTIFFIFDKKIIMENVNVSLVIPVKDEEGTLETLYEKILEVLES
FT                   LNLSFEILFIDDGSTDRSFDIMKQLSQRDSRVKVVRFRRNFGKAAALSCGFEKAKGEII
FT                   ITMDADLQDDPKEIPKFIDLINNGYDVVSGWKKDRKDPWSKKIPSKIFNKITAWLTGVN
FT                   IHDFNCGFKAYRNEVVKNLDIYGELYRYIPALAYSKGFRIGEVVVEHHPRIYGRSKYGW
FT                   ERLIKGFLDLFTVVFLTRFLKRPMHFFGGLGLLFFIVGFLINLGLTIYKYTTGALIGSR
FT                   PLLLFGVLLMILGVQFLSIGLLGEMINNVTHGRKKEYLISEEIGFE"
FT   gene            563111..564727
FT                   /locus_tag="DICTH_0561"
FT   CDS_pept        563111..564727
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0561"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18530"
FT                   /db_xref="InterPro:IPR008930"
FT                   /db_xref="UniProtKB/TrEMBL:B5YD35"
FT                   /protein_id="ACI18530.1"
FT                   /translation="MSNVYFKVIIEEIPRLLGLLDKNPVSPTFGSFDRNYWHYNISDFP
FT                   CARYQEATLTLALLYVLNYEKNPYYNSEGILGFINGGVNFWRKIQRGNGSFDEWYPYEG
FT                   SFVATAFSTYAISEVLLLLKDKIENFEEALRSVKKAVDFLSANVDYTACNQEAGAILTI
FT                   YNYYLLSNEDRYKELAYKRLVSFYKLQKEEGWFPEYGGPDVGYLSLTIDYLAKLYEKSN
FT                   WDIIREMMDKAIGFLYYFSHPDGSFGGEYGSRNTKYIIPSGIEFATSWNKKAGYIAFNL
FT                   RKALSEKSTIGPYNLDDRYLAYIGYTYLQASLYYKEDLEIEGRERYIDKYFNQSGIWVF
FT                   SNDNFYLVSNFKKGGVLKANFKNGYLLKDSGVVVKIRNKVYASSWLNPEEEVISEDRGY
FT                   KVFRELKLLTFPKMSIIKNIFLRIFQSLFGRFNFVNKITKKLLRDILISKQKSSGVKFF
FT                   RVIRVFDDKLEIEDVIISSEKISKVFCGMENPYIFIPSSRYFEIGDLNRYYHQFEVGSK
FT                   RVTIRRVFNEKGKEEFSYKLD"
FT   gene            564687..566963
FT                   /locus_tag="DICTH_0563"
FT   CDS_pept        564687..566963
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0563"
FT                   /product="membrane protein, putative"
FT                   /note="identified by match to protein family HMM PF02366;
FT                   match to protein family HMM PF03706; match to protein
FT                   family HMM TIGR00374"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0563"
FT                   /db_xref="EnsemblGenomes-Tr:ACI20138"
FT                   /db_xref="GOA:B5YD36"
FT                   /db_xref="InterPro:IPR022791"
FT                   /db_xref="InterPro:IPR038731"
FT                   /db_xref="UniProtKB/TrEMBL:B5YD36"
FT                   /protein_id="ACI20138.1"
FT                   /translation="MRKEKKNLVINLIKLILTFLIFWVIFKRVPFNSLFEVIKGTRFFY
FT                   FIPVFLLGVGFTIFKIYKWHLLLSSVEDVNFSRSVDSYFIGMSLGIVTPGRIGEVGRIS
FT                   NINKKLEGLGIALWDKIFDLYIVLLLALPGVYYFRGFLVGILYTFFLIAIFFILIRPQY
FT                   LDFLKKIPILKNYPQIIDGLKVIKLKTLIINLIITFMAYFLVIIEGYFLGMAFNMENFF
FT                   AFLYGYPLVMLVNLIPITIAGLGIREGTAILILDKFSVPSNIAFNVSFLIFLINTALPA
FT                   ILGIFAMYLWEIKKSIYKTDLWAYLITFIGGFLRFYKIGVRSIWIDEAITAQVSGMGVK
FT                   DIILNRASTGIHPPLYFILMHFWIKIFGDSEIAIRSLSAIFGILCIFMIYKLASKIFDK
FT                   LTGLISAFIFAFSPFYVYFGQEARMYPMVTFLILLSLYYLLKGIDKGKNIILITISNIL
FT                   MLYTHIFSAFVVLSENLFVFITNFKNKKVLKKWIIAQFIILLFILPWLYVIIQNRTPEV
FT                   YQGAQKVSLTNLGYTFLEINLGAGRAVFRNKILIASLFLLIFIIGFLPPWEKKREILLL
FT                   FLYLFVPILLLLLLSLRKSFFSARYISMFIPGYVIFLGRGIRRFKHYSLIFLIVMGLLS
FT                   IYALGLNYYYSNLANLNRPWRDAVRYIHENVGGEKVFIFAPYMWRPFEYYNRGKISYET
FT                   LHISQLENKLKGLSSGERFWMIIANHEIEDPEGKVISLLENKFIPLKEVRYYRIIIKQY
FT                   KVPEG"
FT   gene            complement(566960..570649)
FT                   /locus_tag="DICTH_0562"
FT   CDS_pept        complement(566960..570649)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0562"
FT                   /product="tetratricopeptide repeat domain protein"
FT                   /note="identified by match to protein family HMM PF00515"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18791"
FT                   /db_xref="InterPro:IPR002931"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR024618"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:B5YD37"
FT                   /protein_id="ACI18791.1"
FT                   /translation="MRKRTYISISLIILLLILLTSPFAKTTKLGDLLLENKFELLKNSS
FT                   NEDFYSNVLFSITYLLEDNVSQAWRHWKKSIEIKPNSPWHQVIGLLGYDLWDSLPIYKE
FT                   LITLLREKDFNNSYLEYLYWKALLSQNLVQEAEKYSEEKGFIKDFLFLGPFENIGNSGI
FT                   YKEYPPEKEINLEKTYQGKNGIDIKWFTPEERGKNAYTSIYNLIYPNQWAVSYALCYFY
FT                   VPQNQDIYIRIGTTSSYKLFLDDFSFPQIETQRRAIWNQEIYKTKLSSGWHKLLLKLCN
FT                   QEGDFGFFLRVTDSRGNKIPGLKISLVPQNYKRAQVYFERITPEKELIKESDSSEIFYT
FT                   FYGFLLFEKGLTDEAEEYLKRAEKIKQNSSIIKFILGKIYLDSQEELGKSYLLDSYSIS
FT                   KNLKINLYYLSLYELEHGRYEEALKYLEKEDIPENSFLLRSLLIRLFNALSWTKESEDQ
FT                   ISTLEKKYKESQETYFLKGKMYEKRNMPFKAIENYLKALSMNWENWEVFYNLFYLARDL
FT                   HKYDIVETLAKNLIDKDPTDVWAYSQLISIYLSQERIDEAQKLIEKAKNITYLYPETFI
FT                   YEAEIYNLKDEKELAMESYQKAISIDPSYKGIREYLNYLRSEQIRIPDISEYITQKVPE
FT                   EFLDFPAIYLLDRQERIMQKDGSFTVVFHKIIKILKDEAKEKYGEILINYDSSFEDVRI
FT                   LRARTIKPDGKEIEATSIQDFAIASDYPLYTDQRQIVISMPSVEKGSILECFYVIDEYT
FT                   RSIFGKNFQDIFFFQNEIPILRSIYTLKIPSQIDLKYKVYNGKIEPQIKEDKEYKILTW
FT                   EMENVPGIIEEPYMPDPSKLVPQLWITTFESWESLADWYYSLAYPQIRSDKNIKEKVKE
FT                   LTSGAKTEEEKIKSIYYFVTNQVRYVGLEYGIRGIMPHSAPEIFKAKYGDCKDKAILLL
FT                   TMLKEAGIKAYYTLVSTRYSLPLKKELPGFQFDHAIVALPYKNSYLFLDGTAEDVPFGE
FT                   VPMMDQGADAMIIIDGKPLFTKIPMSKPEDNLRRYDIEINIEDGKLLAEVLINLTGYFA
FT                   NYYRYYLKTMTTLQKENFLSRLLNYYIPNSKLTDWDIQNLSNLEEPLLIKLRFENPYLI
FT                   SNKKDINLIKMFPFTSINSAEEISKEERVYDIEYYLPYKEVEDITIKIPKGVNITTTIT
FT                   EIIKENDWISYLVQVERKENILHLKRVFVQKEILIPVQNFKEYKKDLEEIMNYDRGMLL
FT                   IKTD"
FT   gene            570793..571806
FT                   /locus_tag="DICTH_0564"
FT   CDS_pept        570793..571806
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0564"
FT                   /product="transcriptional regulator"
FT                   /note="identified by match to protein family HMM PF00356;
FT                   match to protein family HMM PF00532"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ACI20134"
FT                   /db_xref="GOA:B5YD38"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:B5YD38"
FT                   /protein_id="ACI20134.1"
FT                   /translation="MTKKKKAPTSWDVARLAGVSRSTVSFVLNNTPGIKISEETRKRVL
FT                   EAVKALDYKPNAIARSLAKQKTEAIAFFVLDIANPVFPNMARGIEDVARQNGYILLLCN
FT                   TDGKSLRELRYMNIMLERRVDGIIAGALSNEEVSKIAQKKNMPLVILEHPRLQEHDVVY
FT                   ADNVKGSYEAVMHLIELGHNRIAHITINPESIIVQERIEGYKKALEDAGIPFDADLLKI
FT                   FYGKVDEESAINELFSLPDPPTAIFTFSDFMAIQVMKILIRRGYRIPDDISVVGFDDTL
FT                   ANLTIPALTTVSQPFYEMGAKAAEILIERLKNPNMPIQHVKLPTKLVIRESTAKRK"
FT   gene            571902..572540
FT                   /locus_tag="DICTH_0565"
FT   CDS_pept        571902..572540
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0565"
FT                   /product="trimethylamine corrinoid protein 2"
FT                   /note="identified by match to protein family HMM PF02310;
FT                   match to protein family HMM PF02607; match to protein
FT                   family HMM TIGR02370"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0565"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19047"
FT                   /db_xref="GOA:B5YD39"
FT                   /db_xref="InterPro:IPR003759"
FT                   /db_xref="InterPro:IPR006158"
FT                   /db_xref="InterPro:IPR012741"
FT                   /db_xref="InterPro:IPR036594"
FT                   /db_xref="InterPro:IPR036724"
FT                   /db_xref="UniProtKB/TrEMBL:B5YD39"
FT                   /protein_id="ACI19047.1"
FT                   /translation="MVDLKEIAEAVIKGNRKKVQELVSKALEDGLSPEEIINNGLLAGM
FT                   SVVGERFKNNEIFVPEVLVSARAMQAGMDILKPLIAKNPGIIKGKVVIGTVKGDLHDIG
FT                   KNLVAMMLEGAGYQVFDLGIDVPPEKFVEAIKEYNPDIVGMSALLTTTMPQMGVTIEVL
FT                   KKEGVRDKVKVIVGGAPVTETFAKEIGADGYAPDAPSAVELVNQLLGLK"
FT   gene            572541..574271
FT                   /locus_tag="DICTH_0566"
FT   CDS_pept        572541..574271
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0566"
FT                   /product="2Fe-2S iron-sulfur cluster binding domain
FT                   protein"
FT                   /note="identified by match to protein family HMM PF00111"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0566"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19281"
FT                   /db_xref="GOA:B5YD40"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR027980"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR041414"
FT                   /db_xref="InterPro:IPR042259"
FT                   /db_xref="UniProtKB/TrEMBL:B5YD40"
FT                   /protein_id="ACI19281.1"
FT                   /translation="MHEIKVLNENKIIYANEGENLLDILRDNNINIVSLCNGVGWCGKC
FT                   KVKIWSGKVSALTGEEKKLLSDEEIKNNIRLACQLCIKDDLEIEILEKHDFFNFSKGLE
FT                   YKFVLNPPIRISKIFHKIDERDIVKSYLECIEKYGVFVKDLNLVKKLTNFVKDNYFDAS
FT                   IIIFDEEIIDIREKDLEKIYGVAVDLGTTTLVATLFDITNGGNLGAKMEVNPQVSYGAD
FT                   VLSRINYIMTHRNGLPVLQDLIDSKVENMILSLCEENKINPEDIYLISVAGNSIMTHIF
FT                   LGVNPLSIGVFPFTPVFRRGLIVSSRNLFKGIRNAKVYTFPLISGYVGGDIVSGILAVG
FT                   MDYEDKNILLIDIGTNGEIVLKYKDEFYACATAAGPAFEGGNISQGMIAVNGAIDHVWL
FT                   EDENIRYSVIGDEQEKGITGSGLIDAVALMLDLKIVDETGRMKKEYFNIGKVKITQKDI
FT                   REFQLAKSAIRAGIEMVLIKAGISYKDLDKVYISGNFGNYINLENAIKVGLLPPLEMGK
FT                   FVISGNTSLIGAELLLLDKNFIKKSESIISKIKYIELSSSSEFQDLFIKFMRLGAGYYE
FT                   "
FT   gene            574264..575223
FT                   /locus_tag="DICTH_0567"
FT   CDS_pept        574264..575223
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0567"
FT                   /product="methylcobamide:CoM methyltransferase MtbA,
FT                   putative"
FT                   /EC_number="2.1.1.-"
FT                   /note="identified by match to protein family HMM PF01208"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0567"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18682"
FT                   /db_xref="GOA:B5YD41"
FT                   /db_xref="InterPro:IPR000257"
FT                   /db_xref="InterPro:IPR038071"
FT                   /db_xref="UniProtKB/TrEMBL:B5YD41"
FT                   /protein_id="ACI18682.1"
FT                   /translation="MNNKNKRLVIPLLGAPGVKLTDTTLKENLSDPFVQFKTLYKIVER
FT                   FNPDGIFPFMDLTVEAEALGLKIEFPENDNPSVREHPVKNRDALNEIKRKWKGVSERMI
FT                   TFIKVCEMMAKEFNILKGGYVIGPFTLAGELVGVNDLGINVIEDPDFVEEVVDFTTSVI
FT                   FEYAKALLETGIDMIAVLEPTAVILSPQQFREFSMKHFKHLSSELKKPVIYHICGNTKH
FT                   LIEDMGKSGAWGLSLDSAVDLKWASEIVPSDVRLIGNLDPVKVFLQGNPEMIYEKTKEL
FT                   LEKMRDVDNFILSSGCDIPLGTPLENIDAFMQAAKSFK"
FT   gene            575227..575361
FT                   /locus_tag="DICTH_0568"
FT   CDS_pept        575227..575361
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0568"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0568"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19778"
FT                   /db_xref="UniProtKB/TrEMBL:B5YD42"
FT                   /protein_id="ACI19778.1"
FT                   /translation="MKNSDDFGIISDKLYKILGGDEVGMDHALPEKGGSHRSKYTETL"
FT   gene            575376..576599
FT                   /locus_tag="DICTH_0569"
FT   CDS_pept        575376..576599
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0569"
FT                   /product="domain of unknown function, putative"
FT                   /note="identified by match to protein family HMM PF01837"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0569"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19022"
FT                   /db_xref="InterPro:IPR002708"
FT                   /db_xref="UniProtKB/TrEMBL:B5YD43"
FT                   /protein_id="ACI19022.1"
FT                   /translation="MLRTIEEINEKIRQGKAVVVTAEEMIDIVKEKGVEKAAKEVDVVT
FT                   TGTFGIMCSSGIYFNIGHTKPRIKLGGGKVYLNGVPAYAAYAAVDLFLGANALPDDDPR
FT                   NRYYPGDFEYGGGHVIEDLVSGKEIRITAQAYGTDCYPRKFLDAYITIHDLNEAVLFNV
FT                   RNAYQNYNVAVNSSDKTIYTYMGMLKPRFGNANYSSAGQLSPLLNDPYYKTIGIGTRIF
FT                   LGGGIGYVAWHGTQHNPNVERTERGIPKGGAGTLAVIGDLKQMSSEWLRGVSMKGYGVS
FT                   LAVGIGVPIPVLDEEIAFYTSVSDEDILAPVVDYATTYPNRGSEVITYVSYKELRSGEI
FT                   ELFGKKVPTSPLSSYPKARRIAEILKEWIKEGKFLLTSPSAPIPGVESGIKFKPFSGRE
FT                   ILEEVEKR"
FT   gene            576596..577009
FT                   /locus_tag="DICTH_0570"
FT   CDS_pept        576596..577009
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0570"
FT                   /product="iron-sulfur cluster-binding protein"
FT                   /note="identified by match to protein family HMM PF00037"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0570"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19480"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR018449"
FT                   /db_xref="UniProtKB/TrEMBL:B5YD44"
FT                   /protein_id="ACI19480.1"
FT                   /translation="MRTERIVLHFPKELADKPVIVNLVKKFNLDFNILKATITPDAEGV
FT                   MVLEITGEDNKFSEGIEYLKELGVSIQPLSKDVIWLEDKCVHCGYCVSYCPTKALNRDE
FT                   KTLTVSFDSQKCTACGICVEICPYSAMEMKIFV"
FT   gene            577068..577799
FT                   /locus_tag="DICTH_0571"
FT   CDS_pept        577068..577799
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0571"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF04040"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0571"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18810"
FT                   /db_xref="InterPro:IPR003374"
FT                   /db_xref="InterPro:IPR007183"
FT                   /db_xref="UniProtKB/TrEMBL:B5YD45"
FT                   /protein_id="ACI18810.1"
FT                   /translation="MSSDKYVERTYRKYMKALDLVSFQVKIQESDLYILAKKDLKKEAE
FT                   KFLLFYRKQIEDYILEDPVFKLTLSPHRPKDNAPEIVQDMCFWSGKAGVGPMASVAGAI
FT                   AEYVGKELLNYSDEVIVENGGDIFISTKKERKVAIFAGESPWSNKIGVLIPPNSTLGVC
FT                   TSSGKVGPSLSFGVTDAVMIVSNSAVFSDALATAVGNMIKNEKDVELGIEFARKFPEVI
FT                   QVVIVFDKHLGVWGNLELIKL"
FT   gene            complement(577800..578318)
FT                   /locus_tag="DICTH_0572"
FT   CDS_pept        complement(577800..578318)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0572"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0572"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18382"
FT                   /db_xref="GOA:B5YD46"
FT                   /db_xref="UniProtKB/TrEMBL:B5YD46"
FT                   /protein_id="ACI18382.1"
FT                   /translation="MFNKVFWSIFLIIIGLSLLANNFDVPVLKDLWKLWPLVFIYTGIK
FT                   LIFPKYRRNIKMREERYKILKLVEEGRIRADEAEELIKKLEEVSKKEKRYLRVNVVEKE
FT                   RNIVNITVPLSFLSWGLKFASTYAGKYGEKIEISPEEIKNLINDPDFKGRIVDINDVDD
FT                   NVQVVIEII"
FT   gene            complement(578311..578685)
FT                   /locus_tag="DICTH_0573"
FT   CDS_pept        complement(578311..578685)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0573"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0573"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19525"
FT                   /db_xref="InterPro:IPR018658"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:B5YD47"
FT                   /protein_id="ACI19525.1"
FT                   /translation="MSHPLPRCPICGNEMIIKKLECPNCKITIEGEFWVNRLASLPQEE
FT                   LEFLELFLKTRGNVKEMERILKLSYPTVRSKLDNILKKLGLLEEEEEPKDKVKWIINKL
FT                   EKGEITVQDALKILEEGENV"
FT   gene            complement(578778..580004)
FT                   /locus_tag="DICTH_0574"
FT   CDS_pept        complement(578778..580004)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0574"
FT                   /product="ABC-type transport system, involved in
FT                   lipoprotein release, permease component"
FT                   /note="identified by match to protein family HMM PF02687"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0574"
FT                   /db_xref="EnsemblGenomes-Tr:ACI20154"
FT                   /db_xref="GOA:B5YD48"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR025857"
FT                   /db_xref="UniProtKB/TrEMBL:B5YD48"
FT                   /protein_id="ACI20154.1"
FT                   /translation="MKTQIKENLRLAVYSLISNKLRSFLTILGIIIGVFSVVLLISIGE
FT                   GAKNQTLQIIENLGSNTLIIFPSSTETGGTFRSIQGQRPRRGMPQLFSYNDLLYLRNIF
FT                   RNELLVSSLVSSPYNVYYQIFPIEANVQGTDNDGILISKDSIIEGRFFTSYEQDAKEKV
FT                   CIVGPKIAKSIAISYKEATNKIIKIGDHNFRIIGILKERGYSQNLGDLDSRIIIPLTTA
FT                   LMLKGDQTLNFIIAQVKENKSIETYRQKLIFVLKQRRGKLNFVIAKQEDLLSAMNDILN
FT                   ILTLTLAGIAAISLIVGGIGIMNIMLVSVTERYKEIGIRKAIGAKKRDILIQFLTESAF
FT                   LGMIGGTLGIALSIIAGEILSKFEVPYSLSYSTLILGFSFSLFIGLIFGVLPAMRAANL
FT                   DPIQALRSE"
FT   gene            complement(580001..581092)
FT                   /locus_tag="DICTH_0575"
FT   CDS_pept        complement(580001..581092)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0575"
FT                   /product="efflux transporter, RND family, MFP subunit"
FT                   /note="identified by match to protein family HMM TIGR01730"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0575"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19280"
FT                   /db_xref="InterPro:IPR039562"
FT                   /db_xref="UniProtKB/TrEMBL:B5YD49"
FT                   /protein_id="ACI19280.1"
FT                   /translation="MKRLLIIVLILTAIGITVFYQSNNAILVKVEKISKKDLNLTINLS
FT                   GNLSFLRKIEIYPKISGVVKEVRVKPGDKVKKGDILAIIDAEDLKKQIEQIKNIIDLAK
FT                   ISIAFGTLNSQSEFKITSDQIKTLESYYESLKKLYEERIIKSPINGFIAKVNLSPNETV
FT                   QISQNNLNLNNLLGNFSSLLNMFNLALPQNNPAFIIIDPTSLNAILKVDENNVLKIREG
FT                   QKAIITVDALDQNPWEGKVTYVSKIPSLNKDGTYAYEVYIPIPQLGEKVVEGMTISAII
FT                   NIGVKKDVITIPLSAITFKEGKTYVYVYENGKAQEREVIIGDMTLDEIEIKEGLKEGDL
FT                   IITSPIDKIANNKKVKIDNEIKR"
FT   gene            complement(581097..582050)
FT                   /locus_tag="DICTH_0576"
FT   CDS_pept        complement(581097..582050)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0576"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0576"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19017"
FT                   /db_xref="GOA:B5YD50"
FT                   /db_xref="InterPro:IPR001531"
FT                   /db_xref="InterPro:IPR008947"
FT                   /db_xref="UniProtKB/TrEMBL:B5YD50"
FT                   /protein_id="ACI19017.1"
FT                   /translation="MKKRIIFLGILFLILISPIFSWSAHREMTEIILKDYVWLKNYNKI
FT                   KVTPYTYNDPSPYNPAYAIPYRGEKIGDTIDAITIITRYVTEPDNGMDENLNLNSMQKL
FT                   TGGSSGWRHQYYIALGGVLKLGEAPKRIIHFWNLAREAFQKRDYYWGFRFFAYSLHYLQ
FT                   DLTQPFHAYPMPLGNVIKNIFNLEKVIAQGENHHYTLEDYQEYQILNKNPAYIETLKKA
FT                   KPYKIENPEEAGIKAAWTSRKDAGKLFEIQSKYFKEINETKNYKAPKDLFMGNNSTLKE
FT                   EYDKIILRNLENFAGYSKGYIEFLKEFLEKLEGQEK"
FT   gene            complement(582067..583140)
FT                   /locus_tag="DICTH_0577"
FT   CDS_pept        complement(582067..583140)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0577"
FT                   /product="sugar ABC transporter, ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0577"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19930"
FT                   /db_xref="GOA:B5YD51"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B5YD51"
FT                   /protein_id="ACI19930.1"
FT                   /translation="MSIEIRLENITKTFKAKNETIYALKNINLNIPAGKTISILGPSGC
FT                   GKTTLLKVIAGLEKPDEGKIFFNSEDVSELSPYERRIGMVFQNYALYPHYKARGNLAFP
FT                   FWIKKVPEKEIDEKIRETAKILGVGFEYLLDKKPKELSGGEQQRVAIGRCIIRNPSVML
FT                   FDEPLSNLDAKLRVITRAQLKKLLVTFNVTSVYVTHDQTEAISIGDLIGIMNNGEIIQV
FT                   GTYEEIVNNPKNSFVASFFGKPSMNLLEVKVINSQIMWRDKTIPLDKKIEDGEYLLGFH
FT                   GKDVEINPNGEIKGEIYFIDGTPADISKVLHVQLEDNSSIKIEIKSGEIYRCGEKIAFS
FT                   LPKKIYLFKKNSGERIL"
FT   gene            complement(583144..583818)
FT                   /locus_tag="DICTH_0578"
FT   CDS_pept        complement(583144..583818)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0578"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0578"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18529"
FT                   /db_xref="InterPro:IPR011465"
FT                   /db_xref="InterPro:IPR029046"
FT                   /db_xref="UniProtKB/TrEMBL:B5YD52"
FT                   /protein_id="ACI18529.1"
FT                   /translation="MRKIRFIKYIILLLFVLTLLGTNKPSFAISYEEILQKTISSYKNL
FT                   KTFSCILEVYNKAGNNEENITYEYYFQKPDKIRLEIMEGKDKGTIIVYQNGRVRYKKGG
FT                   VLSFIPLSLNVDDPIVLSIRRGRVNELSLEYIVDILTKYNPQSIKEVNILGYSCYVIEI
FT                   GDSRDRLYNYSLQRIYIEKNNFIPIQLEQYENTNGQNELVHRRVYKNFKINPPIDEKIF
FT                   NI"
FT   gene            complement(583815..584372)
FT                   /locus_tag="DICTH_0579"
FT   CDS_pept        complement(583815..584372)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0579"
FT                   /product="conserved protein"
FT                   /note="identified by match to protein family HMM PF01613"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0579"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19183"
FT                   /db_xref="GOA:B5YD53"
FT                   /db_xref="InterPro:IPR002563"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:B5YD53"
FT                   /protein_id="ACI19183.1"
FT                   /translation="MYHEVKTNFVYLLHPLPGILITSIGKNNNPNVMSASWITPISINP
FT                   PLISISLRPERYTYELIKETGDFAINIPDYSLRKAVFICGRFSGRKVNKFKKANLTPIP
FT                   ANKIKSPIIKECLAHIECTLEKIIELPADHHLIIGRVQYAQAHEEIFKNTYIPEKFKPL
FT                   LYFGKDIYGTIETFEQVKIEEI"
FT   gene            complement(584385..584960)
FT                   /locus_tag="DICTH_0580"
FT   CDS_pept        complement(584385..584960)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0580"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0580"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18359"
FT                   /db_xref="UniProtKB/TrEMBL:B5YD54"
FT                   /protein_id="ACI18359.1"
FT                   /translation="MRKNYIFIFTLILFLSTIIFAQTQTTTKTQPPKKPATIFVLHALT
FT                   FSNLSKGNLEKDLKSLDDTFKMSIPIYHPAIGLNLSFYTKLQQKGLPYPSMINRILKNL
FT                   VNILNSSELPDKTTINIVLYTEDDKDLYNGKTLFLTFPLSAIKEYNKTKDLNKFGSQII
FT                   VFLETEKLEYKNGVFTAKNYDFEWILKI"
FT   gene            585018..586988
FT                   /locus_tag="DICTH_0581"
FT   CDS_pept        585018..586988
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0581"
FT                   /product="ATP-dependent DNA helicase"
FT                   /note="identified by match to protein family HMM PF00580"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0581"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18958"
FT                   /db_xref="GOA:B5YD55"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR013986"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="UniProtKB/TrEMBL:B5YD55"
FT                   /protein_id="ACI18958.1"
FT                   /translation="MNNQFDSEKKIFIIPSRKKKEFLERIEKDLNEEQRKVVLEADGPS
FT                   LVIAGPGSGKTRTIVYRVGYLVALGYSPKNIMLLTFTNQAARHMINRTQALIRESIEEI
FT                   WGGTFHHVGNRILRVYGKIIGINEQYNILDREDSLDLIDECLEELFPEENLGKGILGEL
FT                   FSYKVNTGKNWDEVLKIKAPQIIDKIEIVQKVFERYEKRKRELNVLDYDDLLFFWYRLL
FT                   LESEKTRKILNDRFLYILVDEYQDTNWLQGEIIRLTREENKNILVVGDDAQSIYSFRGA
FT                   TIENILSFPEIFPGTRIFYLVFNYRSTPEIINLANEIIKRNTRQYFKEIKPVLKSGSKP
FT                   KLVWVRDDEEEAQFVVEVIKELHKEGVKYKDIGVLFRSNYHSMAVQMELTLQGIPYEVR
FT                   GGLRFFEQAHIKDMISLLKILFNPQDEISAQRFFKLFPGIGRAYAKKLSQVLKESKDFD
FT                   KIFQMQFSGRTLEGLRILKNIWDKIKVIPVQNFSEILRVFFNEYYKDYLERNYPDFKDR
FT                   EKDVDQLILLSERYDDLEKFLSELTLYTYAGEKLLEEEEEEKDFVVLSTIHQAKGLEWH
FT                   AVFILRLVQGDFPSYKSMDNIEEERRLFYVAVTRAKRELYVITYLTRKVKDMNVFTKPS
FT                   IFLEELPYKELFEEWIVQREI"
FT   gene            complement(586992..587276)
FT                   /locus_tag="DICTH_0582"
FT   CDS_pept        complement(586992..587276)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0582"
FT                   /product="YitW"
FT                   /note="identified by match to protein family HMM PF01883"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0582"
FT                   /db_xref="EnsemblGenomes-Tr:ACI20012"
FT                   /db_xref="InterPro:IPR002744"
FT                   /db_xref="InterPro:IPR034904"
FT                   /db_xref="UniProtKB/TrEMBL:B5YD56"
FT                   /protein_id="ACI20012.1"
FT                   /translation="MNLKETIENKLKEIIDPEVGLDLVTLNTIEKLEIDNDGNVKIVFR
FT                   PTTPFCPLGIQLALSIKKAVKEIDGVKNVDVEVVDYIFAEQANELLKNQ"
FT   gene            587370..587735
FT                   /locus_tag="DICTH_0583"
FT   CDS_pept        587370..587735
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0583"
FT                   /product="transcriptional regulatory protein"
FT                   /note="identified by match to protein family HMM PF00072"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0583"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18514"
FT                   /db_xref="GOA:B5YD57"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:B5YD57"
FT                   /protein_id="ACI18514.1"
FT                   /translation="MKKILIVEDEQNVRGLIKETLEFLNKYEIHEAGTGKEALEKIKEL
FT                   NPDLVILDIMLPDIDGYTICEQIKEDPSLNSLVLILTARSSDLDKRVGYSMGADDYMTK
FT                   PFGLADLITRVENLLGE"
FT   gene            587763..590210
FT                   /locus_tag="DICTH_0585"
FT   CDS_pept        587763..590210
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0585"
FT                   /product="alkaline phosphatase synthesis sensor protein
FT                   PhoR"
FT                   /EC_number="2.7.3.-"
FT                   /note="identified by match to protein family HMM PF00512;
FT                   match to protein family HMM PF01590; match to protein
FT                   family HMM PF02518"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0585"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18625"
FT                   /db_xref="GOA:B5YD58"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B5YD58"
FT                   /protein_id="ACI18625.1"
FT                   /translation="MVKTYYNETKERLLSLFRALLLFIALLLVKFDIIPPINQSIFNIF
FT                   LVFSSIYILITTIFPVYKYPIFYKHEIFTAIDVILVAILVYLTGGISSDLYLFLIFPIV
FT                   SSAFRYDFRSAILSAILVTLVFILFGIIQGVNIILSNTYIRVVELGVIAIVLALFLNYI
FT                   GRESLKLEQKINEMKIFSEIIKTVNSSLETKEILSLILDSAVKLLGADGGTIFLKDKDT
FT                   GDLIFERAIGEKGELLEGKKLSKGEGIVGWVVENGTPIIINNPQKDPRFSSYYDKLSGF
FT                   KTGSIICAPLKVGDEVLGAIEVINSNRNRKFTEYELDMLMNLAYETSVALNKAILYNEV
FT                   NLEREKMKKILENVGDGLVILDGRKRLSMFNNVAEEIFKLSPEQKEKRCTEVLKCRNLS
FT                   GELMCSECPLDKMVFQGLSLMQYEMKVWNGEKEIILGCNLSSTWEGRKVTNFILALRDI
FT                   SLAKELDRMKSEFVANVSHELKTPLTAIKGYSELLIKMNLPPEKVRNYYQIIYKESERL
FT                   TQLINDLLEVSRIESGKIELKKEMVEIRKVIKERATFFQTQTSKHTIVLQFPEYPTFIL
FT                   GDNARLAQVFHNLLDNAIKYSPNGGNIWVRVSDKMEDIVIEVQDQGIGIPPEHLPHIFD
FT                   RFYRVDSSLRKSTSGTGLGLSIVKSIIEAHGGKISVASKVGEGTTFTIRLPRRFSLVDP
FT                   LTGTLSLPYFFPLLWREMYKVQGPFAFGRIYYEFEGLISDNVRKNTIYNLANRLKERLR
FT                   PNDLIGHGFNRFYLFTRTVMDIEEKVSHIPLGDMGDLKVHLKFLTSVNNSIEDVVRLVN
FT                   EDF"
FT   gene            complement(590207..591688)
FT                   /gene="guaB"
FT                   /locus_tag="DICTH_0584"
FT   CDS_pept        complement(590207..591688)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="guaB"
FT                   /locus_tag="DICTH_0584"
FT                   /product="inosine-5'-monophosphate dehydrogenase"
FT                   /EC_number="1.1.1.205"
FT                   /note="identified by match to protein family HMM PF00478;
FT                   match to protein family HMM PF00571; match to protein
FT                   family HMM TIGR01302"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0584"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19566"
FT                   /db_xref="GOA:B5YD59"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR001093"
FT                   /db_xref="InterPro:IPR005990"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR015875"
FT                   /db_xref="UniProtKB/TrEMBL:B5YD59"
FT                   /protein_id="ACI19566.1"
FT                   /translation="MNFDERFLGEALTFDDILLVPAYSEVTPKEVCVDTYLTERIHLNI
FT                   PILSAAMDTVTEARMAIAIAREGGLGIIHRNMSIERQAEEVDKVKRSEHGMITDPIFLH
FT                   PEQTVGEALSIMAKYHISGLPVVEKDGKLVGIVTNRDLRFETNMNKKVSEIMTKDNLIV
FT                   AQVGITIKDAQEILQKYKIEKLPIVDKDFKLRGLITIKDIQKMKQYPNAAKDKKGRLIA
FT                   GAAIGVGEEAIKRAKALVEAEVDVIVVDTAHGHHKRVLETVNELKKLFSKEVVIVAGNV
FT                   ATAEGTKALIDAGADVVKVGIGPGSICTTRVVAGIGVPQFSAIWECAKEAKKYNVPIIA
FT                   DGGIKFSGDITKAIAAGAHAVMLGSLLAGTEESPGEIEIYQGRSFKVYRGMGSLSAMKE
FT                   GSKDRYFQEQSEKLVPEGIEGRVPYRGPVSEVLFQLVGGLKSGMGYCGVKNLEELRTKT
FT                   KFIKITNAGLRESHPHDVIITKEAPNYSISTWESR"
FT   gene            591797..592999
FT                   /locus_tag="DICTH_0587"
FT   CDS_pept        591797..592999
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0587"
FT                   /product="Fe-S oxidoreductase family protein"
FT                   /note="identified by match to protein family HMM PF04055"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0587"
FT                   /db_xref="EnsemblGenomes-Tr:ACI20036"
FT                   /db_xref="GOA:B5YD60"
FT                   /db_xref="InterPro:IPR006158"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR023980"
FT                   /db_xref="UniProtKB/TrEMBL:B5YD60"
FT                   /protein_id="ACI20036.1"
FT                   /translation="MFYDNKQNKYSVNALLGALEGSFKPLEVEVISSEKLGSWLENIEK
FT                   NTVYIFCVSFFTTQFFEIEALLRKIKSKIENIKIIVGGPHASGDPESAIKIGADIVVVG
FT                   EGEKLFLDIIDRIISGEDVKGIFKAKGFVNLDEFSPFSLKFKRFGPIEISRGCPYGCYF
FT                   CQTPRIFGGVMRHRSVEKILDLVKVMNNLNLKDIRFVTPNAFAYGSNTGKDVNLVKIEE
FT                   LLSGIRKVIGKKGRIFFGSFPSEVRPEHVKEETLELVKTYANNDNLVIGAQSGSQRILD
FT                   LSHRAHTVEDVYKAVELTLKYNLKANVDFIFGLPYEEEKDIEETVRFIEELVKMGAKVH
FT                   AHTFMPLPGTPFAKFPPGKIEGLYKKVINRLLPKGVIFGNFREQEKIAWDLYKYFSSKE
FT                   E"
FT   gene            complement(592969..593829)
FT                   /locus_tag="DICTH_0586"
FT   CDS_pept        complement(592969..593829)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0586"
FT                   /product="membrane protein, putative"
FT                   /note="identified by match to protein family HMM PF00892"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0586"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19448"
FT                   /db_xref="GOA:B5YD61"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:B5YD61"
FT                   /protein_id="ACI19448.1"
FT                   /translation="MIKNKTEKEKAYIFLLIGITAMASASLIIRLTPAPPLIIASYRLL
FT                   IASLILFIINKNHIRIPKNIPILLLAGISLGIHFYTWISALFLTSVANAVVLVNTSPIF
FT                   ISLLTYIYEKRKPTKKFFFSLFLILIGIVLITNNKLSLRFGEGELLAILGAVTFAFYLY
FT                   IGRYLSSDLNVSSYITLVYFTGGITLLVFALLLRIPLVGYPINIYVNFLLLALIPQLIG
FT                   HTSANYAIRILSPNLTSIVLIGETVIATIFAFIFLKEKISLFQTIGIIFIIIGILYSSL
FT                   EEKYL"
FT   gene            complement(593834..594673)
FT                   /gene="nadC"
FT                   /locus_tag="DICTH_0588"
FT   CDS_pept        complement(593834..594673)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nadC"
FT                   /locus_tag="DICTH_0588"
FT                   /product="nicotinate-nucleotide pyrophosphorylase"
FT                   /EC_number="2.4.2.19"
FT                   /note="identified by match to protein family HMM PF01729;
FT                   match to protein family HMM PF02749; match to protein
FT                   family HMM TIGR00078"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0588"
FT                   /db_xref="EnsemblGenomes-Tr:ACI20133"
FT                   /db_xref="GOA:B5YD62"
FT                   /db_xref="InterPro:IPR002638"
FT                   /db_xref="InterPro:IPR004393"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022412"
FT                   /db_xref="InterPro:IPR027277"
FT                   /db_xref="InterPro:IPR036068"
FT                   /db_xref="InterPro:IPR037128"
FT                   /db_xref="UniProtKB/TrEMBL:B5YD62"
FT                   /protein_id="ACI20133.1"
FT                   /translation="MKSIPYLHLKKIVEEALEEDIGFGDITTESIVPEDMNSKAVIIAK
FT                   EEGILAGLPVAKAVFKTLESSVEFKELKKDGDKIKEGDIILEIIGKTKTILMGERTALN
FT                   FIQRLSGIATYTRKCVDMVRPYGVKILDTRKTTPTLRILEKYAVKIGGGENHRFALYDM
FT                   VLIKDNHIRVAGSIKEAIRRVRENVSHVYKIEVEVSNLEELKEALETQVDIVLLDNMDY
FT                   ETLKEAINMAKGKVLIEVSGKISMEDLEKIAKLGVDFISMGKLTHSFKSLDLSLEIL"
FT   gene            complement(594633..596267)
FT                   /gene="nadB"
FT                   /locus_tag="DICTH_0589"
FT   CDS_pept        complement(594633..596267)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nadB"
FT                   /locus_tag="DICTH_0589"
FT                   /product="L-aspartate oxidase"
FT                   /EC_number="1.4.3.16"
FT                   /note="identified by match to protein family HMM PF00890;
FT                   match to protein family HMM PF01266; match to protein
FT                   family HMM PF02910; match to protein family HMM PF07992;
FT                   match to protein family HMM TIGR00551"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0589"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19498"
FT                   /db_xref="GOA:B5YD63"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR005288"
FT                   /db_xref="InterPro:IPR015939"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR037099"
FT                   /db_xref="UniProtKB/TrEMBL:B5YD63"
FT                   /protein_id="ACI19498.1"
FT                   /translation="MTERFITPFSSEDFEKEYDLIIIGSGIAGLISAYYAPENLKIALL
FT                   SKDKLEESNTYYAQGGIAVALNPEDSPELHYKDTLNAGAEFNEEKIVRIVVHEGIERVK
FT                   DLIKLGVNFDKHNGLSFTKEAAHSKRRILHAQGDATGYEIARVMINLVRNKNNIDIYEH
FT                   HMLVDLLTHEDEVYGGIFFDTKEKKIKIFTSRYTILATGGAGQLYLHTTNPLTATGDGL
FT                   AVAFRAGARIMDLEFFQFHPTALDIDSPQRFLISEAVRGEGAHLLNAFGERFMLNYHPL
FT                   AELAPRDVVTRAIFFEMTETQDKIYLDLRPIGEKRIKDRFPNIYKKCMEYGIDITKDLV
FT                   PVSPAAHYFMGGIETDENGRTSLKNLYACGEVACTGLHGANRLASNSLLEGLVFGKRCI
FT                   DTILNEDPAKPRSIPNNKSIHVNSFSLGEVEKMIKILRKTLWEKVGIIREEKELKEAEN
FT                   IIHENLYEKLGSCTIIDRSFFELKNMLLISKLMINSALIRKESRGAHFRLDYPKSKEEW
FT                   RKHIIWEREKEVIFCEVNSLPSFKKNR"
FT   gene            complement(596264..597160)
FT                   /gene="nadA"
FT                   /locus_tag="DICTH_0590"
FT   CDS_pept        complement(596264..597160)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nadA"
FT                   /locus_tag="DICTH_0590"
FT                   /product="quinolinate synthetase complex, A subunit"
FT                   /note="identified by match to protein family HMM PF02445;
FT                   match to protein family HMM TIGR00550"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0590"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18692"
FT                   /db_xref="GOA:B5YD64"
FT                   /db_xref="InterPro:IPR003473"
FT                   /db_xref="InterPro:IPR023066"
FT                   /db_xref="InterPro:IPR036094"
FT                   /db_xref="UniProtKB/TrEMBL:B5YD64"
FT                   /protein_id="ACI18692.1"
FT                   /translation="MTIQEKIQKLKREKNAIILAHNYQLPEVQDIADFVGDSLELARIS
FT                   AQVKEEVIIFCGVHFMAETASILAPNKKVILPDLFAGCPLANTITPEDVKSLKEKYKNY
FT                   AIVAYVNTSAKVKAESDYICTSANAISVVEKIPEEKIIFIPDRNLGYYVSKHTKKEMII
FT                   WNGFCPTHQRILPQDIINLKEKYKDAKVVVHPECRKEVLDLADKIASTSGIIKFVKEDD
FT                   GKRYIIGTEAGLLHRLRKENPEKEFYLASSLAVCPNMKKITLDKILTSLENLEPEVKVE
FT                   ESVREKALKPIERMLNL"
FT   gene            complement(597232..597534)
FT                   /locus_tag="DICTH_0591"
FT   CDS_pept        complement(597232..597534)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0591"
FT                   /product="PglF"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0591"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19313"
FT                   /db_xref="GOA:B5YD65"
FT                   /db_xref="InterPro:IPR010445"
FT                   /db_xref="UniProtKB/TrEMBL:B5YD65"
FT                   /protein_id="ACI19313.1"
FT                   /translation="MSTVIIVLLVGIILALLFSFQNQSLVTIYFLNWSFEEKISTVLFL
FT                   TFAAGVILAFISTLPTIIKDKRTISKLNKRIKELEKNISLNKETLPEQDNRVNNK"
FT   gene            597497..597616
FT                   /locus_tag="DICTH_0592"
FT   CDS_pept        597497..597616
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0592"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0592"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18436"
FT                   /db_xref="UniProtKB/TrEMBL:B5YD66"
FT                   /protein_id="ACI18436.1"
FT                   /translation="MIPTSSTIITVLTISHLLKKEGEIYILPLLRFFIFYNLK"
FT   gene            complement(597619..598224)
FT                   /locus_tag="DICTH_0593"
FT   CDS_pept        complement(597619..598224)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0593"
FT                   /product="acetate kinase"
FT                   /note="identified by match to protein family HMM PF06130"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0593"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18432"
FT                   /db_xref="GOA:B5YD67"
FT                   /db_xref="InterPro:IPR008300"
FT                   /db_xref="UniProtKB/TrEMBL:B5YD67"
FT                   /protein_id="ACI18432.1"
FT                   /translation="MKEVKVPIGVSARHVHLSQDDLERLFGKGYELHPLKPLSQPGQFA
FT                   AEEEVELIGPKRSLKVRILGPVRKNTQVELALTDVIYLGLPSIPPVRDSGDVEGTPGIK
FT                   IKGPLGEIEIPKGVIIAWRHIHTPEDIAKDLGLVDKQLVKVKVEGPRALTFENVLIRVS
FT                   NKFAWEFHIDTDEANAAMVKTGDIATVIFEPAKIMQKI"
FT   gene            complement(598322..600202)
FT                   /locus_tag="DICTH_0594"
FT   CDS_pept        complement(598322..600202)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0594"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0594"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19067"
FT                   /db_xref="InterPro:IPR032583"
FT                   /db_xref="UniProtKB/TrEMBL:B5YD68"
FT                   /protein_id="ACI19067.1"
FT                   /translation="MIREEISYLVLPKEVENILLSCKKIIIPESREHFLELALGGKNNM
FT                   EFEVKYEVPGKGEVVEAIITRAKNGIVVNYTDPYMRRRDPDSLVIGDEGDTDKPTFKER
FT                   FGEDFDTLREKTFNWLKEQELIVMPFMAGGYELGYPSLLIAPSNAGFFAWALADIQGFI
FT                   PKSQLRDNFEPIAIVYVAPPFRHTHFSGKQIVVHYRSDGRHEVFSYNLYPGPSAKKGVY
FT                   GVLLNIGEMEGWITAHASTVKIVTPYDNELVILHEGASGGGKSEMIQQMHREKDNRILV
FT                   GENIVTGEKYYIEIKESCEIFPVTDDMALCHPRLQNGSGKMVIKDAEQGWFVRVDQIKR
FT                   YGVDPQLESITIHPPEPLIFLNIEGHPGATALIWEHTMDEPGKPCPNPRVILPRRFVPN
FT                   IIDEPVEVDVRSFGFRTPPCTKDKPTYGIVGLFHVLPPALAWLWRLVSPRGYDNPSITS
FT                   GDLMSSEGVGSYWPFATGKMVKHANLLLQQILDYPRTQYILIPNQYIGAYRVGFMPEWI
FT                   VREYLAKRGSARIKPDNLKPARCSLLGFALETLKVEGHYIPKALLQVDQQPEVGPEAYD
FT                   KGAEMLKAFFKKELQKFISLDLDPLGKRIIECCLEDGTLEDYIKLIPPRR"
FT   gene            600379..601707
FT                   /locus_tag="DICTH_0596"
FT   CDS_pept        600379..601707
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0596"
FT                   /product="folylpolyglutamate synthase"
FT                   /EC_number="6.3.2.17"
FT                   /note="identified by match to protein family HMM PF02875;
FT                   match to protein family HMM PF08245; match to protein
FT                   family HMM TIGR01499"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0596"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18960"
FT                   /db_xref="GOA:B5YD69"
FT                   /db_xref="InterPro:IPR001645"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR018109"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:B5YD69"
FT                   /protein_id="ACI18960.1"
FT                   /translation="MYWDSLNYVNSFINYEKRLDNLTYEEKKFYLERMRYLLQLMGNPQ
FT                   DNLQAFHIAGTKGKGSTSAMIFSILKSAGYKVGLYTSPHLQSIRERIATHEGFISQEEF
FT                   VDLIDYAKPYIEEAKKHPIFGSPTFFEVLTALAFLYFSMKKLDYVVIEVGLGGRLDATN
FT                   VINPLISIITPIGFDHMHILGDTLEKIAFEKAGIIKEGKIVISSPQKKEAEEVIERVSR
FT                   ERNAVYYKVDDLFSWRKKEANLDGQKFLLEGRDIKEEFFIPLLGEHQIVNAVTAYGAIY
FT                   VLKNRLNIDNEVVKKGFENVQWRGRFQIINKNPLIVVDGAHNVDSAMALKNTLESYVNF
FT                   DRLFLICGIMKDKDAEKFLKILDPLVYSYNFIPLPSHRTRTPEELANIVKVFRPNAEIN
FT                   IYDNFSSAISFVNKKASPADLILITGSLYLAGEALDYFYGRLD"
FT   gene            complement(601704..602387)
FT                   /locus_tag="DICTH_0595"
FT   CDS_pept        complement(601704..602387)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0595"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF00085;
FT                   match to protein family HMM PF00462; match to protein
FT                   family HMM TIGR02187"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0595"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19712"
FT                   /db_xref="GOA:B5YD70"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR011767"
FT                   /db_xref="InterPro:IPR011903"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B5YD70"
FT                   /protein_id="ACI19712.1"
FT                   /translation="MALLREEDRQYLENLFKENLKDKVKIILFSDKAAGSKLVVPGRVE
FT                   CPYCQQTREILEELVSLSDKLELEIHDFLTDEIIAKKYNVDKIPAILFEKNNNVLGVRY
FT                   FGIPSGYEFSSLIEDILDISRGETQLSPTTKAFLATVNKPVHIQVFVTPTCPYCPRAVR
FT                   LAHQFAMENPLITADMIEAIEFPHLAEKYNVTGVPKTIINEKVEIEGAVPENIFLEYFK
FT                   SALKD"
FT   gene            complement(602390..603361)
FT                   /gene="trxB"
FT                   /locus_tag="DICTH_0597"
FT   CDS_pept        complement(602390..603361)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trxB"
FT                   /locus_tag="DICTH_0597"
FT                   /product="thioredoxin-disulfide reductase"
FT                   /EC_number="1.8.1.9"
FT                   /note="identified by match to protein family HMM PF00070;
FT                   match to protein family HMM PF01134; match to protein
FT                   family HMM PF03486; match to protein family HMM PF07992;
FT                   match to protein family HMM TIGR01292"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0597"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19544"
FT                   /db_xref="GOA:B5YD71"
FT                   /db_xref="InterPro:IPR005982"
FT                   /db_xref="InterPro:IPR008255"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B5YD71"
FT                   /protein_id="ACI19544.1"
FT                   /translation="MDFISLTKPIEKIEEEQDVIILGGGPAGLTAGIYAGRNLWRTLII
FT                   EKAIVGGNAALTEKIDNYPGFPEGITGEELVKRMEAQAKKFGSKILEADVLSLKIDGNW
FT                   KIVETSNGVFRAPTLIIATGTRPKKLGVPGEKEFIGKGVSYCAVCDGAFFTGKKVAVIG
FT                   GGDSAVEEAIYLTKFAEEVTIIHRRDTLRAEKINQQRAFSNPKIKFLWSHIVKAIEGEK
FT                   KVEKLILEDLKTGETKIFPVDGVFIYIGLIPNTELFKGILNLDSNGFIITDEKMHTSIP
FT                   GIYAAGDVRGKILRQVVTAVSDGAIAGMEASKFLEELNYKEV"
FT   gene            complement(603436..604287)
FT                   /locus_tag="DICTH_0598"
FT   CDS_pept        complement(603436..604287)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0598"
FT                   /product="oxidoreductase, putative"
FT                   /note="identified by match to protein family HMM PF00248"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0598"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19895"
FT                   /db_xref="GOA:B5YD72"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:B5YD72"
FT                   /protein_id="ACI19895.1"
FT                   /translation="MVQKRPYGKKGELLSIIGFGGILVMNEEQREATRRVAEAIDLGIN
FT                   YFDVAPSYGDAEDKLGPALRRKRKNIFLACKTMERTKEKAWEELQNSLKKLETDYFDLY
FT                   QLHAMTTEEDFQLATGPNGALETFVKAKKEGIIRYIGFSAHSVDVALKLLDVFDFDSIL
FT                   FPINWVNFFNGNFGPQVVQKAQEKNVTILALKAMAKTIIPEGQERKYPKCWYDPIDEKD
FT                   LAQLALRFTLSQPVTAAIPPGEYKFFKWAIEVGENFTPITVEELEILKQRAKNLEPIFK
FT                   VS"
FT   gene            604473..605850
FT                   /pseudo
FT                   /locus_tag="DICTH_0599"
FT                   /note="sodium-driven multidrug efflux pump protein,
FT                   authentic frameshift; this gene contains a frame shift
FT                   which is not the result of sequencing error; identified by
FT                   similarity to SP:Q9WZS2; match to protein family HMM
FT                   PF01554"
FT   gene            605828..606526
FT                   /gene="lipB"
FT                   /locus_tag="DICTH_0601"
FT   CDS_pept        605828..606526
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lipB"
FT                   /locus_tag="DICTH_0601"
FT                   /product="lipoyltransferase"
FT                   /note="identified by match to protein family HMM PF03099;
FT                   match to protein family HMM TIGR00214"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0601"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18548"
FT                   /db_xref="GOA:B5YD73"
FT                   /db_xref="InterPro:IPR000544"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="InterPro:IPR020605"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5YD73"
FT                   /protein_id="ACI18548.1"
FT                   /translation="MKKLLVIDFREKIKYEDAWDLQKKLHDLRVKDTIYDTLILLEHFP
FT                   VITLGKFGDEKNLLKTKEELKSMGIDFIRVDRGGDITYHGPSQLVGYFIFKVDGVKNFV
FT                   LKVEKSIINVLHEYGIEAKESIEYPGVWVEDRKITAIGIAIKKRVSYHGFALNVNNDLA
FT                   PFSYIIPCGLKDKKVTSILKEANFSPPMEDVKRKVCLSVVKEFGFDSFMVFNFSSCKEL
FT                   SNFGMLLEDL"
FT   gene            complement(606825..607814)
FT                   /locus_tag="DICTH_0602"
FT   CDS_pept        complement(606825..607814)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0602"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF07251"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0602"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19589"
FT                   /db_xref="GOA:B5YD74"
FT                   /db_xref="InterPro:IPR022853"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5YD74"
FT                   /protein_id="ACI19589.1"
FT                   /translation="MSLLWGFLILILVLIFLGIFFSFVPLGLWISALAAGVSIKITDLI
FT                   GMRLRRVPPGVIINSLIKAHKAGLSEVTLDKLEAHYLAGGNVDKVVNALIAAQRAGIPL
FT                   TFEKAAAIDLAGRDVLEAVQMSVNPKVIETPVVAAVAKDGIELKAKARVTVRANIERLV
FT                   GGAGEATIIARVGEGIVTTIGSAESYKEVLENPDSISKTVLAKGLDAGTAFEIVSIDIA
FT                   DVDVGNNVGARLKMDQAEADMRIAQAQAESRRALAIAREQEMKALTQEMRARLIEAEKE
FT                   VPLAVAEALRSGKIGVLDYYTLKNIMADTAMREAISKLGQKEEEGRKD"
FT   gene            complement(607811..609082)
FT                   /locus_tag="DICTH_0603"
FT   CDS_pept        complement(607811..609082)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0603"
FT                   /product="YqeZ"
FT                   /note="identified by match to protein family HMM PF01957"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0603"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18818"
FT                   /db_xref="GOA:B5YD75"
FT                   /db_xref="InterPro:IPR002810"
FT                   /db_xref="InterPro:IPR002825"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:B5YD75"
FT                   /protein_id="ACI18818.1"
FT                   /translation="MKKIFITIFLLFLILSSIYAQNQNVYIIPIKGTIELGLASFVERS
FT                   IREHPNAKAFIFEIDTFGGRVDAAIKIRDTILATPTLTIAFIKDRAWSAGALIALSCEK
FT                   IVISPSGSIGAAEPRPADEKTISALKAEFESTAKKRNRNPKIAAAMVDADEVIPGLKQK
FT                   GKILTLYAEEAKKWKIADEILENTDSVIKFFNLEKGKIIELQPNWAENFVRFITDPTVS
FT                   SIILTVGMLSLYVAIFTPGLGVPELLALVCLGLFFGGHYLAGLAGLEPVILFLLGLILI
FT                   FIEMHTPGFGIPGIAGSISVFLSIYWTIVQKGGTLQALLTGILVVLSLIIFLAIYLPKS
FT                   RVWIKFGLPESQKKDLGYTAFQERKDLIGKKGKTITMLRPTGIIEIEGEKFEAYSESEF
FT                   IEPSEEVIVFKVEGNKIFVRRSEK"
FT   gene            complement(609084..609548)
FT                   /locus_tag="DICTH_0604"
FT   CDS_pept        complement(609084..609548)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0604"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0604"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19932"
FT                   /db_xref="GOA:B5YD76"
FT                   /db_xref="UniProtKB/TrEMBL:B5YD76"
FT                   /protein_id="ACI19932.1"
FT                   /translation="MENLVISRLRILTFLFIAVYLLPNSFFDDLRIWLLILFALLYSSI
FT                   VYYFVAREKLQENLTLSIIDLLIVFFYLFLINQMATKFVFLIYLPAIKEILYRRIKNAY
FT                   IISFMGNLGVIVLSFILKENLPLEISLSLIPISFLIPYFSSSYIKEMEGS"
FT   gene            complement(609588..610886)
FT                   /locus_tag="DICTH_0605"
FT   CDS_pept        complement(609588..610886)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0605"
FT                   /product="ABC transporter ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0605"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19965"
FT                   /db_xref="GOA:B5YD77"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR018632"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B5YD77"
FT                   /protein_id="ACI19965.1"
FT                   /translation="MELLRLENITVSFKFPEGEITVLDNINFTVNEGDFIALLGPSGSG
FT                   KSTILRIIAGLLKPNKGKVYYKGKEIKGVNPGVAMVFQNFALFPWLTVLENVELGLKAK
FT                   GVPPEERRERAIKAIDLIGLDGFENAYPKELSGGMKQRVGFARALVMDPDILLLDEPFS
FT                   ALDVLTAENLRNDLIELWIEKRIPTKAIILVTHSIEEAVYMADRVLLLSKDPGRIIKEV
FT                   KITLPHWRDKKSQEFLDIVDEIYGVLTGKPVERISAKEKKPLHIPQASVGSITGLVELV
FT                   NDLEGKADIYKLGEELLMDVEDLLPIIEACEILGFAEIREGDIILTEAGREFAEADVLE
FT                   RKEIFKKLAIEKVPFLKQIVKLLQSKSNHKMPRSFFLDLLKQHLSPQEAEKELDILIDW
FT                   GRYAELFEYDDDRDELYLPETSELLVNVQKQEE"
FT   gene            complement(610908..612620)
FT                   /locus_tag="DICTH_0606"
FT   CDS_pept        complement(610908..612620)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0606"
FT                   /product="ABC transporter permease protein"
FT                   /note="identified by match to protein family HMM PF00528"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0606"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18788"
FT                   /db_xref="GOA:B5YD78"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B5YD78"
FT                   /protein_id="ACI18788.1"
FT                   /translation="MSRVIWSPTRYRRFSLGDIIILLFIGSIIYAISSLNTIYSKPTEV
FT                   ISLDLSPQKLPLYSLFSLLRMILAYFISLIFTIVYAYTAAYKKSLEKILIPLLDILQSI
FT                   PVLSFLPPVFMAVISMFPGSKLGLEITSIILIFTGQVWNMVFSFYQSLISIPRDLKEAA
FT                   QLFKLNPWQRFWYLELPYSAIGLIWNSMMSWAGGWFFLMACEMFTLTNQNFVLPGLGSY
FT                   LSFAALKGDLLKIFYGLFALITVIILLDQLVWRPLLSWSQKFKVEYVQAEEYYESKVLL
FT                   WYRRSRIFDLLYKKIILPLRERLEILFISYYDKKEKQEIKTSKISKLLNLIVSTILIFL
FT                   VLRGFIGLLKLIINLPLNMWKDIIYSAFLTLLRVTTAVLIALSWTLPLGVRIGMNPKLS
FT                   KVIQPIVQIVASVPATAIFPVIVMYLINLPGGLNIASIVLMLLGTQWYLLFNIIAGGMS
FT                   IPNDLIEVSELLKLSKIDKWKILIIPSILPFLVTGGITAMGGAFNASIVSEYIEFHNQI
FT                   YKIKGLGALITEASSKGNNSLLAASTLVMALIVVTINRLFWKRLFKKSEELLS"
FT   gene            612904..615381
FT                   /locus_tag="DICTH_0607"
FT   CDS_pept        612904..615381
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0607"
FT                   /product="glycoside hydrolase, family 57"
FT                   /note="identified by match to protein family HMM PF03065"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0607"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18464"
FT                   /db_xref="GOA:B5YD79"
FT                   /db_xref="InterPro:IPR004300"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:B5YD79"
FT                   /protein_id="ACI18464.1"
FT                   /translation="MGKLYVSFIWHMHQPYYKDTSKSLSIFPWVRFHGIKNYYNMVSIL
FT                   KDFPKIKQTFNFVPSLLLQIQEYLDRRTTDLWLEKSLKKASELNMEDKKFILDNFFLLN
FT                   KEKMGFIFPRFKELYYKKLNNEEYTVQDFLDLQVLYNLAWFDPDLRKKDSFLIYLVEKG
FT                   KNFTEEEKLKVIEKQFEILRGLFSLYRSMQDSGQIEVIFSPFFHPIMPLLIDTKSAKVS
FT                   TPELPLPFDYFSFKEDAEKQLFLGKEYYRKLFDKDPLGIWPSEQAVSPEFVEMVSEFNI
FT                   KWFVSDERILFKSLGEDFLRDNEEFINKPEILYKPYRINLNGKEVYAVFRDQVLSDRIG
FT                   FVYMNYPPEDGAKDLYYRLLKIKNSLPQNSDFLVTIALDGENCWEYYDNDGRDFLRNLY
FT                   TLLSDSKELETITVKDFIEKTKNFGELNNIFTGSWINADLTTWIGEIEENLAWEYLTIT
FT                   RKFVEKKKDRVDWISLMAAEGSDWFWWYGDDQESGYDEIFDEIFRSHLKNVYRSINKAY
FT                   PSFLDFPIVFRNPLWRSRRSLIFTPKIDGIITSKDEWVLSSLNLLEEKKSEFITGIYYG
FT                   YDLSNLYMRIDLMDKAEKYFNDDYFIVINFYSRNKGSCKYRLDLRNELCGDNISLKIKD
FT                   IVEVSIPWDKFTGFDRNSTIHFKVDLCKNTEMVESLEDTENFWFEIPNLMDEIITKLFL
FT                   FGDPSRKVELSTMLISRKKVYNLYSKVSILQDSLKKDFVKIENKGEIIEVTKHISLREL
FT                   LFLIQCVRDLKVFGILDKYVCAPVGRVSKTEGIYVIEPKVFVHDFLKKYIEKEKLEVPI
FT                   EMDKLGRIEIYGL"
FT   gene            615371..616057
FT                   /locus_tag="DICTH_0609"
FT   CDS_pept        615371..616057
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0609"
FT                   /product="endonuclease V"
FT                   /EC_number="3.1.21.7"
FT                   /note="identified by match to protein family HMM PF04493"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0609"
FT                   /db_xref="EnsemblGenomes-Tr:ACI20107"
FT                   /db_xref="GOA:B5YD80"
FT                   /db_xref="InterPro:IPR007581"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5YD80"
FT                   /protein_id="ACI20107.1"
FT                   /translation="MDYESKYFKWLGYEETVRLQKEISEKIIKEDAFKNLRYVGGVDTS
FT                   SIEDKIAGVIVVLEFNTLEVLEVSIEISQVNFPYIPGFLSFREGPIILKAWENLKIKPD
FT                   LLIFDGQGIAHPRRLGIASHVGYVLDVPSIGCAKKILVGVYKEPDKKRGSFEYIYIDNE
FT                   IVGAVVRTKDNVKPVFVSLGHKISLSTSIEIILKTSTKYRLPEPVRLAHIYSKKALNFE
FT                   IKGELL"
FT   gene            complement(616025..617101)
FT                   /locus_tag="DICTH_0608"
FT   CDS_pept        complement(616025..617101)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0608"
FT                   /product="conserved protein"
FT                   /note="identified by match to protein family HMM PF05559"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0608"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19871"
FT                   /db_xref="InterPro:IPR008482"
FT                   /db_xref="UniProtKB/TrEMBL:B5YD81"
FT                   /protein_id="ACI19871.1"
FT                   /translation="MLKREIAELPLHSGKAPFWLFQRMKKLSREIILLFAVENKIDELL
FT                   KKLSDPFWFQALGCVLGFDWHSSGLTTTTGAALKEGLGELSHEIGLYIVGGKGKAGLNT
FT                   PEEIKRLAEKEGFDPQKWILVSRTVARVDNNAIQDGYQLYHHLLIFTKEGNWCVIQQGM
FT                   NENNNFARRYHWLGEEVKSFIEEPHKGIITQKFENYVINLVAKESKPAQEVITQLMNEK
FT                   PDKVLKLWNEVSLKLPSYHPITPKEIRPENLKTILLKTYEAPPKDFQEVLLKEGVGSKT
FT                   LRALTLISELVYNTPASIKDPARFSFAHGGKDGHPYPVDRENYDKTIELLEKAIKNAKL
FT                   GRREEIETLKKLSFYFKV"
FT   gene            617158..617640
FT                   /locus_tag="DICTH_0610"
FT   CDS_pept        617158..617640
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0610"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF02643"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0610"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19208"
FT                   /db_xref="GOA:B5YD82"
FT                   /db_xref="InterPro:IPR003795"
FT                   /db_xref="InterPro:IPR038695"
FT                   /db_xref="UniProtKB/TrEMBL:B5YD82"
FT                   /protein_id="ACI19208.1"
FT                   /translation="MKKRTVFFTTIFTILLMIVMFSLLSLGKENSPKFPRGRLLITQGD
FT                   KSLEIPIEIADRDELWTLGLMYRKSIPWEYGMLFVFPYDTNAGFWMKNTYVPLDIAFIL
FT                   EDGTIINIQRMEPCKDELNCPIYFSPKPYRYALEVRAGFFERYGFSVGAKIKYWRE"
FT   gene            617711..617896
FT                   /locus_tag="DICTH_0611"
FT   CDS_pept        617711..617896
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0611"
FT                   /product="conserved domain protein"
FT                   /note="identified by match to protein family HMM PF00037"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0611"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19845"
FT                   /db_xref="GOA:B5YD83"
FT                   /db_xref="InterPro:IPR001080"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:B5YD83"
FT                   /protein_id="ACI19845.1"
FT                   /translation="MSAPKIDRDLCIGCGVCASLCPDVFEIDEEGKAVVREGADCESAG
FT                   CCQDAADSCPVGAITL"
FT   gene            617972..619360
FT                   /locus_tag="DICTH_0612"
FT   CDS_pept        617972..619360
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0612"
FT                   /product="TldD protein"
FT                   /note="identified by match to protein family HMM PF01523"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0612"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19002"
FT                   /db_xref="GOA:B5YD84"
FT                   /db_xref="InterPro:IPR002510"
FT                   /db_xref="InterPro:IPR025502"
FT                   /db_xref="InterPro:IPR035068"
FT                   /db_xref="InterPro:IPR036059"
FT                   /db_xref="UniProtKB/TrEMBL:B5YD84"
FT                   /protein_id="ACI19002.1"
FT                   /translation="MISKSIAEEILEISLSKGGDFSELFFEVSNSLYFYFDDNKLEEAV
FT                   AGEDVGVGLRVILGDRTFYGYTTDISLMGLRKLAKNLAEAVFQGDKDIKVVLSEKDEYG
FT                   IRPLKDIGSFEIKEGKDILKIMNEKARGYDSRIVQFTSVIRTVDQKILIANTEGDFIED
FT                   RRVRTAVYGLSVGSYNGIIQTGYETVAGTVGWELLTEEVINKIPYEASRRAILLLEAKE
FT                   APAGVMPVVISSKAGGVLIHEAVGHGLEADLVDKGVSVYKGKIGEKVASELVTMVDAGV
FT                   LEGMYGSSAVDDEGVKTNYNVLIDRGILKGYMHSRITAKKFNVRPSGNGRRQNFRYPPI
FT                   PRMTNTFILPGESKVEDMLQRLERGIYVVKMGGGQVDTTSGDFVFGIEEGYLVINGEIK
FT                   HPIRGATLIGNGPKILEKIEMIGNDIGFAPGTCGKDGQGVPVTDGMPTLFISEITIGGT
FT                   EKGE"
FT   gene            619366..620676
FT                   /locus_tag="DICTH_0613"
FT   CDS_pept        619366..620676
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0613"
FT                   /product="putative PmbA protein"
FT                   /note="identified by match to protein family HMM PF01523"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0613"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18787"
FT                   /db_xref="GOA:B5YD85"
FT                   /db_xref="InterPro:IPR002510"
FT                   /db_xref="InterPro:IPR035068"
FT                   /db_xref="InterPro:IPR036059"
FT                   /db_xref="UniProtKB/TrEMBL:B5YD85"
FT                   /protein_id="ACI18787.1"
FT                   /translation="MTVDLFKLIEDLRKQKIECEIFFQEREKSTLVISRQEVENYQISR
FT                   EYGIGVRVIKDGKHGFSYTTNLDKIDETIQRAIELSQVMEEDENWKFSKDLDLKDFKYY
FT                   PEEPSFQEKIKRLVELEKEIYSKDKRVKTVRNIVWEKTTDNNRIISTTGLSLEYNQQYQ
FT                   YIYTEIGASDGTNERSGFEFDVARSWNELEFDKLVEKVVWQATSLLGALPKKTQSVDII
FT                   LPAERASEFLELISELFSAENVQKGKSVLKGLLGESVASPILSIVEDPLSEKALIPRLF
FT                   DDEGIKTYQKYFIRNGVLENFAYNVYSANKEGKNSTGNGVRGSFKSLPQVDYFNLYIEP
FT                   RDKSEDELIKSVRNGVYVISLMGLHLADTISGDFSLGIEGLWIKDGELAEPVAEMTISG
FT                   NLKDFLKNITGIGNKLDLKGNINSPMLKLEDITLAGK"
FT   gene            620699..621178
FT                   /locus_tag="DICTH_0615"
FT   CDS_pept        620699..621178
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0615"
FT                   /product="rubrerythrin subfamily"
FT                   /note="identified by match to protein family HMM PF02915"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0615"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18540"
FT                   /db_xref="GOA:B5YD86"
FT                   /db_xref="InterPro:IPR003251"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="UniProtKB/TrEMBL:B5YD86"
FT                   /protein_id="ACI18540.1"
FT                   /translation="MVKMFSSQDLIEMAIHIEEEGEKFYELMGSKVEDEELKKLFSYLA
FT                   LEEKRHALAFKEIYSRLENEGFVSAYPDQEANKYLHAFVDSQIFIDWDKLSTRTVWSLS
FT                   EVLDLAISLEKDSILFYYEMEKYIPEKDKNILYEIIKQEKMHLSQLTEFKKGIKN"
FT   gene            complement(621175..622035)
FT                   /gene="dapF"
FT                   /locus_tag="DICTH_0614"
FT   CDS_pept        complement(621175..622035)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dapF"
FT                   /locus_tag="DICTH_0614"
FT                   /product="diaminopimelate epimerase"
FT                   /EC_number="5.1.1.7"
FT                   /note="identified by match to protein family HMM PF01678;
FT                   match to protein family HMM TIGR00652"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0614"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19844"
FT                   /db_xref="GOA:B5YD87"
FT                   /db_xref="InterPro:IPR001653"
FT                   /db_xref="UniProtKB/TrEMBL:B5YD87"
FT                   /protein_id="ACI19844.1"
FT                   /translation="MVEFVKSHGLGNDYIVFDKTQINFPLTEKNIRLICDRNRGVGSDG
FT                   ILVLEKINNQEFKVRIFNPDGSEAEKSGNGIRILAKYIYDYKYTTEKEFFIYTLGGKVK
FT                   ASVIEEQNGRAKTIEVEMGKVTFRSSEIPVAGPEREVIDEELKINGEILKITCLSIGNP
FT                   HCVFFVDEIDEEKIKSLGPKIENNPIFPNRINVQMVKVLDSNKIEIRIWERGAGYTLAS
FT                   GSSSCAAASAAYRKGLVNNQVEVIMPGGTLHIRINPDWSVNLIGPVEEVFKGELSEEML
FT                   YKLKD"
FT   gene            622170..623918
FT                   /locus_tag="DICTH_0616"
FT   CDS_pept        622170..623918
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0616"
FT                   /product="thermostable DNA ligase"
FT                   /EC_number="6.5.1.1"
FT                   /note="identified by match to protein family HMM PF01068;
FT                   match to protein family HMM PF04675; match to protein
FT                   family HMM PF04679; match to protein family HMM TIGR00574"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0616"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19645"
FT                   /db_xref="GOA:B5YD88"
FT                   /db_xref="InterPro:IPR000977"
FT                   /db_xref="InterPro:IPR012308"
FT                   /db_xref="InterPro:IPR012309"
FT                   /db_xref="InterPro:IPR012310"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR016059"
FT                   /db_xref="InterPro:IPR022865"
FT                   /db_xref="InterPro:IPR036599"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5YD88"
FT                   /protein_id="ACI19645.1"
FT                   /translation="MLFGELAQYFERIEKTTKRNEMMEILADLFRKVDKEEIDKIIYLL
FT                   NGRVAPDYEKIEFGMSDKLVLRAMALALKIPLLELERSYKEVGDLGELVVKYSKNEGKD
FT                   LTVVETFNTLYDIANLSGEGSVDAKVNRLAFLINSLTPQGGKYLVRIVLGKLRLGVGEP
FT                   TIMDALSFAKVKDKGLRPFIERAFNITSDLGYVAKVFWEGGVEALKRIKVQVGRPIRMA
FT                   LAERVSRAEEIIKRLGKCAVEPKFDGFRCQIHKKENSVRIFSRNLEDNTYMFPDLVEAV
FT                   LKQFPDRDVIIEGEAISYNPETGEFYPFQVTVQRKRKYNISEMVELYPLQLFAFDILYL
FT                   DGEDTTSLPYIRRRQKLEEALVEGEKISITKNIITNDPKEIQSFFEECITEGLEGIVAK
FT                   RLDAPYQAGMRNFNWIKLKRSYQGHLADTVDCVILGYFKGRGHRAKFGIGALLVGVYDD
FT                   ERDLFKTIAKIGTGPTEEEWVKFREILDEIKVEKRPNNVESFIEPDVWVEPKYVVVVQA
FT                   DEITRSPVHTCGRELDGLGYALRFPRVQGFVREDKGPYDATTVKEILEMFRNQKKEKVE
FT                   EDSDLL"
FT   gene            624121..625660
FT                   /gene="rrs_1"
FT                   /locus_tag="DICTH_0617"
FT   rRNA            624121..625660
FT                   /gene="rrs_1"
FT                   /locus_tag="DICTH_0617"
FT                   /product="16S ribosomal RNA"
FT   gene            625788..628799
FT                   /gene="rrl_1"
FT                   /locus_tag="DICTH_0621"
FT   rRNA            625788..628799
FT                   /gene="rrl_1"
FT                   /locus_tag="DICTH_0621"
FT                   /product="23S ribosomal RNA"
FT   gene            628864..628980
FT                   /gene="rrf_1"
FT                   /locus_tag="DICTH_0622"
FT   rRNA            628864..628980
FT                   /gene="rrf_1"
FT                   /locus_tag="DICTH_0622"
FT                   /product="5S ribosomal RNA"
FT   gene            complement(629004..631007)
FT                   /locus_tag="DICTH_0623"
FT   CDS_pept        complement(629004..631007)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0623"
FT                   /product="hdig domain protein"
FT                   /note="identified by match to protein family HMM PF01966;
FT                   match to protein family HMM TIGR00277"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0623"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19392"
FT                   /db_xref="GOA:B5YD89"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR006675"
FT                   /db_xref="InterPro:IPR011621"
FT                   /db_xref="InterPro:IPR011624"
FT                   /db_xref="UniProtKB/TrEMBL:B5YD89"
FT                   /protein_id="ACI19392.1"
FT                   /translation="MRKEILNYKGVYKFFKRLKTEVSKNLKQNLTLILTIFLLGDFLIL
FT                   SLDFVFIPPLKINDIAPKDIIATRTVIYRDESETERIKNLMLSQFKPIYTVDQNITIKV
FT                   LSKLSEVLSPTSEHSEVYNYISKFQLSTVNTIRKKIETWIIENYSKGIKEEEVKAKKQE
FT                   FIKFLTYELRFPQDIAQKLSDILIVPNMFIDVKETENKKTELIKSIKPIERIISKGDVI
FT                   LRKGEKVTPEKFQILETLGYTFSPKSILRFLCLFLFVALLHISLILILSYFGQMNIKDL
FT                   NIFLFINSIFLSALAISKIFSFYSTYLAPITTFLFIILSLMDFPDYAILSFLTILLSAI
FT                   FLRSFIIPIILMFDLIFIYRGLRNLEDRATYLKTSFMLTLIRIPILVLIKYAYPEVYIN
FT                   FSDLFYSIINPIISGILAIGLIPIIEDLFRLASPLKLFELTNPNHPLLRELIMEAPGTY
FT                   YHSLIVGNLAERAAEESGANPKIVRTASLYHDIGKVKRPQYFIENLLPNQKNPHDDLSP
FT                   YLSAIIIKSHPKDGAEILNKNKFPKNIIDIVEQHHGTSLLSYFYMKQKQLNPNQIIPEV
FT                   DFRYPGPKPKSKEAAIVMLADSVEAATRSLKNVTPENIEKVVRDVIRKKLNDGQLENSR
FT                   LTLEELEKISQSFIKTLIEVRHPRVPYPHEIR"
FT   gene            631071..631148
FT                   /locus_tag="DICTH_0624"
FT   tRNA            631071..631148
FT                   /locus_tag="DICTH_0624"
FT                   /product="tRNA-Gln"
FT   gene            631188..632096
FT                   /locus_tag="DICTH_0625"
FT   CDS_pept        631188..632096
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0625"
FT                   /product="bifunctional GcaD protein (TMS protein)"
FT                   /EC_number="2.7.7.23"
FT                   /EC_number="2.3.1.157"
FT                   /note="identified by match to protein family HMM PF00483"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0625"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19617"
FT                   /db_xref="GOA:B5YD90"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:B5YD90"
FT                   /protein_id="ACI19617.1"
FT                   /translation="MDNFKVIILAAGQGKRMRTELPKVLHPLYENTILEFLLDTVETVF
FT                   EKEYILVVSPKVKSYLSFVSDKNIVIQDKPLGTGDAVKRTEVLLKDYDGDVLILPGDMP
FT                   LIRGETLKKVCDFHRENSNACTVVTTILDNPLGYGRIIRDEKGNILKIVEEKDATEKEK
FT                   EVKEINTSIYAFKWKPLKEALMHLKNDNAQGEFYLTDVIEIFNKQKLKIGVIRVGSEEV
FT                   LGANTQEELSIIRGILKKRVNKNNMENGVIIVDPDKVVIGHKVVVENDVIVQPEVFIFG
FT                   DYIIRKNSYIGPFSYINSKSD"
FT   gene            632112..633053
FT                   /locus_tag="DICTH_0626"
FT   CDS_pept        632112..633053
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0626"
FT                   /product="ribose-phosphate pyrophosphokinase"
FT                   /EC_number="2.7.6.1"
FT                   /note="identified by match to protein family HMM PF00156;
FT                   match to protein family HMM TIGR01251"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0626"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18545"
FT                   /db_xref="GOA:B5YD91"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR000842"
FT                   /db_xref="InterPro:IPR005946"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR029099"
FT                   /db_xref="InterPro:IPR037515"
FT                   /db_xref="UniProtKB/TrEMBL:B5YD91"
FT                   /protein_id="ACI18545.1"
FT                   /translation="MGQKCLALYSGTSNRELAEEVAKYLGVELGEIEIRRFSDGEIYAR
FT                   IARSVRGAEVYVIQSLGSRVNEYFMELLIIIDALKRASAGEVTAVIPYYAYARQDRKTK
FT                   SREPITAKLVANLLTVAGASRVVTMDLHAGQIQGFFDIPVDNLSALPLFTRYFQDKNLK
FT                   DPVVVSPDIGGVTRARALADRLHTPLAIIYKRRPAPEVAEVEEIIGDVEGRDVIICDDI
FT                   ITTGNTLFSAAKLLKLKGARDIYAAVTHGILTNDAHKKLEESEIKELVVTNTLPIPVEK
FT                   RVPKLTIISIGNLLGEAIKRISNKDSLSSLFD"
FT   gene            633086..633709
FT                   /locus_tag="DICTH_0627"
FT   CDS_pept        633086..633709
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0627"
FT                   /product="ribosomal protein L25, Ctc-form"
FT                   /note="identified by match to protein family HMM PF01386;
FT                   match to protein family HMM TIGR00731"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0627"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19320"
FT                   /db_xref="GOA:B5YD92"
FT                   /db_xref="InterPro:IPR001021"
FT                   /db_xref="InterPro:IPR011035"
FT                   /db_xref="InterPro:IPR020056"
FT                   /db_xref="InterPro:IPR020057"
FT                   /db_xref="InterPro:IPR029751"
FT                   /db_xref="InterPro:IPR037121"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5YD92"
FT                   /protein_id="ACI19320.1"
FT                   /translation="MEITEIKLKKRDKIGKQYAKKYRRSNLIPGVVYGAHLKENIHVLV
FT                   EKKDLWNLIKKGHSKEQHILRLIIEDGENTITENAILQDIQIDPIKDDLLHVDFHAVSL
FT                   EEVVDVYVPVVLVGESKGVKQGGILQHGVEEILIRALPLDVPPHIEVDITDLEIGDSIT
FT                   VGDLNLPENIKVLTPADEVIVNIIPPKGYTEEASTEESQTESQS"
FT   gene            633735..634586
FT                   /locus_tag="DICTH_0628"
FT   CDS_pept        633735..634586
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0628"
FT                   /product="DegV family protein"
FT                   /note="identified by match to protein family HMM PF02645;
FT                   match to protein family HMM TIGR00762"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0628"
FT                   /db_xref="EnsemblGenomes-Tr:ACI20163"
FT                   /db_xref="GOA:B5YD93"
FT                   /db_xref="InterPro:IPR003797"
FT                   /db_xref="UniProtKB/TrEMBL:B5YD93"
FT                   /protein_id="ACI20163.1"
FT                   /translation="MIKIVTDSTAALPEEYVKRYDITVVPLKVAFGDEVYRDGVDITPE
FT                   IFFKKVKESSIFPKTSQPSVEEFYQAYKNIFDKYPDTEAIISIHISAKLSGTVGSANAA
FT                   RELLPQKDKIFVIDSKLTELALGVVVIELAKAVEKGAKVDDLIALAEKMHLHSSIKFTV
FT                   DTLEYLYRGGRIGAAQAWMGSILQIKPILELRDGAIEPVERVRTKQKVKSRIIELTKEY
FT                   AGSDPVKIAIAYSDNYEEVLEVAQEVKNSLNITDFYIGPFSCTILSHIGPGSWGIIVFK
FT                   EV"
FT   gene            634598..636145
FT                   /locus_tag="DICTH_0629"
FT   CDS_pept        634598..636145
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0629"
FT                   /product="single-stranded nucleic acid binding R3H"
FT                   /note="identified by match to protein family HMM PF01424"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0629"
FT                   /db_xref="EnsemblGenomes-Tr:ACI20126"
FT                   /db_xref="GOA:B5YD94"
FT                   /db_xref="InterPro:IPR001374"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034081"
FT                   /db_xref="InterPro:IPR036867"
FT                   /db_xref="UniProtKB/TrEMBL:B5YD94"
FT                   /protein_id="ACI20126.1"
FT                   /translation="MNKLLQQIVDDLDKFLAIFPSDIKSRLEQDPDIKDLIEVVLDLGR
FT                   EIEARFYKKTVVFEGRFTTEEDLNYIIARVGEFSGDKRAGIERTLHRISAIENRHGRII
FT                   GLTCRVGRAVLGTVDIIRDVIETGKNILLLGRPGVGKTTLLRETARVLADELGKRVIII
FT                   DTSNEIGGDGDIPHPAIGRARRMQVPNPAKQHDVMIEAVENHMPEVIVIDEIGTELEAK
FT                   AARTIAERGVQLIGTAHGITLQNLLLNPTLSDLVGGIQVVTLSDEEAKRRGTQKTVLER
FT                   KAPPTFQVVIEIQERDRLAIHHDVAKTVDALLRGYIIKPEIRLRTPEGEVKKVEAPTIE
FT                   PSEEEEEVSVFGKPEREKRTEPLKIFPYGISRNRLEKAIRNLGVPAFVVKNLSEASCLL
FT                   ILKAHQKRAKDLLKEAEKKGIKIAVLRSNTVTQIERFLSEEFGISVGTSKSDAEEEALR
FT                   EAQEGIEYVLTHDEPYELSPQPAYIRRLQHQLIQQYGLYSESVGVEPFRKVRIYPSH"
FT   gene            636157..636774
FT                   /gene="tmk"
FT                   /locus_tag="DICTH_0630"
FT   CDS_pept        636157..636774
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tmk"
FT                   /locus_tag="DICTH_0630"
FT                   /product="thymidylate kinase"
FT                   /EC_number="2.7.4.9"
FT                   /note="identified by match to protein family HMM PF02223;
FT                   match to protein family HMM TIGR00041"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0630"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19026"
FT                   /db_xref="GOA:B5YD95"
FT                   /db_xref="InterPro:IPR018094"
FT                   /db_xref="InterPro:IPR018095"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR039430"
FT                   /db_xref="UniProtKB/TrEMBL:B5YD95"
FT                   /protein_id="ACI19026.1"
FT                   /translation="MKNSLFITFEGIDGSGKTTQAILLKDYLESKGFKVYLTREPGGTE
FT                   VGSKIREILLSPDFSINPWTEVFLYLASRVENTIVVKKKLEENYIVICERYADSTIAYQ
FT                   GYGRNLPLNILAEMNDIATSGLKPDLTVLIDLDPELALRRKKTFDRIEMEGKDFYYRVR
FT                   EGYLEIAKREQERFIIIPGSLSKEEIFERIVKRIKEKFLRGV"
FT   gene            636777..637103
FT                   /locus_tag="DICTH_0631"
FT   CDS_pept        636777..637103
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0631"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0631"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19848"
FT                   /db_xref="InterPro:IPR010375"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="UniProtKB/TrEMBL:B5YD96"
FT                   /protein_id="ACI19848.1"
FT                   /translation="MKLVFAIIQEEDWKKVREIFIEHNLSLTFFKSKGGFLEEASITLM
FT                   TVVEDDKFEEVLSILRENCKEREKMIIPPLPSVELLRTVPMPVKIKVGGAVVFAVDVSY
FT                   FEKI"
FT   gene            637106..638086
FT                   /locus_tag="DICTH_0632"
FT   CDS_pept        637106..638086
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0632"
FT                   /product="DNA polymerase III subunit gamma/tau"
FT                   /EC_number="2.7.7.7"
FT                   /note="identified by match to protein family HMM TIGR00678"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0632"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18709"
FT                   /db_xref="GOA:B5YD97"
FT                   /db_xref="InterPro:IPR004622"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B5YD97"
FT                   /protein_id="ACI18709.1"
FT                   /translation="MAFKEIVGQKQAIEVLRRAINENKLSQTYLFVGPEGVGKRLTAIS
FT                   FVQALNCKVEPLEGCGECDICKSIEKLSYPDLFYLKPEGQWYKIQQIRDIRKEAYVKPY
FT                   ISNWKVFILDDAHQLRAEGANALLKILEEPPEHTLFILIAYRPELLLPTIISRSQIISF
FT                   SYLSYDEVWQIIKDKVSEDKLEILVNLSQGSVGKALFWGEENNWTKRIELFKYLTLLKK
FT                   DRPYSPFELVDFLVEEKDDEKIINLLELVLFWWRDLLLWKLTEDEKYIMQKDFLPEIAR
FT                   KAQEYSVSDLRNFFRLTQDAIRGIRNNANLLLTLETLFLRVGMSS"
FT   gene            638083..638988
FT                   /locus_tag="DICTH_0633"
FT   CDS_pept        638083..638988
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0633"
FT                   /product="Tpl protein"
FT                   /note="identified by match to protein family HMM PF04468"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0633"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19567"
FT                   /db_xref="InterPro:IPR007557"
FT                   /db_xref="UniProtKB/TrEMBL:B5YD98"
FT                   /protein_id="ACI19567.1"
FT                   /translation="MMTEEKENIENIYVVGIRLRSLKVYYFSTTDPNLKVGDVVIVKTV
FT                   QGVEAGKVVIPPFVPSENFEPPSPLKPILRKATEEDLQKIKEYREKEKEILQFAQEKAK
FT                   ILGLPMKMLACEINFDYSKITIHFASEERVDFRELVKELAGQYKTRIELHQVGVRDEVR
FT                   YLGGIGICGREVCCHLYLQDFESISVKMAKEQGLALNPLKISGICGRLMCCLSYEYKTY
FT                   QEIKASLPPKGTVVETKQGKGIVVDHHVPLNKLVVEFDEERRELISLDEVEKIYKKEDK
FT                   EGEKDKVLEKILKMLEEEED"
FT   gene            638996..639769
FT                   /locus_tag="DICTH_0634"
FT   CDS_pept        638996..639769
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0634"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0634"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19742"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="UniProtKB/TrEMBL:B5YD99"
FT                   /protein_id="ACI19742.1"
FT                   /translation="MDYFEEIKIFFWRRGYQIDECCQKDRIVLPKNTSLESDYFSFLSH
FT                   YRFRRLLSDIIHSQDNGKVLIDRLLSRWKLEEIKEYWDFLIKSGIINLIGNDYYFSYPY
FT                   IDNFGETLEWYISELLRKEFKMPTIWGVKIRELRGGGDFDVLSILEGSLLYIECKTSPP
FT                   NNVRLREMWEFLRRREELKPKITIFFIDTTLKIERNIIENIKYLLDRRFAKGKSNISLK
FT                   LKEGIYAFDKSLYIMQSKGDLIKNFQIVFRNFFNG"
FT   gene            639762..641057
FT                   /locus_tag="DICTH_0635"
FT   CDS_pept        639762..641057
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0635"
FT                   /product="ATPase, AAA family"
FT                   /note="identified by match to protein family HMM PF00004;
FT                   match to protein family HMM PF01078"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0635"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18865"
FT                   /db_xref="GOA:B5YDA0"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR021886"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032423"
FT                   /db_xref="UniProtKB/TrEMBL:B5YDA0"
FT                   /protein_id="ACI18865.1"
FT                   /translation="MDRQESLFKEDHNYEPLSFRMRPRTLEEFLGAEDIIGENSFLRKA
FT                   INKGYLPSLIVYGPPGSGKTTLSILLAKAINAEFIELNAAIVGVQELKEALQRARRNLE
FT                   LYGKRTVLFLDEIHHFNRLQQDVLLPFVEKGTIILIGATTENPFFALNTTLLSRCRLIE
FT                   LKPLSNENIEKILRRALEDEDRGLGKKKLQITDDAIEEIVRFANGDARIALNTLELASF
FT                   MASPLEDGRLMIDRDVVKEVIGKRVFRYDQKGDEHYHTISAFIKSIRGSDPDAALYYLA
FT                   KMLLSGEDPRFIARRLIIHAAEDIGMADPFAIVVAQAAYYAVDVVGMPEARIPLAEATI
FT                   YLATAPKSNSVIMGIDKAMKYIEEHGVAIVPEHLRGNSPDYIYPHDYPNHFVKQRYLPE
FT                   GVEEFFYNPSEQGREKKVKERLEALWRERYKK"
FT   gene            641033..642202
FT                   /locus_tag="DICTH_0636"
FT   CDS_pept        641033..642202
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0636"
FT                   /product="divergent polysaccharide deacetylase family"
FT                   /note="identified by match to protein family HMM PF04748"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0636"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18988"
FT                   /db_xref="GOA:B5YDA1"
FT                   /db_xref="InterPro:IPR006837"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:B5YDA1"
FT                   /protein_id="ACI18988.1"
FT                   /translation="MERKVQKVILLLVFFVFVLGGCKGEKKIEKHIDENKVIKEKSIVV
FT                   LDTEIAEDIIKDYEKDIERYIVEDRKESYRDYVLNWKFYSIYFKNPLTKYFLLEKLKSE
FT                   ELIVDRVRSSQGISEKYQIFRKYRFSEGDEKNIKIANLYFPINKVNADNLPKIAFVVDD
FT                   VVEDNFWTHELLNFPYTLNISIIPTRKTKDIAEKVSKRGWEVLMHLPMESISYPRDAKY
FT                   LVSEAIMVGMDEVEIENIIKTHLERFGNVKISWVNNHMGSKVTQDSETMERVIKVFKKY
FT                   NLAFLDSRTILNSVGYKMANRSGIPALENMLFIDHENDEERIKARFIQAVNIAKKRGWG
FT                   VFILHLRPKTIKVLNELDKEGFFNDLDLVRISDLYEVISEHSSGLALKN"
FT   gene            643928..644875
FT                   /locus_tag="DICTH_0637"
FT   CDS_pept        643928..644875
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0637"
FT                   /product="ribokinase:Carbohydrate kinase, PfkB"
FT                   /note="identified by match to protein family HMM PF00294"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0637"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19862"
FT                   /db_xref="GOA:B5YDA2"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:B5YDA2"
FT                   /protein_id="ACI19862.1"
FT                   /translation="MIIVGGEALIDFTPIEINGEIAYIPKEGGSPYNVAITLGRLGAPC
FT                   GFFGKISYDFFGEMLIEKLKKNHVDISLVLRSEKNTTLAFVILREGEPHFIFYGENTAD
FT                   VSLEEKDIPLIDPEKVELIHFGSISMIREPGCFVLEKMMTQNHGKVLISFDPNIRPNLI
FT                   RDKNDYLRKFEAWLKTIDILKASIADIKWLYETESMDEIARYFLEKGVKIFLLTLGKEG
FT                   SIGYTKFFSAFSKGKEVKVVDTVGAGDAFMGGFLYYLNSIGKLNKNFLENVTKTELENA
FT                   LDFSNTVSALTCTKKGAEPPYLAEVENFMGKRYY"
FT   gene            644919..645965
FT                   /locus_tag="DICTH_0638"
FT   CDS_pept        644919..645965
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0638"
FT                   /product="membrane-associated zinc metalloprotease,
FT                   putative"
FT                   /note="identified by match to protein family HMM PF02163;
FT                   match to protein family HMM TIGR00054"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0638"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18731"
FT                   /db_xref="GOA:B5YDA3"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR004387"
FT                   /db_xref="InterPro:IPR008915"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="InterPro:IPR041489"
FT                   /db_xref="UniProtKB/TrEMBL:B5YDA3"
FT                   /protein_id="ACI18731.1"
FT                   /translation="MELILFLILFGLLTIPHEFGHFIFAKIFGVKVYEYAIGFGPKILE
FT                   IKGKETRFVLRLIPIGGFVKMAGVDDINLPEFEEVPENRRFYRKAPWQRFLILFAGSFM
FT                   NFVFAIILFISIFLIGIPQPIPVVDKVLENKPASMAGIMPGDRLLYINGQKIEDISDAV
FT                   RLITGSIKAPGEEKFIEVTLERDGNILTFRVKPEWSEERKGGVIGIVFKTVPKKYSLPA
FT                   SVKNGILMFVNALLLIFYVFKALFSGAQGVSITGPIGIAKMTGEVASMGLIYYLNFIAL
FT                   LSVQIGIFNLLPIPALDGGRILFIIIEKVRGKPIETSKEEIIHWVGFLILLFLMLLVTF
FT                   FDILNLRK"
FT   gene            645962..647029
FT                   /gene="ispG"
FT                   /locus_tag="DICTH_0639"
FT   CDS_pept        645962..647029
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ispG"
FT                   /locus_tag="DICTH_0639"
FT                   /product="4-hydroxy-3-methylbut-2-en-1-yl diphosphate
FT                   synthase"
FT                   /EC_number="1.17.7.1"
FT                   /note="identified by match to protein family HMM PF04551;
FT                   match to protein family HMM TIGR00612"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0639"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18658"
FT                   /db_xref="GOA:B5YDA4"
FT                   /db_xref="InterPro:IPR004588"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="InterPro:IPR016425"
FT                   /db_xref="UniProtKB/TrEMBL:B5YDA4"
FT                   /protein_id="ACI18658.1"
FT                   /translation="MNRKKTRVVKVGNIAIGGDNPIRVQSMTKTPTVDIKSTVRQIKRL
FT                   AKKGCEIIRLGVPDKESALALGKIKKASPIPIVADIHFDYRLALIALEQGVDKLRLNPG
FT                   NIKNPKYISLIAKEAKARGVPIRVGSNAGSLPKEILEKYNGLTPEALVESALHEVRLLE
FT                   DNDFTDIVISVKASSVPLTVEAYRLLSQKVDYPLHIGITESGTVFPGTIRSSVGLGILL
FT                   YEGIGDTIRVSLASSPDKEVEVAYEILDSLELRRKGIRVIACPMCARSHFPVQQVAKEI
FT                   ERKFKNYPLNLVVAVMGCEVNGPGEAKWADIGITGSKDRVIIFRKGKIIKETNFRNIIS
FT                   ELEEELDKIKEVNSN"
FT   gene            647067..648536
FT                   /locus_tag="DICTH_0640"
FT   CDS_pept        647067..648536
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0640"
FT                   /product="hdig/kh domain protein"
FT                   /note="identified by match to protein family HMM PF00013;
FT                   match to protein family HMM PF01966; match to protein
FT                   family HMM PF08668; match to protein family HMM TIGR00277;
FT                   match to protein family HMM TIGR03319"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0640"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19538"
FT                   /db_xref="GOA:B5YDA5"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR004088"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR006675"
FT                   /db_xref="InterPro:IPR017705"
FT                   /db_xref="InterPro:IPR022711"
FT                   /db_xref="InterPro:IPR036612"
FT                   /db_xref="UniProtKB/TrEMBL:B5YDA5"
FT                   /protein_id="ACI19538.1"
FT                   /translation="MGLGYFIRRYIESKTIQLVEKRAEEILKKAEEEAEEKKRSALLEA
FT                   KEEIFKLRNEAEREIRERRNELTNLERRILQREENLERKEEILANKEREINNRLESVKR
FT                   LEEEAMNELQKIAQMTKEEAKEILLKHVEEEIQKDIAIKIKEAEAKYKEMAEEKAREII
FT                   TEAIQRCAVDHTVESTVSVVSLPSEEMKGRIIGREGRNIRTFETLTGVDLIIDDTPEAV
FT                   VLSSFDPVRREIARIALERLVKDGRIHPARIEEMVNKAKKEVENRIREEGERALIEVGI
FT                   QNIHPDLVRTLGRLYYRTSYGQNVLQHSIEVAKIAAIIAAELHMDVNLAKRAGLLHDIG
FT                   KAIDYEVEGSHATLGAELLKKYGEHPDIVHAVAAHHEEIPLVKPLDVIIQVADSISAVR
FT                   PGARRESIEIYIKRLEKLEEIAMSFPGVEKAYAIQAGREVRVLVSPEEVDDLAATRLAY
FT                   QIAKKIEKEMEYPGQIKVTVIRETRAVEYAK"
FT   gene            648539..649327
FT                   /locus_tag="DICTH_0641"
FT   CDS_pept        648539..649327
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0641"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF00149;
FT                   match to protein family HMM TIGR00282"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0641"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18720"
FT                   /db_xref="GOA:B5YDA6"
FT                   /db_xref="InterPro:IPR005235"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:B5YDA6"
FT                   /protein_id="ACI18720.1"
FT                   /translation="MNILFLGDIVGRIGRRGVGLLLPQIKKEYKIDLVLANIENAASGF
FT                   GITESVLKELMDYGIDAFTSGNHIWDKKEGIPLLDTYEKILRPANYPLGVPGRGYTVLT
FT                   HLDKKVGIINIQGRVFMEPIENPFHVVKNIVEEMKKDTKIIIVDIHAEATSEKIAMGYF
FT                   LDGMVTAVVGTHTHVQTADERILPGGTGYITDLGMCGALDSVLGVEKEAVLKKFLLQIP
FT                   QKFNVPEKGLFKMEGVIIEVEEESGKTKNIIRLQRRGEIK"
FT   gene            649372..649635
FT                   /locus_tag="DICTH_0642"
FT   CDS_pept        649372..649635
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0642"
FT                   /product="SpoVS"
FT                   /note="identified by match to protein family HMM PF04232"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0642"
FT                   /db_xref="EnsemblGenomes-Tr:ACI20125"
FT                   /db_xref="GOA:B5YDA7"
FT                   /db_xref="InterPro:IPR007347"
FT                   /db_xref="InterPro:IPR036882"
FT                   /db_xref="UniProtKB/TrEMBL:B5YDA7"
FT                   /protein_id="ACI20125.1"
FT                   /translation="MVEVLKVSAKSNPNAVAGALAGVIREKGRAEIQVIGAGAVNQAVK
FT                   AIAITRGYVAPSGIDLICIPAFTDVQIDGEERTAIRFIVEPR"
FT   gene            649777..649983
FT                   /gene="rpmE"
FT                   /locus_tag="DICTH_0643"
FT   CDS_pept        649777..649983
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmE"
FT                   /locus_tag="DICTH_0643"
FT                   /product="ribosomal protein L31"
FT                   /note="identified by match to protein family HMM PF01197;
FT                   match to protein family HMM TIGR00105"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0643"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19203"
FT                   /db_xref="GOA:B5YDA8"
FT                   /db_xref="InterPro:IPR002150"
FT                   /db_xref="InterPro:IPR027491"
FT                   /db_xref="InterPro:IPR034704"
FT                   /db_xref="InterPro:IPR042105"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5YDA8"
FT                   /protein_id="ACI19203.1"
FT                   /translation="MKKGIHPELKKARIVCACGAVYETLSTKEYMTVEICSKCHPFFTG
FT                   QRKFVDTEGRVERFAKKYNWEIK"
FT   gene            649986..650642
FT                   /gene="thyX"
FT                   /locus_tag="DICTH_0644"
FT   CDS_pept        649986..650642
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thyX"
FT                   /locus_tag="DICTH_0644"
FT                   /product="thymidylate synthase, flavin-dependent"
FT                   /EC_number="2.1.1.148"
FT                   /note="identified by match to protein family HMM PF02511;
FT                   match to protein family HMM TIGR02170"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0644"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18385"
FT                   /db_xref="GOA:B5YDA9"
FT                   /db_xref="InterPro:IPR003669"
FT                   /db_xref="InterPro:IPR036098"
FT                   /db_xref="UniProtKB/TrEMBL:B5YDA9"
FT                   /protein_id="ACI18385.1"
FT                   /translation="MRVKLISYTPEPEKVCALAMRLCHYQGNIEELEEKLTPEEISRLL
FT                   NKAKKLQHMSIFEHASFTFYIEGVSRVTTHQLVRHRIASYSQQSQRYVKIKDEYVIPET
FT                   IEKEEQRLNIYRDLINKAFEAYEELVKLGVPKEDARYLLPQAVESKIIVTMNARELMHF
FT                   FTLRTCNSAQWEIRELAWKMLDLVKNVAPVIFSDAGPPCFRGPCPEGKNCIPERG"
FT   gene            650651..651247
FT                   /gene="tdk"
FT                   /locus_tag="DICTH_0645"
FT   CDS_pept        650651..651247
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tdk"
FT                   /locus_tag="DICTH_0645"
FT                   /product="thymidine kinase"
FT                   /EC_number="2.7.1.21"
FT                   /note="identified by match to protein family HMM PF00265"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0645"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19253"
FT                   /db_xref="GOA:B5YDB0"
FT                   /db_xref="InterPro:IPR001267"
FT                   /db_xref="InterPro:IPR020633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5YDB0"
FT                   /protein_id="ACI19253.1"
FT                   /translation="MEILNGPSGWIEVICGGMYSGKSEELIRRVRRAQIAKQKVQVFKH
FT                   SLDIRYDKDYVASHTGLKIEAIPVSSSADIERLVEDDTQVVAIEEGQFFDMGIVKVCQR
FT                   LADKGKRVIVAGLDQDFRGEPFGPMPYLMAVAEYVDKLHAICMKCGNVASRTQRIIDGK
FT                   PAYYDDPIILVGAFETYEARCRNCHIVLRRDENEK"
FT   gene            651237..652121
FT                   /locus_tag="DICTH_0646"
FT   CDS_pept        651237..652121
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0646"
FT                   /product="conserved membrane protein YqhQ"
FT                   /note="identified by match to protein family HMM PF07136"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0646"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18573"
FT                   /db_xref="GOA:B5YDB1"
FT                   /db_xref="InterPro:IPR010787"
FT                   /db_xref="UniProtKB/TrEMBL:B5YDB1"
FT                   /protein_id="ACI18573.1"
FT                   /translation="MKSKKDLVGGQAVYEGVMMRKGIDIAVAVRDPDGQIVIKKERLQP
FT                   YFKKWTQIPFLRGLMILMDSLFWGIKALNYSTQVAFKEEEKIDNNWEIGLALLLGFALF
FT                   VVLFIVLPLLIVRPIERYISSQIIIRLLEGIVRLVIFVLYLFSITKIKEIYRVFQYHGA
FT                   EHKTVFCYEAGEELTVENCRKYSRFHPRCGTSFLLVVMLVSIVVFAFLGQQPFLLRIIS
FT                   RILLIPVIFSLSYEIIRIGSQHTDSWFWKIILTPGLWMQYFTTKEPDDYQLETAIVALK
FT                   EVTEKEYASEVGS"
FT   gene            652099..653202
FT                   /gene="prfA"
FT                   /locus_tag="DICTH_0647"
FT   CDS_pept        652099..653202
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prfA"
FT                   /locus_tag="DICTH_0647"
FT                   /product="peptide chain release factor 1"
FT                   /note="identified by match to protein family HMM PF00472;
FT                   match to protein family HMM PF03462; match to protein
FT                   family HMM TIGR00019"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0647"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19547"
FT                   /db_xref="GOA:B5YDB2"
FT                   /db_xref="InterPro:IPR000352"
FT                   /db_xref="InterPro:IPR004373"
FT                   /db_xref="InterPro:IPR005139"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5YDB2"
FT                   /protein_id="ACI19547.1"
FT                   /translation="MLQKLVLDKLEEIEKRFKEIENLLTKEEIISDLSRYQSLLKERAK
FT                   IEEIVEKFSEYKKLLKEREDLEVMTKEEQDEDLRSLAEAELEEIEKKLEKIEFDLKALL
FT                   LPKDPNDEKNIIMEIRAGTGGEEAALFAADLFRMYVGYAQKKGWKVEIVSSNPTGLGGY
FT                   KEIIFIVEGKGAYSRLKFESGVHRVQRVPITESSGRIHTSTATVAVLPEMEEVDVEIDP
FT                   KDLRIETFRSGGAGGQHVNKTESGVRITHIPSGIVVQCQDERSQHQNREKAMKVLRARL
FT                   YEYYQREKENEIASQRRQQVGTGERSEKIRTYNFPQRRVTDHRINYSSFQLEEVLSGEL
FT                   DEFIDRLILAEKEEQIKKLFEEVGATS"
FT   gene            653210..654034
FT                   /locus_tag="DICTH_0648"
FT   CDS_pept        653210..654034
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0648"
FT                   /product="bifunctional methyltransferase"
FT                   /note="identified by match to protein family HMM PF05175;
FT                   match to protein family HMM TIGR00536"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0648"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18615"
FT                   /db_xref="GOA:B5YDB3"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR004556"
FT                   /db_xref="InterPro:IPR007848"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR040758"
FT                   /db_xref="UniProtKB/TrEMBL:B5YDB3"
FT                   /protein_id="ACI18615.1"
FT                   /translation="MIWLKKEIEKFNPESAWLEAELLIAFVLNKERAFIYTIDFLEEEK
FT                   IEEIKRLLDLRKKGIPLNYIIKKKEFYNTEFFIEKGVLIPRNETEILIEVAKDSILREG
FT                   YYRVAEVGVGSGNISITLAKEFENIKIYACDISPKAIKIARFNAEINKVSDKIEFFYGP
FT                   FIYPLIYRNIDFEILLSNPPYVASYEFPFLQKEVKREPWEALYGGWDGCEFYRTLFKIL
FT                   KDKGKKFVAILEISPFIYKKVLNIVKRFFNNVIVESFEDSLGYKRVLRVVWQ"
FT   gene            654025..655038
FT                   /locus_tag="DICTH_0649"
FT   CDS_pept        654025..655038
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0649"
FT                   /product="Sua5/YciO/YrdC/YwlC family protein"
FT                   /note="identified by match to protein family HMM PF01300;
FT                   match to protein family HMM PF03481; match to protein
FT                   family HMM TIGR00057"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0649"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19686"
FT                   /db_xref="GOA:B5YDB4"
FT                   /db_xref="InterPro:IPR005145"
FT                   /db_xref="InterPro:IPR006070"
FT                   /db_xref="InterPro:IPR010923"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="InterPro:IPR038385"
FT                   /db_xref="UniProtKB/TrEMBL:B5YDB4"
FT                   /protein_id="ACI19686.1"
FT                   /translation="MAIVLKVDKDNPDLEALEKAAQVLDAGGLVAFPTETVYGLGADAL
FT                   NPEAVRKIFVAKGRPQDNPIIVHVGKKEQVYSLAENVSPIAERLMERFWPGPLTLIFYK
FT                   SNLVNDIVTAGSPKVGIRQPMNKVALKLLEIFGRPIAAPSANASGRPSPTRAEHVIEDL
FT                   GDRIDMIIDGGEVSFGVESTVLDVTTDPPIIYRPGACPKEEIERVIGRKVLLWRGKKTE
FT                   DIPSPGLKYRHYAPKVPLYIIEEFNEIWQNKIDIWLKEGKKVGILVSKENEGLYPDIVK
FT                   KYVVGSRNNLKEVALNLFFYLRKLEKEVDIIISESFPEEGIGLAIMDRLRRAAGEG"
FT   gene            655040..655483
FT                   /locus_tag="DICTH_0650"
FT   CDS_pept        655040..655483
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0650"
FT                   /product="protein tyrosine phosphatase"
FT                   /note="identified by match to protein family HMM PF01451"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0650"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18877"
FT                   /db_xref="GOA:B5YDB5"
FT                   /db_xref="InterPro:IPR017867"
FT                   /db_xref="InterPro:IPR023485"
FT                   /db_xref="InterPro:IPR036196"
FT                   /db_xref="UniProtKB/TrEMBL:B5YDB5"
FT                   /protein_id="ACI18877.1"
FT                   /translation="MKIVFVCSGNTCRSPMAEYLFRDIVKKLNLSNIEVTSAGIFTYEG
FT                   REPSYLSVKVMIERGIDISSHRSRKLTFDLIKEASLIYTMTKDQLFVLGEMYPEFKNKI
FT                   LTLGEEDIEDPFGLDIEKYREVRDKIEKAITKIVENLKERVVR"
FT   gene            655480..655926
FT                   /gene="rpiB"
FT                   /locus_tag="DICTH_0651"
FT   CDS_pept        655480..655926
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpiB"
FT                   /locus_tag="DICTH_0651"
FT                   /product="ribose 5-phosphate isomerase B"
FT                   /EC_number="5.3.1.6"
FT                   /note="identified by match to protein family HMM PF02502;
FT                   match to protein family HMM TIGR00689; match to protein
FT                   family HMM TIGR01120"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0651"
FT                   /db_xref="EnsemblGenomes-Tr:ACI20095"
FT                   /db_xref="GOA:B5YDB6"
FT                   /db_xref="InterPro:IPR003500"
FT                   /db_xref="InterPro:IPR004785"
FT                   /db_xref="InterPro:IPR036569"
FT                   /db_xref="UniProtKB/TrEMBL:B5YDB6"
FT                   /protein_id="ACI20095.1"
FT                   /translation="MKIAIGADHAGYMLKEELKHWLDEWNIPYHDFGTYSPERVDYPDY
FT                   GILVARAVAKGGFEKGILICGTGIGMSIVANKVKGIRAALCRDPYEAKLSREHNDANIL
FT                   ALGGRILGFDLAKEIVRVWLNTEFSGGRHKVRIDKISRIEEDEL"
FT   gene            655923..657167
FT                   /gene="glyA"
FT                   /locus_tag="DICTH_0652"
FT   CDS_pept        655923..657167
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glyA"
FT                   /locus_tag="DICTH_0652"
FT                   /product="serine hydroxymethyltransferase"
FT                   /EC_number="2.1.2.1"
FT                   /note="identified by match to protein family HMM PF00464;
FT                   match to protein family HMM PF01276"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0652"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19421"
FT                   /db_xref="GOA:B5YDB7"
FT                   /db_xref="InterPro:IPR001085"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR019798"
FT                   /db_xref="InterPro:IPR039429"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5YDB7"
FT                   /protein_id="ACI19421.1"
FT                   /translation="MRYLPEVDPEIYEAIKSEEYREEYHLELIASENFVSRAVLEAQGS
FT                   VLTNKYAEGYPGKRYYGGCMYVDKVEDIARERVKTIYGAEHANVQPHSGSQANMAVYFV
FT                   VLNPGDNVLGMNLAHGGHLTHGSPVNFSGKLYNFYFYGVDRDTEMINYDSVWNLAKEVK
FT                   PKLIVAGASAYPRIIDFEKFAQIAEDVGAYFMVDMAHIAGLVAAGLHPSPVPYAHFVTS
FT                   TTHKTLRGPRGGFILCKKEFAKEIDKAVFPGIQGGPLMHVIAAKAVAFKEAMTPEFKEY
FT                   QKQIILNAKAMAEELMRLGYRLVSGGTDNHLMLVDLRDKGITGKEAEKALEEAGITVNK
FT                   NAIPFDPQPPTVTSGIRIGTPALTTRGMKEDEMRYVARLIHEVLSNFKDSKVKEKVKKE
FT                   VEELCKQFPIYRKEN"
FT   gene            657171..657794
FT                   /gene="upp"
FT                   /locus_tag="DICTH_0653"
FT   CDS_pept        657171..657794
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="upp"
FT                   /locus_tag="DICTH_0653"
FT                   /product="uracil phosphoribosyltransferase"
FT                   /EC_number="2.4.2.9"
FT                   /note="identified by match to protein family HMM PF00156;
FT                   match to protein family HMM TIGR01091"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0653"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18965"
FT                   /db_xref="GOA:B5YDB8"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005765"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR034332"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5YDB8"
FT                   /protein_id="ACI18965.1"
FT                   /translation="MVIVVDHPLVQHKLTKLRDKNTGPKEFRELLFEISSLMLYEVTKN
FT                   LPTKEVEVETPLGIAKGKVLDNKDLAIVPILRAGLVMADGMLQILPSAKVGHIGLYRDP
FT                   ETLKPVQYYTKLPEDIDKREVIVVDPMLATGGSAVAAISILKAKGVKDIKFVCIISAPE
FT                   GIETLRNSHPDVDIYTAAIDERLNDHGYIIPGLGDAGDRLFGTK"
FT   gene            657781..659097
FT                   /gene="murA"
FT                   /locus_tag="DICTH_0654"
FT   CDS_pept        657781..659097
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murA"
FT                   /locus_tag="DICTH_0654"
FT                   /product="UDP-N-acetylglucosamine
FT                   1-carboxyvinyltransferase"
FT                   /EC_number="2.5.1.7"
FT                   /note="identified by match to protein family HMM PF00275;
FT                   match to protein family HMM TIGR01072"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0654"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19808"
FT                   /db_xref="GOA:B5YDB9"
FT                   /db_xref="InterPro:IPR001986"
FT                   /db_xref="InterPro:IPR005750"
FT                   /db_xref="InterPro:IPR013792"
FT                   /db_xref="InterPro:IPR036968"
FT                   /db_xref="UniProtKB/TrEMBL:B5YDB9"
FT                   /protein_id="ACI19808.1"
FT                   /translation="MEQNEMIGDLHVRKDKFVIEGGHKLRGEIEIWGSKNASLPIMAAS
FT                   VLNSGDLILDNVPPVKDNITMAEILKFLGMEVEFLGGDRLHIKGEPKGWRAPYELVSKM
FT                   RASFELMGPLLARFGEAEIPYPGGCRIGLRPVDLHIKGFESLGAEVTVEKGYVCARAKK
FT                   GLKGTKIHLDKPSVGATRNIMMAAVMAEGETVIENAACEPEVVDLGNFLRMMGAEIEGL
FT                   GTSTIYIKGKKELKPVDYYKVIPDRIAAGTFIIAGVMLGKDLIIKNVEPEHLQSLFIKL
FT                   KEAGVESFQIKEREVRVKAAKNWKGIEVTTMPYPGFPTDLQPQMMVFLSLAQGSSLIVE
FT                   TVFENRFLHVGELLRLGAKISIDGRTALIQGVEKLKGAPVEATDLRAGAALVLAGLVAE
FT                   GITEVLDVGEHIDRGYVALEDKLSSLGAKIKRVYYEESN"
FT   gene            659081..660520
FT                   /locus_tag="DICTH_0655"
FT   CDS_pept        659081..660520
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0655"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0655"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19087"
FT                   /db_xref="GOA:B5YDC0"
FT                   /db_xref="UniProtKB/TrEMBL:B5YDC0"
FT                   /protein_id="ACI19087.1"
FT                   /translation="MKKVTKVLLIFTSILISLIFFVIITSPFWVKPLIYYILEKNFGNY
FT                   IRAEDVRYIFPNKLQISTLEIGDFASFSNASISLQNLIKLSPVNIELTKPKITVIHNEK
FT                   GEWIFPQIPGIDASKPGGSSSINVEIKAKIKDGIVIVRDLRIKKDIEIGKVNGDLSWKN
FT                   QVITYSVSTFIDNQQIKSYGNYDFSKEKGSLTFEFKNALANVWAPIFLSDIFQIEKGYF
FT                   TGWINTQGEKSFWSATGEINASKVEGKIASFSPKFADVSTKVKIEGENITILEGKGKLW
FT                   EADIKFLGKVSPTPNLSISFGNLNLEKVDKEFFKNSINLKGNAKGEILISDSWEETVVK
FT                   GYIVAEKGSIYNFVFDSIRVNTDSKLPLISLEILGNLDVGSLTGKASLNLKSGFITLKL
FT                   DANNIKVEKIAEVFNLPKMEGKGDVIIEAKKDKKWKILVSGVIENGRLGEYSAENIKFN
FT                   FENEDIDFNLPLGDSFFFQRG"
FT   gene            660958..663957
FT                   /locus_tag="DICTH_0656"
FT   CDS_pept        660958..663957
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0656"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF04357"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0656"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19980"
FT                   /db_xref="GOA:B5YDC1"
FT                   /db_xref="InterPro:IPR007452"
FT                   /db_xref="UniProtKB/TrEMBL:B5YDC1"
FT                   /protein_id="ACI19980.1"
FT                   /translation="MGKGKFSYSNFKFDVKGRINWQDQIKFSPYFLFTGDLSSWNLEIY
FT                   LKNSSLKYNNYMFRISDLNLRTDSNRNIEGHIFLIDGEQFAYIGLNGNWDEWKLTFWGE
FT                   NIKVLGEKIKVIKVNLDSSFSGDFNIKVGDYLLKSDFGLSLDSKFINLKNFYFDKYYLG
FT                   DIKLSLENNILNIDGQILQGFVRGYYKIGESGNLDFSDIRFGDLKVSGTVNIRKDGLIF
FT                   KIPKLNFSGLDLENIQCKLDFEEPNHVKEFSVEMPFNIRVYGDFNLESGYVKSLLYIKM
FT                   KEKEIGFLNLKGDFEKLSFIGNIFAGSVEGYYDFKENSAILDVKNLSLSEIDSNFYGNL
FT                   EDFSATFKEGFLSFKGNSTKMGFKGNSIENVSFKGSYKEDLKFNLTASYSMFDFSLNGT
FT                   FNFRGGNRFTLSLRPKEGNFNEVLSKVLSLDFIGEVDKDFKNIRLTLNKDDIKFLKSGN
FT                   INIDVQNSVLMGNVIVGERGEINLKLGFDGNGLVNLKDISLSFLEDLDISGFEGSISGL
FT                   LRLEKWDIPDFELDAVNLRIKNFNEKSINLSLKGVKDRNGYLLSGDISKLSEKPAKING
FT                   VFSPKDFNLQVSFTDLKFLEDFISKDLIAEGDLKSGVLRLDVDGDLSNINLYGKLTWSN
FT                   PLVFKYVKDKIYGGNFQLNYNNGELKLTDLEINAFSSKLKIHGVISPLFSLYGNVSSLC
FT                   LSSPDIGNGYLAGDFKITKDKDIYTINGTLKVSNSHIYFPKNTNISLNNFKLNLPLSLD
FT                   LELKLEDNILFSDPGLLYLYLKGNVFIKGNINMPLLDGKIEFVNGNINILGNDFIVNDG
FT                   YIRFPGLSFNENIWEVSASKIIQGYNVILKGISFMGNSSFIFSSDPPLSLREILFLLLG
FT                   QKNLPIVKEENWTLSTILESIPQGVEGVVSSAFSSYILSPLLSEFEKILKMDRIKVEYT
FT                   LEGLIPRWKSISFERVLFSNLSLNVVYYLEGDNLWSTQLTYKFNENLYFKLYTSPKTEF
FT                   SFSFEYGTQF"
FT   gene            663972..666860
FT                   /locus_tag="DICTH_0657"
FT   CDS_pept        663972..666860
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0657"
FT                   /product="surface antigen, putative"
FT                   /note="identified by match to protein family HMM PF01103;
FT                   match to protein family HMM PF07244"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0657"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19374"
FT                   /db_xref="GOA:B5YDC2"
FT                   /db_xref="InterPro:IPR000184"
FT                   /db_xref="InterPro:IPR010827"
FT                   /db_xref="InterPro:IPR023707"
FT                   /db_xref="InterPro:IPR034746"
FT                   /db_xref="InterPro:IPR039910"
FT                   /db_xref="UniProtKB/TrEMBL:B5YDC2"
FT                   /protein_id="ACI19374.1"
FT                   /translation="MGLNKKFLFFIAFIFALICFTFAQSEYKIEDIVIKGNQKISTQEI
FT                   LNMVGVSKGANITDDQINKIKEKLDNSTYFLSVVINKLSGKSGIILEINVVESPFLIFI
FT                   NGISFQGLQRISVKELQNLIILPAIGWTTDERIWEQKRKFMSTGYFSKVDVNEVKSGEG
FT                   FIVIFNFQENPVLEKIEVKGLQNLRKEDVLSMIGIKEGMLISEDDLMAKKEEIISSNMF
FT                   SKVEFNITKKENKLYLTINLEENPLVSKVGLIGNNKSNIKDIQAILSIVGDISENTIIS
FT                   KSSIYYSEELISLWKAKLLETGYFKKVELNPKRVNERSVEVEITVVENPWVVAIDVKGL
FT                   VNLKKEKVMEVISGRGRGFLNDNYLNELKEKLLSTGWFSSVDTKYVITPNNYAYITLTV
FT                   VENPILKSITYSGLRLIPEKEIKKYRILKEGDFISDDRIEEQITKFENMGYFSKVSVEK
FT                   SVENDKVSLNFIFNENPEVKKIVFEGLLGVSEKELRQVLLNKEGLPFNSVFLDKDVQSI
FT                   LNLLQSKGYVFASIQNVVFNNEGELIFYFKDYKVEDIQVEIIPSTETSVLSFLAIFRRP
FT                   TDKNVVKREISLSVGESVNIEKIKSDLQRIYNVGIFEDVSVRFDKGSTEDSVKVVYVVK
FT                   EKLSGSFNFGGGYATDVGLYGFVEYKEKNLFGKAQQLSLQLSLTSLAKINYQLTFIDPW
FT                   FLGGRNAFQLDLYDKKVNITDATTSSTSTFEKAGGAFSFSYPLENFWSISLGFKYESIT
FT                   PIESSTMTTSTTVGSFNVGLWRDTRDFYLNPTQGSRQAISIEFAGGGSESNFIKYNVDL
FT                   QWHLPLTNRESPISISQQKERQVLSLKIGFGFEEGNFPSTELFTLGGTSTIRGFSDNIF
FT                   KGDTYLLFNMQYRIPLGNNLYGVLFVDSGSAWYRQDVTSLTDIKFYTGIGLGLRYDTLI
FT                   IPIRIDFGYNFGNDPIAPNTKWRVHFSFGDIF"
FT   gene            666881..668344
FT                   /locus_tag="DICTH_0658"
FT   CDS_pept        666881..668344
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DICTH_0658"
FT                   /product="outer membrane protein, putative"
FT                   /note="identified by match to protein family HMM PF07244"
FT                   /db_xref="EnsemblGenomes-Gn:DICTH_0658"
FT                   /db_xref="EnsemblGenomes-Tr:ACI19123"
FT                   /db_xref="GOA:B5YDC3"
FT                   /db_xref="InterPro:IPR010827"
FT                   /db_xref="UniProtK