(data stored in ACNUC7421 zone)

EMBL: CP001150

ID   CP001150; SV 1; circular; genomic DNA; STD; PRO; 3152792 BP.
XX
AC   CP001150;
XX
PR   Project:PRJNA31111;
XX
DT   26-JAN-2009 (Rel. 99, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 5)
XX
DE   Rhodobacter sphaeroides KD131 chromosome 1, complete sequence.
XX
KW   .
XX
OS   Rhodobacter sphaeroides KD131
OC   Bacteria; Proteobacteria; Alphaproteobacteria; Rhodobacterales;
OC   Rhodobacteraceae; Rhodobacter.
XX
RN   [1]
RP   1-3152792
RX   DOI; 10.1128/JB.01565-08.
RX   PUBMED; 19028901.
RA   Lim S.K., Kim S.J., Cha S.H., Oh Y.K., Rhee H.J., Kim M.S., Lee J.K.;
RT   "Complete genome sequence of Rhodobacter sphaeroides KD131";
RL   J. Bacteriol. 191(3):1118-1119(2009).
XX
RN   [2]
RP   1-3152792
RA   Lim S.K., Cha S.H., Kim S.J., Oh Y.K., Kim M.S., Lee J.K.;
RT   ;
RL   Submitted (04-SEP-2008) to the INSDC.
RL   R&D Center, GenoTech Corp. 59-5 Jang-dong, Yuseong-gu, Daejeon 305-343,
RL   South Korea
XX
DR   MD5; 3538a88b31297b62e648754fb5534bb2.
DR   BioSample; SAMN02603252.
DR   EnsemblGenomes-Gn; EBG00001188372.
DR   EnsemblGenomes-Gn; EBG00001188373.
DR   EnsemblGenomes-Gn; EBG00001188374.
DR   EnsemblGenomes-Gn; EBG00001188375.
DR   EnsemblGenomes-Gn; EBG00001188376.
DR   EnsemblGenomes-Gn; EBG00001188377.
DR   EnsemblGenomes-Gn; EBG00001188378.
DR   EnsemblGenomes-Gn; EBG00001188379.
DR   EnsemblGenomes-Gn; EBG00001188380.
DR   EnsemblGenomes-Gn; EBG00001188381.
DR   EnsemblGenomes-Gn; EBG00001188382.
DR   EnsemblGenomes-Gn; EBG00001188383.
DR   EnsemblGenomes-Gn; EBG00001188384.
DR   EnsemblGenomes-Gn; EBG00001188385.
DR   EnsemblGenomes-Gn; EBG00001188386.
DR   EnsemblGenomes-Gn; EBG00001188387.
DR   EnsemblGenomes-Gn; EBG00001188388.
DR   EnsemblGenomes-Gn; EBG00001188389.
DR   EnsemblGenomes-Gn; EBG00001188390.
DR   EnsemblGenomes-Gn; EBG00001188391.
DR   EnsemblGenomes-Gn; EBG00001188392.
DR   EnsemblGenomes-Gn; EBG00001188393.
DR   EnsemblGenomes-Gn; EBG00001188394.
DR   EnsemblGenomes-Gn; EBG00001188395.
DR   EnsemblGenomes-Gn; EBG00001188396.
DR   EnsemblGenomes-Gn; EBG00001188398.
DR   EnsemblGenomes-Gn; EBG00001188400.
DR   EnsemblGenomes-Gn; EBG00001188404.
DR   EnsemblGenomes-Gn; EBG00001188407.
DR   EnsemblGenomes-Gn; EBG00001188409.
DR   EnsemblGenomes-Gn; EBG00001188411.
DR   EnsemblGenomes-Gn; EBG00001188413.
DR   EnsemblGenomes-Gn; EBG00001188415.
DR   EnsemblGenomes-Gn; EBG00001188417.
DR   EnsemblGenomes-Gn; EBG00001188419.
DR   EnsemblGenomes-Gn; EBG00001188421.
DR   EnsemblGenomes-Gn; EBG00001188423.
DR   EnsemblGenomes-Gn; EBG00001188425.
DR   EnsemblGenomes-Gn; EBG00001188427.
DR   EnsemblGenomes-Gn; EBG00001188429.
DR   EnsemblGenomes-Gn; EBG00001188431.
DR   EnsemblGenomes-Gn; EBG00001188433.
DR   EnsemblGenomes-Gn; EBG00001188435.
DR   EnsemblGenomes-Gn; EBG00001188437.
DR   EnsemblGenomes-Gn; EBG00001188439.
DR   EnsemblGenomes-Gn; EBG00001188441.
DR   EnsemblGenomes-Gn; EBG00001188443.
DR   EnsemblGenomes-Gn; EBG00001188445.
DR   EnsemblGenomes-Gn; RSKD131_rrna16s1.
DR   EnsemblGenomes-Gn; RSKD131_rrna23s1.
DR   EnsemblGenomes-Gn; RSKD131_rrna5s1.
DR   EnsemblGenomes-Gn; RSKD131_trnaAla1.
DR   EnsemblGenomes-Gn; RSKD131_trnaAla2.
DR   EnsemblGenomes-Gn; RSKD131_trnaArg1.
DR   EnsemblGenomes-Gn; RSKD131_trnaArg2.
DR   EnsemblGenomes-Gn; RSKD131_trnaArg3.
DR   EnsemblGenomes-Gn; RSKD131_trnaArg4.
DR   EnsemblGenomes-Gn; RSKD131_trnaAsn1.
DR   EnsemblGenomes-Gn; RSKD131_trnaAsp1.
DR   EnsemblGenomes-Gn; RSKD131_trnaAsp2.
DR   EnsemblGenomes-Gn; RSKD131_trnaCys1.
DR   EnsemblGenomes-Gn; RSKD131_trnaGln1.
DR   EnsemblGenomes-Gn; RSKD131_trnaGln2.
DR   EnsemblGenomes-Gn; RSKD131_trnaGlu1.
DR   EnsemblGenomes-Gn; RSKD131_trnaGlu2.
DR   EnsemblGenomes-Gn; RSKD131_trnaGly1.
DR   EnsemblGenomes-Gn; RSKD131_trnaGly2.
DR   EnsemblGenomes-Gn; RSKD131_trnaGly3.
DR   EnsemblGenomes-Gn; RSKD131_trnaHis1.
DR   EnsemblGenomes-Gn; RSKD131_trnaIle1.
DR   EnsemblGenomes-Gn; RSKD131_trnaLeu1.
DR   EnsemblGenomes-Gn; RSKD131_trnaLeu2.
DR   EnsemblGenomes-Gn; RSKD131_trnaLeu3.
DR   EnsemblGenomes-Gn; RSKD131_trnaLeu4.
DR   EnsemblGenomes-Gn; RSKD131_trnaLeu5.
DR   EnsemblGenomes-Gn; RSKD131_trnaLys1.
DR   EnsemblGenomes-Gn; RSKD131_trnaMet1.
DR   EnsemblGenomes-Gn; RSKD131_trnaMet2.
DR   EnsemblGenomes-Gn; RSKD131_trnaPhe1.
DR   EnsemblGenomes-Gn; RSKD131_trnaPro1.
DR   EnsemblGenomes-Gn; RSKD131_trnaPro2.
DR   EnsemblGenomes-Gn; RSKD131_trnaPro3.
DR   EnsemblGenomes-Gn; RSKD131_trnaSer1.
DR   EnsemblGenomes-Gn; RSKD131_trnaSer2.
DR   EnsemblGenomes-Gn; RSKD131_trnaThr1.
DR   EnsemblGenomes-Gn; RSKD131_trnaThr2.
DR   EnsemblGenomes-Gn; RSKD131_trnaThr3.
DR   EnsemblGenomes-Gn; RSKD131_trnaTrp1.
DR   EnsemblGenomes-Gn; RSKD131_trnaVal1.
DR   EnsemblGenomes-Gn; RSKD131_trnaVal2.
DR   EnsemblGenomes-Tr; EBT00001766980.
DR   EnsemblGenomes-Tr; EBT00001766981.
DR   EnsemblGenomes-Tr; EBT00001766982.
DR   EnsemblGenomes-Tr; EBT00001766983.
DR   EnsemblGenomes-Tr; EBT00001766984.
DR   EnsemblGenomes-Tr; EBT00001766985.
DR   EnsemblGenomes-Tr; EBT00001766986.
DR   EnsemblGenomes-Tr; EBT00001766987.
DR   EnsemblGenomes-Tr; EBT00001766988.
DR   EnsemblGenomes-Tr; EBT00001766989.
DR   EnsemblGenomes-Tr; EBT00001766990.
DR   EnsemblGenomes-Tr; EBT00001766991.
DR   EnsemblGenomes-Tr; EBT00001766992.
DR   EnsemblGenomes-Tr; EBT00001766993.
DR   EnsemblGenomes-Tr; EBT00001766994.
DR   EnsemblGenomes-Tr; EBT00001766995.
DR   EnsemblGenomes-Tr; EBT00001766996.
DR   EnsemblGenomes-Tr; EBT00001766997.
DR   EnsemblGenomes-Tr; EBT00001766998.
DR   EnsemblGenomes-Tr; EBT00001766999.
DR   EnsemblGenomes-Tr; EBT00001767000.
DR   EnsemblGenomes-Tr; EBT00001767001.
DR   EnsemblGenomes-Tr; EBT00001767002.
DR   EnsemblGenomes-Tr; EBT00001767003.
DR   EnsemblGenomes-Tr; EBT00001767004.
DR   EnsemblGenomes-Tr; EBT00001767005.
DR   EnsemblGenomes-Tr; EBT00001767006.
DR   EnsemblGenomes-Tr; EBT00001767007.
DR   EnsemblGenomes-Tr; EBT00001767008.
DR   EnsemblGenomes-Tr; EBT00001767009.
DR   EnsemblGenomes-Tr; EBT00001767010.
DR   EnsemblGenomes-Tr; EBT00001767011.
DR   EnsemblGenomes-Tr; EBT00001767012.
DR   EnsemblGenomes-Tr; EBT00001767013.
DR   EnsemblGenomes-Tr; EBT00001767014.
DR   EnsemblGenomes-Tr; EBT00001767015.
DR   EnsemblGenomes-Tr; EBT00001767016.
DR   EnsemblGenomes-Tr; EBT00001767017.
DR   EnsemblGenomes-Tr; EBT00001767018.
DR   EnsemblGenomes-Tr; EBT00001767019.
DR   EnsemblGenomes-Tr; EBT00001767020.
DR   EnsemblGenomes-Tr; EBT00001767021.
DR   EnsemblGenomes-Tr; EBT00001767022.
DR   EnsemblGenomes-Tr; EBT00001767023.
DR   EnsemblGenomes-Tr; EBT00001767024.
DR   EnsemblGenomes-Tr; EBT00001767025.
DR   EnsemblGenomes-Tr; EBT00001767026.
DR   EnsemblGenomes-Tr; EBT00001767027.
DR   EnsemblGenomes-Tr; RSKD131_rrna16s1-1.
DR   EnsemblGenomes-Tr; RSKD131_rrna23s1-1.
DR   EnsemblGenomes-Tr; RSKD131_rrna5s1-1.
DR   EnsemblGenomes-Tr; RSKD131_trnaAla1-1.
DR   EnsemblGenomes-Tr; RSKD131_trnaAla2-1.
DR   EnsemblGenomes-Tr; RSKD131_trnaArg1-1.
DR   EnsemblGenomes-Tr; RSKD131_trnaArg2-1.
DR   EnsemblGenomes-Tr; RSKD131_trnaArg3-1.
DR   EnsemblGenomes-Tr; RSKD131_trnaArg4-1.
DR   EnsemblGenomes-Tr; RSKD131_trnaAsn1-1.
DR   EnsemblGenomes-Tr; RSKD131_trnaAsp1-1.
DR   EnsemblGenomes-Tr; RSKD131_trnaAsp2-1.
DR   EnsemblGenomes-Tr; RSKD131_trnaCys1-1.
DR   EnsemblGenomes-Tr; RSKD131_trnaGln1-1.
DR   EnsemblGenomes-Tr; RSKD131_trnaGln2-1.
DR   EnsemblGenomes-Tr; RSKD131_trnaGlu1-1.
DR   EnsemblGenomes-Tr; RSKD131_trnaGlu2-1.
DR   EnsemblGenomes-Tr; RSKD131_trnaGly1-1.
DR   EnsemblGenomes-Tr; RSKD131_trnaGly2-1.
DR   EnsemblGenomes-Tr; RSKD131_trnaGly3-1.
DR   EnsemblGenomes-Tr; RSKD131_trnaHis1-1.
DR   EnsemblGenomes-Tr; RSKD131_trnaIle1-1.
DR   EnsemblGenomes-Tr; RSKD131_trnaLeu1-1.
DR   EnsemblGenomes-Tr; RSKD131_trnaLeu2-1.
DR   EnsemblGenomes-Tr; RSKD131_trnaLeu3-1.
DR   EnsemblGenomes-Tr; RSKD131_trnaLeu4-1.
DR   EnsemblGenomes-Tr; RSKD131_trnaLeu5-1.
DR   EnsemblGenomes-Tr; RSKD131_trnaLys1-1.
DR   EnsemblGenomes-Tr; RSKD131_trnaMet1-1.
DR   EnsemblGenomes-Tr; RSKD131_trnaMet2-1.
DR   EnsemblGenomes-Tr; RSKD131_trnaPhe1-1.
DR   EnsemblGenomes-Tr; RSKD131_trnaPro1-1.
DR   EnsemblGenomes-Tr; RSKD131_trnaPro2-1.
DR   EnsemblGenomes-Tr; RSKD131_trnaPro3-1.
DR   EnsemblGenomes-Tr; RSKD131_trnaSer1-1.
DR   EnsemblGenomes-Tr; RSKD131_trnaSer2-1.
DR   EnsemblGenomes-Tr; RSKD131_trnaThr1-1.
DR   EnsemblGenomes-Tr; RSKD131_trnaThr2-1.
DR   EnsemblGenomes-Tr; RSKD131_trnaThr3-1.
DR   EnsemblGenomes-Tr; RSKD131_trnaTrp1-1.
DR   EnsemblGenomes-Tr; RSKD131_trnaVal1-1.
DR   EnsemblGenomes-Tr; RSKD131_trnaVal2-1.
DR   EuropePMC; PMC2632106; 19028901.
DR   EuropePMC; PMC4919450; 27151214.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00504; Glycine.
DR   RFAM; RF00517; serC.
DR   RFAM; RF00521; SAM_alpha.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01497; ALIL.
DR   RFAM; RF01793; ffh.
DR   RFAM; RF01849; alpha_tmRNA.
DR   RFAM; RF01867; CC2171.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   SILVA-LSU; CP001150.
DR   SILVA-SSU; CP001150.
DR   StrainInfo; 278681; 0.
XX
CC   Bacteria available from KCTC
CC   (http://www.brc.re.kr/English/_SearchView.aspx?sn=12085).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3152792
FT                   /organism="Rhodobacter sphaeroides KD131"
FT                   /chromosome="1"
FT                   /strain="KD131; KCTC 12085"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:557760"
FT   gene            77..610
FT                   /locus_tag="RSKD131_0001"
FT   CDS_pept        77..610
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0001"
FT                   /product="Transcription antitermination protein nusG"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ACL99860"
FT                   /db_xref="GOA:B9KL78"
FT                   /db_xref="InterPro:IPR001062"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR006645"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR015869"
FT                   /db_xref="InterPro:IPR036735"
FT                   /db_xref="UniProtKB/TrEMBL:B9KL78"
FT                   /protein_id="ACL99860.1"
FT                   /translation="MAKRWYSVSVLSNFEKKVAEQIRTAVADAGLEEEIDEVLVPTEEV
FT                   IEVRRGKKVTSERRFMPGYVLVHMEMSNRGYHLISSINRVTGFLGPQGKPMPMRDSEVN
FT                   TILNRVEEGEAQPRSLIRYDIGETVKVTDGPFEGFSGMVEDVDEEHSRLKVTVSIFGRA
FT                   TPVELEFTQVAKGA"
FT   gene            703..1155
FT                   /locus_tag="RSKD131_0002"
FT   CDS_pept        703..1155
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0002"
FT                   /product="50S ribosomal protein L11"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ACL99861"
FT                   /db_xref="GOA:B9KL79"
FT                   /db_xref="InterPro:IPR000911"
FT                   /db_xref="InterPro:IPR006519"
FT                   /db_xref="InterPro:IPR020783"
FT                   /db_xref="InterPro:IPR020784"
FT                   /db_xref="InterPro:IPR036769"
FT                   /db_xref="InterPro:IPR036796"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9KL79"
FT                   /protein_id="ACL99861.1"
FT                   /translation="MAKKIIGSLKLQVKAGQANPSPPVGPALGQRGLNIMAFVKEFNAK
FT                   SADLEPGTPTPVIITYYQDKSFSLELKTPPASFMLKKAAGLAPVGKRNRPKGSTKPGRE
FT                   VAGSVTVAQIRKIAEAKMKDLNANDVEAAMQIILGSAKSCGIEVKG"
FT   gene            1159..1857
FT                   /locus_tag="RSKD131_0003"
FT   CDS_pept        1159..1857
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0003"
FT                   /product="50S ribosomal protein L1"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ACL99862"
FT                   /db_xref="GOA:B9KL80"
FT                   /db_xref="InterPro:IPR002143"
FT                   /db_xref="InterPro:IPR005878"
FT                   /db_xref="InterPro:IPR016095"
FT                   /db_xref="InterPro:IPR023673"
FT                   /db_xref="InterPro:IPR023674"
FT                   /db_xref="InterPro:IPR028364"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9KL80"
FT                   /protein_id="ACL99862.1"
FT                   /translation="MAKVGKRTRSAREAFVGKDLISVEDAVALIKQAASAKFDETLEVA
FT                   MNLGVDPRHADQMVRGVVTLPNGTGKTVRVAVFARGAKADEAKAAGADIVGAEDLMETI
FT                   QSGKIEFDRCIATPDMMPLVGRLGKILGPRNLMPNPKVGTVTMDVKSAVEAAKGGEVQF
FT                   KVEKAGVIHAGVGKMSFEADKLAQNVRAFVDAVNRAKPAGAKGTYLKKVSLSSTMGPGV
FT                   SVDLTSATSH"
FT   gene            2120..2611
FT                   /locus_tag="RSKD131_0004"
FT   CDS_pept        2120..2611
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0004"
FT                   /product="50S ribosomal protein L10"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ACL99863"
FT                   /db_xref="GOA:B9KL81"
FT                   /db_xref="InterPro:IPR001790"
FT                   /db_xref="InterPro:IPR022973"
FT                   /db_xref="UniProtKB/TrEMBL:B9KL81"
FT                   /protein_id="ACL99863.1"
FT                   /translation="MVEELGQIFESSGVVVVAHYAGITVAQMQDLRAQMREVGGSVRVA
FT                   KNRLAKIALAGKPSEKMGDLLTGMTVMAYSEDPVAAAKVADAYAKKNDKFVILGGAMGD
FT                   TILDPAGVKTVAAMPSREELIAQIVSCIGAPASNIAGAIGAPASNIAGILSTLEEREAA
FT                   "
FT   gene            2681..3058
FT                   /locus_tag="RSKD131_0005"
FT   CDS_pept        2681..3058
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0005"
FT                   /product="50S ribosomal protein L7/L12"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ACL99864"
FT                   /db_xref="GOA:B9KL82"
FT                   /db_xref="InterPro:IPR000206"
FT                   /db_xref="InterPro:IPR008932"
FT                   /db_xref="InterPro:IPR013823"
FT                   /db_xref="InterPro:IPR014719"
FT                   /db_xref="InterPro:IPR036235"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9KL82"
FT                   /protein_id="ACL99864.1"
FT                   /translation="MADLNKLAEDIVGLTLLEAQELKTILKDKYGIEPAAGGAVMMAGP
FT                   AAGAAAPAEEEKTEFDVVLTDAGANKINVIKEVRAITGLGLKEAKDLVEAGGKVKEAVA
FT                   KADAEAMKKKLEEAGAKVELK"
FT   gene            3303..7436
FT                   /locus_tag="RSKD131_0006"
FT   CDS_pept        3303..7436
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0006"
FT                   /product="DNA-directed RNA polymerase subunit beta"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ACL99865"
FT                   /db_xref="GOA:B9KL83"
FT                   /db_xref="InterPro:IPR007120"
FT                   /db_xref="InterPro:IPR007121"
FT                   /db_xref="InterPro:IPR007641"
FT                   /db_xref="InterPro:IPR007642"
FT                   /db_xref="InterPro:IPR007644"
FT                   /db_xref="InterPro:IPR007645"
FT                   /db_xref="InterPro:IPR010243"
FT                   /db_xref="InterPro:IPR014724"
FT                   /db_xref="InterPro:IPR015712"
FT                   /db_xref="InterPro:IPR019462"
FT                   /db_xref="InterPro:IPR037033"
FT                   /db_xref="InterPro:IPR037034"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9KL83"
FT                   /protein_id="ACL99865.1"
FT                   /translation="MAQSYVGQKRIRRYYGKIREVLEMPNLIEVQKSSYDLFLKSGDGP
FT                   KAADGEGIQGVFQSVFPIKDFNETAVLEFVKYELEKPKYDVDECQQRDMTYAAPLKVTL
FT                   RLIVFDVDETTGARSVKDIKEQDVYMGDMPLMTANGTFIVNGTERVIVSQMHRSPGVFF
FT                   DHDKGKTHSSGKLLFACRIIPYRGSWLDFEFDAKDIVFARIDRRRKLPVTTLLYALGMD
FT                   QEGIMDAYYETVNFKHQKNRGWVTRFFPERVRGTRPTYDLVDAATGEVILKAGEKATPR
FT                   MVKKWIDEAQITELLVPFDHIVGRYVAQDIINEETGEIWVEAGDELTMEYDRDGEVKGG
FT                   TLKLLLDQGITDIPVLDIDNVNVGPYIRNTMAADKNMGRDTALMDIYRVMRPGEPPTVE
FT                   AASNLFDTLFFDSERYDLSAVGRVKMNMRLDLGKPDTQRTLDRDDIIACIKALTELRDG
FT                   KGEIDDIDHLGNRRVRSVGELMENQYRVGLLRMERAIKERMSSVEIDTIMPQDLINAKP
FT                   AAAAVREFFGSSQLSQFMDQTNPLSEVTHKRRLSALGPGGLTRERAGFEVRDVHPTHYG
FT                   RMCPIETPEGQNIGLINSLATFARVNKYGFIETPYRKVVEGAVTDDVVYMSATEEMRHT
FT                   VAQANAQLDEEGRFVSDLISSRKAGEFMLNPPDAIDLIDVSPKQLVSVAASLIPFLEND
FT                   DANRALMGSNMQRQAVPLLQSDAPFVGTGIEAVVARDSGAAIMARRAGVIDQVDATRIV
FT                   VRATEMLEPGEPGVDIYRLRKFKRSNQSSCINQRPLVKVGDVVHRGEVVADGPCTDMGE
FT                   LALGRNVIVAFMPWNGYNYEDSILISERILRDDVYTSIHIEEYEVAARDTKLGPEEITR
FT                   DIPNVGEEALRNLDEAGIVYIGAEVQPGDILVGKITPKGESPMTPEEKLLRAIFGEKAS
FT                   DVRDTSLRLPPGAYGTIVEVRVFNRHGVDKDERALQIEREEVERLARDRDDELAILERN
FT                   IYSRLRTLIMGKTAVKGPKGIRAGSEINEDLLSTLSRGQWWQLALGEEADAKEVEALHE
FT                   QFEAQKRALDHRFEDKVEKVRRGDDLPPGVMKMVKVFVAVKRKLQPGDKMAGRHGNKGV
FT                   ISKVVPIEDMPFLADGTHVDLVLNPLGVPSRMNVGQILETHMGWAARGLGIKIDEALQD
FT                   YRRSGDLTPVKEAMRLAYGDETYEGAFGDREDEDLVEMAGRVTKGVPIATPVFDGAKEP
FT                   DVNDALRRAGFDQSGQSIVFDGRTGEQFARPVTVGVKYMLKLHHLVDDKLHARSTGPYS
FT                   LVTQQPLGGKAQFGGQRLGEMEVWALEAYGAAYTLQEMLTVKSDDVAGRTKMYESIVKG
FT                   EDNFEAGVPESFNVLVKEVRGLGLNMELLDADEE"
FT   gene            7518..11765
FT                   /locus_tag="RSKD131_0007"
FT   CDS_pept        7518..11765
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0007"
FT                   /product="DNA-directed RNA polymerase subunit beta"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ACL99866"
FT                   /db_xref="GOA:B9KL84"
FT                   /db_xref="InterPro:IPR000722"
FT                   /db_xref="InterPro:IPR006592"
FT                   /db_xref="InterPro:IPR007066"
FT                   /db_xref="InterPro:IPR007080"
FT                   /db_xref="InterPro:IPR007081"
FT                   /db_xref="InterPro:IPR007083"
FT                   /db_xref="InterPro:IPR012754"
FT                   /db_xref="InterPro:IPR038120"
FT                   /db_xref="InterPro:IPR042102"
FT                   /db_xref="UniProtKB/TrEMBL:B9KL84"
FT                   /protein_id="ACL99866.1"
FT                   /translation="MNQELSTNPFNPVAPVKTFDEIKISLASPERILSWSYGEIKKPET
FT                   INYRTFKPERDGLFCARIFGPIKDYECLCGKYKRMKYRGVVCEKCGVEVTLQKVRRERM
FT                   GHIELAAPVAHIWFLKSLPSRIGLMLDMTLRDLERILYFENYVVIEPGLTDLTYGQLMT
FT                   EEEFLDAQDQYGADAFTANIGAEAIREMLSAIDLEQTAETLREELKEATGELKPKKIIK
FT                   RLKIVESFLESGNRPEWMILTVLPVIPPELRPLVPLDGGRFATSDLNDLYRRVINRNNR
FT                   LKRLIELRAPDIIVRNEKRMLQEAVDALFDNGRRGRVITGTNKRPLKSLSDMLKGKQGR
FT                   FRQNLLGKRVDFSGRSVIVTGPELKLHQCGLPKKMALELFKPFIYSRLEAKGLSSTVKQ
FT                   AKKLVEKERPEVWDILDEVIREHPVLLNRAPTLHRLGIQAFEPILIEGKAIQLHPLVCS
FT                   AFNADFDGDQMAVHVPLSLEAQLEARVLMMSTNNVLSPANGAPIIVPSQDMVLGLYYTT
FT                   MERRGMKGEGMAFSSVEEVEHALAAGEVHLHATITARIKQIDEEGNEVVKRYQTTPGRL
FT                   RLGNLLPLNAKAPFELVNRLLRKKDVQNVIDTVYRYCGQKESVIFCDQIMGMGFREAFK
FT                   AGISFGKDDMLIPDTKWPIVNEVRDQVKEFEQQYMDGLITQGEKYNKVVDAWSKCSDKV
FT                   AGEMMAEISAVRYDDAGAEKEPNSVYMMSHSGARGSPAQMKQLGGMRGLMAKPNGEIIE
FT                   TPIISNFKEGLTVLEYFNSTHGARKGLADTALKTANSGYLTRRLVDVAQDCIVRTHDCG
FT                   TENAITASAAVNEGEVVSPLAERVLGRVAAEDILVPGSDEVIVARGELIDERRADLVDQ
FT                   ANVASVRIRSPLTCEAEEGVCAMCYGRDLARGTLVNIGEAVGIIAAQSIGEPGTQLTMR
FT                   TFHIGGIAQGGQQSFLEASQEGRIEFRNPNLLENANGEQIVMGRNMQLAIIDEAGQERA
FT                   THKLTYGAKVHVKDGQTVKRATRLFEWDPYTLPIIAEKAGVARFVDLVSGISVREDTDE
FT                   ATGMTQKIVSDWRSTPKGGDLKPEIIIMNPETGDPMRNEAGNPISYPMSVEAILSVEDG
FT                   QTVRAGDVVARIPREGARTKDITGGLPRVAELFEARRPKDHAIIAENDGYVRFGKDYKN
FT                   KRRITIEPVDDTLNSVEYMVPKGKHIPVQEGDFVQKGDYIMDGNPAPHDILRILGVEAL
FT                   ANYMIDEVQEVYRLQGVKINDKHIEVIVRQMLQKYEILDSGETTLLKGEHVDKAELDEV
FT                   NQKAMDHGMRPAHAEPILLGITKASLQTRSFISAASFQETTRVLTEASVQGKRDKLVGL
FT                   KENVIVGRLIPAGTGGATSRVKKIAHDRDQKVIDTRRAEAESAAALAAPTDEVIDLGSE
FT                   DSGLVETVENREE"
FT   gene            11957..12883
FT                   /locus_tag="RSKD131_0008"
FT   CDS_pept        11957..12883
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0008"
FT                   /product="transporter, RhaT family, DMT superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ACL99867"
FT                   /db_xref="GOA:B9KL85"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:B9KL85"
FT                   /protein_id="ACL99867.1"
FT                   /translation="MRLSDNLRGALAMTVAMAAFTVNDALMKAVTQTMPLFQAIALRGL
FT                   VSLPLLFLYGWAVGGLRFRIPRRDGGLLALRAGADVLSTVAYLSALMVLPLANLVAILQ
FT                   SVPLAVTLAAALVLKEPLGWRRFSAILIGFCGVLLIVRPGAEGFSLWSLVGLAAVGCVV
FT                   ARDLATRRIGSDLPAATIALWTSGAVTLLGLAGSLPSGFEPVTGGEALYLGGAAVALMA
FT                   GYVSIVLAMRGGDIAAVSPFRYTALLWAIALGWLLFRDLPDGLALLGFAVITATGLFTI
FT                   WREARLRRLPREASVDIPSDSPYTPPT"
FT   gene            complement(12913..13494)
FT                   /locus_tag="RSKD131_0009"
FT   CDS_pept        complement(12913..13494)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0009"
FT                   /product="Hypothetical Protein"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ACL99868"
FT                   /db_xref="UniProtKB/TrEMBL:B9KL86"
FT                   /protein_id="ACL99868.1"
FT                   /translation="MTTGHPRNSLFRTLRAVFRTALTTIFDTLGIEDTAQALVTHAGKV
FT                   FHAAATDEHDGVLLQVVLFAGDVGDHLEAVGQANLGDLTHSGVRLLRRRGVDARADATL
FT                   LRAGLQVLGLGADSFRLPRLADELLDRWHSRSPCCNPFHSRLPGSDRGAPFVVPVHTNT
FT                   KTADVPLAGTTRWNSRGSGHMARIMTTTVN"
FT   gene            13480..13950
FT                   /locus_tag="RSKD131_0010"
FT   CDS_pept        13480..13950
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0010"
FT                   /product="30S ribosomal protein S7"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ACL99869"
FT                   /db_xref="GOA:B9KL87"
FT                   /db_xref="InterPro:IPR000235"
FT                   /db_xref="InterPro:IPR005717"
FT                   /db_xref="InterPro:IPR020606"
FT                   /db_xref="InterPro:IPR023798"
FT                   /db_xref="InterPro:IPR036823"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9KL87"
FT                   /protein_id="ACL99869.1"
FT                   /translation="MSRRHAAEKREILPDAKFGDTVLTKFMNNLMIDGKKSVAESIVYN
FT                   ALDRVQTRLKREPLEAFHEALDNVKPSVEVRSRRVGGATYQVPVEVRTERREALAIRWL
FT                   ITAARKRNENTMEERLAAELADACNNRGTAVKKREDTHKMADANKAFSHYRW"
FT   gene            13975..16092
FT                   /locus_tag="RSKD131_0011"
FT   CDS_pept        13975..16092
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0011"
FT                   /product="Elongation factor G"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ACL99870"
FT                   /db_xref="GOA:B9KL88"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004540"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005517"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009022"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035649"
FT                   /db_xref="InterPro:IPR041095"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9KL88"
FT                   /protein_id="ACL99870.1"
FT                   /translation="MARDYPLELYRNFGIMAHIDAGKTTTTERILYYTGKSHKIGEVHD
FT                   GAATMDWMEQEQERGITITSAATTTFWERTEDGKTPLSPKHRFNIIDTPGHVDFTIEVE
FT                   RSLAVLDGAVCLLDANAGVEPQTETVWRQADRYKVPRIVFVNKMDKIGADFFNCVKMIK
FT                   DRTGATPAPIALPIGAEDKLEGIIDLVTMQEWVYQGEDLGASWIIKDVRDELKAEAEEW
FT                   RGKLIELAVEQDDEAMEAYLEGNEPDVPTLRKLIRKGCLAMAFVPVTAGSAFKNKGVQP
FT                   VLNSVIDYLPSPLDVPAYMGFAPGDETETRNIARSADDSQPFAALAFKIMNDPFVGSLT
FT                   FTRLYSGVLKKGDQMVNSTKGKRERVGRMMMMHAINREEIDEAFAGDIIALAGLKETTT
FT                   GDTLCDPANQVVLETMTFPEPVIEIAVEPKTKADQEKMGLALARLAAEDPSFRVETDFE
FT                   SGQTIMKGMGELHLDILVDRMKREFKVEANIGAPQVAYRETISREAEIDYTHKKQTGGT
FT                   GQFARVKLVITPTEPGEGYSFESKIVGGAVPKEYIPGVEKGIKSVMDSGPLAGFPVIDF
FT                   RVALIDGAFHDVDSSVLAFEIASRAAMREGLKKAGAKLLEPIMKVEVVTPEEYTGGIIG
FT                   DLTSRRGMVQGQDTRGNANVINAFVPLANMFGYINTLRSMSSGRAVFTMHFDHYDAVPQ
FT                   NISDEIQKKYA"
FT   gene            16167..17342
FT                   /locus_tag="RSKD131_0012"
FT   CDS_pept        16167..17342
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0012"
FT                   /product="Translation elongation factor Tu"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ACL99871"
FT                   /db_xref="GOA:B9KL89"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004160"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004541"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR033720"
FT                   /db_xref="InterPro:IPR041709"
FT                   /db_xref="UniProtKB/TrEMBL:B9KL89"
FT                   /protein_id="ACL99871.1"
FT                   /translation="MAKAKFERNKPHVNIGTIGHVDHGKTTLTAAITKYFGEFRAYDQI
FT                   DGAPEERARGITISTAHVEYESDTRHYAHVDCPGHADYVKNMITGAAQMDGAILVVNAA
FT                   DGPMPQTREHILLGRQVGIPYMVVYMNKVDQVDDPELIELVEMEIRELLSSYDYPGDDI
FT                   PIIKGSALAAMNGTDKEIGEDSIRALIAAVDEYIPTPARAVDQPFLMPVEDVFSISGRG
FT                   TVATGRIERGVVKVGEELEIVGIRPSKKTVCTGVEMFRKLLDQGEAGDNVGLLLRGVDR
FT                   DGIERGQVLCKPGSVKPHTKFEAEAYILTKEEGGRHTPFFANYRPQFYFRTTDVTGTVQ
FT                   LPEGTEMVMPGDNLKFNVELIAPIAMEEKLRFAIREGGRTVGAGVVSKIIA"
FT   gene            17415..17723
FT                   /locus_tag="RSKD131_0013"
FT   CDS_pept        17415..17723
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0013"
FT                   /product="30S ribosomal protein S10"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ACL99872"
FT                   /db_xref="GOA:B9KL90"
FT                   /db_xref="InterPro:IPR001848"
FT                   /db_xref="InterPro:IPR027486"
FT                   /db_xref="InterPro:IPR036838"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9KL90"
FT                   /protein_id="ACL99872.1"
FT                   /translation="MQGQTIRIRLKAFDYRVLDASTQEIVNTAKRTGAQVRGPIPLPNK
FT                   IEKFTVLRGPHIDKKSRDQWEIRTHKRLLDIVDPTPQTVDALMKLDLAAGVDIQIKV"
FT   gene            17737..18459
FT                   /locus_tag="RSKD131_0014"
FT   CDS_pept        17737..18459
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0014"
FT                   /product="50S ribosomal protein L3"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ACL99873"
FT                   /db_xref="GOA:B9KL91"
FT                   /db_xref="InterPro:IPR000597"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR019927"
FT                   /db_xref="UniProtKB/TrEMBL:B9KL91"
FT                   /protein_id="ACL99873.1"
FT                   /translation="MRSGVIAKKLGMTRLFLEDGKQVPVTVLQLDSLQVVAQRTTEKDG
FT                   YTAVQLGAGAAKAKRVSAAQRGHFAKANVEPKRKIAEFRVTPDCLIDVGAEITADHYFA
FT                   GQFVDIAGTSIGKGFAGAMKRHNFGGLRASHGVSISHRSHGSTGQCQDPGKVFKGKKMA
FT                   GHMGAARVTTQNLQVVRTDSDRGLIMVKGAVPGSKGGWVTIKDAVKKPAPEQAIRPAAI
FT                   RAAAVAEETSTGGESNEG"
FT   gene            18449..19069
FT                   /locus_tag="RSKD131_0015"
FT   CDS_pept        18449..19069
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0015"
FT                   /product="50S ribosomal protein L4"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ACL99874"
FT                   /db_xref="GOA:B9KL92"
FT                   /db_xref="InterPro:IPR002136"
FT                   /db_xref="InterPro:IPR013005"
FT                   /db_xref="InterPro:IPR023574"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9KL92"
FT                   /protein_id="ACL99874.1"
FT                   /translation="MKAEVIKLDASPAGSIELDDAIFGLEPRADILHRVVRWQRAKAQA
FT                   GTHSVLGKSDVSYSTKKIYRQKGTGGARHGSKKAPIFRHGGVYKGPTPRSHAHDLNKKF
FT                   RALGLKHALSSKATTGNLIVLEDIALAEGKTAMLAKAVKELGWKRVLVIDGADINENFA
FT                   KAARNLEGVDVLPSIGANVYDILKRDTLVITKAGVEALEARLK"
FT   gene            19066..19362
FT                   /locus_tag="RSKD131_0016"
FT   CDS_pept        19066..19362
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0016"
FT                   /product="50S ribosomal protein L23"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ACL99875"
FT                   /db_xref="GOA:B9KL93"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR012678"
FT                   /db_xref="InterPro:IPR013025"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9KL93"
FT                   /protein_id="ACL99875.1"
FT                   /translation="MTAKPEHYDVIRKPVITEKATMTSEANGVVFAVAMEATKPQIKEA
FT                   VEAIFNVKVKAVNTVVTKGKTKKFKGRPGVRSDRKKAYVTLEEGNTIDVSTGL"
FT   gene            19485..20324
FT                   /locus_tag="RSKD131_0017"
FT   CDS_pept        19485..20324
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0017"
FT                   /product="50S ribosomal protein L2"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ACL99876"
FT                   /db_xref="GOA:B9KL94"
FT                   /db_xref="InterPro:IPR002171"
FT                   /db_xref="InterPro:IPR005880"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR014726"
FT                   /db_xref="InterPro:IPR022666"
FT                   /db_xref="InterPro:IPR022669"
FT                   /db_xref="InterPro:IPR022671"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9KL94"
FT                   /protein_id="ACL99876.1"
FT                   /translation="MALKSYKPTTPGQRGLVLIDRSELWKGRPVKTLVEGLIKTGGRNN
FT                   TGRVTMWHKGGGAKRLYRIVDFKRRKFDVPAVVERIEYDPNRTAFIALVRYEDGELAYI
FT                   LAPQRLAVGDSVVAGVKTDVKPGNAMPFSGMPIGTIVHNVELKPGKGGQLARAAGTYAQ
FT                   FVGRDGGYAQIRLSSGELRMVRQECMATVGAVSNPDNSNQNFGKAGRMRHKGVRPTVRG
FT                   VAMNPIDHPHGGGEGRTSGGRHPVTPWGKGTKGNRTRKSKASDKLIVRSRHAKKKGR"
FT   gene            20328..20606
FT                   /locus_tag="RSKD131_0018"
FT   CDS_pept        20328..20606
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0018"
FT                   /product="30S ribosomal protein S19"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ACL99877"
FT                   /db_xref="GOA:B9KL95"
FT                   /db_xref="InterPro:IPR002222"
FT                   /db_xref="InterPro:IPR005732"
FT                   /db_xref="InterPro:IPR020934"
FT                   /db_xref="InterPro:IPR023575"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9KL95"
FT                   /protein_id="ACL99877.1"
FT                   /translation="MARSTWKGPFVDGYLLKKAEKSRESGKNEVIKIWSRRSTILPQFV
FT                   GLTFGVYNGKKHVPVNVTEEMIGQKFGEYSPTRTYYGHAADKKAKRK"
FT   gene            20610..20990
FT                   /locus_tag="RSKD131_0019"
FT   CDS_pept        20610..20990
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0019"
FT                   /product="50S ribosomal protein L22"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ACL99878"
FT                   /db_xref="GOA:B9KL96"
FT                   /db_xref="InterPro:IPR001063"
FT                   /db_xref="InterPro:IPR005727"
FT                   /db_xref="InterPro:IPR036394"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9KL96"
FT                   /protein_id="ACL99878.1"
FT                   /translation="MGKEKNPRRVGENEAFAKVKMLRTSPQKLNLVAALIRGKKVDKAI
FT                   ADLTFSKKRISQDVLKCLQSAIANAENNHGLDVDELVVSEAFCGKNLVMKRGRPRARGR
FT                   FGKIMKPFSELTIKVKQVGETA"
FT   gene            20990..21706
FT                   /locus_tag="RSKD131_0020"
FT   CDS_pept        20990..21706
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0020"
FT                   /product="30S ribosomal protein S3"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ACL99879"
FT                   /db_xref="GOA:B9KL97"
FT                   /db_xref="InterPro:IPR001351"
FT                   /db_xref="InterPro:IPR004044"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR005704"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR018280"
FT                   /db_xref="InterPro:IPR036419"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9KL97"
FT                   /protein_id="ACL99879.1"
FT                   /translation="MGQKVNPIGMRLQVNRTWDSRWFAESKDYGNLLLEDLKMREFIHD
FT                   YAKQAGVSKVIIERPHRKCRVTIHTARPGVIIGKKGADIETLRKKLSAFTKSELHLNIV
FT                   EIRKPELDAQLVAESIAQQMERRVSFRRAMKRGVQNAMRIGALGIRVNVSGRLGGAEIA
FT                   RTEWYREGRVPLHTLRADIDYATSEATTPYGIIGVKVWIFKGEILEHDPQAHDRRHSEA
FT                   QEGAAPRPPRRDRERA"
FT   gene            21721..22134
FT                   /locus_tag="RSKD131_0021"
FT   CDS_pept        21721..22134
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0021"
FT                   /product="50S ribosomal protein L16"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ACL99880"
FT                   /db_xref="GOA:B9KL98"
FT                   /db_xref="InterPro:IPR000114"
FT                   /db_xref="InterPro:IPR016180"
FT                   /db_xref="InterPro:IPR020798"
FT                   /db_xref="InterPro:IPR036920"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9KL98"
FT                   /protein_id="ACL99880.1"
FT                   /translation="MLQPKRTKFRKQHKGRIHGEAKGGFLLNFGGFGLKATEPERVTAR
FT                   QIEAARRAITRHMKRQGRVWIRVFPDVPVTSKPTEVRMGKGKGSVDYWAAKVKPGRIMF
FT                   EIDGVSETIAREALRLGAMKLPVMTRIVVREDW"
FT   gene            22374..22580
FT                   /locus_tag="RSKD131_0022"
FT   CDS_pept        22374..22580
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0022"
FT                   /product="50S ribosomal protein L29"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ACL99881"
FT                   /db_xref="GOA:B9KL99"
FT                   /db_xref="InterPro:IPR001854"
FT                   /db_xref="InterPro:IPR018254"
FT                   /db_xref="InterPro:IPR036049"
FT                   /db_xref="UniProtKB/TrEMBL:B9KL99"
FT                   /protein_id="ACL99881.1"
FT                   /translation="MTTAQELRSKTPDQLRDQLVALKKEAFNLRFQQATGQLENTARMR
FT                   AVRRDVARIKTVLNEMAASAAAN"
FT   gene            22594..22836
FT                   /locus_tag="RSKD131_0023"
FT   CDS_pept        22594..22836
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0023"
FT                   /product="30S ribosomal protein S17"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ACL99882"
FT                   /db_xref="GOA:B9KLA0"
FT                   /db_xref="InterPro:IPR000266"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019984"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9KLA0"
FT                   /protein_id="ACL99882.1"
FT                   /translation="MPKRILQGTVTSDKNEQTVTVLVERRFKHPLLKKTVRLSKKYRAH
FT                   DPENQFKVGDIVRIEECAPISKTKRWKVVTDAVVA"
FT   gene            22910..23278
FT                   /locus_tag="RSKD131_0024"
FT   CDS_pept        22910..23278
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0024"
FT                   /product="50S ribosomal protein L14"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ACL99883"
FT                   /db_xref="GOA:B9KLA1"
FT                   /db_xref="InterPro:IPR000218"
FT                   /db_xref="InterPro:IPR005745"
FT                   /db_xref="InterPro:IPR019972"
FT                   /db_xref="InterPro:IPR036853"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9KLA1"
FT                   /protein_id="ACL99883.1"
FT                   /translation="MIQMQTNLDVADNSGARRVQCIKVLGGSHRRYASVGDIIVVSVKE
FT                   AIPRGRVKKGDVRKAVVVRTAKEVRREDGTTIRFDRNAAVILNNQGEPVGTRIFGPVVR
FT                   ELRAKNFMKIISLAPEVL"
FT   gene            23278..23583
FT                   /locus_tag="RSKD131_0025"
FT   CDS_pept        23278..23583
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0025"
FT                   /product="50S ribosomal protein L24"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ACL99884"
FT                   /db_xref="GOA:B9KLA2"
FT                   /db_xref="InterPro:IPR003256"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR005825"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR041988"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9KLA2"
FT                   /protein_id="ACL99884.1"
FT                   /translation="MAAKLKKGDRVVVLAGKDKGKQGEITAVMPKDNKAVVEGVNVAIR
FT                   HTKQTPTAQGGRLAKAMPIDLSNLALLDANGKATRVGFRFEGEKKVRYAKTTGDVI"
FT   gene            23583..24143
FT                   /locus_tag="RSKD131_0026"
FT   CDS_pept        23583..24143
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0026"
FT                   /product="50S ribosomal protein L5"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ACL99885"
FT                   /db_xref="GOA:B9KLA3"
FT                   /db_xref="InterPro:IPR002132"
FT                   /db_xref="InterPro:IPR020929"
FT                   /db_xref="InterPro:IPR020930"
FT                   /db_xref="InterPro:IPR022803"
FT                   /db_xref="InterPro:IPR031309"
FT                   /db_xref="InterPro:IPR031310"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9KLA3"
FT                   /protein_id="ACL99885.1"
FT                   /translation="MLDQTNYTPRLKAAYANSVRAAMKEEFGYKNDMQIPRLDKIVLNM
FT                   GVGEAVKDTKKVKTAAEELSMIAGQKAVVTHAKKSIAGFRVREQMPLGCKVTLRGDRMY
FT                   EFLDRLITIALPRVRDFRGVKGNSFDGRGNYAMGLKEQFVFPEINFDKVDEVLGMDIII
FT                   CTTAKTDAEAKALLKQFNMPFIS"
FT   gene            24163..24468
FT                   /locus_tag="RSKD131_0027"
FT   CDS_pept        24163..24468
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0027"
FT                   /product="SSU ribosomal protein S14P"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ACL99886"
FT                   /db_xref="GOA:B9KLA4"
FT                   /db_xref="InterPro:IPR001209"
FT                   /db_xref="InterPro:IPR018271"
FT                   /db_xref="InterPro:IPR023036"
FT                   /db_xref="UniProtKB/TrEMBL:B9KLA4"
FT                   /protein_id="ACL99886.1"
FT                   /translation="MAKKSMIEREIKRAKMVQQYAAKRASLKEITTNADLPMEQRFKAQ
FT                   LKLAELPRNSSATRIHNRCQLTGRPHAYYRKLKLSRIMLRELASFGQIPGMVKSSW"
FT   gene            24487..24879
FT                   /locus_tag="RSKD131_0028"
FT   CDS_pept        24487..24879
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0028"
FT                   /product="30S ribosomal protein S8"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ACL99887"
FT                   /db_xref="GOA:B9KLA5"
FT                   /db_xref="InterPro:IPR000630"
FT                   /db_xref="InterPro:IPR035987"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9KLA5"
FT                   /protein_id="ACL99887.1"
FT                   /translation="MNDPLGDMLTRIRNAQLRGKSTVSTPASRLRAWVLDVLQAEGYIR
FT                   GYEKKETENGQGELVISLKYFEGTPVIRELKRVSKPGRRVYMATKDLPSVRNGLGVSII
FT                   STPKGVMSDASARSANVGGEVLCTVF"
FT   gene            24932..25423
FT                   /locus_tag="RSKD131_0029"
FT   CDS_pept        24932..25423
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0029"
FT                   /product="50S ribosomal protein L6"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ACL99888"
FT                   /db_xref="GOA:B9KLA6"
FT                   /db_xref="InterPro:IPR000702"
FT                   /db_xref="InterPro:IPR002358"
FT                   /db_xref="InterPro:IPR019906"
FT                   /db_xref="InterPro:IPR020040"
FT                   /db_xref="InterPro:IPR036789"
FT                   /db_xref="UniProtKB/TrEMBL:B9KLA6"
FT                   /protein_id="ACL99888.1"
FT                   /translation="MTASISGQSIEVKGPKGTRSFSATDDVTLALDEGSVKVTPRGTSK
FT                   RARQQWGMVRSQVENLVTGVTSGFKKELEISGVGYRAQMAGNVLKLSLGYSHDVNFEVP
FT                   AGVTVTTPKQTEITVEGIDQQLVGQVAANIREWRRPEPYKGKGIRYKDEFIFRKEGKKK
FT                   "
FT   gene            25435..25794
FT                   /locus_tag="RSKD131_0030"
FT   CDS_pept        25435..25794
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0030"
FT                   /product="50S ribosomal protein L18"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ACL99889"
FT                   /db_xref="GOA:B9KLA7"
FT                   /db_xref="InterPro:IPR004389"
FT                   /db_xref="InterPro:IPR005484"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9KLA7"
FT                   /protein_id="ACL99889.1"
FT                   /translation="MANTKRELFLKRRLRVRNKLKASANGRLRLSVHRSSKNISAQLID
FT                   DANGVTLAAASTLEKGLGFVGKNNVEASAAVGRAIAERAKAAGIEECFFDRGGFLFHGK
FT                   IKALADAAREGGLKF"
FT   gene            25806..26369
FT                   /locus_tag="RSKD131_0031"
FT   CDS_pept        25806..26369
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0031"
FT                   /product="30S ribosomal protein S5"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ACL99890"
FT                   /db_xref="GOA:B9KLA8"
FT                   /db_xref="InterPro:IPR000851"
FT                   /db_xref="InterPro:IPR005324"
FT                   /db_xref="InterPro:IPR005712"
FT                   /db_xref="InterPro:IPR013810"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018192"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9KLA8"
FT                   /protein_id="ACL99890.1"
FT                   /translation="MAERENRRDRRDDRSREETPEFADRLVAINRVSKTVKGGKRFGFA
FT                   ALVVVGDQRGRVGFGKGKAKEVPEAIRKATEQAKRQMIRVALRDGRTLHHDQEGRHGAG
FT                   KVVMRAAVPGTGIIAGGPMRAVFEMLGIQDVVAKSLGSQNPYNMIRATMDGLKRESSPR
FT                   QVAQRRGKKVADILKKPEAEVAEA"
FT   gene            26382..26570
FT                   /locus_tag="RSKD131_0032"
FT   CDS_pept        26382..26570
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0032"
FT                   /product="50S ribosomal protein L30"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ACL99891"
FT                   /db_xref="GOA:B9KLA9"
FT                   /db_xref="InterPro:IPR005996"
FT                   /db_xref="InterPro:IPR016082"
FT                   /db_xref="InterPro:IPR036919"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9KLA9"
FT                   /protein_id="ACL99891.1"
FT                   /translation="MAKTIIVKQVRSAARRPAVQTAVLKGLGLNKMHRTRELEDTPSIR
FT                   GMVAKIPHLVEIIEERG"
FT   gene            26727..27212
FT                   /locus_tag="RSKD131_0033"
FT   CDS_pept        26727..27212
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0033"
FT                   /product="50S ribosomal protein L15"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ACL99892"
FT                   /db_xref="GOA:B9KLB0"
FT                   /db_xref="InterPro:IPR001196"
FT                   /db_xref="InterPro:IPR005749"
FT                   /db_xref="InterPro:IPR021131"
FT                   /db_xref="InterPro:IPR030878"
FT                   /db_xref="InterPro:IPR036227"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9KLB0"
FT                   /protein_id="ACL99892.1"
FT                   /translation="MKLNELRDNEGAARKKKRVARGPGSGKGKTAGRGIKGQKSRSGVA
FT                   LNGYEGGQMPLYRRLPKRGFTKPNRKEYAVVNLGLIQKFVDAGKLDASQPIDENAIVAA
FT                   GVTSHKRDGIRVLAKGEITAKLALTVSGASKSAVEAIEKAGGSITLTAPAAAAASAE"
FT   gene            27334..28671
FT                   /locus_tag="RSKD131_0034"
FT   CDS_pept        27334..28671
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0034"
FT                   /product="Preprotein translocase secY subunit"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ACL99893"
FT                   /db_xref="GOA:B9KLB1"
FT                   /db_xref="InterPro:IPR002208"
FT                   /db_xref="InterPro:IPR023201"
FT                   /db_xref="InterPro:IPR026593"
FT                   /db_xref="InterPro:IPR030659"
FT                   /db_xref="UniProtKB/TrEMBL:B9KLB1"
FT                   /protein_id="ACL99893.1"
FT                   /translation="MAANLSWGALGKATDLRQRIFFTIGLLMVYRLGTYIPVPGIDGSA
FT                   LRQFMDSATAGIGGMLNMFTGGAISRMGIFALGIMPYISASIIVQLMASMVPKLEQLKK
FT                   EGEQGRKKINQYTRYGTVFLATFQAWGIAMSLEAGDLVTDPGMFFRAACVITLVGGTMF
FT                   LMWLGEQITARGIGNGISLIIFVGIVAEIPAHLAQFLSQGRSGAISPAVIVGVIAMVIA
FT                   VITFVVFMERALRKIHIQYPRRQVGMKVYDGGSSHLPVKVNPAGVIPAIFASSLLLLPV
FT                   TISTFSGQQTGPVMSTILAYFGPGQPLYLLFFAGMIVFFAYFYTANVAFKVDDVAENLK
FT                   NQNGFIPGIRPGKKTEEYLEYVVNRILVLGSAYLAAVCLLPEILRNQLGIPFYFGGTSV
FT                   LIVVSVTMDTINQVQSHLLAHQYEGLIERSQLRGRKRTGAKTPTRR"
FT   gene            28679..29335
FT                   /locus_tag="RSKD131_0035"
FT   CDS_pept        28679..29335
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0035"
FT                   /product="Adenylate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ACL99894"
FT                   /db_xref="GOA:B9KLB2"
FT                   /db_xref="InterPro:IPR000850"
FT                   /db_xref="InterPro:IPR006259"
FT                   /db_xref="InterPro:IPR007862"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033690"
FT                   /db_xref="UniProtKB/TrEMBL:B9KLB2"
FT                   /protein_id="ACL99894.1"
FT                   /translation="MMVNVILLGPPGAGKGTQAKRLEESRGMVQLSTGDMLREAKTSGS
FT                   EMGRRAAEVMDRGELVTDEIVIGLIREKLQSPAAGGFIFDGFPRTLKQADALGELLAQM
FT                   GQGLDAVIEMQVDDAALVARITGRYSCGSCGAVYHDDTKPTKVEGVCDVCGSTDLRRRA
FT                   DDTAEALSKRLMEYYKKTSPLIGYYYAKGQLSSVDGLAEMDAVSAAISKVLDKRG"
FT   gene            29510..29878
FT                   /locus_tag="RSKD131_0036"
FT   CDS_pept        29510..29878
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0036"
FT                   /product="30S ribosomal protein S13"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ACL99895"
FT                   /db_xref="GOA:B9KLB3"
FT                   /db_xref="InterPro:IPR001892"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR018269"
FT                   /db_xref="InterPro:IPR019980"
FT                   /db_xref="InterPro:IPR027437"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9KLB3"
FT                   /protein_id="ACL99895.1"
FT                   /translation="MARIAGVNIPTAKRVPIALTYIHGIGDFVAGQICDAVGIDRARRV
FT                   NELSDAEVLSIREYIDANVTVEGDLRRETSMNIKRLMDLGCYRGLRHRRGLPVRGQRTH
FT                   TNARTRKGPAKAIAGKKK"
FT   gene            29892..30281
FT                   /locus_tag="RSKD131_0037"
FT   CDS_pept        29892..30281
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0037"
FT                   /product="30S ribosomal protein S11"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ACL99896"
FT                   /db_xref="GOA:B9KLB4"
FT                   /db_xref="InterPro:IPR001971"
FT                   /db_xref="InterPro:IPR018102"
FT                   /db_xref="InterPro:IPR019981"
FT                   /db_xref="InterPro:IPR036967"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9KLB4"
FT                   /protein_id="ACL99896.1"
FT                   /translation="MARDKTRMKRKERKNIAAGVAHVNSSFNNTKILISDVQGNAISWS
FT                   SAGTMGFKGSRKSTPYAAQMAAEDAAKKAQDHGMKTIEVEVQGPGSGRESALRALAAAG
FT                   LNITSIRDVTPMAHNGCRPPKRRRV"
FT   gene            30397..31413
FT                   /locus_tag="RSKD131_0038"
FT   CDS_pept        30397..31413
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0038"
FT                   /product="DNA-directed RNA polymerase subunit alpha"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ACL99897"
FT                   /db_xref="GOA:B9KLB5"
FT                   /db_xref="InterPro:IPR011260"
FT                   /db_xref="InterPro:IPR011262"
FT                   /db_xref="InterPro:IPR011263"
FT                   /db_xref="InterPro:IPR011773"
FT                   /db_xref="InterPro:IPR036603"
FT                   /db_xref="InterPro:IPR036643"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9KLB5"
FT                   /protein_id="ACL99897.1"
FT                   /translation="MIHKNWAELIKPTQLVVKPGADPARVATVIAEPLERGFGLTLGNA
FT                   LRRVLLSSLQGAAITSVQIDNVLHEFSSVAGVREDVTDIVLNLKGVSIKMEVEGPKRLS
FT                   ISAKGPGVVTAGDISESNGIEILNKDHVICHLDEGADVFMELTVNTGKGYVAADKNRPE
FT                   DAPIGLIPIDAIYSPVKKVSYEVTPTREGQVLDYDKLTMRIETDGGLTPDDAVAYAARI
FT                   LQDQLSIFVNFEEPESATRHDVEDGLEFNPLLLKKVDELELSVRSANCLKNDNIVYIGD
FT                   LIQKTEAEMLRTPNFGRKSLNEIKEVLSGMGLHLGMDVEDWPPENIEDLAKRFEDQF"
FT   gene            31514..31933
FT                   /locus_tag="RSKD131_0039"
FT   CDS_pept        31514..31933
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0039"
FT                   /product="50S ribosomal protein L17"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ACL99898"
FT                   /db_xref="GOA:B9KLB6"
FT                   /db_xref="InterPro:IPR000456"
FT                   /db_xref="InterPro:IPR036373"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9KLB6"
FT                   /protein_id="ACL99898.1"
FT                   /translation="MRHARGYRRLNRTHEHRKALFANMAGSLIEHEQIKTTLPKAKELR
FT                   PIIEKLITLAKRGDLHARRQAAAQLKEDRHVARLFEILGPRYAERAGGYVRVLKAGFRY
FT                   GDMAPMAIIEFVDRDPNAKGAADKARTAAEEALEE"
FT   gene            32240..32803
FT                   /locus_tag="RSKD131_0040"
FT   CDS_pept        32240..32803
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0040"
FT                   /product="Response regulator receiver protein"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ACL99899"
FT                   /db_xref="GOA:B9KLB7"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR005143"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036693"
FT                   /db_xref="UniProtKB/TrEMBL:B9KLB7"
FT                   /protein_id="ACL99899.1"
FT                   /translation="MATAGYFLGLHVRFTSPLITMQSYREDWIEYYTEKGYVIYDPTIR
FT                   WALSETGHRRWSDLAEQDSRGVFAAAAQFDLRFGVTCSWGTRESRSLGSFARSDREFTD
FT                   REVELIFSLFQRLHELTQPPQELTQPQIEALRCIAGGDRHAAAAMKLGISESALKARIA
FT                   SARQRLGARTTAEAIQRAKEYRLI"
FT   gene            32859..34244
FT                   /locus_tag="RSKD131_0041"
FT   CDS_pept        32859..34244
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0041"
FT                   /product="Protease Do precursor"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ACL99900"
FT                   /db_xref="GOA:B9KLB8"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR001940"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR011782"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:B9KLB8"
FT                   /protein_id="ACL99900.1"
FT                   /translation="MRHALLAFSLIAFLSPLAAPAETRLPESAAEISLSFAPVVRSAAP
FT                   AVVNIYATRVVEQRVSPFAADPFFDQLFRDFGRRQPRVQNSLGSGVIVSGDGIVVSNYH
FT                   VVGQADAIRVVLNDRREYEAEVMLADQDSDLAVLKLKEARDLPHLGLRDSDGVEVGELV
FT                   LAIGNPFGVGQTVSQGIVSGLARSGLSIDGGRGYFIQTDAAINPGNSGGALVDTAGRLV
FT                   GINTAILTQSGGSNGIGFAIPANLVRSFLAQAEAGEARFQRPWAGVNGQAVDAGMAEAM
FT                   GLERPEGVVLTELDPESPFRAAGLRAGDVVVALEGQRTDSPQEVIFRLSSLGIGARATV
FT                   SYLRDGETREAEIALVVAPDKPPRETVALRETVLAGLTVERLNPAVRAELNLPLTLEGV
FT                   VVRASEATAAQTGLRPGDILLEINGRRIERPRDVERAAQERVRWWQIDVLRDGKPLRLR
FT                   FRL"
FT   gene            34283..35596
FT                   /locus_tag="RSKD131_0042"
FT   CDS_pept        34283..35596
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0042"
FT                   /product="Recombination protein MgsA"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ACL99901"
FT                   /db_xref="GOA:B9KLB9"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR021886"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032423"
FT                   /db_xref="UniProtKB/TrEMBL:B9KLB9"
FT                   /protein_id="ACL99901.1"
FT                   /translation="MSDLFDREPAPPQPDAPRPLADRLRPKSLAEVIGQGKVLSPDGPL
FT                   GAMLASGSLSSLILWGPPGVGKTTIARLLAKETDLAFVQISAIFTGVPDLRKVFEAAKL
FT                   RRANGQGTLLFVDEIHRFNKAQQDGFLPHMEDGTILLVGATTENPSFELNAALMSRAQV
FT                   IVLERLSLADLERLAQRAEHETGRALPLDGPAREALLEMADGDGRALLNLVEQVMAWKV
FT                   KGPLDRDQLATRLMRRAAKYDKSGEEHYNLISALHKSVRGSDPDAALYWFARMLEGGED
FT                   PRFLARRITRMAVEDIGLADPQAQGICLEAWATYERLGSPEGELALAEALVYLALSPKS
FT                   NAVYTAYKAARAAAKQTGSEPPPKHILNAPTKMMKEIGYGSGYQYDHDAEDGFSGQNYF
FT                   PESMKRPVWYLPQERGFERELKKRTDYFSKLRAKRQGG"
FT   gene            35649..36002
FT                   /locus_tag="RSKD131_0043"
FT   CDS_pept        35649..36002
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0043"
FT                   /product="camphor resistance protein CrcB"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ACL99902"
FT                   /db_xref="GOA:B9KLC0"
FT                   /db_xref="InterPro:IPR003691"
FT                   /db_xref="UniProtKB/TrEMBL:B9KLC0"
FT                   /protein_id="ACL99902.1"
FT                   /translation="MALGGALGASARYLTNVGSMRLFGPAFPVGTMIVNVVGSFLMGVL
FT                   VVVLAHKGNRYAPFLMTGMLGGFTTFSAFSLDAVTLYERGQAGLAAAYVGLSVGLSLAG
FT                   LMAGMAAVRGWMA"
FT   gene            36008..37039
FT                   /locus_tag="RSKD131_0044"
FT   CDS_pept        36008..37039
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0044"
FT                   /product="Ribosomal large subunit pseudouridine synthase C"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ACL99903"
FT                   /db_xref="GOA:B9KLC1"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR006224"
FT                   /db_xref="InterPro:IPR006225"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:B9KLC1"
FT                   /protein_id="ACL99903.1"
FT                   /translation="MQLLKVTADEGEQRLDRWFKRRFPHVTQGAVEKMCRTGQVRVDGA
FT                   RAKASDRVAEGMEIRVPPLPDPDAPRPQASRVTKSDEQMIQDCVIYRDNDIIVLNKPAG
FT                   LPSQGGSGQGERHVDGLTEALKFGYKERPKLVHRLDKDTSGVLVLARTDRVARALSESF
FT                   RHRNTRKIYWALVAGVPSPKQGSIKYALMKAPGHGRGGEGEKMLCIHPAKVGDYPEAKR
FT                   AQTDFFTLWFLGSRCAWMALSPITGRTHQLRAHMAELGHPIVGDGKYGGSGQENLGDGW
FT                   GAQIGGEMSRKLHLHARSLTIEHPIKKDLVTFTAPLPGHMAKTWKLLDWKEGDVPEDPF
FT                   GAF"
FT   gene            37039..37746
FT                   /locus_tag="RSKD131_0045"
FT   CDS_pept        37039..37746
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0045"
FT                   /product="ATP12 ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ACL99904"
FT                   /db_xref="GOA:B9KLC2"
FT                   /db_xref="InterPro:IPR011419"
FT                   /db_xref="InterPro:IPR023335"
FT                   /db_xref="InterPro:IPR042272"
FT                   /db_xref="UniProtKB/TrEMBL:B9KLC2"
FT                   /protein_id="ACL99904.1"
FT                   /translation="MAGWVAKRFWKEASVAEEPGGFAVLLDGRGVRTPAKRPLILPTCA
FT                   LAEAVASEWQAQEGEVRPETMPVTRSANSALDKVAPQFDEVTEMLAAYGGTDLLCYRAT
FT                   APEALVARQARAWDPVLAWAAERFEAPLETTAGVMHQAQPEASLTRLAEHVRSFSPFQV
FT                   AGFHDLVAISGSLILGLGVTEGHLLPEEAWELSRVDESWQIEQWGADEEAAEIEAFRRT
FT                   AFLQAARFYALCG"
FT   gene            37973..38989
FT                   /locus_tag="RSKD131_0046"
FT   CDS_pept        37973..38989
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0046"
FT                   /product="Cationic amino acid ABC transporter, periplasmic
FT                   binding protein precursor"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ACL99905"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:B9KLC3"
FT                   /protein_id="ACL99905.1"
FT                   /translation="MTKSVFLGTLTVAGLAAGLASAATLDDVKARGELNCGVSTGLTGF
FT                   SLPDANGNWTGFDVSLCRAVAAAVLGDGTKVKFVPTTGQTRFTALASGEVDMLARNSTW
FT                   TFSRDTDLKLDFVGVNYYDGQGFMVRKDLGVTSAKELDGATVCIQTGTTTELNLADWFK
FT                   VNNLSYTPVAVETNAEGEQQYAAGACDAYTTDASGLAATRAAFADPENHIILPEIISKE
FT                   PLGPAVRHGDNEWADIVRWTLNALIAAEEYGVTSANMEELAANSPNPEIQRLLGVQGDL
FT                   GKMIRLDNDWAKRAIAVGGNYGEIFAATIGEATPIGLARGLNAQWTQGGLLYAPPFR"
FT   gene            39138..40400
FT                   /locus_tag="RSKD131_0047"
FT   CDS_pept        39138..40400
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0047"
FT                   /product="Polar amino acid ABC transporter, inner membrane
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ACL99906"
FT                   /db_xref="GOA:B9KLC4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B9KLC4"
FT                   /protein_id="ACL99906.1"
FT                   /translation="MANVADAPKDSFRLSMLLYDTRYRSLTIQVFVFFLFMAGAAWLVD
FT                   NTMRNLEALGKDFDFGFLWNRAGYDISQRLVDYTNDSTHGRAMLVGLLNTLLIALLGCM
FT                   AATVIGVLVGVLRLSRNWIVGRLMTVYVEVFRNVPLLLWILLIYAVFSEATPAPNAFRP
FT                   NPETGIADRSMFLDAIAVTNRYTALPNPVFSRELGWLDLGLFYVNMDVLAVIGAIIAGW
FT                   FINRSVKARATRIQEATGERPATWWSSLLLLVGLPVAVLLALGFHLEFPELRGFNFVGG
FT                   LNVSNSFMALWLALSLYTGAFIAEIVRGGILAVSRGQSEAAFALGLRPGRTMNLVILPQ
FT                   ALRVIIPPLISQYLNLTKNSSLAIAVGYLDLRGTLGGITLNQTGRELECVLLMMLIYLA
FT                   ISLVISGVMNVYNSAVKLKER"
FT   gene            40402..41730
FT                   /locus_tag="RSKD131_0048"
FT   CDS_pept        40402..41730
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0048"
FT                   /product="Polar amino acid ABC transporter, inner membrane
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ACL99907"
FT                   /db_xref="GOA:B9KLC5"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B9KLC5"
FT                   /protein_id="ACL99907.1"
FT                   /translation="MSDTHAQTVPFVRETMLPPVAPPANEAGVVSWMRQNLFSGPLNIA
FT                   LTLLGLVAIYYVLEGIVPWLMRSVWTADTLAQCRQIITERWGEGATGACWAVIRERWPQ
FT                   FLYGFYPNHLYWRPTLTFLLLFVALAPILFAQVPRQMLWFSLAYPFLAFWLLWGGSIFL
FT                   PLVAAAGFLFGWLAYRLAARFGTIAAVAAAALVPVLWWLFLAGDVSDDLARLTGRTFPL
FT                   WLEEVRSDKFGGFVLAVTIGVSGIALSLPLGIILALGRRSDMFLIKALSVSFIEFIRGV
FT                   PLIALLFTASLLLNYFLPPGTTFDIILRVIIMVTLFAAAYIAEVIRGGLAALPRGQYEA
FT                   ADALGLDYWKAQRLIILPQALKISIPGIVSTFIGMFKDTTLVVFVGLLDPLKGITDAVR
FT                   ASTDWKGIYWEPYIFVGLIFFAFNFAMSRYSMHLERRLKTDHR"
FT   gene            41743..42531
FT                   /locus_tag="RSKD131_0049"
FT   CDS_pept        41743..42531
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0049"
FT                   /product="ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ACL99908"
FT                   /db_xref="GOA:B9KLC6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030679"
FT                   /db_xref="UniProtKB/TrEMBL:B9KLC6"
FT                   /protein_id="ACL99908.1"
FT                   /translation="MSEAIERAIDRSHMQVSDEVAIQISQMNKWYGSFHVLRDVNMTVH
FT                   KGERIVICGPSGSGKSTLIRCINRLEEHQSGQIVVDGIELTSDLKNIDKVRSEVGMVFQ
FT                   HFNLFPHLTILENCTLAPIWVRKTPKKEAEEVAMHYLKKVKIPEQAHKYPGQLSGGQQQ
FT                   RVAIARSLCMKPRIMLFDEPTSALDPEMIKEVLDTMIELAEEGMTMLCVTHEMGFAQAV
FT                   ANRVIFMDQGQIVEQNEPGEFFRNPKSERTKLFLSQILGH"
FT   gene            42741..43109
FT                   /locus_tag="RSKD131_0050"
FT   CDS_pept        42741..43109
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0050"
FT                   /product="Ferredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ACL99909"
FT                   /db_xref="GOA:B9KLC7"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:B9KLC7"
FT                   /protein_id="ACL99909.1"
FT                   /translation="MANITFTSPIMHGPKTVYAVAGDTKTILAVAEEHRIPIPFDCKDG
FT                   NCASCLIEVTYEEPSLRKGITLTEKEKAKLRELGKITAQEIQDAEVLDLPPRYRLACQF
FT                   IARDENVTVAFSGEPGGA"
FT   gene            43404..44621
FT                   /locus_tag="RSKD131_0051"
FT   CDS_pept        43404..44621
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0051"
FT                   /product="Peptidase M24"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ACL99910"
FT                   /db_xref="GOA:B9KLC8"
FT                   /db_xref="InterPro:IPR000587"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR029149"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="InterPro:IPR039394"
FT                   /db_xref="UniProtKB/TrEMBL:B9KLC8"
FT                   /protein_id="ACL99910.1"
FT                   /translation="MRSEMERPENYRFHNGEKAALPFPPEEYEARLEGLRDLMELHSLD
FT                   AVVLTSMHNVAYYSGFLYLSFGRPYACVVTPTDCVTVSAGIDAGQPWRRSVGDNITYTD
FT                   WQRDNFWRTVAQVTGTGRAIGCEADHLTMVQAEKLNAFLRPSRGMDIAPGTMAQRMLKS
FT                   PAEIALIRHGAQVADVGGYAIREAIREGATELEIAMVGRDAMEHEIAARFPEAEYRDSW
FT                   VWFQSGPNTDGAHNPVTNRALRRGDILSLNCFPMISGYYTALERTLFLGEVDEASLKIW
FT                   EANVAAHEYGISLLQPGASCADVTAKLNAFLEERDLLRYRTFGYGHSFGLLSHYYGREA
FT                   GLELREDIETVLEPGMVISMEPMLTLGAGQPGAGGYREHDILVITEDGPENITGYPYGP
FT                   GFNVVG"
FT   gene            44860..47031
FT                   /locus_tag="RSKD131_0052"
FT   CDS_pept        44860..47031
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0052"
FT                   /product="Hypothetical Protein"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ACL99911"
FT                   /db_xref="GOA:B9KLC9"
FT                   /db_xref="InterPro:IPR006179"
FT                   /db_xref="InterPro:IPR011048"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR027372"
FT                   /db_xref="UniProtKB/TrEMBL:B9KLC9"
FT                   /protein_id="ACL99911.1"
FT                   /translation="MSMKLAGMTSALALAAAAPVLAETSFNRIATFATTANMAAGEDTS
FT                   RPTSAEIVSVSEDGLTLIYTDSPLGVVGLIDITDPEAPKPLGNIAMGGEPTTAVIAGAR
FT                   AYVAVNTSESYTAPSGKLVTVDLESREEVASCDLGGQPDSVAKAPDGSFLAIAIENERD
FT                   EEVNDGALPQMPAGFLVKLPLTEAGADCAALERIDLTGLAAIAPEDPEPEFVSVNEAGD
FT                   IAVTLQENNEVVIVAADGTISHFPAGTVDLDGIDTKKDGRLSFTDRQEGRLREPDGIKW
FT                   IGTDHLATANEGDWNGGARGWTIFSRDGQVVWEAGASLERAIAAIGHYPEHRSKSKGVE
FT                   VESVEVASFGGTPLAFVASERASVVAVYDLTDPSAPRLLQILPSGISPEGVVAIPGRDL
FT                   LVTANEADLREDGGAPAHVMIYRRGEGPAAYPTLTSEGSDPLIGWGALSALAADARTPG
FT                   QLWAVSDSVYSMAPTIYRIDATATPARITEAIPVTRMGQPAQKLDLEGIATDGEGGFWL
FT                   ASEGNSAKLVPHAIYHVDGKGRIDEEIPFPAELLAGETRFGLEGIAKVGDVLWMAVQRE
FT                   WKDDPKGQVKLLAYDIKEESWGAVRYPLDAPAEGAWMGLSELTVHGDWAWLIERDNRVA
FT                   DAGAAKRLTRVALSDLKPAPLGSELPLVKKEMVRDLVPDLQRLNGYVPDKVEGFAIDAA
FT                   GRGYFVTDNDGTDDASGETLFWSVDQLPE"
FT   gene            47452..48216
FT                   /locus_tag="RSKD131_0053"
FT   CDS_pept        47452..48216
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0053"
FT                   /product="ErfK/YbiS/YcfS/YnhG family protein precursor"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ACL99912"
FT                   /db_xref="GOA:B9KLD0"
FT                   /db_xref="InterPro:IPR005490"
FT                   /db_xref="InterPro:IPR038063"
FT                   /db_xref="UniProtKB/TrEMBL:B9KLD0"
FT                   /protein_id="ACL99912.1"
FT                   /translation="MIVTSRILSYALMALLPFLAACAQAPAPETPKEHPLYPGIQDGEF
FT                   FIEPVPTRYLTPDTVRQEVAYNGPEKPGTIVVDTFARRLYYVTDEGRAMRYAIAVGRAG
FT                   LAFRGNATVQRKREWPSWQPTANMIRTQPEMYAPYAAGLPGGLQNPLGARALYLYRGGR
FT                   DTMFRIHGTVQNASIGHATSAGCIRLFNQDAIDLYGRVNLGTPVKVRTEAESLALEGQF
FT                   HDDRYGRIAPGPAEPLTEEERILLSGVPAQTR"
FT   gene            complement(48262..48603)
FT                   /locus_tag="RSKD131_0054"
FT   CDS_pept        complement(48262..48603)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0054"
FT                   /product="Hypothetical Protein"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ACL99913"
FT                   /db_xref="InterPro:IPR008579"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:B9KLD1"
FT                   /protein_id="ACL99913.1"
FT                   /translation="MSHLIRLSREAVAPETERPAPDRLIAGDPVHTTWNLEERDGLFCG
FT                   IWQSTPGKWRVRYEEWEYIRILEGHSILTSAAGEAVTLRASDSWIIRPGFEGTWEVIET
FT                   TVKDYVIRL"
FT   gene            48798..49601
FT                   /locus_tag="RSKD131_0055"
FT   CDS_pept        48798..49601
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0055"
FT                   /product="3-methyl-2-oxobutanoate hydroxymethyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ACL99914"
FT                   /db_xref="GOA:B9KLD2"
FT                   /db_xref="InterPro:IPR003700"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:B9KLD2"
FT                   /protein_id="ACL99914.1"
FT                   /translation="MAADILARKGGEPIVCLTAYTTPMARLVDAHCDLTLVGDSLGMVV
FT                   HGLPTTLGVTMEMMILHGQAVARGTSRSMLVVDMPFGSYEESPAQAFANARRLMAETGC
FT                   AAVKLEGGQHMAETIRFLVARGVPVMAHIGLTPQAVNALGGYKVQGRGADAERVMEDAI
FT                   AVAEAGAFSVVLEKVPDGLSQRITQRIAIPTIGIGASAHCDGQVLVLDDMLGLFADFRP
FT                   KFVKRYGELGASADEAIATYAAEVRARRFPAPEHVFADELKGKAQ"
FT   gene            49601..50440
FT                   /locus_tag="RSKD131_0056"
FT   CDS_pept        49601..50440
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0056"
FT                   /product="Pantothenate synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ACL99915"
FT                   /db_xref="GOA:B9KLD3"
FT                   /db_xref="InterPro:IPR003721"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR042176"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9KLD3"
FT                   /protein_id="ACL99915.1"
FT                   /translation="MPPVLRTVAELRARVSDWKAAGETVGVVPTMGALHEGHLSLARRA
FT                   RASCDRVIVTIFVNPRQFNNPADLEKYPRTEAQDAALLASVGVDAVFAPAPEEVYPRGF
FT                   ATNVSVSGVSEPLEGAHRPGHFDGVATVVAKLFGMTRADRAFFGEKDWQQLMVVQRLVA
FT                   DLNIPVTIEGCATVREADGLALSSRNRRLSAEGRARAPALVRAMQAAAEAMRGGRSVPE
FT                   ALAEARAAVLAAGFETVDYLELRTADLLLPMERLQGEGRLLAAATLDGVRLIDNIPV"
FT   gene            complement(50547..51818)
FT                   /locus_tag="RSKD131_0057"
FT   CDS_pept        complement(50547..51818)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0057"
FT                   /product="Acetylornithine deacetylase or
FT                   succinyl-diaminopimelate desuccinylase"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ACL99916"
FT                   /db_xref="GOA:B9KLD4"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR010182"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:B9KLD4"
FT                   /protein_id="ACL99916.1"
FT                   /translation="MDDRRLIAEVEARRADLVALTQDLVRIPTLNPPGRNYRALCDMLA
FT                   ARLAPQFEVELVRAHGAPGDSETYPRWNLITRRQGARDGDCVHFNSHHDVVEVGRGWTR
FT                   DPFGAEVEGDRLYGRGACDMKGGLAASVIAAEAFLAVCPDFAGSIEISGTADEESGGFG
FT                   GVAYLARQGRFAHVQHVLIPEPLHKDRICLGHRGVWWAEVETQGRIAHGSMPFLGDSAI
FT                   RHMGALLAEIEERLYPLLATRTTAMPVTPEGARQSTLNINSIHGGEPEPEPGYTGLPAP
FT                   CVADRCRIVIDRRFLIEEDLDEVKAELRALAERLAEARPGFAFEIRDLFEVRPTLTDRD
FT                   APVVRSTAAAIERVLARQAEYVVSPGTYDQKHIDRIGKLKNCIAYGPGLLHLAHQPDEW
FT                   VSIADMVDSAKVMALVLADLLAPE"
FT   gene            51949..52218
FT                   /locus_tag="RSKD131_0058"
FT   CDS_pept        51949..52218
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0058"
FT                   /product="Hypothetical Protein"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ACL99917"
FT                   /db_xref="GOA:B9KLD5"
FT                   /db_xref="UniProtKB/TrEMBL:B9KLD5"
FT                   /protein_id="ACL99917.1"
FT                   /translation="MILGFLKLALVGFVLLTILYVLIRIYARSLRREALENEYDEGHGD
FT                   GPREAYIEAGMRDYEHSLRKKLILLVYIVPAIIFAAVFWTLNNP"
FT   gene            52226..52882
FT                   /locus_tag="RSKD131_0059"
FT   CDS_pept        52226..52882
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0059"
FT                   /product="Hypothetical Protein"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ACL99918"
FT                   /db_xref="GOA:B9KLD6"
FT                   /db_xref="InterPro:IPR011088"
FT                   /db_xref="UniProtKB/TrEMBL:B9KLD6"
FT                   /protein_id="ACL99918.1"
FT                   /translation="MRYLKWTVPAVAALLVISFLHYTLPRHDVVRIVGTNTQRMDLGEN
FT                   AFFFASPDAGTNTATAGNRDIKFINAVRPNGKTIVYRNEDTGWGWPPYFKVNSFDIQAK
FT                   ATDLTSTEAEPKWVVVTRYGWRNQLFTTFPNAVKLREVASPEVTVIPWFNIFFFVALGG
FT                   LAILVRGMWMQFRERTIDPALEDMGDAWDRESGLARKRTRTNVGRFKAWMRSLRS"
FT   gene            complement(52993..55410)
FT                   /locus_tag="RSKD131_0060"
FT   CDS_pept        complement(52993..55410)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0060"
FT                   /product="Phenylalanyl-tRNA synthetase beta chain"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ACL99919"
FT                   /db_xref="GOA:B9KLD7"
FT                   /db_xref="InterPro:IPR002547"
FT                   /db_xref="InterPro:IPR004532"
FT                   /db_xref="InterPro:IPR005121"
FT                   /db_xref="InterPro:IPR005146"
FT                   /db_xref="InterPro:IPR005147"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR020825"
FT                   /db_xref="InterPro:IPR033714"
FT                   /db_xref="InterPro:IPR036690"
FT                   /db_xref="InterPro:IPR041616"
FT                   /db_xref="UniProtKB/TrEMBL:B9KLD7"
FT                   /protein_id="ACL99919.1"
FT                   /translation="MKFTLSWLKDHLETEAPLDEIVTALTDLGHEVEGVEDPVKVLGAF
FT                   RICRVIEAQPHPNADRLRLCRVATWPNGPDAPSEEVQVVCGAPNARTGLVGVFAPVGTH
FT                   VPGTGVDLKPGVIRGVESNGMLCSERELMLSDDHDGIIDLPEDAPMGMRFIDYKGVNDP
FT                   TIEVKITPNRPDGLGVRGLARDLAARGLGRLKPLPVEPVPGLFPSPVSVTIEAALKEKG
FT                   CPLFAGRTIRGVKNGPSPDWLQARLRSVGLRPISALVDITNYFTIGLNRPLHVFDVAKI
FT                   TGGLRIHAAEGGEELLALDGKTYKLRPDQMLISDDAQPESLAGIMGGELSGCTEETTDV
FT                   FLESAYWDPITIAATGRALKIVSDARYRFERGVDPAFTLPGLELATRMILDLCGGEASE
FT                   VVMDGAVPDTSRAYRFDPKRVVSLVGMEIPEAEQRATLEALGFTLDGELAAPPSWRPDV
FT                   QGEADLVEEIARVASLTKLQGKPLPRAQAGVPKPILTPLQVREQAARRTLAALGYNECV
FT                   TYSFIDEAAAKLFGGGSEAVRVENPISSEMTHLRPDLLPGLLRAAARNQARGFADMALC
FT                   EIGPVFAGGEPGEQQLQATGLLVGASAPRDPFGSRRPVDVYDAKADAEAVLAAVGAPAK
FT                   MQISRKVPGWWHPGRSGAVGLGPNLLATFGEVHPKILREMDVKGPAVAFTILVANVPLP
FT                   KVKTPTRPALKLSDLQAVERDFAFVVDASVEALTLVNAAQGADKALIESVRVFDQFSGD
FT                   KAEAQMGAGKKSLALTVRLQPTDRTLTDKDIEAVSAKIVEKVAKAAGATLRG"
FT   gene            55536..55757
FT                   /locus_tag="RSKD131_0061"
FT   CDS_pept        55536..55757
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0061"
FT                   /product="Hypothetical Protein"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ACL99920"
FT                   /db_xref="UniProtKB/TrEMBL:B9KLD8"
FT                   /protein_id="ACL99920.1"
FT                   /translation="MYLDLIPRAGRRLFLLLRLCLLAAFIAPLGLTLAASGEAVQITPP
FT                   PPPAGAVTPRPVRPRPCPWRTGPAPAAP"
FT   gene            complement(55800..56507)
FT                   /locus_tag="RSKD131_0062"
FT   CDS_pept        complement(55800..56507)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0062"
FT                   /product="Hypothetical Protein"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ACL99921"
FT                   /db_xref="GOA:B9KLD9"
FT                   /db_xref="UniProtKB/TrEMBL:B9KLD9"
FT                   /protein_id="ACL99921.1"
FT                   /translation="MHNIVTIQNVIAATLVVWYFAAVYYLELRRQFRYPEYPAARLYPM
FT                   WRKRFQLYGQLQANAAGNVTERSPEAQEVLQSFLRKVEVRSATLVALWAVLLGADLMLA
FT                   FSIPTWQPGRLLLIGLAVCCLPFVLRLGFGLSQVDQIAAHRVLTNATDDATAARRLQDQ
FT                   LIEDLYRKELAFRFSAQGFRVMLLVLAMLTVGYLSTYIDWAAVRAQLPELTLPRLSLPE
FT                   LSLPALSLPKFGF"
FT   gene            complement(56550..57632)
FT                   /locus_tag="RSKD131_0063"
FT   CDS_pept        complement(56550..57632)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0063"
FT                   /product="Phenylalanyl-tRNA synthetase alpha chain"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ACL99922"
FT                   /db_xref="GOA:B9KLE0"
FT                   /db_xref="InterPro:IPR002319"
FT                   /db_xref="InterPro:IPR004188"
FT                   /db_xref="InterPro:IPR004529"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR022911"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9KLE0"
FT                   /protein_id="ACL99922.1"
FT                   /translation="MTALDTLRGKYIEAIASAADEAALEEVRLAALGKKGEISLKMREL
FT                   GQMSPEERQTTGAALNRLRDEIDASLRARKQGLADAALDARLKTEWLDVTLPGRPRRAG
FT                   TIHPVSQVMAELTAIFSDMGFAVAEGPQVESDWFNFDALNIPPEHPARQEHDTFFMARA
FT                   EGDDRPPHVLRTHTSPVQIRAMQAQGAPIRVIAPGRVYRMDMDQTHTPMFHQVEGLAID
FT                   RDISMANLKWVLEEFCRAFFEVPSVELRFRASHFPFTEPSAEVDIRCSWEGGQLRIGEG
FT                   DGWLEILGSGMVHPKVLAAAGVNPDEWQGFAFGMGIDRIAMLKYGIPDLRAFFESDLRW
FT                   LRHYGFAALDMPDLAGGLSR"
FT   gene            complement(57837..58199)
FT                   /locus_tag="RSKD131_0064"
FT   CDS_pept        complement(57837..58199)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0064"
FT                   /product="50S ribosomal protein L20"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ACL99923"
FT                   /db_xref="GOA:B9KLE1"
FT                   /db_xref="InterPro:IPR005813"
FT                   /db_xref="InterPro:IPR035566"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9KLE1"
FT                   /protein_id="ACL99923.1"
FT                   /translation="MSRVKSGKVTHARHRKVIKQAKGYYAARSTNFRTATQAVDKANQY
FT                   ATRDRKARKRNFRALWIQRINAAVRLFDIEMTYSRFINGLSKAGIEVDRKVLADLAVHE
FT                   PEAFNAIAAQAKAALA"
FT   gene            complement(58212..58418)
FT                   /locus_tag="RSKD131_0065"
FT   CDS_pept        complement(58212..58418)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0065"
FT                   /product="50S ribosomal protein L35"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ACL99924"
FT                   /db_xref="GOA:B9KLE2"
FT                   /db_xref="InterPro:IPR001706"
FT                   /db_xref="InterPro:IPR018265"
FT                   /db_xref="InterPro:IPR021137"
FT                   /db_xref="InterPro:IPR037229"
FT                   /db_xref="UniProtKB/TrEMBL:B9KLE2"
FT                   /protein_id="ACL99924.1"
FT                   /translation="MEMPKMKTKSAAKKRFSFTATGKVKAGPAGKRHGMIKRSTKFIRD
FT                   VTGTMILSDADAKIVKKYMPYDR"
FT   gene            complement(58528..59946)
FT                   /locus_tag="RSKD131_0066"
FT   CDS_pept        complement(58528..59946)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0066"
FT                   /product="Pyruvate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ACL99925"
FT                   /db_xref="GOA:B9KLE3"
FT                   /db_xref="InterPro:IPR001697"
FT                   /db_xref="InterPro:IPR011037"
FT                   /db_xref="InterPro:IPR015793"
FT                   /db_xref="InterPro:IPR015795"
FT                   /db_xref="InterPro:IPR015806"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR036918"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:B9KLE3"
FT                   /protein_id="ACL99925.1"
FT                   /translation="MATLGPASNDYATIRALFEAGADVFRLNMSHGSHDDIRARHQMLR
FT                   QIEADTGTPVCILADLQGPKLRVGTFANGSEELVERGRFRLDLDPAPGTAERVNLPHPE
FT                   IFAALEPGSSLLVNDGKIRLEVADCGPDFADCIVTVGGTISNRKGVNVPDVVLPLAALS
FT                   EKDRRDLEFVCELGVDWLALSFVQRPEDVEEARSLARGRAAILSKIEKPAAVKAYDAIL
FT                   AVSDGIMVARGDLGVELPVQAVPPIQKRLVRGARAAAKPVIVATQMLESMIDSPMPTRA
FT                   EVSDVATAIYEGADAVMLSAESAAGSYPIEAVMTMNNTAISVESDPVYRDIIEASRAAK
FT                   RASVADAIVAAAREIAETTPIKAICCFTQTGKTVSLVARERPRVPILALTPLVETARRL
FT                   SLTWGTHCVVTAPQERFKGAVICAARAALSDGFAQEHEQIAVVAGVPFNVRGTTNILRV
FT                   APCDERLIYSGDPE"
FT   gene            60099..60851
FT                   /locus_tag="RSKD131_0067"
FT   CDS_pept        60099..60851
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0067"
FT                   /product="N-formylglutamate amidohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ACL99926"
FT                   /db_xref="GOA:B9KLE4"
FT                   /db_xref="InterPro:IPR007709"
FT                   /db_xref="InterPro:IPR011227"
FT                   /db_xref="UniProtKB/TrEMBL:B9KLE4"
FT                   /protein_id="ACL99926.1"
FT                   /translation="MTETRMTAFEIVGADRPSRWLVTCDHASNRVPPEVAGGDLGLPAA
FT                   EMGRHIAYDVGAAGLARALADRLDGPCVLSTFSRLVIDPNRGEKDPTLVMRLYDGTIIP
FT                   ANRHVDAVEVERRLETLHRPYHAALARLAARRADTVIVAIHSFTPQLLGRPPRPWHVGI
FT                   LHSPLNDRFSRALIERLQGEPDLCVGDNQPYLGHLPGDSIDRHALQRDRLNTLIELRHD
FT                   LIREEGQQTAWAERLAPILEEVLAALPD"
FT   gene            complement(61098..61964)
FT                   /locus_tag="RSKD131_0068"
FT   CDS_pept        complement(61098..61964)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0068"
FT                   /product="Aminotransferase, class IV"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ACL99927"
FT                   /db_xref="GOA:B9KLE5"
FT                   /db_xref="InterPro:IPR001544"
FT                   /db_xref="InterPro:IPR018300"
FT                   /db_xref="InterPro:IPR036038"
FT                   /db_xref="UniProtKB/TrEMBL:B9KLE5"
FT                   /protein_id="ACL99927.1"
FT                   /translation="MNMSRTVYVNGEYLPEEEATVSIFDRGFLMADGVYEVTSVLGGKL
FT                   IDFPGHAARLERSLAELEMTAPMKAQDLLEVHRELVRRNGIDEGLIYLQITRGNPGDRD
FT                   FAFPPADTKPTVVLFTQAKPGLAANPTAKVGIKVISIPDIRWGRRDIKTVQLLYPSMAK
FT                   MAAKKAHVDDAWFVEDGLVTEGTSNNAYIVKGGKIITRNLSNDILHGITRAAVVRFARE
FT                   AQMEVEERPFTIEEAQGADEAFFTSASAFVMPVVEIDGKAVGTGTPGPVAARLREIYLD
FT                   ESLKAAV"
FT   gene            complement(61961..62923)
FT                   /locus_tag="RSKD131_0069"
FT   CDS_pept        complement(61961..62923)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0069"
FT                   /product="Mandelate racemase/muconate lactonizing enzyme,
FT                   C-terminal domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ACL99928"
FT                   /db_xref="GOA:B9KLE6"
FT                   /db_xref="InterPro:IPR013341"
FT                   /db_xref="InterPro:IPR013342"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR029065"
FT                   /db_xref="InterPro:IPR034603"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/TrEMBL:B9KLE6"
FT                   /protein_id="ACL99928.1"
FT                   /translation="MITVTPESFRLAEVFTISRGSRTESRVLTVTVTREGISGRGECVP
FT                   YARYGETLESVADQIATLPENLTRADLQTLLPAGAARNAVDCALWDLEAKDSGKRVWQL
FT                   LGLPAPQPQVTAFTLSLDAPEKMRAAAARNAHRPLLKIKLGTPDDMARLEAVRAGAPAT
FT                   RIIVDANEGWTADIYTELAPHLLRLGVALVEQPLPAGQDELLAEIARPLPVCADEACHD
FT                   RHSLPALKGKYDVINIKLDKTGGLTEALALREAALAEGYGLMVGCMVGSSLAMAPATLV
FT                   AQGAAYVDLDGPLLLAEDREQPLVFDEAGIHPPSAELWG"
FT   gene            complement(63033..64034)
FT                   /locus_tag="RSKD131_0070"
FT   CDS_pept        complement(63033..64034)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0070"
FT                   /product="Hypothetical Protein"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ACL99929"
FT                   /db_xref="InterPro:IPR011669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR035086"
FT                   /db_xref="InterPro:IPR035402"
FT                   /db_xref="UniProtKB/TrEMBL:B9KLE7"
FT                   /protein_id="ACL99929.1"
FT                   /translation="MIETPYLLFLGDAPDALAAKVAQGIKDWRPEFAVGQFRMEGCKAD
FT                   MGLPDMTLAEAKAAGCKTLVIGVANRGGVISQAWKKVLISALEEGFDLASGLHNLLRDE
FT                   EDLAAVARATGRTLHDVRVPTVDYPIANGRKRTGKRMLAVGTDCSIGKMYTALCVDREM
FT                   RERGLKSSFRATGQTGILITGDGVPLDAVIADFMAGSIEYLTPDNDADHWDLIEGQGSL
FT                   FHVSYSGVTLALIHGGQPDALVICHEPTRSHMRGLPDYKLPSIEQVRDAALAMARVANP
FT                   ACVAVGCSINTQALSDEEALAYCAEVEARTGLPTVDPFRHGAGRLVDALMAV"
FT   gene            64233..65258
FT                   /locus_tag="RSKD131_0071"
FT   CDS_pept        64233..65258
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0071"
FT                   /product="Citrate (Pro-3S)-lyase"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ACL99930"
FT                   /db_xref="GOA:B9KLE8"
FT                   /db_xref="InterPro:IPR005000"
FT                   /db_xref="InterPro:IPR011206"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9KLE8"
FT                   /protein_id="ACL99930.1"
FT                   /translation="MRSASQYYTEFGHRDETSLPRDRMSFRLQPAPPARPNRCQLFGPG
FT                   SRPALFEKMAASAADVINLDLEDSVAPDDKAQARANIIEAINGLDWGRKYLSVRINGLD
FT                   TPFWYRDVVDLLEQAGDRLDQIMIPKVGCAADVYAVDALVTAIERAKGRTKPLSFEVII
FT                   ESAAGIAHVEEIAASSPRLQAMSLGAADFAASMGMQTTGIGGTQENYYMLHDGQKHWSD
FT                   PWHWAQAAIVAACRTHGILPVDGPFGDFSDDEGFRAQARRSATLGMVGKWAIHPKQVAL
FT                   ANEVFTPSETAVTEAREILAAMDAAKARGEGATVYKGRLVDIASIKQAEVIVRQAEMIS
FT                   A"
FT   gene            complement(65349..65819)
FT                   /locus_tag="RSKD131_0072"
FT   CDS_pept        complement(65349..65819)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0072"
FT                   /product="Transcriptional regulator, AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ACL99931"
FT                   /db_xref="InterPro:IPR010499"
FT                   /db_xref="InterPro:IPR011256"
FT                   /db_xref="InterPro:IPR029442"
FT                   /db_xref="UniProtKB/TrEMBL:B9KLE9"
FT                   /protein_id="ACL99931.1"
FT                   /translation="MAMFPVHIRETSPRRLAALRHTGAFEEIGATFGQICQILEERSLL
FT                   SQAGCMIGVYWDNPLLAPPGALHSHAGIDVPEGMEIAPPLEELRLAGGRHAVLQYTGPY
FT                   SGLARAYRYFFSQWLPEAREIQAEGPLIEIYRNAAMETPSDQLVTEICVPLL"
FT   gene            66025..66993
FT                   /locus_tag="RSKD131_0073"
FT   CDS_pept        66025..66993
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0073"
FT                   /product="Acetyl-coenzyme A carboxylase carboxyl
FT                   transferase subunit alpha"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ACL99932"
FT                   /db_xref="GOA:B9KLF0"
FT                   /db_xref="InterPro:IPR001095"
FT                   /db_xref="InterPro:IPR011763"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:B9KLF0"
FT                   /protein_id="ACL99932.1"
FT                   /translation="MSAMNYLEFEKPLSEIEGKAEELRALARGNREMDVEKEATALDKK
FT                   AETLLKDLYKDLTPWRKCQVARHPDRPHCKDYIEGLFTEYTPLAGDRNFADDHAIMGGL
FT                   ARFNDNPVVVIGQEKGHDTKTRIERNFGMARPEGYRKAIRLMEMAHRFRLPVITLVDTP
FT                   GAYPGKGAEERGQAEAIARATQKCLEIGVPLVAVVIGEGGSGGAVALATANRIAMLEHS
FT                   VYSVISPEGCASILWKDAEKMREAAEALRLTAQDLHKLGVIDRIIKEPLGGAQRGRRET
FT                   VDAVGKAIEMMLKELVGRKPEWLVKDRRNKFLDMGSKGLAA"
FT   gene            66990..67304
FT                   /locus_tag="RSKD131_0074"
FT   CDS_pept        66990..67304
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0074"
FT                   /product="Small multidrug resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ACL99933"
FT                   /db_xref="GOA:B9KLF1"
FT                   /db_xref="InterPro:IPR000390"
FT                   /db_xref="UniProtKB/TrEMBL:B9KLF1"
FT                   /protein_id="ACL99933.1"
FT                   /translation="MTPWLLVLVARLMETGWALGLKYSDGFTRPVPSVLTLAGAVASFW
FT                   LLSLAMKSLPVGTAYAVWVGIGAVGTALLAMALFGEPASPLRIAGIGLILAGIIALKLA
FT                   "
FT   gene            67404..67958
FT                   /locus_tag="RSKD131_0075"
FT   CDS_pept        67404..67958
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0075"
FT                   /product="Hypothetical Protein"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ACL99934"
FT                   /db_xref="InterPro:IPR028992"
FT                   /db_xref="UniProtKB/TrEMBL:B9KLF2"
FT                   /protein_id="ACL99934.1"
FT                   /translation="MFLKAWHEGRLTVRWVPEEEAATEGLFPDESCILTAAGPAALGRM
FT                   VPGDRIWRCGGRPLPVLGIERRMLRPEPLGDPRGWPVRLAEDALGRALPARALLLSPNQ
FT                   QVLPGGAATPIPAIALVDGCRILQRPPELPVPVTRLLLAEAALVQVEGLLVMAARRPAL
FT                   LASDPLSEGRPRGVSRDAASG"
FT   gene            68046..69224
FT                   /locus_tag="RSKD131_0076"
FT   CDS_pept        68046..69224
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0076"
FT                   /product="Glucose sorbosone dehydrogenase precursor"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ACL99935"
FT                   /db_xref="GOA:B9KLF3"
FT                   /db_xref="InterPro:IPR011041"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR012938"
FT                   /db_xref="UniProtKB/TrEMBL:B9KLF3"
FT                   /protein_id="ACL99935.1"
FT                   /translation="MIRRSPLVLLLLPAGAFAQPVEQGPPATDFEPAFETQTRAPALEA
FT                   TGATAEPFVQGLEHPWGIAALPEGGWLVTERPGRLRMVSEDGTLSDPIKGLPEVDARKQ
FT                   GGLLDVAAGPTFAEDRMIYWTYAKAVEGGTITAAARGALSEDGTEVSAVEDIFRQEPPS
FT                   QAPMHYGSRILFDGEGHAIITTGEHSIEAERDRAQDLGTSYGKVIRVALDGATPEDNPF
FT                   AESEGLGTIWSYGHRNIQSAAFDAEGQLWIVEHGPKGGDELNLIQPGANYGWPEVSYGV
FT                   NYDGSPVGTGEPRGEGFTEPTYYWDPVIAPGDMTFYRGTAFEGWQGDLLVGSMKPGGLV
FT                   RLTLEAGRVAGEERLLGDVGRVRDVEETAEGHLLLLIDAPDGGILRVTPEAG"
FT   gene            complement(69249..70208)
FT                   /locus_tag="RSKD131_0077"
FT   CDS_pept        complement(69249..70208)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0077"
FT                   /product="Hypothetical Protein"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ACL99936"
FT                   /db_xref="GOA:B9KLF4"
FT                   /db_xref="UniProtKB/TrEMBL:B9KLF4"
FT                   /protein_id="ACL99936.1"
FT                   /translation="MTEPQDKSVDLGFYARERLAALSPLEAGVAGAGLLWTLSVSLHLI
FT                   FRGDGGIFAHVMAILAVVLPLTLTVSMVLFLRTIRHLKAENERMASAVDAMRKAHLVSQ
FT                   QGGAARVALEKRVEELAAAQHQTETRLAELFAVPAEPAPAGRAPEDQPALALGGPRQRA
FT                   PLTAGDLVRAMNFPESAEDRAGFRALRRALEDPSSAKLIRAAQDVLTLLSQLGLFMEDL
FT                   PPDRARPDIWRRFAEGERGRPISDLGGIHDKEALASVAAKMREDAVFRDASHHFLRAFD
FT                   RTVSHFAGQASDAEIVDMSETRTARAFMLIGRASGTFD"
FT   gene            complement(70219..70689)
FT                   /locus_tag="RSKD131_0078"
FT   CDS_pept        complement(70219..70689)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0078"
FT                   /product="Transcription elongation factor greA"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ACL99937"
FT                   /db_xref="GOA:B9KLF5"
FT                   /db_xref="InterPro:IPR001437"
FT                   /db_xref="InterPro:IPR006359"
FT                   /db_xref="InterPro:IPR018151"
FT                   /db_xref="InterPro:IPR022691"
FT                   /db_xref="InterPro:IPR023459"
FT                   /db_xref="InterPro:IPR028624"
FT                   /db_xref="InterPro:IPR036805"
FT                   /db_xref="InterPro:IPR036953"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9KLF5"
FT                   /protein_id="ACL99937.1"
FT                   /translation="MDKIPMTRAGFTALDDELKTLKTVERPAVIRSIAEAREHGDLSEN
FT                   AEYHAAREKQSFIEGRIKELEAILSLAEVIDPAKLSGSIKFGATVTILDEETEEERTYQ
FT                   IVGEAEADIEAGLLNIKSPLARALIGKDEGDSIEVKTPGGERGYEVVSVRFV"
FT   gene            complement(70671..70889)
FT                   /locus_tag="RSKD131_0079"
FT   CDS_pept        complement(70671..70889)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0079"
FT                   /product="Hypothetical Protein"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ACL99938"
FT                   /db_xref="UniProtKB/TrEMBL:B9KLF6"
FT                   /protein_id="ACL99938.1"
FT                   /translation="MHGARSIVTRRSARPRAATNAAPLRPSGGGARTPLHSSVPSDQVR
FT                   GTQAQGHGPARAVAFCFLGEGRWTRFR"
FT   gene            70962..72617
FT                   /locus_tag="RSKD131_0080"
FT   CDS_pept        70962..72617
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0080"
FT                   /product="Electron-transferring-flavoprotein dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ACL99939"
FT                   /db_xref="GOA:B9KLF7"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR040156"
FT                   /db_xref="UniProtKB/TrEMBL:B9KLF7"
FT                   /protein_id="ACL99939.1"
FT                   /translation="MTEQTPREQMEYDVVIVGAGPSGLSAAIRLKQLDPDLSVVLLEKG
FT                   SEVGAHILSGAVLDPAGLNALIPDWKEKGAPLNTPVTEDHFFLLTPAGQTMLPSWPVPK
FT                   LMDNHGNYVVSMGNVCRWLATQAEELGVEIFPGMSCSELVYGENGEVRGVVAGEFGKNA
FT                   DGTPGPSYEPGMELLGKYVMLAEGVRGSLSKQVMEKFDLRKGYGPQKYGLGMKEIWEID
FT                   PAKHKPGRIWHTMGWPLGKNAGGGSFIYHAENNQVFIGLVVHLNYENPHLYPYQEFQRF
FT                   KHHPMVAELLKGGKRVAYGARAISEGGYQSLPKMVFPGGALLGCSAGMVNVPRIKGNHN
FT                   AMLSGKAAAEAAHAAIKAGRQSDELSDYEQSVRKGPIGQDLWKVRNVKPIWSHLGLYAS
FT                   MALGGLDMWTNSLFNFSFFGTMKHHQTDAADTKPARDFAPIDYPKPDGVLSFDRLTNVA
FT                   FSFTNHEESQPAHLRLKDPAIPIAVNLPKYAEPAQRYCPAGVYEVVSEAGRDPRFVINF
FT                   QNCVHCKTCDIKDPSQNIDWTTPQGGDGPNYPNM"
FT   gene            72717..74417
FT                   /locus_tag="RSKD131_0081"
FT   CDS_pept        72717..74417
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0081"
FT                   /product="TPR repeat-containing protein precursor"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ACL99940"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:B9KLF8"
FT                   /protein_id="ACL99940.1"
FT                   /translation="MANILMRPVLALALAALLPAAAGAQQEDAGAYLAARVAAAGSDYR
FT                   SAADWFTRALAADPSNTSLIEGALISDFSLGEIEKAVPLATRLTESGNGAQAAALVLLA
FT                   DRAKREEYQAILTAEPTGLGPLVDRLSFAWAAFGAGRMSEALEAFDQLATTQGLEPFGL
FT                   YHKALALAAAGDFEGADEILSGRDGNALRVMRRGSIAHAQILSQLDRNADAVAMLEKSF
FT                   GTDADAGIDALKERLAAGETLPYDVARNATDGMAEIFFTLAGALSGEVDDGSTLLYART
FT                   ATHLRPDHTEALLLSAQILDNQGQHQLASETYARIPTADPMFFVAEIGRADALRADGKI
FT                   EASLEVLQGLARSKPELMQVHLALGDALRREERYADAVKAYDAAIARVPAPERQHWPLF
FT                   YSRGICHERLSHWKEAEADFRRALELNPDEPQVLNYLGYSFVDRGQNLEEALSMIERAV
FT                   AARPESGYIIDSLAWAYFRLGRYQDAVEPMEKASLLEPVDPIVTDHLGDVYWAVGRKLE
FT                   ARFQWHRALSFDPEEKEAQRIRRKLEVGLDALLAEEGAKPLSVAVRAND"
FT   gene            74410..75246
FT                   /locus_tag="RSKD131_0082"
FT   CDS_pept        74410..75246
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0082"
FT                   /product="4-diphosphocytidyl-2-C-methyl-D-erythritol
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ACL99941"
FT                   /db_xref="GOA:B9KLF9"
FT                   /db_xref="InterPro:IPR004424"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9KLF9"
FT                   /protein_id="ACL99941.1"
FT                   /translation="MTEAFARAKINLTLHVTGQRPDGYHLLDSLVVFADVGDRVRAEPA
FT                   EALSLAITGPQAANLPVADDNLVLRAARTLGGQGARLTLEKHLPVASGIGGGSADAAAA
FT                   LVALARLWQVPLPDPAAVLKLGADVPVCLEGRAVRMAGVGEILTPLAAPLPEAWLVLAN
FT                   PGVSVPTPPVFKALARRDNPPMPDDLPGWPTVESLAALLATQRNDLEPPAIALAPEIAR
FT                   TRAALAAQPGCLLARMSGSGATCFGLFAAEEAARAAAEAIGTQHPGWWVAPARMVG"
FT   gene            75364..75873
FT                   /locus_tag="RSKD131_0083"
FT   CDS_pept        75364..75873
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0083"
FT                   /product="Hypothetical Protein"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ACL99942"
FT                   /db_xref="UniProtKB/TrEMBL:B9KLG0"
FT                   /protein_id="ACL99942.1"
FT                   /translation="MIWIRLLLLPLFFCPTLALAQVDATPATDPARYLALESVARTDAT
FT                   AQDLARRIEARAIAEAEAGSGEPVEVEGMLVDFADGRRLLHVALCGGAWFGNLGCHSSL
FT                   FTMPAGGAGFVRVLDLIGSGPIWFDSREGVGGWPDLILGGTRPSHPPYIRWRWTGQTFD
FT                   KVWPPG"
FT   gene            complement(75881..77302)
FT                   /locus_tag="RSKD131_0084"
FT   CDS_pept        complement(75881..77302)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0084"
FT                   /product="membrane-anchored oxidoreductase precursor"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ACL99943"
FT                   /db_xref="GOA:B9KLG1"
FT                   /db_xref="InterPro:IPR011041"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR012938"
FT                   /db_xref="UniProtKB/TrEMBL:B9KLG1"
FT                   /protein_id="ACL99943.1"
FT                   /translation="MATPAFAADGFDVSTQIGPDPVLPAPEMSLLPDLTVAEVVGWQEG
FT                   ETPTVPEGLSIAAYATGLANPRTVHTLPNGDVLVVQSRGPAGEPVSRPKDLIRGWIMAM
FT                   AHGGDGDQPPSNRITLLRDADRDGTVDERHDLLTDLNSPFGVAWIDDRLYVAATDAILV
FT                   YPYTLGQTEIVAEPEVLTPLPGGPINHHWTKDLALSPDGASLFVSVGSNSNIVENGIEA
FT                   EKGRAAIWQVDRETGAARVYASGLRNPNGLTFHPGTGRLWTVVNERDELGPNLVPDYMT
FT                   SVQEGAFYGWPWSYYGQHVDPRVHPERPDMVQAAIPPDYALSSHVAALGLTFSYGSALP
FT                   EAWRSGAFVGEHGSWNRDAFNGYKVVYVPFVDGRPAETAQDVVTGFLDGDRAHGRPVGV
FT                   GIDGTGALLVADDAGNTVWRVAAADGTISDAPVGTDQVETEQSGAAAAPQEEAPRPTGT
FT                   PAQTQIAPATEPARP"
FT   gene            complement(77331..77729)
FT                   /locus_tag="RSKD131_0085"
FT   CDS_pept        complement(77331..77729)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0085"
FT                   /product="Conserved hypothetical membrane protein
FT                   precursor"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ACL99944"
FT                   /db_xref="GOA:B9KLG2"
FT                   /db_xref="InterPro:IPR016923"
FT                   /db_xref="InterPro:IPR019251"
FT                   /db_xref="UniProtKB/TrEMBL:B9KLG2"
FT                   /protein_id="ACL99944.1"
FT                   /translation="MLVPFPIACLTLTLGADIAYWATGNLMWQHFAEWLLLIAVVTGAV
FT                   AALLGAIDLLVRRPLRRLRMGWIHGIGNLVALGLAVVNSFVHARDGWTGVVPWGIVLSA
FT                   LTVAVMAATVWLGLSMVFRHGAGVARHD"
FT   gene            77933..79027
FT                   /locus_tag="RSKD131_0086"
FT   CDS_pept        77933..79027
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0086"
FT                   /product="Membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ACL99945"
FT                   /db_xref="GOA:B9KLG3"
FT                   /db_xref="UniProtKB/TrEMBL:B9KLG3"
FT                   /protein_id="ACL99945.1"
FT                   /translation="MPKERIVFQFAAYRIMSSRRHALRVAVQTAVATLAVHLLMRPLAP
FT                   DLESWAVIAALFTIGTSVDATLGAGISRIAGTALGAGLGLAVTGLLGGSSLPALLLAAV
FT                   LSNSLAAIWPGLTYAAVMAAIVALDPSPDGRSALALSGAVVLGTIFGTAASFLVWPEFG
FT                   RNRAVLSLREAMDDCREFLGLIHKGVTTDDRRNRYFLHQRFRGHLFALYDRIAETHFTP
FT                   QVRSGAGLREAADAVEALWYALVILDRGVISGRARLSDSTVERVRPVLAAVQTEACRVL
FT                   ESASIAAGPGRATPTDPTELKRVLAEARELTLAAAAEGRDIAPAQEQALQALSFALDEM
FT                   ERSLMALMRVIEPECEAPDKVRAA"
FT   gene            complement(79055..79378)
FT                   /locus_tag="RSKD131_0087"
FT   CDS_pept        complement(79055..79378)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0087"
FT                   /product="Response regulator receiver protein"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ACL99946"
FT                   /db_xref="GOA:B9KLG4"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:B9KLG4"
FT                   /protein_id="ACL99946.1"
FT                   /translation="MEDDFFLAHDLAAILEAEGAEVLGPAGTMTEALDLASSSACDAAV
FT                   LDVNLRHLTVQPVIEVLERRGVPLVLLTGASPETLPPDMRALPLMMKPVEAAALVAHLA
FT                   ACG"
FT   gene            complement(79806..80810)
FT                   /locus_tag="RSKD131_0088"
FT   CDS_pept        complement(79806..80810)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0088"
FT                   /product="Transcriptional regulator, LacI family"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ACL99947"
FT                   /db_xref="GOA:B9KLG5"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:B9KLG5"
FT                   /protein_id="ACL99947.1"
FT                   /translation="MTVSIKDVARAAGVAPSTVSRALGKGPVSAEVRAQVEAAVRATGY
FT                   QPNLSARRLRSQVPATVGLVLADIRNPFFTRLSFGVEDAAYRAGLRVFLCNTDEDPARE
FT                   AMHLEMMAGERVSGLILAPTRELRPEALRRLQMPVVLVDRDPEGAGCDAVTLDNEGAMR
FT                   TLVDHVVASGRQRIAGLFGANSFTGEARAAGFVAALARHGLPALVHRAPPNALAGYAAL
FT                   ADWLEAERPEALIVSNGLFLEAAVRFCHDRGLVIPRDLAVAGVDDDPWTGIVNPGLTVL
FT                   RQPAETMGREALTLLLARLEMPDRPRRKLVLESELVPRDSTAPRLLSRDEPAA"
FT   gene            80987..83494
FT                   /locus_tag="RSKD131_0089"
FT   CDS_pept        80987..83494
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0089"
FT                   /product="Phosphoenolpyruvate--protein phosphotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ACL99948"
FT                   /db_xref="GOA:B9KLG6"
FT                   /db_xref="InterPro:IPR000032"
FT                   /db_xref="InterPro:IPR000121"
FT                   /db_xref="InterPro:IPR001020"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR006318"
FT                   /db_xref="InterPro:IPR008279"
FT                   /db_xref="InterPro:IPR008731"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="InterPro:IPR018274"
FT                   /db_xref="InterPro:IPR023151"
FT                   /db_xref="InterPro:IPR035895"
FT                   /db_xref="InterPro:IPR036618"
FT                   /db_xref="InterPro:IPR036637"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:B9KLG6"
FT                   /protein_id="ACL99948.1"
FT                   /translation="MTRQGEIPRELIQLDARASSKEEAIAQAAAALVAAGCVRPGFEAS
FT                   MLRREAVSNTYLGKGIAIPHGTVEDRDLIQKDAIAVLQVRDGVEWNAGERARLVVAIAA
FT                   RSDGHIEILRRLTRLLQDEDRLAALAATDDRQALSDALNGVAAGAAATAEPAGDFAQSF
FT                   DWVLDYPTGLHARPATEWAEAARRFPCRIRIRHGAETADARNMISLLSLGLKSGDAITV
FT                   SAEGQGAAEALATLKVTMTGLSAREKADAARAEEKRRATAAAGGWVPLSSPRAIEGVPA
FT                   APGLAIGRITRIATDGMEIPDEPVELARAADLLHAALGQTVEQLHSLADDTARRLGESD
FT                   AAIFRAQAGLLADPDLITLASQWLVDGHGLAWSWHRAYEDMAARLSALRNPVLAARAAD
FT                   LRDVGQRVLAHIDPRFARSRLADLPEDTILVAEDISPSDAAGLDPAKVAGLVTALGGPT
FT                   SHTAILARTLGLPAVVGTGAVIERLEDGACAIVDGHGGRLYLDPSEADLASARDWIAAE
FT                   EARRARAAETRALPATTRDGHRIDIGANINLAEQAAFALGQGAEGVGLMRTEFLFLERS
FT                   ESPTEDEQAEAYAAMARALEGRPLVIRALDIGGDKQVAHLDLPREENPFLGVRGARLLL
FT                   RRPDLLVPQLRALYRAAAGGAQISVMFPMVTSLGELLELRATCERIRQELDAPVVPLGI
FT                   MVEVPSAALLAAEFAAHADFFSIGTNDLTQYALAIDRQNPELAPEADSLHPAVLRLIDL
FT                   TVKGAAAHGRWVGVCGGIAGDPFGAALLAGLGVDELSMTPRDIPAVKERLRQSDRAGLR
FT                   ALAERALACSDADAVRALAAEAP"
FT   gene            83491..84477
FT                   /locus_tag="RSKD131_0090"
FT   CDS_pept        83491..84477
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0090"
FT                   /product="1-phosphofructokinase precursor"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ACL99949"
FT                   /db_xref="GOA:B9KLG7"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR017583"
FT                   /db_xref="InterPro:IPR022463"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:B9KLG7"
FT                   /protein_id="ACL99949.1"
FT                   /translation="MSRVHTVTLNPAIDQTVSLPHLAVGEVNRATAVRHDPGGKGINVA
FT                   SVLADWGVSVAAHGLLGRANAAPFEALFAQKSIADRMLRVAGETRTNVKILEEDGRTTD
FT                   LNLPGFPADEGHLAALAEGLGSVAAGELVVISGSQPAGLPASATARLAARVQERGARVL
FT                   CDVSGAPLAEVLAAPLLPDAIKPNRHELEGWVGRNLADRADLAAAAAALAARGIALVVV
FT                   SLGTEGALFVSSDGAVVARPVQLSRGSTVGAGDAMVAGLASALVEGLPLRATAARATAF
FT                   AAAKLQNPGPHLPGVDQVHALEARVERMAAADWIRAAGRTDDQGERT"
FT   gene            84474..86219
FT                   /locus_tag="RSKD131_0091"
FT   CDS_pept        84474..86219
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0091"
FT                   /product="PTS system, fructose subfamily, IIC subunit
FT                   precursor"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ACL99950"
FT                   /db_xref="GOA:B9KLG8"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR003353"
FT                   /db_xref="InterPro:IPR003501"
FT                   /db_xref="InterPro:IPR006327"
FT                   /db_xref="InterPro:IPR013011"
FT                   /db_xref="InterPro:IPR013014"
FT                   /db_xref="InterPro:IPR036095"
FT                   /db_xref="UniProtKB/TrEMBL:B9KLG8"
FT                   /protein_id="ACL99950.1"
FT                   /translation="MTGIVAVISTGSFGPHAALAREALRKAAQGLGRAIAVELRTQETV
FT                   TDALPPEAVSGASQVLLVTEPGGAAADEARFAGRPTIHATLAEVLEDAPGVLARTGSGA
FT                   AAAPASAPAAAEGALKIVAITSCPTGIAHTFMAAEGLVEGARAQGHQIRVETQGSVGAQ
FT                   DELTAAEIAAADLVIIAADKQVDLGRFGGKRLFLSPTKPAITDGAGLIRKAQAEARMQA
FT                   GSASSEAAQPEAKKVGVYKHLMTGVSFMLPFVVAGGLLIAIAFALGGIYVYEDQYAGTL
FT                   GHTLFQIGAKGAFTLMVPALAGYIAWSIADRPGLAPGMTGGVIAGTIGAGFLGGIVAGF
FT                   IAGYGVLWLNRAIKLPKTLQGLKPVLILPLLGTALTGLLMYYVVGEPTARLLATITAFL
FT                   QGMQGTSAALLGLLLGGMMAVDMGGPVNKAAYAFATTLIAANVLEPMAAVMCAGMVPPI
FT                   ALAVACRLLPARFTPEEREAGNAAFVLGLAFVTEGAIPFAARDPLRVIPSLIAGSAVAG
FT                   AICMALGVAQRVPHGGIFVLPIPNAVTNLTGFGIALVAGTAVSVLALALVKRRIVVPAA
FT                   VPSAV"
FT   gene            complement(86327..86653)
FT                   /locus_tag="RSKD131_0092"
FT   CDS_pept        complement(86327..86653)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0092"
FT                   /product="Hypothetical Protein"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ACL99951"
FT                   /db_xref="GOA:B9KLG9"
FT                   /db_xref="InterPro:IPR003844"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9KLG9"
FT                   /protein_id="ACL99951.1"
FT                   /translation="MGLSLAAYAGAALAEIAGCFAVWAWWRLGASALWLVPGALSLGAF
FT                   AWLLALTPVEVAGRSYAVYGGIYVAASLLWLWAVEGVRPDRWDMGGAALVLAGAAVILW
FT                   APRG"
FT   gene            complement(86653..87078)
FT                   /locus_tag="RSKD131_0093"
FT   CDS_pept        complement(86653..87078)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0093"
FT                   /product="transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ACL99952"
FT                   /db_xref="GOA:B9KLH0"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="UniProtKB/TrEMBL:B9KLH0"
FT                   /protein_id="ACL99952.1"
FT                   /translation="MLTIGKLAEAAGVKVPTIRYYEQIGLLPPPERSAGNQRLYGHRAE
FT                   ERLAFIRHARDLGFPLEAIRDLLSLSDRPDQSCEAADAIARAQLSAVQARIGRLRALEA
FT                   ELERMIGQCAHGTIADCRVIEVLGDHAHCVHEHRKEP"
FT   gene            87186..89384
FT                   /locus_tag="RSKD131_0094"
FT   CDS_pept        87186..89384
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0094"
FT                   /product="Heavy metal translocating P-type ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ACL99953"
FT                   /db_xref="GOA:B9KLH1"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:B9KLH1"
FT                   /protein_id="ACL99953.1"
FT                   /translation="MREWRVTGMDCASCAGKIRDAVGRLPGVSGVEVAIMSERLKLTLD
FT                   EGQGAPEAVEATVRKLGFGIAPRAEARPFVLPEAAEAACGCGACGTDAPHAHSHSHDHE
FT                   AAEPGAWYRTAKGRLVLLTGVLLTCAWTVEALVPGPVGPVAFAMACLIGLVPIARRAFA
FT                   ALRLGQPFTIEGLMTVAAAGALFIGAAEEAALVIFLFAVGEVLEGVAASRARDGIRALS
FT                   RLVPETARLEQDGRTVEVPAAGLQPGQIVRVRPGERIPADGEILEGQGGLDESPVTGES
FT                   IPVTRGPGEAVFAGAVATDAVLRIRVTRAAKDNTIARIVRLVEEAEEARAPTERFIDRF
FT                   SRWYMPLIVGLAVAVAVLPPLAAGADWSTWIYRGLALLLIGCPCALVISVPAAIASALA
FT                   SGARRGLLMKGGAVIEAAAAVRQVAFDKTGTLTRGRPEVTDVVTLSGEPEVRVLALAAA
FT                   VERGSAHPLAQAILARAEAAGAPDLPAEAARSLAGRGAEARVEGEDLWVASPSFAAERG
FT                   VLDAGTRARAEALEAEGKTVTVLFREGRALGLLALRDEPRGDAAEAVRQLGRMGVSTTI
FT                   LTGDNARTAEAIAARLGTGFRAHMRPEDKLAAIREMAGQGGVMMIGDGINDAPALKAAS
FT                   VGMAMGSGTDVALETADAAILRDRVTDVPATIRLARAAMRNIRQNIAVALGLKGVFLVT
FT                   SVLGITGLWIAILADTGATVLVTLNALRLLRFDPEARG"
FT   gene            complement(89508..90029)
FT                   /locus_tag="RSKD131_0095"
FT   CDS_pept        complement(89508..90029)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0095"
FT                   /product="Single-stranded DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ACL99954"
FT                   /db_xref="GOA:B9KLH2"
FT                   /db_xref="InterPro:IPR000424"
FT                   /db_xref="InterPro:IPR011344"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:B9KLH2"
FT                   /protein_id="ACL99954.1"
FT                   /translation="MAGSVNKVIIIGNLGRDPEVRSFQNGGKVVNLRIATSEQWRDRAS
FT                   GERKERTEWHSVAIFDENLARVAEQYLRKGSTVYIEGQLETRKWQDQSGQDRYSTEVVL
FT                   RPFRSSLTMLGGRGEGAGAGGGMGGGGYEDRGGPDSYDNYGSSPRGGASSGGAPSGGGR
FT                   RNDLDDEIPF"
FT   gene            90264..90857
FT                   /locus_tag="RSKD131_0096"
FT   CDS_pept        90264..90857
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0096"
FT                   /product="Lytic transglycosylase, catalytic precursor"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ACL99955"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:B9KLH3"
FT                   /protein_id="ACL99955.1"
FT                   /translation="MGAAVVGLGLASAPTEGLADGLKIQRSTMNRAGIFKSQTRLLDGR
FT                   LSQQYESSTRLKPKVETLAAALPTARYNGRYKGEFLESAKSAARKHGVPEDLYLRLVQQ
FT                   ESGWNPGAVSVKGATGLAQLMPGTAQLLRVNINDPHQNLEGGARYLKMMYNKFGTWQLA
FT                   LAAYNAGPQAVEKHSGIPPYRETQNYVKVIWGNS"
FT   gene            complement(90970..92262)
FT                   /locus_tag="RSKD131_0097"
FT   CDS_pept        complement(90970..92262)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0097"
FT                   /product="Seryl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ACL99956"
FT                   /db_xref="GOA:B9KLH4"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002317"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR015866"
FT                   /db_xref="InterPro:IPR033729"
FT                   /db_xref="InterPro:IPR042103"
FT                   /db_xref="UniProtKB/TrEMBL:B9KLH4"
FT                   /protein_id="ACL99956.1"
FT                   /translation="MHDIRIIREFPDRFDTALSRRGLSALSGEILAIDEARRSKILAAD
FT                   TAQAEQNRASKEVGAAKARGDEAEFERLRALLAEKKAEVARLNEEAAAEDARLRDMLVA
FT                   IPNLPLDEVPEGPDESANVEIRRWGTPRGFNFAPKEHFEIAGVKPGMDFATAAKISGSR
FT                   FVMLKGAVIRVHRALAQFMLDTHVTEHGLTETWTPVLVKDEAMFGTGQLPKFSEDSYQT
FT                   TNGWWLIPTSEVTLTNSVAGEILDEAQLPIRMTAHTQCFRSEAGSAGKDTSGMLRQHQF
FT                   EKVEMVSITTPETSLAEHERMTGCAEAILQKLGLPYRTIVLCTGDMGFGATKTHDLEVW
FT                   LPGQNTYREISSVSVCGDFQARRMNARFRPAGGGKPEFVHTLNGSGLAVGRCLIAVLEN
FT                   GQQEDGSVELPEALHPYLGGKTRISADGTLE"
FT   gene            complement(92369..92926)
FT                   /locus_tag="RSKD131_0098"
FT   CDS_pept        complement(92369..92926)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0098"
FT                   /product="Superoxide dismutase, copper/zinc binding
FT                   precursor"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ACL99957"
FT                   /db_xref="GOA:B9KLH5"
FT                   /db_xref="InterPro:IPR001424"
FT                   /db_xref="InterPro:IPR018152"
FT                   /db_xref="InterPro:IPR024134"
FT                   /db_xref="InterPro:IPR036423"
FT                   /db_xref="UniProtKB/TrEMBL:B9KLH5"
FT                   /protein_id="ACL99957.1"
FT                   /translation="MSRTIAIAAAALLAAPALAQDVPARAENATAAPGQPGFPERTATF
FT                   MSVEGTPLGKATIAPLPHGVLFTLDLQGLPPESWLGFHIHETGECDAGTGFKSAGGHFS
FT                   IAETEHGLMVEAGPHAGDMPNQYVGADGTLRAQVFNTFVQLGGENASDLTGRALMLHSG
FT                   PDDYVSQPAGDAGDRLACAVIE"
FT   gene            complement(92975..93151)
FT                   /locus_tag="RSKD131_0099"
FT   CDS_pept        complement(92975..93151)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0099"
FT                   /product="Hypothetical Protein"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ACL99958"
FT                   /db_xref="UniProtKB/TrEMBL:B9KLH6"
FT                   /protein_id="ACL99958.1"
FT                   /translation="MPRWQASHGRPYMHATRGSKPGMNRPGRAQGPISRHAGRRPETGP
FT                   TQGTVARPSRFLG"
FT   gene            93218..93544
FT                   /locus_tag="RSKD131_0100"
FT   CDS_pept        93218..93544
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0100"
FT                   /product="Protein translocase subunit yajC"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ACL99959"
FT                   /db_xref="GOA:B9KLH7"
FT                   /db_xref="InterPro:IPR003849"
FT                   /db_xref="UniProtKB/TrEMBL:B9KLH7"
FT                   /protein_id="ACL99959.1"
FT                   /translation="MFVTPAFAQAASGGAAGAFTSFVPLILIFVIMYFLLIRPQQKKLK
FT                   EHKAMVEALRRGDQVLTGGGIVGKVVKVHEDGIVDVEIADGVKVRVMKSTIVQVMSKTE
FT                   PAAA"
FT   gene            93560..95224
FT                   /locus_tag="RSKD131_0101"
FT   CDS_pept        93560..95224
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0101"
FT                   /product="Protein-export membrane protein SecD"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ACL99960"
FT                   /db_xref="GOA:B9KLH8"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR005791"
FT                   /db_xref="InterPro:IPR022645"
FT                   /db_xref="InterPro:IPR022813"
FT                   /db_xref="UniProtKB/TrEMBL:B9KLH8"
FT                   /protein_id="ACL99960.1"
FT                   /translation="MLHFPVWKRVLIWGICALAILYAAPNFFYSRVESHNDAVAAIEKA
FT                   GGTATPEQTAAVGLWPEWLPSNIVNLGLDLRGGAHLLAEVRVEDVYAARMDGLWPEVRD
FT                   ALRGLRDQVGSIRRQTAPAGELRVAISRPEGMQAALEAARRLAQPVVSFTGMGQNDIEI
FT                   SSQGDVLVIRLTEAEKTAMDSRTVQQSLEIIRRRVDEVGTREPTIQRQGEDRILIQVPG
FT                   IGSAAELKSLIGTTAKLTFHPVLGRTADAQSSASGDLVLPAANEQGIFYVLDRSPVVTG
FT                   EELVDAQPSFDQNNRPAVSFRFNPSGARAFGDYTAQNIGKPFAIVLDNEVISAPVIQAH
FT                   IAGGSGIITGNFSVEESTELAVLLRAGALPAEMTFLEERTIGPELGQDSIDAGRTAAIV
FT                   GMIAVVAFMIASYGWFGVLANIALAINMLAIIALLSVVGATLTLPGIAGIVLTIGVAVD
FT                   ANVLIYERIREELRQGKQPGRAIELGFEKALSAIVDANVTTFLVALIMFLVGAGPVRGF
FT                   AVTLTIGIFTSVFTAVYVTRILIATWFAWRRPRTIVV"
FT   gene            95234..96208
FT                   /locus_tag="RSKD131_0102"
FT   CDS_pept        95234..96208
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0102"
FT                   /product="Protein-export membrane protein secF"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ACL99961"
FT                   /db_xref="GOA:B9KLH9"
FT                   /db_xref="InterPro:IPR005665"
FT                   /db_xref="InterPro:IPR022645"
FT                   /db_xref="InterPro:IPR022646"
FT                   /db_xref="InterPro:IPR022813"
FT                   /db_xref="UniProtKB/TrEMBL:B9KLH9"
FT                   /protein_id="ACL99961.1"
FT                   /translation="MAFRLKLCPEKTNIDFFWAAPVTFGFSVFLMAASLVAWLTLGLNF
FT                   GIDFRGGTTIRTESTQTVDVAAYRAALEGQDLGDISITEVFDPGFRADQHVAMVRIGAQ
FT                   DATQSITPEQIGQVEEALKTVDPSITFPSVESVGPKVSGELIWSAIMAVAAACAGIAVY
FT                   IWLRFEWQFALGSVAALIHDVLVTIGVFALFQIKFDLTTVAALLTVLGYSINDTVVVFD
FT                   RLRENLVKYKTMPLRDVMNLSVNETLSRTIMTLMTTLIALVSLLVFGGDVIRGFVFAIT
FT                   FGVVIGTYSSIYMAKNIVLYLGVDRGGPKKDSKAGTQFANIDA"
FT   gene            96385..96738
FT                   /locus_tag="RSKD131_0103"
FT   CDS_pept        96385..96738
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0103"
FT                   /product="YheA protein"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ACL99962"
FT                   /db_xref="InterPro:IPR007523"
FT                   /db_xref="InterPro:IPR036748"
FT                   /db_xref="UniProtKB/TrEMBL:B9KLI0"
FT                   /protein_id="ACL99962.1"
FT                   /translation="MRLTEITYDSAQPVEGYGPGYFRIGGEVLEGACLISPWGAGPWGG
FT                   LEDMAGPLALVDRIDVLFVGMGADVAHVPQAFRAALEEAGIGVEAMSSPAACRTYNVLL
FT                   SEGRRVAIALLPV"
FT   gene            96806..97438
FT                   /locus_tag="RSKD131_0104"
FT   CDS_pept        96806..97438
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0104"
FT                   /product="Cytochrome c biogenesis ATP-binding export
FT                   protein ccmA"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ACL99963"
FT                   /db_xref="GOA:B9KLI1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005895"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B9KLI1"
FT                   /protein_id="ACL99963.1"
FT                   /translation="MDLTVTNLACARGGVTVLERVSFRLSRGAALILRGPNGIGKTTLL
FT                   RTVAGLQPAVAGEISMPPEAVAYAAHADGLKATLTAAENLAFWAAIYGTDRAARAIERM
FT                   NLAALADRQAQNLSAGQKRRLGLARLLVTGRPLWVLDEPTVSLDAASVALFGDVVRTHL
FT                   AEGGAALMATHIDLGLAEAEVLDLAPYRAETPAGAEPADDPFAGVTA"
FT   gene            97435..98091
FT                   /locus_tag="RSKD131_0105"
FT   CDS_pept        97435..98091
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0105"
FT                   /product="Heme exporter protein CcmB"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ACL99964"
FT                   /db_xref="GOA:B9KLI2"
FT                   /db_xref="InterPro:IPR003544"
FT                   /db_xref="InterPro:IPR026031"
FT                   /db_xref="UniProtKB/TrEMBL:B9KLI2"
FT                   /protein_id="ACL99964.1"
FT                   /translation="MIALLLRDLRLALRAGGGFGLGLAFFLLVAVLVPLGVGPEPATLA
FT                   KIAPGILWVGALLACLLSLDRIFALDHEDGSLDLLATAPIPLEGVVAVKACAHWIVTGL
FT                   PLTLVSPLLGLLMNLPAEGYPLLLASLAIGTPALSVIGTFGAALTVGLKRGGLLLSLLV
FT                   LPLYVPTLVFGAEAVRRGALGMDVATPFLLLGGITAGVAALLPFASAAAVRINLR"
FT   gene            98134..98868
FT                   /locus_tag="RSKD131_0106"
FT   CDS_pept        98134..98868
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0106"
FT                   /product="Heme exporter protein CcmC"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ACL99965"
FT                   /db_xref="GOA:B9KLI3"
FT                   /db_xref="InterPro:IPR002541"
FT                   /db_xref="InterPro:IPR003557"
FT                   /db_xref="UniProtKB/TrEMBL:B9KLI3"
FT                   /protein_id="ACL99965.1"
FT                   /translation="MAMSIWEYANPKKFMETSSIALPWATGGALLCLIVGLVWGFFFTP
FT                   DDYKQGSTVKIIYLHVPSALMAINAWLMMLAASLIWLVRRHHVSALAAKAAGPVGLTFT
FT                   LVALVTGAVWGQPMWGTWWAWDPRLTSFLILALFYLGYIALWQAVENPDTAADLTSVLC
FT                   IVGSVFAVLSRYAVNFWNQGLHQGASLSLDKEENVADVFYFPLLVCIAGFVLLFLTLVL
FT                   LRTRTEIRVRRVQALLARERMA"
FT   gene            98865..99026
FT                   /locus_tag="RSKD131_0107"
FT   CDS_pept        98865..99026
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0107"
FT                   /product="Heme exporter protein D"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ACL99966"
FT                   /db_xref="GOA:B9KLI4"
FT                   /db_xref="InterPro:IPR007078"
FT                   /db_xref="UniProtKB/TrEMBL:B9KLI4"
FT                   /protein_id="ACL99966.1"
FT                   /translation="MIPDLGKYAVSVLTAYGASIALLAGLVALSLWRGARVRRMLREVE
FT                   QRQGRIDG"
FT   gene            99034..99558
FT                   /locus_tag="RSKD131_0108"
FT   CDS_pept        99034..99558
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0108"
FT                   /product="Periplasmic protein thiol--disulphide
FT                   oxidoreductase DsbE"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ACL99967"
FT                   /db_xref="GOA:B9KLI5"
FT                   /db_xref="InterPro:IPR004799"
FT                   /db_xref="InterPro:IPR013740"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B9KLI5"
FT                   /protein_id="ACL99967.1"
FT                   /translation="MFVPPVLFAGLAAMFFVGMQRENPDELPSALAGKPAPAVRTEPLG
FT                   DHPPFEDAILRAPGVKLVNYWASWCAPCRVEAPTLEALAADGVEIHGVNYKDKPENAEA
FT                   FLAELGNPYATLGADASGRMALDWGVYGVPETYVIDGKGRIVLRFPGPVTERVLEETIR
FT                   PAMEKAAAAAR"
FT   gene            complement(99759..102443)
FT                   /locus_tag="RSKD131_0109"
FT   CDS_pept        complement(99759..102443)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0109"
FT                   /product="Aconitase"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ACL99968"
FT                   /db_xref="GOA:B9KLI6"
FT                   /db_xref="InterPro:IPR000573"
FT                   /db_xref="InterPro:IPR001030"
FT                   /db_xref="InterPro:IPR006249"
FT                   /db_xref="InterPro:IPR015928"
FT                   /db_xref="InterPro:IPR015931"
FT                   /db_xref="InterPro:IPR018136"
FT                   /db_xref="InterPro:IPR036008"
FT                   /db_xref="UniProtKB/TrEMBL:B9KLI6"
FT                   /protein_id="ACL99968.1"
FT                   /translation="MTVTVGHDSQKTRKTLSVGGSSYAYYSIPAAEEAGLGQFARLPAA
FT                   LKVVLENMLRFEDGKTVSVDDIRAFSEWGANGGRNPREIAYRPARVLMQDFTGVPAVVD
FT                   LAAMRDGILGLGGDAQKINPLNPVDLVIDHSVMIDEFGNPRAFQMNVDREYERNMERYT
FT                   FLKWGQKAFNNFRVVPPGTGICHQVNLEYLAQTVWTDRDQDGMEVAYPDTLVGTDSHTT
FT                   MVNGLAVLGWGVGGIEAEAAMLGQPVSMLIPEVVGFKLTGQMIEGTTATDLVLKVVQML
FT                   RKKGVVGKFVEFYGEGLDHLPLADRATIANMAPEYGATCGFFPIDGETLRYLRQTGRDE
FT                   ARIALVEAYAKANGLWRDAGYEPIYTDTLHLDMGEIVPAISGPKRPQDYLPLTDAKASF
FT                   AREMETSFKRPVGKEVPVAGEDYTMSSGKVVIASITSCTNTSNPYVLIGAGLVARKARA
FT                   LGLNRKPWVKTSLAPGSQVVSEYLEAAGLQEDLDAVGFNLVGYGCTTCIGNSGPLQPEI
FT                   SAAINEGDLVAAAVLSGNRNFEGRISPDVRANYLASPPLVVAYALAGDMNIDLTSEPVG
FT                   MGTNGPVYLKDIWPTNAEIAELVEKTVTREAFQKKYADVFKGDAKWQAVSTTDSQTYDW
FT                   PASSTYIQNPPYFQNMSKEPGVITDITGARVLALLGDMITTDHISPAGSFKESTPAGKY
FT                   LVERQVSPREFNSYGSRRGNHEVMMRGTFANIRIKNEMLDGVEGGYTLGPDGQQTSIFD
FT                   ASMAYQAAGTPLVIFGGIEYGAGSSRDWAAKGTALLGVKAVIAESFERIHRSNLVGMGV
FT                   IPFEFTEGQNRKMLGLKGDETVSIQGLSGDLKPLSLVPCTIAYGDGTVKTIQLKCRIDT
FT                   EIEIEYVEHGGVLHYVLRDLASV"
FT   gene            102749..103372
FT                   /locus_tag="RSKD131_0110"
FT   CDS_pept        102749..103372
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0110"
FT                   /product="Hypothetical Protein"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ACL99969"
FT                   /db_xref="InterPro:IPR010634"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B9KLI7"
FT                   /protein_id="ACL99969.1"
FT                   /translation="MVVELFTSQGCSACPPADAFLAALAADPRVIPLALHVDYWDYIGW
FT                   EDQFADARFTQRQKSYARAIGSRTIYTPQMIVGGTDRVEGNAPEKVAALILKHMQAAER
FT                   VGLWLERDGDVLRIHAEADPPLDEAVRVQLVRYRPEETVAIEHGENEGRTVTYRNIVTS
FT                   WEVVGDWGGQAPLSIEAKAAGPEPLAVILQNEGPGAILAAASLR"
FT   gene            complement(103451..104509)
FT                   /locus_tag="RSKD131_0111"
FT   CDS_pept        complement(103451..104509)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0111"
FT                   /product="Hypothetical Protein"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ACL99970"
FT                   /db_xref="UniProtKB/TrEMBL:B9KLI8"
FT                   /protein_id="ACL99970.1"
FT                   /translation="MIRRLARAVLGLALMGSLAATGLTAARIARDPALTPFTEAAADEI
FT                   RAASDRAMTRHAPPEAILARLALRLAEEPPNPVAVEALAELAAEQGLTLPPETAARLEE
FT                   LREETLWEDAAGCLACLWDAASCSLSAELLCQAPMVLTPAGDVAGLARAGQAWASGSEV
FT                   DRVDLALSTVGLGATAAVLVSGGSSATVKVGAGLLRMAHRMRLLSPPLARLVTRTAATA
FT                   VDWARLPAVRSTEDMAGLLRPEALRPMAEVAKGLGRIGARLPPAQTLHLLRHVDDGADA
FT                   RRFAAAAEALGPRTVARVEMLGKVRFLRATVRWSDAARALMASLTALLASATALLAGAA
FT                   QSLGLRLLRRLV"
FT   gene            complement(104506..105549)
FT                   /locus_tag="RSKD131_0112"
FT   CDS_pept        complement(104506..105549)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0112"
FT                   /product="Tryptophanyl-tRNA synthetase precursor"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ACL99971"
FT                   /db_xref="GOA:B9KLI9"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002305"
FT                   /db_xref="InterPro:IPR002306"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR024109"
FT                   /db_xref="UniProtKB/TrEMBL:B9KLI9"
FT                   /protein_id="ACL99971.1"
FT                   /translation="MTEPVQTPQVFPTRVFSGIQPSGGLTLGNYLGALKRFAEMQKDGV
FT                   ETIYCVVDMHAITVWQDPAKLRQQTREIAAAFLAAGVDPVRSILFNQSQVTAHAELAWI
FT                   FNCVARMGWMNRMTQWKDKAGKNAEAASLGLFAYPALMAADILAYRATHVPVGEDQKQH
FT                   VELTRDIAIKFNNDFGVNFFPVTEPVIEGVATRVMSLRDGTKKMSKSDPSDQSRINMTD
FT                   DADTITRKIHKAKTDPLPLPYSIEGLKERPEARNLVNIYAALSRSTPEAVVTEFAGAPF
FT                   GVFKPKLAELAVSVMAPISDEMNRLMADPAEIDRILGDGADRAEALARPVLDEVHDIVG
FT                   MIRSRRR"
FT   gene            105641..106327
FT                   /locus_tag="RSKD131_0113"
FT   CDS_pept        105641..106327
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0113"
FT                   /product="Rhomboid family protein"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ACL99972"
FT                   /db_xref="GOA:B9KLJ0"
FT                   /db_xref="InterPro:IPR002610"
FT                   /db_xref="InterPro:IPR022764"
FT                   /db_xref="InterPro:IPR035952"
FT                   /db_xref="UniProtKB/TrEMBL:B9KLJ0"
FT                   /protein_id="ACL99972.1"
FT                   /translation="MRDNYNASPVNPMPAVVWLLALPIVAMEAVVALGASGIVGGGAGA
FT                   GWRLDAWQRFAFSPDLMRAMLETHTYPWQGMIRLVSYPLVHATFLHALMAVVILLALGK
FT                   MVGEVFRPWAVAAVFLGAAVVGALAYAAIPGVRAPLIGAYPADYGLVGAFTFLIWTRLA
FT                   ATGGNQYRAFSLIGMLLGIQLLFGLFFGGGYEWVADLAGFATGFLLSFAVSPGGWARVK
FT                   EKLRRR"
FT   gene            complement(106358..107899)
FT                   /locus_tag="RSKD131_0114"
FT   CDS_pept        complement(106358..107899)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0114"
FT                   /product="Integral membrane protein MviN precursor"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ACL99973"
FT                   /db_xref="GOA:B9KLJ1"
FT                   /db_xref="InterPro:IPR004268"
FT                   /db_xref="UniProtKB/TrEMBL:B9KLJ1"
FT                   /protein_id="ACL99973.1"
FT                   /translation="MKPISLARGFLTVGGWTLLSRGAGFARDVMMAAYLGAGPVAEAFL
FT                   VAFALPNMFRRFFAEGAFNMAFVPMFAKKLEGHEDAKAFARDAFSGLAGILVTFTLLGT
FT                   LLMPWLVLAMASGFAGDARFDLAVGFGRIAFSYIFFISLVALLSGVLNAFGRFTEASFV
FT                   PVLMNLMFIAAMLIADRQGWDMGLTLAWTVPVTGVAQFLFTWFAARRLGFTLWPHLPRL
FT                   TPDLKRLAVIAAPAVLAGGVVQVNLLVGRQVASFTEGAVAWLSYADRLYQLPLGVVGIA
FT                   IGTVLLPDLSRRLRAGDEAGSRASFNRGTEFALMLTVPAAVALVVIALPLTQVLFQRGA
FT                   FGADDAWNTALALGAYGLGLPAFVLHKVLQPLYYAREDTRRPFHYAVVSMVVNLAFAIG
FT                   LMPVMGFLAAALATTVSGWVMVWQLWAGSRGMGAASGLDDRLRARLPRIVVAALFMGLV
FT                   LFGATGLLEPLLSEPGWRYPGLAALVAAGIASYFGAGAAIGAFRLSDLRSLRRRA"
FT   gene            complement(107896..110688)
FT                   /locus_tag="RSKD131_0115"
FT   CDS_pept        complement(107896..110688)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0115"
FT                   /product="PII uridylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ACL99974"
FT                   /db_xref="GOA:B9KLJ2"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR010043"
FT                   /db_xref="InterPro:IPR013546"
FT                   /db_xref="UniProtKB/TrEMBL:B9KLJ2"
FT                   /protein_id="ACL99974.1"
FT                   /translation="MAPASEAGPAQDPLFSGLILPRSRILDAEALTRSILAEIDAAGPL
FT                   DPKSARAIAVRQMTEAKSAGNRALSETFEARPREARGLIRAQAALTDGLVTAALRVACE
FT                   RLHPLANPTEAERIAVLAVGGYGRAEMAPHSDVDLLFLTPWKITPWAEMVIESMLYMLW
FT                   DLRLKVGHSSRTVKDCLRLGREDITIRTALLEHRFLAGHAPLAAELDETLWNELFRGTG
FT                   AEFIDAKLEERGQRHKRQGGQRYVLEPNVKEGKGGLRDLQTLYWIGKYLNRVPSPSGLV
FT                   AAGLLTRDEFETFERAESFLWAVRCHLHYATGRATDQLTFDLQVEVAARMGYADTRGRR
FT                   GVEVFMQDYFRHATRVGELTRVFLAQLEARHEKREPKIMGLFRRKKRLKPEYSLVNGRI
FT                   DVLDPKAFLADKLNLLRIFEEALRTGFLIHPGAMRLIAANLHLIDEEMQHDREANRIFL
FT                   DMLLRHGNPERALRRMNELGVLGAFIPEFERIVAMMQFNVYHHYTVDEHTIQCISTLAQ
FT                   IERHELDEELPIANRILTDGISRRVIYVALLLHDIGKGRPEDHSILGAQIARRVAPRFG
FT                   LTAEECETVEWLVRYHLLMSDMAQKRDIGDPRTVRDFAKAVRSKKRLDLLTVLTVCDIR
FT                   GVGPGTWNNWKAQLLRKLYRDTVTALDAGLESLNRENRADEAKRALRELLEEWDPKDLR
FT                   AELARHYPPYWQALSNATHAVFARMLRGLGETEIRIDLDPDPDRDATRACFALADHPGI
FT                   FSRLAGALALVGANVVDARTYTTKDGYATAVFWIQDSEGSPYEISRLPRLTSMIDKTLK
FT                   GEVVAREALKDRDKLKKREAQFRFPTHIAFDNEGSDIYTIIEVDTRDRPGLLYDLTRTL
FT                   AANNIYIASAVIATYGAQVVDSFYVKDMFGLKLHQKNRQETLEKKLRQAIVEGAERAKQ
FT                   "
FT   gene            complement(110672..111847)
FT                   /locus_tag="RSKD131_0116"
FT   CDS_pept        complement(110672..111847)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0116"
FT                   /product="ABC-type branched-chain amino acid transport
FT                   systems periplasmic component-like protein precursor"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ACL99975"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:B9KLJ3"
FT                   /protein_id="ACL99975.1"
FT                   /translation="MLSVLSRARKSLGRAALALAALGVAACEPVAMTGGGPAVDSSKPV
FT                   PVALLVPAGSGQASDELLARSLQNAARLAAADLGNVQIDLRVYNTAGQPSQAASVASQA
FT                   VADGAKIILGPVFAQEANAVGAAVAPSGVNVLSFSNNPDIAGGNVFVLGPTFQNTANRL
FT                   AGYAVRQGNGRIMAVSDRTPAGQSGRAAIERGVAQSGGTLVASMDYEFSQNGIVSAAPG
FT                   IVERAQVTNAQALFLTADTAGALPLVTQVLRENGLPQETARFIGLTRWDIPSATLSLPG
FT                   VQGGWFALPDPGVYGQYEQRYRAAYGEAPHPISGLAYDGVAAVGALLKRGASDGLSGRA
FT                   LTQGSGFVGVNGIFRLRSDGTNERGLAVAQIRNNQVVVIDPAPRSFGGAGF"
FT   gene            111930..112817
FT                   /locus_tag="RSKD131_0117"
FT   CDS_pept        111930..112817
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0117"
FT                   /product="Transcriptional regulator, Fis family"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ACL99976"
FT                   /db_xref="GOA:B9KLJ4"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR008189"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:B9KLJ4"
FT                   /protein_id="ACL99976.1"
FT                   /translation="MTIGEAEPESGPGGARPLAPGLHFIATPIGAARDITLRALDILRA
FT                   ADVLAAEDTRTLRHLMEIHGIPLGGRPLVAYHDHNGEAARPRLLRALAEGRSVAYASEA
FT                   GTPLVADPGFQLGRAAIAAGHPVLAAPGPSAVLAALTVSGLPTDRFLFAGFPPATTSAR
FT                   RKFLAELAPVPATLVLYESPKRIHKTLEDMAVVLGDRQAAVCRELTKRFEEVSRGPLGL
FT                   LAQDFGDRSVKGEIVVVVDRAAPVQAGPEDLEAALVAALGTMSVKEAAAAVAGQLGLPR
FT                   RDVYQAALRLAEER"
FT   gene            112814..113167
FT                   /locus_tag="RSKD131_0118"
FT   CDS_pept        112814..113167
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0118"
FT                   /product="Hypothetical Protein"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ACL99977"
FT                   /db_xref="GOA:B9KLJ5"
FT                   /db_xref="InterPro:IPR003509"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011856"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9KLJ5"
FT                   /protein_id="ACL99977.1"
FT                   /translation="MSGEVSYHAGQTAEEAVARIYDRSGRPVAARRWRGLSGEIDLIAR
FT                   EGAEVIFIEVKKSTSHAAAAARLSRRQMDRIYGAASEFLAGEPRGQLTASRFDVALVDA
FT                   LGRVEIIENAFAA"
FT   gene            113220..114170
FT                   /locus_tag="RSKD131_0119"
FT   CDS_pept        113220..114170
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0119"
FT                   /product="Glutathione synthase"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ACL99978"
FT                   /db_xref="GOA:B9KLJ6"
FT                   /db_xref="InterPro:IPR004215"
FT                   /db_xref="InterPro:IPR004218"
FT                   /db_xref="InterPro:IPR006284"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:B9KLJ6"
FT                   /protein_id="ACL99978.1"
FT                   /translation="MRMSLNVALQMDPIGSVNIDADSTFRIALEAQARGHRLFFYTPDH
FT                   LAYDDGRVTARGSWIELRREKGNHVSYGETTTVDLGGFDVVWLRQDPPFDMGYITTTHI
FT                   LELLMPEVLVVNDPFWVRNAPEKLLVLRFPDLIPPTTIARDLTTIRAFKERHGDIILKP
FT                   LYGNGGAGVFRLDPNDRNLSSLHELFTSMSREPLIAQKFLPAVEKGDKRIILVDGEPIG
FT                   AINRVPQAGETRSNMHVGGRAEKVNLTDRDREICAALGPVLREKGQIFVGIDVIGDWLT
FT                   EINVTSPTGLQELERFDGTNGAARIWEVIEARRRG"
FT   gene            complement(114944..115120)
FT                   /locus_tag="RSKD131_0120"
FT   CDS_pept        complement(114944..115120)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0120"
FT                   /product="Transposase, IS4"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ACL99979"
FT                   /db_xref="UniProtKB/TrEMBL:B9KLJ7"
FT                   /protein_id="ACL99979.1"
FT                   /translation="MIDLRRVLAEITFRDADETSGPLPSLSIWRRLLARHPSGTIRQVV
FT                   KQALNPLEVEARH"
FT   gene            complement(115461..117005)
FT                   /locus_tag="RSKD131_0121"
FT   CDS_pept        complement(115461..117005)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0121"
FT                   /product="Mg chelatase, subunit ChlI"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ACL99980"
FT                   /db_xref="InterPro:IPR000523"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004482"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR025158"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B9KLJ8"
FT                   /protein_id="ACL99980.1"
FT                   /translation="MIARAFTVAFEGIDPRSVEVQCAVSPGLPAFAIVGLPDKAVSEAR
FT                   ERVRTALASMSIALPSRRITVNLSPADLPKEGSHFDLAIALALLAALEIVPAEEVERIL
FT                   AIGELSLDGRLVPVAGALPAAVAAAEQDRALLCPRGSGAEAAWVGATEVLAAASLDQVV
FT                   RHFTGQASIPPAEAGEVIDRPAVSVDLASVSGQERARRALEIAAAGRHHLLMIGAPGSG
FT                   KSLLARCMPGLLPPMTPAEALETSMIHSLAGKLSDGGISRARPFSSPHHTASPASIVGG
FT                   GRRAGPGEASLAHNGVLFLDELPEFPPRVLDTLRQPLETGEIMVPRADARHRYPCRFLL
FT                   IAAANPCRCGHLADASRACSRAPICGEEYLGRISGPLMDRLDLRIEVPPVDWVDGRLPP
FT                   ATEDSATVAARVAAARALQTRRYEGSAGVRVNADAEGPLLEQVAAPDAEGRALLARVAE
FT                   RFGLSARAYHRILRVARTIADLDGAPEVRHPHLAEAVSYRLTATAARSRITPATPR"
FT   gene            complement(117094..117330)
FT                   /locus_tag="RSKD131_0122"
FT   CDS_pept        complement(117094..117330)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0122"
FT                   /product="Hypothetical Protein"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ACL99981"
FT                   /db_xref="InterPro:IPR015102"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B9KLJ9"
FT                   /protein_id="ACL99981.1"
FT                   /translation="MLLIAVRDYLRERHQASLGDLAHRFRCDPSAMRGMVEHWVGKGKA
FT                   RELPCAPLACGKSCCGCTKAPEVIYEWVEGPPH"
FT   gene            complement(117337..119649)
FT                   /locus_tag="RSKD131_0123"
FT   CDS_pept        complement(117337..119649)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0123"
FT                   /product="Ferrous iron transport protein B"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ACL99982"
FT                   /db_xref="GOA:B9KLY5"
FT                   /db_xref="InterPro:IPR003373"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR011640"
FT                   /db_xref="InterPro:IPR011642"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030389"
FT                   /db_xref="InterPro:IPR041069"
FT                   /db_xref="UniProtKB/TrEMBL:B9KLY5"
FT                   /protein_id="ACL99982.1"
FT                   /translation="MSGATIALLGNPNCGKTTLFNALTGTRQMVGNWPGVTVEKKTGEI
FT                   RFAGRTAALVDLPGTYSLGSGHTVSTDERIARDFALSGEAQLVVNIVDASNIERNLYLT
FT                   LQILEMGVPVVVALNMMDIAASQRIEIDLEALAARLGCPVVPIVAATGRGIEELKAALV
FT                   QALDTGVPAVKPLSYVPEIEAAVADLVPAIEAAGETRAPRWLALELLEGSRTLIARVPT
FT                   LAPEVARARQALEEALGYDPDTAIASGRYDAVAEATAAAVRRTSELGRTLSDRIDRVVL
FT                   NRVLGIPIFLFVMYLMFLFTINVGSAFIDFFDVAAATIFVEGTAELLGRAGSPDWLTTV
FT                   LASGVGGGVQTVATFIPVIACLFLFLSVLEDSGYMARAAFVMDRFMRIVGLPGKSFVPL
FT                   IVGFGCNVPAVMATRTLENERDRTMTIAMAPFMSCGARLPVYALFAAAFFPANGQNLVF
FT                   LLYLIGILAAVFTGLVLKNTLLPGSTTPFVMELPPYHIPTLRAVLLRTWDRLKSFVIRA
FT                   GRVLVPVVAVIAVLNSWGRDGSFGNEDTDNSVLAAIGQTIAPAFEPMGIRPENWPATVG
FT                   IFTGLLAKEAVVGTLNALYSGMGETEEAQEEAAPYSLTAGLSAAVATIGENFGDLAGAL
FT                   TDPLGIEIGDLSSTDAAAEELEVSTGTFGAMRALFDGQAGAFAYLLMVLLYVPCTAAIA
FT                   AVWREAGPAWTGFVSVWTLMMGWGSATVFYQAATFARHPEASALWIGGVLAAFALVILV
FT                   MKRIGGTGSSRSAPAGA"
FT   gene            complement(119646..119885)
FT                   /locus_tag="RSKD131_0124"
FT   CDS_pept        complement(119646..119885)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0124"
FT                   /product="FeoA family protein"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ACL99983"
FT                   /db_xref="GOA:B9KLY6"
FT                   /db_xref="InterPro:IPR007167"
FT                   /db_xref="InterPro:IPR008988"
FT                   /db_xref="InterPro:IPR038157"
FT                   /db_xref="UniProtKB/TrEMBL:B9KLY6"
FT                   /protein_id="ACL99983.1"
FT                   /translation="MVLSLKDMAAGATARVTGYAPGGAAYRQKLLSMGLTPGTALRVLR
FT                   VAPLGDPVVIEVRGYQLSLRKAEASALSIEETAA"
FT   gene            complement(119892..120140)
FT                   /locus_tag="RSKD131_0125"
FT   CDS_pept        complement(119892..120140)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0125"
FT                   /product="FeoA family protein"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ACL99984"
FT                   /db_xref="GOA:B9KLY7"
FT                   /db_xref="InterPro:IPR007167"
FT                   /db_xref="InterPro:IPR008988"
FT                   /db_xref="InterPro:IPR038157"
FT                   /db_xref="UniProtKB/TrEMBL:B9KLY7"
FT                   /protein_id="ACL99984.1"
FT                   /translation="MMNARQMPLAFAPQEARLAVTGLAGCKEMQKRLSEMGLHVGGEVK
FT                   VIRGCVTGPLLLAVGKSRLALGQEMSRKIFVTPLQDR"
FT   gene            complement(120770..121279)
FT                   /locus_tag="RSKD131_0126"
FT   CDS_pept        complement(120770..121279)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0126"
FT                   /product="Hypothetical Protein"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ACL99985"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR010287"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="UniProtKB/TrEMBL:B9KLY8"
FT                   /protein_id="ACL99985.1"
FT                   /translation="METDMKTKELDTAFHDMLKDVYYAERQILKALPKMARAAKSEQLK
FT                   EAFKTHREETEGQKERLEKVFELLGKRAQGKTCPAIDGIIEEGSEVIDEYKDSPALDAA
FT                   LLAAAQAVEHYEMARYGTLVAWARTLGMEDAAKLLAETLEEEKKTDGLLNDLAGAEVNQ
FT                   SALAAA"
FT   gene            complement(121463..123763)
FT                   /locus_tag="RSKD131_0127"
FT   CDS_pept        complement(121463..123763)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0127"
FT                   /product="Oxidoreductase alpha (Molybdopterin) subunit"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ACL99986"
FT                   /db_xref="GOA:B9KLY9"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR010046"
FT                   /db_xref="InterPro:IPR037951"
FT                   /db_xref="InterPro:IPR041953"
FT                   /db_xref="UniProtKB/TrEMBL:B9KLY9"
FT                   /protein_id="ACL99986.1"
FT                   /translation="MDRPKEKRQRKDTPFYEAASGSWGSVRGIARVLLDQKPGPGVVRT
FT                   LMRQNKPGGHMCTSCAWAKPAKPNLFEFCENGAKATVWDLTTDRCGPDFFAAHSVSELR
FT                   TWSDHDLEKTGRLTHPMRYDAASDHYLPVTWEEAFREIGGRLRGIDPKQTVFYTSGKAS
FT                   LETAFLWQLFARAYGHNNLPDSSNMCHETTSVGLKKVIGSPVGTCVLEDFTHCDMILFF
FT                   GQNTGTNSPRFLHELQRAVQRGCKIVTFNPVRERGLVEFVNPQNPSQMTLGSPTRISDI
FT                   YLQVRPGGDIAALAGICKHLFALEDQRGSVIDRAFVAEHTSDFEAFEARIRDTSWEEIE
FT                   RNSMLRRADLEQVAEIYARSEKVIGIYGMGLTQHVHGWLNIGMLVNLLLMRGNIGRKGA
FT                   GISPVRGHSNVQGQRTVGISEKPSLVPIDKMEELFGLSIPRDEGWNTAVATEKLLDGTL
FT                   KAFLSLGGNFARAIPDQGRTDAAWAGLDLNVQVATKLNRSHTLVSRDSWLLPCLVRAEE
FT                   DRQASGPQAVSMEDSLSHIHGSVGKRPPASAWLLSEAAIVAGLAEATLPANPKLRWRDW
FT                   VGDYRHIRDLIEACWPEQFAAFNARLFTPGGFYRGNAARERQWKTDSGKAQFTAPDKLC
FT                   ALGEPPEGKEMTLVTLRSNDQFNTTIYGFSDRLRGLEGPRNVLLMNPEEIARHGLHEGQ
FT                   RVTLECAWSDGVDRRVSGLRVTAYDLPDSCVGAYYPETNPLVPLAARDELSGTPAYKGT
FT                   PVRIRAEGSAGPL"
FT   gene            124011..125555
FT                   /locus_tag="RSKD131_0128"
FT   CDS_pept        124011..125555
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0128"
FT                   /product="NH(3)-dependent NAD(+) synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ACL99987"
FT                   /db_xref="GOA:B9KLZ0"
FT                   /db_xref="InterPro:IPR003694"
FT                   /db_xref="InterPro:IPR008136"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR022310"
FT                   /db_xref="InterPro:IPR036653"
FT                   /db_xref="UniProtKB/TrEMBL:B9KLZ0"
FT                   /protein_id="ACL99987.1"
FT                   /translation="MSGQVAAARQETLVEEILDLSRQRQAGPLSPWFAARLEEQVEKGL
FT                   FLSPEDLEATGARLVEELVEYRTRTQVSTAVIGMSGGVDSALTAALFKAAGWHVVGHTL
FT                   PIEQDPTETDRGIEACAALGIEHRPLDLSGAYEAALAHLGELDPDLLSSDETPARTRRG
FT                   NLRARLRMMTLYDQAHRLGGLVAGTDNFSELTAGFWTLHGDVGDLAPVQSLLKSWEVPW
FT                   LARAYRVPEATWRAMPTDGLGIGGGDEAQIGATYLEWDILQFALAEALGDDPGLATRHL
FT                   AFALRMDADRHAQEVLGTLIARMRATWHKRLNPIRLNHPKADRYEPLERMEARLFRPQG
FT                   VTSDEALMGFPTEMQDLAAHLVRALKAADCRLVTAESCTAGLIAACVSGVPGRSGVLEG
FT                   SFVAYRPTMKFAALGVPEALIAEETVYDPKVARRMAEGALASAPEADLALAVTGVAGPG
FT                   EDEGHPPGYVCVAAALRGQETRVSEHYFPGSPRQVLAATLRRALQEGLTVLQEAHR"
FT   gene            complement(125578..126123)
FT                   /locus_tag="RSKD131_0129"
FT   CDS_pept        complement(125578..126123)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0129"
FT                   /product="Molybdopterin adenylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ACL99988"
FT                   /db_xref="GOA:B9KLZ1"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR036425"
FT                   /db_xref="UniProtKB/TrEMBL:B9KLZ1"
FT                   /protein_id="ACL99988.1"
FT                   /translation="MKIAIVTASDRASRGDYEDLSGPAIADWLATAVTSPYEIVRRIVP
FT                   DGVETVRTALIELCDAEGAALVFTTGGTGPAPRDLTPEAMVGVIEKELPGFGELLRSIG
FT                   LQQTPTAILSRQTAGVRGRSLIVNLPGQPAAIALSLQGVFGAIPKCLDLIGAGRMTVSD
FT                   RWGVEGRAAPTLPDYLRS"
FT   gene            126410..127534
FT                   /locus_tag="RSKD131_0130"
FT   CDS_pept        126410..127534
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0130"
FT                   /product="Alcohol dehydrogenase, zinc-binding domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ACL99989"
FT                   /db_xref="GOA:B9KLZ2"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B9KLZ2"
FT                   /protein_id="ACL99989.1"
FT                   /translation="MKITAAVLERDGIAGNYAEERPLAIRELDLAAPGPGEVLIRVAAA
FT                   GICHSDLSVINGTRRRPLPMVLGHEASGHVEALGEGVEDLEPGDHVVCIFAPGCGRCTP
FT                   CAEGRPALCEKAARHHAVGELMTGHRRLSLGGRPVHHHLGISGFATHAVVARPSLVRVP
FT                   REVPPHVSALFSCAMLTGAGAVFNTAQIRPGSKVAVVGLGGVGLSAILGAAAAGAAEIV
FT                   AIDPFPAKMEAARAMGATLSVPADGDTVAAVRDLTAGGVDYAFELAGSVRALETAFAVT
FT                   RRGGMTVTAGLPHPDDRMSLEALKLVAEERTLKGSYIGSCVPQRDLPRMLALHRRGLLP
FT                   VEKMLTHRLKLDEINLAMDRLAEGSAIRQVVDLG"
FT   gene            complement(127574..128995)
FT                   /locus_tag="RSKD131_0131"
FT   CDS_pept        complement(127574..128995)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0131"
FT                   /product="Peptidase U62, modulator of DNA gyrase"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ACL99990"
FT                   /db_xref="GOA:B9KLZ3"
FT                   /db_xref="InterPro:IPR002510"
FT                   /db_xref="InterPro:IPR025502"
FT                   /db_xref="InterPro:IPR035068"
FT                   /db_xref="InterPro:IPR036059"
FT                   /db_xref="UniProtKB/TrEMBL:B9KLZ3"
FT                   /protein_id="ACL99990.1"
FT                   /translation="MTDSAFRPFETHLDVETASAILREATRGADDGELFLERSRSESLV
FT                   LDDGRVKTASYDASEGFGLRAVRGEVAGYAHSTQISEQALKRACETARLAVGDGGGAMA
FT                   APPAGTNRRLYADLDPMADAAFPVKIELLREIDAFVRDLDPRVIQVSATVGAGLQEVEI
FT                   LRPEGTRLADVRPMVRMNVSVIVEENGRRESGSFGGGGRFGLSKLMEPDWWQTAAREAV
FT                   RIATVNLQAVPAPAGVMDVVLGAGWPGILLHEAIGHGLEADFNRKKTSAFAGLMGERIA
FT                   APGVTVLDDGTIPDRRGSISVDDEGTPSNRTVLIEDGILVGYMQDRQNARLMGTASTGN
FT                   GRRESYAHIPMPRMTNTYMLGGDADPAGIVADLKDGIYAVGFGGGQVDITNGKFVFSCT
FT                   EAYLVKDGKVGAPVKGATLIGDGATALRQIRAIGNDMKLDPGIGNCGKQGQWVPVGVGQ
FT                   PTLMIGGLTVGGSKA"
FT   gene            129021..130076
FT                   /locus_tag="RSKD131_0132"
FT   CDS_pept        129021..130076
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0132"
FT                   /product="Cytochrome c oxidase subunit 2 precursor"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ACL99991"
FT                   /db_xref="GOA:B9KLZ4"
FT                   /db_xref="InterPro:IPR001505"
FT                   /db_xref="InterPro:IPR002429"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR011759"
FT                   /db_xref="InterPro:IPR014222"
FT                   /db_xref="InterPro:IPR036257"
FT                   /db_xref="UniProtKB/TrEMBL:B9KLZ4"
FT                   /protein_id="ACL99991.1"
FT                   /translation="MMTLRRIVFLVVAKTIWSQSVQEQREICPVSGRRTDGTMAGRSQR
FT                   DLNMRHSTTLTGCATGAAGLLAATAAAAQQQSLEIIGRPQPGGTGFQPSASPVATQIHW
FT                   LDGFILVIIAAITIFVTLLILYAVWRFHEKRNKVPARFTHNSPLEIAWTIVPIVILVAI
FT                   GAFSLPVLFNQQEIPEADVTVKVTGYQWYWGYEYPDEEISFESYMIGSPATGGDNRMSP
FT                   EVEQQLIEAGYSRDEFLLATDTAMVVPVNKTVVVQVTGADVIHSWTVPAFGVKQDAVPG
FT                   RLAQLWFRAEREGIFFGQCSELCGISHAYMPITVKVVSEEAYAAWLEQARGGTYELSAV
FT                   LPATPAGVSVE"
FT   gene            130147..131079
FT                   /locus_tag="RSKD131_0133"
FT   CDS_pept        130147..131079
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0133"
FT                   /product="Protoheme IX farnesyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ACL99992"
FT                   /db_xref="GOA:B9KLZ5"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR006369"
FT                   /db_xref="InterPro:IPR030470"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9KLZ5"
FT                   /protein_id="ACL99992.1"
FT                   /translation="MTDIRITGIPKEAGFGDYVALLKPRVMSLVVFTALVGLLVAPVTV
FT                   HPMIALTGILFIALGAGASGALNMWWDEDIDRVMKRTRNRPVPSGIVAPGEALGIGLAL
FT                   SGIAVVMLGLATNLFAAGLLAFTIFFYAVVYSMWLKRTTPQNIVIGGAAGAFPPMIGWA
FT                   VATGGVSVESLFMFALIFMWTPPHFWSLALFMKSDYSDAGVPMLTVTHGRRVTRAHVLV
FT                   YSLLLAPLAVAGAFTGIGGPLYLATALALNGWLLVGAVRIWRRDEAQAEADRYRVEKGF
FT                   FRFSLYYLFLHFGAILAEAALKPYGLGGW"
FT   gene            131081..131257
FT                   /locus_tag="RSKD131_0134"
FT   CDS_pept        131081..131257
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0134"
FT                   /product="Hypothetical Protein"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ACL99993"
FT                   /db_xref="GOA:B9KLZ6"
FT                   /db_xref="UniProtKB/TrEMBL:B9KLZ6"
FT                   /protein_id="ACL99993.1"
FT                   /translation="MTIRAEHEIHRRRLGRNLGVGLTLAAFILVVFGLTVAKVSQLGEQ
FT                   GAFAHAPPGAMGQ"
FT   gene            131254..131829
FT                   /locus_tag="RSKD131_0135"
FT   CDS_pept        131254..131829
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0135"
FT                   /product="Cytochrome c oxidase assembly protein ctaG"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ACL99994"
FT                   /db_xref="GOA:B9KLZ7"
FT                   /db_xref="InterPro:IPR007533"
FT                   /db_xref="InterPro:IPR023471"
FT                   /db_xref="UniProtKB/TrEMBL:B9KLZ7"
FT                   /protein_id="ACL99994.1"
FT                   /translation="MSLSPHQKTAGGLVLVVAVMGAASFAAVPFYNWFCRVTGFAGTTA
FT                   VATEAPAEVLDRTVKVRFDASREAGMPWEFRPLQREMKLKIGETGLAFYEAYNPTDRTV
FT                   AGTASYNVTPDAAGGYFAKIACFCFTEQVLAPGERVEMPVTFYVDPAIIDDPDGRYVRQ
FT                   ITLSYTFHETALTEEQAALAAESATDVN"
FT   gene            131857..132657
FT                   /locus_tag="RSKD131_0136"
FT   CDS_pept        131857..132657
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0136"
FT                   /product="Cytochrome c oxidase, subunit III"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ACL99995"
FT                   /db_xref="GOA:B9KLZ8"
FT                   /db_xref="InterPro:IPR000298"
FT                   /db_xref="InterPro:IPR013833"
FT                   /db_xref="InterPro:IPR024791"
FT                   /db_xref="InterPro:IPR033945"
FT                   /db_xref="InterPro:IPR035973"
FT                   /db_xref="UniProtKB/TrEMBL:B9KLZ8"
FT                   /protein_id="ACL99995.1"
FT                   /translation="MAHAKNHDYHILPPSIWPFMASVGAFVMLFGAVLWMHGSGPWMGL
FT                   IGLVVVLYTMFGWWSDVVTESLEGDHTPVVRLGLRWGFILFIMSEVMFFSAWFWSFFKH
FT                   ALYPMGPESPIIDGIFPPEGIITFDPWHLPLINTLILLCSGCAATWAHHALVHENNRRD
FT                   VAWGLALAIALGALFTVFQAYEYSHAAFGFAGNIYGANFFMATGFHGFHVIVGTIFLLV
FT                   CLIRVQRGHFTPEKHVGFEAAIWYWHFVDVVWLFLFASIYIWGQ"
FT   gene            132844..133515
FT                   /locus_tag="RSKD131_0137"
FT   CDS_pept        132844..133515
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0137"
FT                   /product="Cytochrome c oxidase assembly protein"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ACL99996"
FT                   /db_xref="GOA:B9KLZ9"
FT                   /db_xref="InterPro:IPR002994"
FT                   /db_xref="UniProtKB/TrEMBL:B9KLZ9"
FT                   /protein_id="ACL99996.1"
FT                   /translation="MIRRMILPLLFGLIGAAILVSLGLWQVQRLQWKEGVLADIEARVA
FT                   APPVTLPEAPEAARDRYLPVTVSGRFTGEHIDVLTSRKDRGAGYRVISAFETDEGRRIL
FT                   IDRGFLPQEDRGLPRTAVGAGLTGNLAWPAEVDSFTPSPDPVSGIWFARDVPAMADALS
FT                   TEPVLVVAATPTGDGIDPWPIGTEGIPNDHLGYAVTWFSLAVLWLGMTVLLLWRIRRRM
FT                   E"
FT   gene            133512..134912
FT                   /locus_tag="RSKD131_0138"
FT   CDS_pept        133512..134912
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0138"
FT                   /product="L-threonine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ACL99997"
FT                   /db_xref="GOA:B9KM00"
FT                   /db_xref="InterPro:IPR000634"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR004450"
FT                   /db_xref="InterPro:IPR029144"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="InterPro:IPR037158"
FT                   /db_xref="UniProtKB/TrEMBL:B9KM00"
FT                   /protein_id="ACL99997.1"
FT                   /translation="MKAVKMQYISTRGAAPVLGFGEAMLTGLARDGGLYVPETVPTLSE
FT                   SEIAALAGLSYEEVAFRIMRPFVGETFGDEEFRGLIAAAYEGFGHAARAPLVQLGPNHF
FT                   LLELFHGPTLAFKDFAMQLIGQLFQAALAKNGQRITIVGATSGDTGSAAIEAFRGLSNV
FT                   DVFILFPHGRVSEVQRRQMTTPSEANVHALAVDGDFDDCQARLKDMFNDFAFRDAVGLA
FT                   GVNSINWARVLAQVVYYFTSAVALGAPHREVSFTVPTGNFGDIFAGYIARRMGLPIARL
FT                   VVATNQNDILHRALSTGAYETEGVTPSISPSMDIQVSSNFERALFDAYGRDGAAVAALM
FT                   AELKEGGFRISENALGTLRATFASGRASEEETLATIRATHAATGELLCPHSAVGVKVAE
FT                   EALGPEPMITLATAHPAKFPDAVEAATGLRPPLPARMADLFDRPERVTRVPNDLSALET
FT                   LIRERTGR"
FT   gene            134909..136168
FT                   /locus_tag="RSKD131_0139"
FT   CDS_pept        134909..136168
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0139"
FT                   /product="Processing peptidase"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ACL99998"
FT                   /db_xref="GOA:B9KM01"
FT                   /db_xref="InterPro:IPR001431"
FT                   /db_xref="InterPro:IPR007863"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="InterPro:IPR011765"
FT                   /db_xref="UniProtKB/TrEMBL:B9KM01"
FT                   /protein_id="ACL99998.1"
FT                   /translation="MTVLLDTLPNGFRIVTEHMPGLHSASIGIWIAAGGRHERPEQNGI
FT                   AHFLEHMAFKGTKTRTALRIAEEIEDVGGYINAYTSREMTAYYARVLEADTGLALDVIA
FT                   DIVLNPVFDPKEIEIERHVILQEIGQALDTPDDIIFDWLQEASYPGQAFGRTILGPEER
FT                   VSSFGRADLTRFVGEHYGPDHMILAAAGGVDHDRIVAQAQALFGHLKPVGQRPMQPADF
FT                   LGGERRELKSLEQVHFAMAFEAPNYRAPDVYAAQVYAMALGGGMSSRLFQKVREERGLC
FT                   YSIFAQSGAYEDTGQITIYAGTSGEEVADLAGLTVDELKRATEDMSEAEVARARAQLKA
FT                   GLLMGLESPSNRAERLARLLAIWDRVPGVDEAVEKIDAVTVGAVRDYAERMAQARSALA
FT                   LYGPAEAAPALAQIRERLAA"
FT   gene            136168..136752
FT                   /locus_tag="RSKD131_0140"
FT   CDS_pept        136168..136752
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0140"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ACL99999"
FT                   /db_xref="GOA:B9KM02"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:B9KM02"
FT                   /protein_id="ACL99999.1"
FT                   /translation="MLGLRRKVRIETERMTLRLPAHSDWRDWAALRAESATFLTPWEPV
FT                   WSSDHLSRKAFTNRVYWAARAESQGTALPVLLIRREDQALLGAITLDNIRRGPAQSGTL
FT                   GYWIGRPHARQGYMREAIQGIVHHAFTAMDVSRIEAACLPENAASRGVLEKCGFKYEGV
FT                   AQSYLQIAGRWRNHVLYANLRGDRRGRTDAG"
FT   gene            136998..137804
FT                   /locus_tag="RSKD131_0141"
FT   CDS_pept        136998..137804
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0141"
FT                   /product="Hypothetical Protein"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00001"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:B9KM03"
FT                   /protein_id="ACM00001.1"
FT                   /translation="MIRTVLATLALAVPAAAPAQERTPSHCVALTRGPERMVPAAFGDP
FT                   LAEDRVRIRYVHHATFLIETPGGLVAATDYTGLLGQRDVVPDVATMNNAHSTHWTDLPD
FT                   PRIPHLLPGWQEGGRAEHHLDLGEMLVRNVPTDVRSRWGEGIRKDGNSIFVFEVAGLCI
FT                   GHLGHLHHEPDAAQYAALGRLDVLMVPVDGGYTVGLETMQKVVRRLRSSVVLPMHWFSG
FT                   RSLETFLGEMEPEFEVVRLEGSEIELSPGSLPRRPTIMVLDPAWVD"
FT   gene            137843..139258
FT                   /locus_tag="RSKD131_0142"
FT   CDS_pept        137843..139258
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0142"
FT                   /product="FAD linked oxidase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00002"
FT                   /db_xref="GOA:B9KM04"
FT                   /db_xref="InterPro:IPR004113"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016171"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:B9KM04"
FT                   /protein_id="ACM00002.1"
FT                   /translation="MLNPADDAFLARLAGRLPPGTLTAPEPRHLTEPRGRRQGRAGALA
FT                   LPRDTGEVATIVAACAEARVGIVPLGGGTGLVGGQVMETGPLPLLLSLERMNRVRGIFP
FT                   EENVLLVEAGALLAEVQAAAAAAGRMFPLWLASEGSCRIGGNLASNAGGTAVLRYGNAR
FT                   DLCLGLEAVLPDGSVVHGLKRLRKDNTGYDLRNLLIGAEGTLGIITAASLKLVRPPAAE
FT                   GAALLAVRDPAAALELLGRAQRRLGPLVTGFELMHRQGFDFLAETMPERRLPFVDLPDW
FT                   TVLVDLGLTEGMDPAAELEALFAEAAGAGLVSDGALAQSLAQRADFWALRESIPEANRR
FT                   IGAIASHDISLPLSEIARFVTEAGAAIARLGDLRVNCFGHLGDGNLHYNVFPAAGRRRE
FT                   DYEALRGKITRTVHDLVAAAGGSISAEHGIGRLKVEDLERYGDPAKLRAMRALKAALDP
FT                   FGIMNPGAVLRSE"
FT   gene            complement(139387..139923)
FT                   /locus_tag="RSKD131_0143"
FT   CDS_pept        complement(139387..139923)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0143"
FT                   /product="Adenine phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00003"
FT                   /db_xref="GOA:B9KM05"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005764"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9KM05"
FT                   /protein_id="ACM00003.1"
FT                   /translation="MTHKSVRDYIRTIVDFPHEGILFRDVTTLFADPRGFRIAIDQLLA
FT                   PYAGMRFDKVAGLEARGFILGGAVAHQLSTGFVPIRKKGKLPGRTISVSYQLEYGEAVV
FT                   EVHDDAIQAGEKVLLVDDLLATGGTAEAGIKLIEQLGGQVVGCAFVVDLPDLGGRKRLE
FT                   AMGMEVHALCAFEGL"
FT   gene            complement(139928..140800)
FT                   /locus_tag="RSKD131_0144"
FT   CDS_pept        complement(139928..140800)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0144"
FT                   /product="Methylthioadenosine phosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00004"
FT                   /db_xref="GOA:B9KM06"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR010044"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="UniProtKB/TrEMBL:B9KM06"
FT                   /protein_id="ACM00004.1"
FT                   /translation="MKTMIGVIGGSGVYEIDGLEDAVWTKVETPWGEPSDEILTGRLDG
FT                   VPMAFLPRHGRGHVHSPTTVPYRANIDALKRLGVTDLVSVSACGSFREEMAPGDFVIVD
FT                   QFIDRSFARAKSFFGSGCVAHVSLAHPTCGRLSALCAEAARATGVTVHEGGTYLCMEGP
FT                   QFSTLAESLLYKSWGCHVIGMTNMPEAKLAREAEICYASVAMVTDYDSWHPHHGEVDIT
FT                   AIIATLGANADHARGLVAGLPTRLGTERDLCPHGCDRALDHALMTAPAKRDPELLAKLD
FT                   AVAGRVLKG"
FT   gene            complement(141105..141689)
FT                   /locus_tag="RSKD131_0145"
FT   CDS_pept        complement(141105..141689)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0145"
FT                   /product="Flavin reductase domain protein, FMN-binding"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00005"
FT                   /db_xref="GOA:B9KM07"
FT                   /db_xref="InterPro:IPR002563"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:B9KM07"
FT                   /protein_id="ACM00005.1"
FT                   /translation="MFYRPEDGHGLPHNPFNAIVSPRPIGWISTRGPEGDNLAPYSFFN
FT                   AVAYVPPQVMFASTGAKDSLAALRASGVFCVNIVEEAALARMNATSAAFPRGTDEFLAA
FT                   EVPKEECRTIPCPRVADAPASLECRVTQVVELLGRDNFLILGEVTGVHLRDDCLRDGRF
FT                   DVTAFRPMARLGYRDYAVVREVIELSRPGEG"
FT   gene            141770..142255
FT                   /locus_tag="RSKD131_0146"
FT   CDS_pept        141770..142255
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0146"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00006"
FT                   /db_xref="GOA:B9KM08"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:B9KM08"
FT                   /protein_id="ACM00006.1"
FT                   /translation="MYRLEQEREADWWEVEALYDLCFAPGRTALSSYRLRDGVPTVADL
FT                   CALLRDEDGTLAAAIRYWPVMVGDKPVLLLGPVAVHPTRQGEGLGALLIAETLAEARRI
FT                   GWERVMLVGDAPYYRRFGFRKLEKVVMPPPTNPERVLGMPLVIGAWEGVEGLVTKAT"
FT   gene            142477..143241
FT                   /locus_tag="RSKD131_0147"
FT   CDS_pept        142477..143241
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0147"
FT                   /product="Hypothetical Protein"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00007"
FT                   /db_xref="InterPro:IPR024787"
FT                   /db_xref="UniProtKB/TrEMBL:B9KM09"
FT                   /protein_id="ACM00007.1"
FT                   /translation="MTQKTRLPALHTGPEAEIAALALRFDRAHGPLMSLMNRLGGSVEE
FT                   RMALLPAPVLRQIEAVTRRALEQSHRVAAAGRAAPDLGRRGAPALVALTGAAGGAGGIA
FT                   TSIAELPVTITVIMHAIRNAAVAEGFDPDDPAIRVECLRIFGAGSPLQRDDGVNTSFIG
FT                   ARIAMSGAAVSKVVASVAPKLATALGQKLMAQAVPVLGAVAGAALNTAYLTYYREIAEI
FT                   RFALLRLAQTHGPERVLSEFQSAVKPIPLYRA"
FT   gene            complement(143291..143893)
FT                   /locus_tag="RSKD131_0148"
FT   CDS_pept        complement(143291..143893)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0148"
FT                   /product="Intracellular septation protein A"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00008"
FT                   /db_xref="GOA:B9KM10"
FT                   /db_xref="InterPro:IPR006008"
FT                   /db_xref="UniProtKB/TrEMBL:B9KM10"
FT                   /protein_id="ACM00008.1"
FT                   /translation="MAERINPVVKAVLEWGPIAAFFLGYVKLKDETFTVAGTDYQGFII
FT                   VTAAFIPLMVICTGLLWWLSGKLSKMQVATVVLVVVFGGLSVWLNDDRFFKMKPTMIYL
FT                   LFGVLLGIGLLRGQSWLRLVLEEAIPLQDEGWMILTRRVMAFFFALAIANEAVWRLMST
FT                   DAWVNFKTFGLPLAIFVFFMTQSGLFKRYNPERKDEA"
FT   gene            complement(143905..144810)
FT                   /locus_tag="RSKD131_0149"
FT   CDS_pept        complement(143905..144810)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0149"
FT                   /product="transporter, DME family, DMT superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00009"
FT                   /db_xref="GOA:B9KM11"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:B9KM11"
FT                   /protein_id="ACM00009.1"
FT                   /translation="MTAWILSLEGTPEGARIALLLALTSAFAHACFGALQKGRHDPWLS
FT                   RGAIDSFMLLLSAPVAVFLVPWPRGVEWLVMAGVMAIHLAYKIAMARAYSRAAYTVVYP
FT                   VVRGVGPLATLAFAALFLGEHYVAIQWLGVAILSAAILALARLNFASSPQIGRMDLKAG
FT                   LAWAFAGGLMVAIYTTFDAWAIRLMPDPFTFLAWFFLMTSLDFPLLLGYRLLKARQMPE
FT                   AAAALALRGFVGALVAFVSFGGVMLGTRLGKVAEVSSLRETSTLFAAAIGWLLLGERSG
FT                   PAKILLMGLIALGAILVQLA"
FT   gene            complement(144926..146071)
FT                   /locus_tag="RSKD131_0150"
FT   CDS_pept        complement(144926..146071)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0150"
FT                   /product="Signal recognition particle-docking protein FtsY"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00010"
FT                   /db_xref="GOA:B9KM12"
FT                   /db_xref="InterPro:IPR000897"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004390"
FT                   /db_xref="InterPro:IPR013822"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036225"
FT                   /db_xref="InterPro:IPR042101"
FT                   /db_xref="UniProtKB/TrEMBL:B9KM12"
FT                   /protein_id="ACM00010.1"
FT                   /translation="MSFFKKMREKMFRSSDRLSEDLDALVEDKASEAPAPEVPTPGPLP
FT                   DPEKDAPLILDRPVPQAPDPQPQPAPVPPAAPLPGLPPEPEPERRPGLFGRMFGQTEEP
FT                   RRILDDAMLESLEEVLIQADMGVETALRVTANIAEGRYGRRVSAREIKEALAAEIARIL
FT                   EPVARPMPLYPSRPQVVLVVGVNGSGKTTTIGKLASQFRAAGKSVVIAAGDTFRAAAVE
FT                   QLQVWGRRAGVPVLTAPEGSDPASLAFDAMTKAQAEGADLLMIDTAGRLQNRADLMEEL
FT                   SKIVRVIRKKDPDAPHNTLLVLDATTGQNALNQVEIFRKLADVSGLVMTKLDGTAKGGV
FT                   LVALADRFGLPIHAIGVGEQIDDLAPFDPEEFARALMGLDD"
FT   gene            146263..146661
FT                   /locus_tag="RSKD131_0151"
FT   CDS_pept        146263..146661
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0151"
FT                   /product="Hypothetical Protein"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00011"
FT                   /db_xref="UniProtKB/TrEMBL:B9KM13"
FT                   /protein_id="ACM00011.1"
FT                   /translation="MHRIWAAALTLALAAPALAAEPMSAEEFEAYSTGKTLSYAVGGEI
FT                   YGAEQYLPGRRVVWAFRGQECAHGQWYEQAGQICFVYEHDATPQCWSFYREASGVRAQF
FT                   EGDPTGTELSEVSQTRTPLICAGPDVGV"
FT   gene            complement(146842..148401)
FT                   /locus_tag="RSKD131_0152"
FT   CDS_pept        complement(146842..148401)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0152"
FT                   /product="Exodeoxyribonuclease 7 large subunit"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00012"
FT                   /db_xref="GOA:B9KM14"
FT                   /db_xref="InterPro:IPR003753"
FT                   /db_xref="InterPro:IPR020579"
FT                   /db_xref="InterPro:IPR025824"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9KM14"
FT                   /protein_id="ACM00012.1"
FT                   /translation="MSDLFEDPAPSRNTPEFTVSELSGAVKRVIEGEFGLVRVRGEIGR
FT                   VSRPASGHLYFDLKDDRAVMAAICWKGQAGRLSVRPEEGMEVVATGRMTTFPGQSKYQI
FT                   IVEDMAPAGAGALMAMLEKRRAALAAEGLFDAARKRPLPYLPRVIGVVTSPSGAVIRDI
FT                   LHRLRDRFPSHVLIWPVAVQGEKCAPEVAAAIRGFNALPEGGPIPRPDLLIVARGGGSL
FT                   EDLWGFNEEIVVRAAAESRIPLISAVGHETDTTLIDHAADRRAPTPTAAAEMAVPVRLE
FT                   LLAGLDGQGARLSRCAAETIRRRDQRLRDLARALPRLESLVAGPSQRFDLWSGRLSGAL
FT                   GQSVAARRARLEPLGAHLRPRLLADLVARQKDRLGDRTRSLETCLGRRAERARDRFEAL
FT                   SARLAPAFARLIAETERATRRDAATLGTLAARLDAAPEARLARLSDRLEALDRLRQTLG
FT                   YRETLKRGYAVVRADGAVVTTKAEAGTAAVLEIEFQDGRLSVGRGKTRKPKEEPPAQGS
FT                   LL"
FT   gene            148411..148557
FT                   /locus_tag="RSKD131_0153"
FT   CDS_pept        148411..148557
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0153"
FT                   /product="Hypothetical Protein"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00013"
FT                   /db_xref="UniProtKB/TrEMBL:B9KM15"
FT                   /protein_id="ACM00013.1"
FT                   /translation="MPEARPTGKLRVRAACDGSGSRPEGGRHRCRALATLPAAVRRAGL
FT                   GPG"
FT   gene            complement(148633..148986)
FT                   /locus_tag="RSKD131_0154"
FT   CDS_pept        complement(148633..148986)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0154"
FT                   /product="Hypothetical Protein"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00014"
FT                   /db_xref="UniProtKB/TrEMBL:B9KM16"
FT                   /protein_id="ACM00014.1"
FT                   /translation="MDLRTLLLPAALLAASPLLADEATIARLEAAFAALTPEERVAVQE
FT                   ELEIAGLYVGPVDGSTGPGDGRTLEDAAAFIEENSAGMVAVPLATDEEARAFAKSLAER
FT                   GYSSWLYGEGDEG"
FT   gene            149128..150408
FT                   /locus_tag="RSKD131_0155"
FT   CDS_pept        149128..150408
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0155"
FT                   /product="Phosphoribosylamine--glycine ligase"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00015"
FT                   /db_xref="GOA:B9KM17"
FT                   /db_xref="InterPro:IPR000115"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR020559"
FT                   /db_xref="InterPro:IPR020560"
FT                   /db_xref="InterPro:IPR020561"
FT                   /db_xref="InterPro:IPR020562"
FT                   /db_xref="InterPro:IPR037123"
FT                   /db_xref="UniProtKB/TrEMBL:B9KM17"
FT                   /protein_id="ACM00015.1"
FT                   /translation="MDKGAAMNILILGGGGREHALAWAIKQNPKCDRLIVAPGNAGIAQ
FT                   IAECADLDILDGAAVVAFCEANSVDFVVVGPEAPLAAGVADATRAAGLLTFGPSQAAAR
FT                   LEASKGFTKEVCDACGAPTAGYARFTEAEAARAHVRATGAPIVIKADGLAAGKGVVVAM
FT                   TEAEALAAIDDMFGGSFGAAGAEVVIEEFMTGEEASFFVLTDGRTVLPIGTAQDHKRAF
FT                   DGDEGPNTGGMGAYSPAPVLTTAVQRQALDEIVKPTIAEMGRRGAPYSGVLYAGLMIEK
FT                   GRARLVEYNVRFGDPECQVLMLRLGAQALDLLLACAEGRLDQVQVNWAEDHALTVVMAA
FT                   QGYPGSYRKGTEIRGLESLPETSRQVVFHAGTAAEEGRILATGGRVLAATARGATLAEA
FT                   QAAAYAMVDAIDWPEGFCRRDIGWRAL"
FT   gene            complement(150485..152011)
FT                   /locus_tag="RSKD131_0156"
FT   CDS_pept        complement(150485..152011)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0156"
FT                   /product="Pyruvate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00016"
FT                   /db_xref="GOA:B9KM18"
FT                   /db_xref="InterPro:IPR001697"
FT                   /db_xref="InterPro:IPR011037"
FT                   /db_xref="InterPro:IPR015793"
FT                   /db_xref="InterPro:IPR015806"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:B9KM18"
FT                   /protein_id="ACM00016.1"
FT                   /translation="MDGVAERQMMGEDAPPSGDDPRAEARALLAELTALRADLFRRADA
FT                   RMADWATRVRRLEFLPSVANMADWLALREADLTTLQPRLSRLGLSTLGRLDGHVRPSLE
FT                   AVIAALSAISGLEGPTFPDPQGFDPELRSLHARRDALFGARDAAPGTRILVTLPSEAAS
FT                   DPAIVRELVAAGADAFRINCAHDGPEAWAAMIGHIRKSERMTGRKLPISMDLGGPKFRV
FT                   TKTGGPLPKRLQAGDRFAFVEKPSMAPEGRGWAMLGHPALLAALAPGVQVSVDDGKLWA
FT                   TVIQTGRGHALLEVDRVGERGLKLKPGRGVNLPGSHLDVAALTEEDLAALDVVVAEADL
FT                   VAFSFVQTPGDVRALIAAMEARACHPRPLPAILLKIETPMGLHLLPELIVEAGGSLPVG
FT                   VMIARGDLAVEIGFDRLSEIQEEILWLCEAAQVPVVWATQVLEGMVKEGQASRAEVTDA
FT                   AMSQRADCVMLNKGPHVAAAIEFLRDILIRMDRHQTKKSARLGPLRVWAG"
FT   gene            152233..153480
FT                   /locus_tag="RSKD131_0157"
FT   CDS_pept        152233..153480
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0157"
FT                   /product="Aspartokinase"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00017"
FT                   /db_xref="GOA:B9KM19"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001341"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR005260"
FT                   /db_xref="InterPro:IPR018042"
FT                   /db_xref="InterPro:IPR027795"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR041740"
FT                   /db_xref="UniProtKB/TrEMBL:B9KM19"
FT                   /protein_id="ACM00017.1"
FT                   /translation="MMKFGGTSVADLARIKNAAQKVKREVERGYDVIVIVSAMSGKTNE
FT                   LVGWVEQTSPLFDAREYDAVVSSGENVTAGLMALTLQEMEVPARSWQGWQVPIRTTSQH
FT                   SAARFLEIPRENLDAKFAEGFKVAVVAGFQGVSPEGRITTLGRGGSDTTAVAFAAAFAA
FT                   ERCDIYTDVDGVYTTDPRIASKARKLEKIAYEEMLELASLGAKVLQTRSVELAMRYKVK
FT                   LRVLSSFEDTDETSGTLVCDEEDIMESKVVSGVAYSRDEAKMTLVTVEDRPGVAAAIFG
FT                   PLAEAGVNVDMIVQNISEKDYGSHPGSVTDMTFSCPINQVARARKALEDAKAEGTIVYD
FT                   DLVVDTEVAKVSVVGIGMRSHAGVAATMFKALAADGVNIKVIATSEIKISVLIDRKYME
FT                   LAVQALHDAFALETAN"
FT   gene            153505..155748
FT                   /locus_tag="RSKD131_0158"
FT   CDS_pept        153505..155748
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0158"
FT                   /product="PTSINtr with GAF domain, PtsP"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00018"
FT                   /db_xref="GOA:B9KM20"
FT                   /db_xref="InterPro:IPR000121"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR006318"
FT                   /db_xref="InterPro:IPR008279"
FT                   /db_xref="InterPro:IPR008731"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036618"
FT                   /db_xref="InterPro:IPR036637"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:B9KM20"
FT                   /protein_id="ACM00018.1"
FT                   /translation="MPERSESESRKLLRRLRDSLALSGKGQDRLDRITSLIADSMRTEV
FT                   CSIYLFRDPDTLELCATQGLNPEAVHQTRLKMGEGLVGRVARMASPINTGNAPSERGFR
FT                   FMPETGEEIYSAFLGVPIQRVGEKLGVLVVQSREAREYSEDEVYALEVVAMVLAEMAEL
FT                   GVFVGEGEALSAKHTQPVLMRGSTGQEGAAEGHVWLHEARVVVTNPVGDDPVHETERIR
FT                   AAVAQLRVSVDDLLSASTLDKDQRQVLEAYRLFAHSRGWLRRMEEDIMAGLSAEAAVQK
FT                   EQSAARARLEQVPDAYLRDRLHDLDDLSHRLLRILTGQGRDTGAEMPENPVLVARNIGP
FT                   AELLEYGRKLRGIVLEEGSVGSHAAVVARALAIPLVIHAERITTEALNGDHIMVDGDNG
FT                   LVHLRPEASIAAAFRDKMAMQAKAQERYASLRNLPAQSKCGTVTGLMMNAGLMADLPSL
FT                   DSSGAEGVGLFRTELQFLIRNQMPKRDELARLYARVMDAARGHRVVFRTLDIGSDKVLP
FT                   YLKPQDEPNPAMGWRAIRVGLDKPGVLRMQLQALIRASAGRDLSIMFPFVSEHHEFMMA
FT                   RSHLLRELHRERSLGHPVPVNIRVGTMLETPSLAYAPRAFFETTDFISIGGNDLRQFFF
FT                   AADRENERVRRRYDVLNVSFLTFLEHIVNRCAETATPLSFCGEDAGRPVEALCFAAMGI
FT                   QTLSMRPASIGPVKALLRRVDLIEARKVIEMARASGAETVRPAILEWLATQVD"
FT   gene            155882..157108
FT                   /locus_tag="RSKD131_0159"
FT   CDS_pept        155882..157108
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0159"
FT                   /product="O-succinylhomoserine sulfhydrylase"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00019"
FT                   /db_xref="GOA:B9KM21"
FT                   /db_xref="InterPro:IPR000277"
FT                   /db_xref="InterPro:IPR006234"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:B9KM21"
FT                   /protein_id="ACM00019.1"
FT                   /translation="MLARHGYSFREGRTGMTKDWKTRTQLVHGGSRRSQYGEMAEAIFL
FT                   TQGFVYDSAEQAEARFIETGADEFIYARYGNPTTRMFEERIAAVEGTEDAFATASGMAA
FT                   IHGVLTSIVRAGDHLVAARALFGSCIYILEEVLGRFGVEVTFVDGTDLDQWRAAVRPGT
FT                   KAVFFESVSNPTLEVADIGAIAEIAHAVGALVIVDNVFATPVFSTAVRQGADVVIYSAT
FT                   KHIDGQGRALGGVVCASQAFIRKVLEPFMKHTGGSMSPFNAWLMLNGMATLDLRCRAMA
FT                   DTAEKIARALEGHPQLGRVIHPALESHPQHEMAKAQMERPGTMIALDLAGGKEAAFRFL
FT                   DALRIVKISNNLGDARSIATHPATTTHQRLSDAQKAHLGITPGLVRLSVGLEDADDLIA
FT                   DLKQALAVI"
FT   gene            157204..158283
FT                   /locus_tag="RSKD131_0160"
FT   CDS_pept        157204..158283
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0160"
FT                   /product="GTP cyclohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00020"
FT                   /db_xref="GOA:B9KM22"
FT                   /db_xref="InterPro:IPR003801"
FT                   /db_xref="InterPro:IPR022838"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9KM22"
FT                   /protein_id="ACM00020.1"
FT                   /translation="MNILTPVAERLPSREEAEEALAVLRRWATHTPASDVAALAPEAPA
FT                   LVYPELSRSYPRAFTVDEAYKASLPDLQNGPASLIVGAKAVIQHVGISNFRLPIRYHTR
FT                   DNGDLQLETSVTGTVSLEAEKKGINMSRIMRSFYAHAEQAFSFEVIERALEDYKRDLES
FT                   FDARIQMRFSFPVKVPSLRSGLTGWQYYDIALELVDRGGVRKEIMHLDFVYSSTCPCSL
FT                   ELSEHARRERGQLATPHSQRSVARISVEVRQGKCLWFEDLLDLVRSAVPTETQVMVKRE
FT                   DEQAFAELNAANPIFVEDAARSFCQALQSDPRIGDFRVVASHQESLHSHDAVSVLTEGP
FT                   TFAAESLDPRLFSSLYHVG"
FT   gene            158334..159782
FT                   /locus_tag="RSKD131_0161"
FT   CDS_pept        158334..159782
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0161"
FT                   /product="Cation transporter precursor"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00021"
FT                   /db_xref="GOA:B9KM23"
FT                   /db_xref="InterPro:IPR003445"
FT                   /db_xref="InterPro:IPR004772"
FT                   /db_xref="UniProtKB/TrEMBL:B9KM23"
FT                   /protein_id="ACM00021.1"
FT                   /translation="MLDLRPVGFIIGLLVVALGAAMLLPASVDLLLGNGNGPAILQAAM
FT                   LTMFTGGAVALACANAPTKQLGIRQAFVLTAAIWFALPAFGSLPLILGEPDLTFTDAMF
FT                   EAVSGITTTGSTVIVGLDHLPAGTNLWRGMLNWLGGLGIAFIAMIFLPVMRVGGMQFFR
FT                   TEGFDTLGKVLPRATDIARALLGVYTGLTALCIATYLLIGMEPLDAVVNGVATIATGGF
FT                   SPSDASFGKYPGAGEYAGTVFMILGAMPYIRFVQLVSGAPQAFFGDSQIRAMLRWMVYG
FT                   VGIVTLWRVLTSDQGLEPAFREASFNLVSVFTGTGFFSGSFANWGGFGMVVAFCVGMIG
FT                   GCSSSSSGALSVFRVQVVLTAIRVQIERIGMPDRMASVRYEGRRVEDDVMNALILYVTG
FT                   YILAIGTLSVALTLTGVDPTSALFGVWTSIGNIGYGYGPLVARTGTFIDFPELAKWVLI
FT                   LAMLMGRLALLALVVLVLPRFWRQ"
FT   gene            159825..161279
FT                   /locus_tag="RSKD131_0162"
FT   CDS_pept        159825..161279
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0162"
FT                   /product="Cation transporter precursor"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00022"
FT                   /db_xref="GOA:B9KM24"
FT                   /db_xref="InterPro:IPR003445"
FT                   /db_xref="InterPro:IPR004772"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="UniProtKB/TrEMBL:B9KM24"
FT                   /protein_id="ACM00022.1"
FT                   /translation="MIDPRPVGYILGLLVATLGALMLVPMALDLAAGDRHWLSFAETAT
FT                   ITTVAGSMLALACANGRGQGTGLSLQQSFLLTTGSWVLLPVFGALPFMMGRPDASFTDA
FT                   VFEAMSGFTTTGTTVFIGLDALPLGTNLWRGMLQWLGGLGIVIVAMIFLPVMKVGGMQF
FT                   FRSEGFDTLGKILPRALDISTALIQIYLVLTMACVMTFLALGIPLFEAVVHALTTVSTG
FT                   GFSSSDRSFGLFQGPAEYACAFFMVLASLPFVRFVQLAQGTFLPLWRDPQVRAYLRWNG
FT                   YAIGLIVAYEVVTRNAPVLPTVRETTFNVISTFSGTGFSSVDLGLWGTFPFVLLIVVGL
FT                   IGGCTSSTGCSVKVFRYLILLEAIKVQIRRLQSPSAVIFVDYEGRRVGEDVINSVILFF
FT                   TMFILSFGVLAVLLSLTGLQTKTAITAAWTAIANVGPAFGPEVSATGAVDRFPAVAKWL
FT                   MIGGMLIGRLELLSVFVLLTPRFWRS"
FT   gene            complement(161343..163124)
FT                   /locus_tag="RSKD131_0163"
FT   CDS_pept        complement(161343..163124)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0163"
FT                   /product="Peptidoglycan-binding domain 1 protein precursor"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00023"
FT                   /db_xref="GOA:B9KM25"
FT                   /db_xref="InterPro:IPR002477"
FT                   /db_xref="InterPro:IPR007730"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR036365"
FT                   /db_xref="InterPro:IPR036366"
FT                   /db_xref="UniProtKB/TrEMBL:B9KM25"
FT                   /protein_id="ACM00023.1"
FT                   /translation="MMKQAIFLLWLGAALPAAVPVWAQEQSETRVWVQIEARPTEAEAD
FT                   ERARAYAEVFPDVAGYRLSSGWYAIVLGPYGTDVARLRLQDLLAAGMIPRDSFIADGRA
FT                   FREPFLAPGELPPAPDAEALAVPGPEMLPEDEPLDAPPALEVAPAPLPDETPAEARRSE
FT                   ALLIASDRQELQAALQWFGFYGAAIDGAFGPGTRASMAAWQAAEGAEATGILTARQRAE
FT                   LLDRYGRAQAELGLETVTEEEAGIRITLPTALVGFDRYDPPFVHYAPKDGSGVQVMLIS
FT                   EPGDRGALYGLYDILQTLEVVPPEGTRSRTETGFTIEGRSADLASYTHVELAGGLLKGY
FT                   MLVWHPGDDERMARVLTAMQSSFRPFGDRALDPGMVEMTEEQRRGMLAGLEVRKPRQSR
FT                   SGIFVDPKGAVLTTAEAVAGCGRVTIDREHEARVVATDTALGMALLRPVHPMAPRVTAS
FT                   FRSTEARLGSPVAVAGYPYGEALPAPTLTFGALDALTGLEGEADLRRLRLVSRPGDAGG
FT                   PVLDGSGAVLGMLVAPETGERRLPDEVSFALAPAALTARLSEAGIEPRRAEGSGALAPE
FT                   DLVRLGDGMTALVSCWD"
FT   gene            163249..164187
FT                   /locus_tag="RSKD131_0164"
FT   CDS_pept        163249..164187
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0164"
FT                   /product="Glycine--tRNA ligase precursor"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00024"
FT                   /db_xref="GOA:B9KM26"
FT                   /db_xref="InterPro:IPR002310"
FT                   /db_xref="InterPro:IPR006194"
FT                   /db_xref="UniProtKB/TrEMBL:B9KM26"
FT                   /protein_id="ACM00024.1"
FT                   /translation="MTGKPVPPRSFQEIILRLMTYWGAKGCAVLQPYDMEVGAGTFHPA
FT                   TTLRSLGARPWAAAYVQPSRRPTDGRYGENPNRLQHYYQYQVLIKPSPPDLQKLYLGSL
FT                   EAIGIDMDLHDIRFVEDDWESPTLGAWGLGWEVWCDGMEVSQFTYFQQVGGHDCRPVSG
FT                   ELTYGLERLAMYVLGIDHVMDMPFNDPDGPTPLTYGDVFRQTEQEYSRWNFDQADTDML
FT                   LQHFRDAEAECERILAAPETDKAGRRIVMAHPAYDQCIKASHLFNLLDARGVISVTERQ
FT                   AYIGRVRALAKKCADAFVSTEAGGTLADAGA"
FT   gene            164249..164953
FT                   /locus_tag="RSKD131_0165"
FT   CDS_pept        164249..164953
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0165"
FT                   /product="Methyltransferase FkbM"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00025"
FT                   /db_xref="GOA:B9KM27"
FT                   /db_xref="InterPro:IPR006342"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B9KM27"
FT                   /protein_id="ACM00025.1"
FT                   /translation="MFLIQRPATVLERLFDVIRVVPGSIGRKAARKLYRAYVARRQAEF
FT                   FAVIEGLPKGSLCIDLGANVGEISEGMLDRGMRVIAFEPDPATFAKLSQRLEGRDGVQL
FT                   LCAAAGVSDGLAEIQRPEGWSEATLKGSPGSSLVHRGKGMDAGTATGVQMMDFARFVRG
FT                   LGERIAVLKVDIEGGEWELIPHLVQSECLDLMDHLFVETHEWMDPSRCAQAAEFRQMAK
FT                   QRPSPHMTFDWV"
FT   gene            164944..165426
FT                   /locus_tag="RSKD131_0166"
FT   CDS_pept        164944..165426
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0166"
FT                   /product="Hypothetical Protein"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00026"
FT                   /db_xref="UniProtKB/TrEMBL:B9KM28"
FT                   /protein_id="ACM00026.1"
FT                   /translation="MGLNMNGRVAVASIVLSALGAGALIYWLQIYAFYEPVAFAPGEEI
FT                   RLTPIIGEEPEVIVANDVTGIDANSSPLRFRACFTTPLSQAMLTETYRVYPDPTPLNAP
FT                   PWFDCFDAERIDMALQKGEAIAFLSEHDIAPGVDRVVAVFPDGHAFAWHQLNAEEQ"
FT   gene            165430..167616
FT                   /locus_tag="RSKD131_0167"
FT   CDS_pept        165430..167616
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0167"
FT                   /product="Glycyl-tRNA synthetase subunit beta"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00027"
FT                   /db_xref="GOA:B9KM29"
FT                   /db_xref="InterPro:IPR006194"
FT                   /db_xref="InterPro:IPR008909"
FT                   /db_xref="InterPro:IPR015944"
FT                   /db_xref="UniProtKB/TrEMBL:B9KM29"
FT                   /protein_id="ACM00027.1"
FT                   /translation="MPDLLIELFSEEIPARMQARAREDLKKLVTDGLVEAGLTYASAGA
FT                   FSTPRRLVLSVEGLSAESPTLREERKGPKADAPAAAIEGFLRSTGLTRDRLETRADKKG
FT                   AVLFAVVEKPGRPAPEIVAEVLERTIRTFPWPKSMRWGTGSLRWVRPLQSILCLLSDEG
FT                   GAEVVPMTLDGLTAGNSTEGHRFMAPARFAVSGFDDYRAKLARAFVMLDASEREQAIWH
FT                   EATTQAFAQGLEVVPDAALLSEVAGLVEWPVVLMGAIGEDFLGLPPEVLQTSMREHQKF
FT                   FSVTNPATGRIEKFVTVANRETADHGETILKGNGKVLSARLSDARFFWENDLRTVKTAG
FT                   LEGMAEGLKQVTFHNRLGSQADRIARIEALAREIAPLVGASPDLAAEAARVAKADLQSA
FT                   MVGEFPELQGTMGTYYARAAGLPEAVAQACKAHYQPLGPSDAVPTDPVSGAVALADKID
FT                   TLTGFWAIDEKPTGSKDPFALRRAALGVVRLNLENELRYSLKLLLLDGLVANEIARQFT
FT                   HFKSETNALAGIDDVEAFKQHVTFSLDAAKDKANDLFEYLLAFFHDRLKVHLREQGIRH
FT                   DVIDACLAMPGNDDLTLLVKRAEALSGFLKTDDGTNLLQGFKRANNILTQAEAKDGVEY
FT                   SFGADPKFAETDAERALFSALETAEAAIGPALQAEDFAAAMSAMAALRAPIDAFFETVQ
FT                   VNADNAVLRRNRLNMLHSIRATCARVADLTRIEG"
FT   gene            167735..170281
FT                   /locus_tag="RSKD131_0168"
FT   CDS_pept        167735..170281
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0168"
FT                   /product="Pyruvate phosphate dikinase"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00028"
FT                   /db_xref="GOA:B9KM30"
FT                   /db_xref="InterPro:IPR000121"
FT                   /db_xref="InterPro:IPR008279"
FT                   /db_xref="InterPro:IPR010121"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018274"
FT                   /db_xref="InterPro:IPR036637"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:B9KM30"
FT                   /protein_id="ACM00028.1"
FT                   /translation="MQKIEPISDFDRITPTAAISLKTHGFRAKCLQRLVRLDLPVPVTV
FT                   ALPATTVRAIAAGHPVDCPAILADFGPTPLVSVRPSPENPDWGGPATVLNIGMNAARHA
FT                   ALARIHGEEAADAIYLGFIQSYAIHVARLDPEMFETGGSSSEALRAALHAWAEEMDEPF
FT                   PQDPAQQLSEVLRSMARAWEGTTARLLRQAKGAPAEARLGLVVQEMAQDLGQGISGSGV
FT                   IQFVDPATGVPQVTGRFFNRSRAWHGKAETLYLTQDPRGPSLEERAPEIFAALCRHGSV
FT                   CRARLREEMQIEFTIEDSHLSVLDAVKVQRSSRAGLRIAVALADDQVITRSEALLRVEP
FT                   RALSELLHPQVDPRGRRDRFARGIAASPGAAVGRIVFSSQAAQASAARGEPCILVRRET
FT                   SPEDIRGMNCAAGVLTERGGVTSHAAVIARGLGLPCVVGASEIRLDARERRLVAPDGRV
FT                   FREGDLITVDGTAGEALAGEAAMLAPALDSCFRKLLSWADEMRDIGVRANADTPADALV
FT                   ARQFEAQGIGLCRTEHMFFTDDRLVVMREMIFADSATDRAAALARLLPMQRADFVQLFE
FT                   IMQGHPVCIRLLDPPLHEFLPHSREGLLELAEALDRPLSEVTRRVEAMAEFNPMLGMRG
FT                   VRLGVAIPEIYDMQAQAIFEATLEVAGRGDPVVPEIMIPLVSARREVELVKTRIDAVAA
FT                   AVHTKYGREFAYRLGVMVETPRAALRAGEIAQHAAFLSFGTNDLTQMTYGLSRDDAGRF
FT                   MNTYVQSGVFPEDPFHILDVDGVGELLLIGAERGRATRPDLVVSICGEHGGDPESIEFC
FT                   RRAGFDYVSCSPYRVPLARLAAAHLAIRSREQPNAS"
FT   gene            170281..170406
FT                   /locus_tag="RSKD131_0169"
FT   CDS_pept        170281..170406
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0169"
FT                   /product="Hypothetical Protein"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00029"
FT                   /db_xref="UniProtKB/TrEMBL:B9KM31"
FT                   /protein_id="ACM00029.1"
FT                   /translation="MQAVSPKIGQVCHSGAWATQAGTRRWMPLLTVTKMSRGWTR"
FT   gene            170541..171221
FT                   /locus_tag="RSKD131_0170"
FT   CDS_pept        170541..171221
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0170"
FT                   /product="Cell wall hydrolase, SleB precursor"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00030"
FT                   /db_xref="GOA:B9KM32"
FT                   /db_xref="InterPro:IPR011105"
FT                   /db_xref="InterPro:IPR042047"
FT                   /db_xref="UniProtKB/TrEMBL:B9KM32"
FT                   /protein_id="ACM00030.1"
FT                   /translation="MLLSGAAFADVTVSQSNDPSVSLGGQLSALLGAERNALGTLPAQR
FT                   LEQVAAAVARPEAKPEAPVKAVATKGNRGAKAADDAPAPRYDEAWLASQPATAKDSDEW
FT                   KCLATALYFEARGESIQGQFAVAEVIMNRVDRPGYPGSICGVVRQGGQFSFMFDGKPET
FT                   IREKAAFQRAGKIAALMLAGAPRQLTQGATHFHTRAVRPGWAHRFPRTAAIGAHLFYRQ
FT                   PGGS"
FT   gene            171321..172223
FT                   /locus_tag="RSKD131_0171"
FT   CDS_pept        171321..172223
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0171"
FT                   /product="Dihydroneopterin aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00031"
FT                   /db_xref="GOA:B9KM33"
FT                   /db_xref="InterPro:IPR006157"
FT                   /db_xref="UniProtKB/TrEMBL:B9KM33"
FT                   /protein_id="ACM00031.1"
FT                   /translation="MTNDIRLAFAHPEERAEASAGAAPRDRISLRDHVAEVEIGAFQQE
FT                   RGTRQRVRFNVVVEVRPHPAPLQDDVDRILSYDRITESIADELSAERLNLLETLAERIA
FT                   ERILAEPQAMRVFVRIEKLDRGPGALGVEIVRSRAEAPLRRTGEGGEAVHPLVAFLDNA
FT                   AIAAPDLPARLDALEARGLPLVLAVGLPDAPRPETRHRPTQRRIDLLAIEQNAWALAAR
FT                   DPRCVVVATRTEIDWAMRRGQTIVWAPSKLVLDAVDGPNSRDPVALALWLAEMLAAERL
FT                   VVHGDVTLPAGSRVPLERA"
FT   gene            172269..173306
FT                   /locus_tag="RSKD131_0172"
FT   CDS_pept        172269..173306
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0172"
FT                   /product="Dihydropteroate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00032"
FT                   /db_xref="GOA:B9KM34"
FT                   /db_xref="InterPro:IPR000489"
FT                   /db_xref="InterPro:IPR006390"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="UniProtKB/TrEMBL:B9KM34"
FT                   /protein_id="ACM00032.1"
FT                   /translation="MTYVRPIPLADAARPKGALPLAGGPLFFDRVEILERGRPPVVLPA
FT                   AELDAATLAPLTAPRPPVAGLAMDRPQIMGILNATPDSFSDGGRFATLPEALEQAQALV
FT                   AAGADILDIGGESTRPGAAEVEPAEEIRRTAPVIEMLRGQGIAVPVSIDTRKAPVAEAA
FT                   LIAGADLVNDVAALTWDAGLAAVAARREAPVCLMHAQGTPQTMQADPRYDDVLLDVYDW
FT                   LAERIRAAEAAGIPRARIVTDPGIGFGKTLEHNLALLRRLSLFHGLGCPILLGASRKRF
FT                   IGALADEPSADRRMAGSVAVALAGAAQGAQILRVHDVRETRQALILWQAVTREAAETAA
FT                   ERRQA"
FT   gene            173303..174646
FT                   /locus_tag="RSKD131_0173"
FT   CDS_pept        173303..174646
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0173"
FT                   /product="Phosphoglucosamine mutase"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00033"
FT                   /db_xref="GOA:B9KM35"
FT                   /db_xref="InterPro:IPR005841"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR006352"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR016066"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9KM35"
FT                   /protein_id="ACM00033.1"
FT                   /translation="MTRKLFGTDGVRGTANTHPMTAEMALRLGAAAGRYFRPVGAGSPR
FT                   VVIGKDTRLSGYMLENALTAGLTSTGMNVLLLGPVPTPAVGFLTRSMRAALGVMISASH
FT                   NPHEDNGIKFFGPDGFKLSDEAEAEIEAILAGEIQPAQPGNIGRAKRIEDGRGRYQEYC
FT                   KTTFPSGLRLDGLKVVIDCANGAAYRAAPEVLWELGAEVIPVGVEPNGKNINLRCGSTH
FT                   PEAAAEAVRAHGADVGICLDGDADRVIILDETGKEADGDQIMALFAARWADEGRLRDGT
FT                   LVATVMSNLGLERFLGARGLRLERTPVGDRYVVEAMRRGGWNLGGEQSGHIVMTDFATT
FT                   GDGLLAGLQFLAAMAQTGRRASDLARSFETVPQLLQNVRYAAGQEPLKAPGVQAVIRDA
FT                   EVRLNGAGRLLIRKSGTEPLIRVMAECEDEALLRDVVEEIVAAVRDAA"
FT   gene            174745..174963
FT                   /locus_tag="RSKD131_0174"
FT   CDS_pept        174745..174963
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0174"
FT                   /product="Hypothetical Protein"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00034"
FT                   /db_xref="GOA:B9KM36"
FT                   /db_xref="UniProtKB/TrEMBL:B9KM36"
FT                   /protein_id="ACM00034.1"
FT                   /translation="MDFAWIIPFLSLITLLAGILFAIASKDRVEARRHDPNAPKSTLAK
FT                   DGPQGGVAFLRKDGPTARKPDAEPVLE"
FT   gene            complement(175036..176058)
FT                   /locus_tag="RSKD131_0175"
FT   CDS_pept        complement(175036..176058)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0175"
FT                   /product="Ketol-acid reductoisomerase"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00035"
FT                   /db_xref="GOA:B9KM37"
FT                   /db_xref="InterPro:IPR000506"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013023"
FT                   /db_xref="InterPro:IPR013116"
FT                   /db_xref="InterPro:IPR014359"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9KM37"
FT                   /protein_id="ACM00035.1"
FT                   /translation="MRVYYDRDCDINLIKDKKVAILGYGSQGHAHALNLRDSGAKNVVV
FT                   ALREGSPSAKKAEAEGLKVMGIAEAAAWCDLIMFTMPDELQAETYKKYVHDNLREGSAI
FT                   AFAHGLNVHFGLIEPKPGVDVIMMAPKGPGHTVRGEYVKGGGVPCLVAVHNDATGKAME
FT                   IGLSYCSAIGGGRSGIIETNFRQECETDLFGEQAVLCGGLVELIRMGFETLVEAGYEPE
FT                   MAYFECLHEVKLIVDLIYEGGIANMNYSISNTAEYGEYVSGPRILPYEETKARMKAVLT
FT                   DIQTGKFVRDFMQENAVGQPFFKATRRINDEHQIEQVGEKLRGMMPWISKGKMVDRARN
FT                   "
FT   gene            176188..176643
FT                   /locus_tag="RSKD131_0176"
FT   CDS_pept        176188..176643
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0176"
FT                   /product="Transcriptional regulator, AsnC family"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00036"
FT                   /db_xref="GOA:B9KM38"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B9KM38"
FT                   /protein_id="ACM00036.1"
FT                   /translation="MLDDTDRRLLRHLLAEPALGTAELAARAGLTTATCWRRLERLTER
FT                   GAIGARQAVIDWRRLGYEVEVSLRFTLDKTDPRAFDEFLAAARTVPEVIGIETFLGRVD
FT                   VRLNVIARDMKHYQELYRSRILSLPHITDIEALMLVATIREAEALPL"
FT   gene            176640..177098
FT                   /locus_tag="RSKD131_0177"
FT   CDS_pept        176640..177098
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0177"
FT                   /product="Transcriptional regulator, AsnC family"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00037"
FT                   /db_xref="GOA:B9KM39"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR019885"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B9KM39"
FT                   /protein_id="ACM00037.1"
FT                   /translation="MIDLDDIDRALLRALAEDATQGAGALGRRFGLSQPAAWRRIRRLE
FT                   EAGVIAGRRVVVDREALGFGVTVFLGVKLATKGRISLEDFERAVTAIPEVQVVQHVLGL
FT                   FDYRLRVVARDIADFERVLRRRIMTLPGVGQVEANVLLTEEKRPGPLG"
FT   gene            177277..178404
FT                   /locus_tag="RSKD131_0178"
FT   CDS_pept        177277..178404
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0178"
FT                   /product="Aminotransferase, class V"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00038"
FT                   /db_xref="GOA:B9KM40"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR024169"
FT                   /db_xref="UniProtKB/TrEMBL:B9KM40"
FT                   /protein_id="ACM00038.1"
FT                   /translation="MPALRPDVDPDGLMEFSVVFTDRSLNHMSAKFQQVMRDISGMLRE
FT                   VYGAEAVAVVPGGGTFAMEAVARQFATGAQALVVRNGWFSYRWTQILEAGGFAAGQTVV
FT                   MARPSGNGARAPFAPPPIEEVVAKIAEAKPDVVFAPHVETSAGIILPDDYIARMAEAAH
FT                   AAGALMVLDCIASGCIWVDMAATGVDVLISAPQKGWSASPAGGLVMLSGRAVERLEATA
FT                   SNSFALDLKKWRAIMAAYEAGGHAYHTTMPTDALLGFRDAMAETKAMGFEAAKAAQWRL
FT                   GQEVRAMLAEKGVVSVAAEGFAAPGVVVSYTDDPEVQTGRKFLAEGLQIAAGVPLQVGE
FT                   GAEFRTFRLGLFGLDKLADVEGTVARLRRAVEAVL"
FT   gene            complement(178409..179608)
FT                   /locus_tag="RSKD131_0179"
FT   CDS_pept        complement(178409..179608)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0179"
FT                   /product="Ubiquinone biosynthesis hydroxylase,
FT                   UbiH/UbiF/VisC/COQ6 family precursor"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00039"
FT                   /db_xref="GOA:B9KM41"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR010971"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B9KM41"
FT                   /protein_id="ACM00039.1"
FT                   /translation="MARIATDILVSGGGVAGLTAAAAFASAGWSVICVDPQPPVTSAEA
FT                   EGADLRSTALLQPSIPLLQAAGLWPRLAPHAAPLQVMRIVDAGGPVAEPRVIKDFDAAD
FT                   ISGQPFGWNLPNWLLRREMVAHLKTLKRVDFRPGIATKSVLTRESEALVTLSDGTRVAA
FT                   RLLVAADGRNSPVREALGISVRTTRYGQKALAFTVTHPIPHENVSTEIHRSGGPFTLVP
FT                   LPDAGGKPASAIVWMERGEEALRLKALPREAFEAEMTARSCGILGPLTLASQVNVWPII
FT                   SQVAARMSGERTALMAEAAHVMPPIGAQGLNMSLADLRALLELLADHRDDPGSAALLEA
FT                   YHRRRHWEVQARILGIDLLNRASMAGDPAWRDLRAKLLDALYGSAPVRRTLMRAGLGVA
FT                   "
FT   gene            complement(179660..179890)
FT                   /locus_tag="RSKD131_0180"
FT   CDS_pept        complement(179660..179890)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0180"
FT                   /product="Hypothetical Protein"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00040"
FT                   /db_xref="GOA:B9KM42"
FT                   /db_xref="UniProtKB/TrEMBL:B9KM42"
FT                   /protein_id="ACM00040.1"
FT                   /translation="MNAYADVTDLPNHIIPPMERHTRKTTREDLALFAFAAALVSIVAL
FT                   GCWAFGPVMLGMTALFFVPVMMVIIIMITLG"
FT   gene            complement(179971..180618)
FT                   /locus_tag="RSKD131_0181"
FT   CDS_pept        complement(179971..180618)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0181"
FT                   /product="Pyrimidine 5'-nucleotidase"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00041"
FT                   /db_xref="InterPro:IPR010237"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:B9KM43"
FT                   /protein_id="ACM00041.1"
FT                   /translation="MVADRFSHVRGWVFDLDNTLYPPSARLFDQIERRMTDWVMTELRV
FT                   VREEADRLRRHYWSTYGTTLAGLMAEHGVDPAPYLSHVHDISLDHLERDMILAARIRAL
FT                   PGRKIVYTNGCAPYAERVLEARGLSNLFDAVYGVEHAGFRPKPERAAFETVFAADPLAP
FT                   ETAAMFEDDSRNLLAPHEMGMRTVHVAPEALPAPHIHHHTLDLSEFLALLQP"
FT   gene            180734..181369
FT                   /locus_tag="RSKD131_0182"
FT   CDS_pept        180734..181369
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0182"
FT                   /product="Transcriptional regulator, GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00042"
FT                   /db_xref="GOA:B9KM44"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B9KM44"
FT                   /protein_id="ACM00042.1"
FT                   /translation="MQKDAYTLILEAIEGGTYKPGDRLVESELAERLGVSRTPVREALQ
FT                   RLETQSMLTRDGRSLIVASLDHNQLAELYAVRTELEGLAARLAARHATEEEIRVLRGMV
FT                   EDDRALLGGDPRALSRANKRFHKQIHLASHNRFLVQQLDLVHRSMALMATTSFAAEGRD
FT                   EVAMAEHEQIVQAIEARDGEAAYAALRNHISKAFETRLRVDAGELRMR"
FT   gene            complement(181377..183287)
FT                   /locus_tag="RSKD131_0183"
FT   CDS_pept        complement(181377..183287)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0183"
FT                   /product="General secretory system II, protein E domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00043"
FT                   /db_xref="GOA:B9KM45"
FT                   /db_xref="InterPro:IPR007831"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR037257"
FT                   /db_xref="UniProtKB/TrEMBL:B9KM45"
FT                   /protein_id="ACM00043.1"
FT                   /translation="MPALPDSLPQIRPGRAPAATRALPSPAEAAEPLGVMLLREGNLAP
FT                   HRIMAALSHGGRPSAPLADVLLAEGALSEDEILAMMARRSGLPVLDPATERPDPRLIDR
FT                   LGVRDCLREGLLPLRDTGSAVLLAAAAPESFRRHRPRLEELFGTVIPALATRSSIEAAL
FT                   QEVRADAIGAAAELRVAPEESCRDWRTGQMTRLAALAGLALAAGLALAPGLVLLALTAW
FT                   ALLALACGTALRLATAVATLRRPPPEPESPPLLHLPMVSIIVALYHEEDIAGRLVARLG
FT                   RLDYPHDRLEILLVVEEADRRTRRALLEARLPPWMRIVVSPKGAIRTKPRALNVALDHC
FT                   RGSIVGVYDAEDAPESDQIRRVVEGFSRRGSHVACLQGRLDYYNPRTNWLSRCFTIEYA
FT                   AWFRLMLPGLDRLGLVVPLGGTTLFFRRAALEELGAWDAHNVTEDADLGIRLARHGYRT
FT                   DLIDTVTAEEANCRAIPWIKQRSRWIKGFMMTWAVHMRAPRLLWRQLGPWRFAGFQVMF
FT                   LGSISQTLLAPVLWSFWLLALGLPHPVAPLVPEALLWSMIGLLIGSEGTAIAMGILALR
FT                   QTRHRLNPLWVPTLHLYNPLATFAAYKALWELLRAPFYWDKTCHGVFDAQARGRPLLQP
FT                   A"
FT   gene            complement(183425..184213)
FT                   /locus_tag="RSKD131_0184"
FT   CDS_pept        complement(183425..184213)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0184"
FT                   /product="ErfK/YbiS/YcfS/YnhG family protein precursor"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00044"
FT                   /db_xref="GOA:B9KM46"
FT                   /db_xref="InterPro:IPR005490"
FT                   /db_xref="InterPro:IPR038063"
FT                   /db_xref="UniProtKB/TrEMBL:B9KM46"
FT                   /protein_id="ACM00044.1"
FT                   /translation="MPMTGSLPRRLLPALAALALLAACAPEPPPTRSATPMGLSPQIAA
FT                   LYGPVADGERIIPAVPPQYLSADKVRREVDYFTDRPPGTIVVDPYARYLYLVQPGQRAL
FT                   RYAIAVGREGRGFSGEAVIPIKREWPRWIPTKSMIAEDPEQYGPWKDGMDGGLSNPLGA
FT                   RALYLHRDGKDTYYRIHGTNDVSSIGKATSAGCIRLWNQDILDLYARVSLGTQVVVLTE
FT                   AESGKGTVPAGRALPPRVAGLNSVAPPGETAATMFFTESF"
FT   gene            complement(184389..185552)
FT                   /locus_tag="RSKD131_0185"
FT   CDS_pept        complement(184389..185552)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0185"
FT                   /product="Carbamoyl-phosphate synthase small subunit"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00045"
FT                   /db_xref="GOA:B9KM47"
FT                   /db_xref="InterPro:IPR002474"
FT                   /db_xref="InterPro:IPR006274"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR035686"
FT                   /db_xref="InterPro:IPR036480"
FT                   /db_xref="UniProtKB/TrEMBL:B9KM47"
FT                   /protein_id="ACM00045.1"
FT                   /translation="MAAASPTDKPTACLALADGTIFYGRGFGARGETVAELVFNTAMTG
FT                   YQEIMTDPSYAGQIVTFTFPHVGNVGVTPEDDETAEPVAAGMVVKWDPTEPSNWRATSE
FT                   LTQWLEAKGRIGVGGIDTRRLTRAIRQQGAPHVALAHDPEGRFDIGALVAKARGWRGLV
FT                   GLDLAKDVTCAQSYRWDEMRWAWPEGYRSRSEPGLKVVAIDYGAKRNILRCLASAGCDV
FT                   TVLPATATAEDVLALNPDGVFLSNGPGDPAATGAYAVPMIQGVLARDMPLFGICLGHQM
FT                   LALALGAKTVKMNHGHHGANHPVKDLETGKVEITSMNHGFTVDSQTLPAGVKETHVSLF
FT                   DGSNCGIRVEDRPVFSVQYHPEASPGPQDSYYLFDRFAAAMRARRAA"
FT   gene            185730..186188
FT                   /locus_tag="RSKD131_0186"
FT   CDS_pept        185730..186188
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0186"
FT                   /product="GatB/Yqey domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00046"
FT                   /db_xref="GOA:B9KM48"
FT                   /db_xref="InterPro:IPR003789"
FT                   /db_xref="InterPro:IPR019004"
FT                   /db_xref="InterPro:IPR023168"
FT                   /db_xref="InterPro:IPR042184"
FT                   /db_xref="UniProtKB/TrEMBL:B9KM48"
FT                   /protein_id="ACM00046.1"
FT                   /translation="MTLRERLQDAMKEAMRAKQPDRLSTLRLINAAIKDRDIAARVDGA
FT                   DGMVSDEEITAILGRMVRQRIESARAYEEGGRLELAEKERAEIGVIEDFLPRQLDPEEV
FT                   EAAISAAIAEVEATTIRDMGKVMAELKTRYTGQMDFSAVGPMVKDRLG"
FT   gene            complement(186497..187027)
FT                   /locus_tag="RSKD131_0187"
FT   CDS_pept        complement(186497..187027)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0187"
FT                   /product="Hypothetical Protein"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00047"
FT                   /db_xref="GOA:B9KM49"
FT                   /db_xref="InterPro:IPR019253"
FT                   /db_xref="UniProtKB/TrEMBL:B9KM49"
FT                   /protein_id="ACM00047.1"
FT                   /translation="MPYEWVIAPKAPETSGAFPRSGEEDPLGRLHLWPYRSLPRRGFAA
FT                   FIGVTCLLLALPLIGLLGSPVLWALLPFLVAVVTGMWLALNRSYGDGEILEELTLWPDR
FT                   VTLERHGPRGRRQSWQANPHWVRVTLHRSGGPVPHYLTLGGGPREVEIGAFLGEEERLA
FT                   LWPELERALSRAR"
FT   gene            complement(187041..188741)
FT                   /locus_tag="RSKD131_0188"
FT   CDS_pept        complement(187041..188741)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0188"
FT                   /product="Cytochrome c oxidase subunit 1"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00048"
FT                   /db_xref="GOA:B9KM50"
FT                   /db_xref="InterPro:IPR000883"
FT                   /db_xref="InterPro:IPR014241"
FT                   /db_xref="InterPro:IPR023615"
FT                   /db_xref="InterPro:IPR023616"
FT                   /db_xref="InterPro:IPR033944"
FT                   /db_xref="InterPro:IPR036927"
FT                   /db_xref="UniProtKB/TrEMBL:B9KM50"
FT                   /protein_id="ACM00048.1"
FT                   /translation="MADAAIHGHEHDRRGFFTRWFMSTNHKDIGVLYLFTGGLVGLISV
FT                   AFTVYMRMELMAPGVQFMCAEHLESGLVKGFFQSLWPSAVENCTPNGHLWNVMITGHGI
FT                   LMMFFVVIPALFGGFGNYFMPLHIGAPDMAFPRMNNLSYWLYVAGTSLAVASLFAPGGN
FT                   GQLGSGIGWVLYPPLSTSESGYSTDLAIFAVHLSGASSILGAINMITTFLNMRAPGMTM
FT                   HKVPLFAWSIFVTAWLILLALPVLAGAITMLLTDRNFGTTFFQPSGGGDPVLYQHILWF
FT                   FGHPEVYIIVLPAFGIVSHVIATFAKKPIFGYLPMVYAMVAIGVLGFVVWAHHMYTAGL
FT                   SLTQQSYFMMATMVIAVPTGIKIFSWIATMWGGSIELKTPMLWALGFLFLFTVGGVTGI
FT                   VLSQASVDRYYHDTYYVVAHFHYVMSLGAVFGIFAGIYFWIGKMSGRQYPEWAGKLHFW
FT                   MMFVGANLTFFPQHFLGRQGMPRRYIDYPEAFATWNFVSSLGAFLSFASFLFFLGVIFY
FT                   TLTRGARVTANNYWNEHADTLEWTLTSPPPEHTFEQLPKREDWERAPAH"
FT   gene            complement(189117..189764)
FT                   /locus_tag="RSKD131_0189"
FT   CDS_pept        complement(189117..189764)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0189"
FT                   /product="Octanoyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00049"
FT                   /db_xref="GOA:B9KM51"
FT                   /db_xref="InterPro:IPR000544"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="InterPro:IPR020605"
FT                   /db_xref="UniProtKB/TrEMBL:B9KM51"
FT                   /protein_id="ACM00049.1"
FT                   /translation="MEWSILPGLSPYRETLEAMENRVAAIRAGEAAEAIWLLEHPPLYT
FT                   AGTSARPEDLVEPERFPVHVAGRGGQYTYHGPGQRVAYVMLDLDRRGRDVRRFVTALED
FT                   WVIATLAEFNVRGARREGRVGVWVVRPDRPAGLDGSPREDKIAAIGVKLRRWVSFHGLS
FT                   INVEPDLTHFEGIVPCGIREHGVTSLVDLGLPVTMQDLDAALLRTFPQHFPD"
FT   gene            189870..191429
FT                   /locus_tag="RSKD131_0190"
FT   CDS_pept        189870..191429
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0190"
FT                   /product="Peptidoglycan-binding domain 1 protein precursor"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00050"
FT                   /db_xref="InterPro:IPR002477"
FT                   /db_xref="InterPro:IPR036365"
FT                   /db_xref="InterPro:IPR036366"
FT                   /db_xref="UniProtKB/TrEMBL:B9KM52"
FT                   /protein_id="ACM00050.1"
FT                   /translation="MYGKYLVTASLAALIGLAPAEPVKADAGDAIAGALVGGIIGHAIA
FT                   NDQNRRRAQQQQVYRRAPAKATMSSAQREQNKEVQTALNYFGYPVGTVDGVLGSRSRSA
FT                   VSQFQVLMGYQPTGQLTDYERTILTTAYHRGIAGGPMVQQAIATHPQGMRGLLLMQRDE
FT                   MAGLPAAQSAMALMPQAPAPQMPMAVTAPVLPVAPAAAAAGAAAAVLPELPAPVAEPAP
FT                   AAPELPSFLGSGATMASLASHCNTIGLQTNANGGYTTSAGMTDASFALGEQFCLARSYA
FT                   ISASEELTKQVQGFTPQQIADQCQALGPALKDQVSALSLEPRDDVLKDVSAFVLASGRP
FT                   PAQLAGSARICLGTGYAQDRMDVAVASALLLTALGQKGYAELLGHHLAQGFGASQRPDL
FT                   ALDWYQMGLDAAQSGTAVFGQGMPDRTEVIRKAAYTVGGRADLIVPQTPAPLPVFAPVT
FT                   PPPVEVAAPAPAPVAAPTVEAAASAPAPALALAAQPSGEMAEAGAKAVSAAARLPFLLL
FT                   GQ"
FT   gene            191551..191637
FT                   /locus_tag="RSKD131_trnaLeu1"
FT   tRNA            191551..191637
FT                   /locus_tag="RSKD131_trnaLeu1"
FT                   /product="tRNA-Leu"
FT   gene            191927..193030
FT                   /locus_tag="RSKD131_0191"
FT   CDS_pept        191927..193030
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0191"
FT                   /product="Spermidine/putrescine ABC transporter ATPase
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00051"
FT                   /db_xref="GOA:B9KM53"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005893"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B9KM53"
FT                   /protein_id="ACM00051.1"
FT                   /translation="MVASTQDDGFVVFEHVQKSYDGETLVVKDLNLTIGQGEFLTMLGP
FT                   SGSGKTTCLMMLAGFETATHGEIRLDGRPINTVPPHKRGIGMVFQNYALFPHMTVGENL
FT                   SFPLEVRGMSRSDRERKIKRALDMVQMGAFANRRPAQLSGGQQQRIALARALVFDPQLV
FT                   LMDEPLGALDKQLREHMQFEIKHLHESLGITVVYVTHDQGEALTMSDRIAVFNDGRIQQ
FT                   LAPPSELYERPKNSFVASFIGENNRLPGTVEEIADGRALVRLETGELIDATPVNVARKG
FT                   QQTLVSIRPERVEFKPEMLPPNAHLIDAEVLEFIYMGDIFRTRLRVAGSEDFVIKCRNT
FT                   LGQRVMQPGEKVRIGWAPQDARALDPL"
FT   gene            193085..194176
FT                   /locus_tag="RSKD131_0192"
FT   CDS_pept        193085..194176
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0192"
FT                   /product="ABC polyamine/opine transporter, periplasmic
FT                   substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00052"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:B9KM54"
FT                   /protein_id="ACM00052.1"
FT                   /translation="MGEHKMKKALILSTALSAVAFAASAEQITVMSWGGAYTTSQVEAF
FT                   HKPFTAETGIGVVSVDADNPATPLKAMVEANNVSVDVVDVNTSDAVRLCDEGQLEEIDP
FT                   AMLPAAPDGTPATEDFLPGALSDCAVGNIVYSMIVAYDESKFPNEKPKTIGDFFDTEKF
FT                   PGKRAMWKSAKTTLEMALMGDGVPAAEVYDVMGTPEGVDRAFAKLDAIKGDLIWWEAGA
FT                   QPVQLLADGEVAMTTAYNGRIFAAAVSENKPFVPIWDGQVYEYDLFVIPKGAPNLEAAK
FT                   KFVAFATGTQPLADQAKWISYGPARKSSAPLVGLYQDGKTEMGPNMPTAEANLTNALPS
FT                   SYEFWVDHDTELEERFNAWLASN"
FT   gene            194216..195502
FT                   /locus_tag="RSKD131_0193"
FT   CDS_pept        194216..195502
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0193"
FT                   /product="Binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00053"
FT                   /db_xref="GOA:B9KM55"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B9KM55"
FT                   /protein_id="ACM00053.1"
FT                   /translation="MRDKMADATAQIAAAGTERLTTADGRPLKSALARAQARARRRAFL
FT                   LVLPLLLFVVVTFIVPIGQMLHRSIHNDGFAANMPQLTQWFAETEPGTEPDEAAYAALA
FT                   ADLKAAAEAKTIGVVGTRVNYEMAGTRSLFTSTGRKARNFEPPYRAAILEADEKWANPD
FT                   LWGTMRQVSRAYSPNFFLAAVDLARDNEGNIVRAPAERRVYVMLFERTFLIAGLITFLC
FT                   LLLGYPVAHLLATLPLRTSNLLMILVLLPFWTSLLVRTTSWIVLLQGQGVVNNTLVATG
FT                   LISDSSRIQMIYNQAGTIIAMTHILLPFMILPLYSVMRPIPPSYVRAARSLGASSWTAF
FT                   RRVYLPQTLPGIGAGALLVFILGVGYYITPALVGGASGQLISNLIAFHMQDSLNWSLAA
FT                   ALAAVLLGAVLVLYWLYDRLVGIDNLKLG"
FT   gene            195581..196489
FT                   /locus_tag="RSKD131_0194"
FT   CDS_pept        195581..196489
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0194"
FT                   /product="Binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00054"
FT                   /db_xref="GOA:B9KM56"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B9KM56"
FT                   /protein_id="ACM00054.1"
FT                   /translation="MALPVYASPLERLWYYSYRVLCGLIFLFLIAPILIVIPLSFNVEP
FT                   YFTFTEKMLSLDPDGYSLRWYDTLLTFGMANPEAPRDSSWWMDVWNNAAWVRAAKNSVI
FT                   IGVSSTVVATVLGTVAALGLSRPEMPYRRAIMAILISPMIVPIIITATGLFFFYSATGF
FT                   AGSYVGVVLAHATLGIPFVIITVTATLVGFDRSLTRAAASLGASPTTTFFKVTMPLILP
FT                   GVISGALFAFVTSFDEVVVVLFVAAHDQQTIPRQMWNGIREQISPAILSVATILVIVSV
FT                   LLLATVELLRRRSERLRGISG"
FT   gene            196669..196836
FT                   /locus_tag="RSKD131_0195"
FT   CDS_pept        196669..196836
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0195"
FT                   /product="50S ribosomal protein L33"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00055"
FT                   /db_xref="GOA:B9KM57"
FT                   /db_xref="InterPro:IPR001705"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="InterPro:IPR018264"
FT                   /db_xref="InterPro:IPR038584"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9KM57"
FT                   /protein_id="ACM00055.1"
FT                   /translation="MAKPTTIKIRLNSTAGTGHFYVTKKNARTMTDKMVVRKYDPVKRE
FT                   HVEYKEGKIK"
FT   gene            196910..197395
FT                   /locus_tag="RSKD131_0196"
FT   CDS_pept        196910..197395
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0196"
FT                   /product="Acetyltransferase, GNAT family"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00056"
FT                   /db_xref="GOA:B9KM58"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:B9KM58"
FT                   /protein_id="ACM00056.1"
FT                   /translation="MTVAGLHLRLARPGDLAAVDALFAHSYARLIRADYPPSVLVIAVP
FT                   LLARAQPALLASGRYWLAEAEEGILAAGGWSPRGAADGEIRHLVTRASHVRQGIASALL
FT                   GRAIAQASAEGILRLHCLATRTAVPFYERMGFRRLGEVSVPLDPGVTFPSERMLRAP"
FT   gene            complement(197446..198186)
FT                   /locus_tag="RSKD131_0197"
FT   CDS_pept        complement(197446..198186)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0197"
FT                   /product="Hypothetical Protein"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00057"
FT                   /db_xref="GOA:B9KM59"
FT                   /db_xref="InterPro:IPR006214"
FT                   /db_xref="UniProtKB/TrEMBL:B9KM59"
FT                   /protein_id="ACM00057.1"
FT                   /translation="MADYQTVRSVGAGARAARIDEGLRAHMNKVYGLMSVGMLLTGGVA
FT                   WAFGTSEQLFSLLRDPVTMSPNILGWIVMFAPLIMVFAFGAVLNRLSQAAAQLFFYAYA
FT                   AVMGLSLSWIFVAFTGVSIAQTFLITAIAFASLSLFGYTTKKDLSGFGTFLIMGVVGLL
FT                   VAMVVNIFLASSALAFAISVIGVLIFAGLTAYDTQNIKNTYLQHAHTGDEEWLGKAAIM
FT                   GALQLYLDFINLFMFLLQFMGNRE"
FT   gene            complement(198317..198547)
FT                   /locus_tag="RSKD131_0198"
FT   CDS_pept        complement(198317..198547)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0198"
FT                   /product="Hypothetical Protein"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00058"
FT                   /db_xref="InterPro:IPR009506"
FT                   /db_xref="UniProtKB/TrEMBL:B9KM60"
FT                   /protein_id="ACM00058.1"
FT                   /translation="MFASLHTARLATRGVQAGGSLQRLVARAHLALAAHRQRRALAHLD
FT                   PHLLADVGLTVDEARAEAARPLWDVPSNWRR"
FT   gene            198665..199600
FT                   /locus_tag="RSKD131_0199"
FT   CDS_pept        198665..199600
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0199"
FT                   /product="Transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00059"
FT                   /db_xref="GOA:B9KM61"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B9KM61"
FT                   /protein_id="ACM00059.1"
FT                   /translation="MPRNLDLTALRSFVAVADAGGVTRAAGFLNLTQSAVSMQIKRLEE
FT                   TLDLALLDRSARRVALTAAGEQLLGYARRMLALNDEVFGRLTHDDFEGEVVLGVPHDIV
FT                   YPAIPQVLQRFSAEFPRMRVTLLSSYTRKLKSQFARGECDVIMTTEDTVEPGGETLVEL
FT                   PLVWVGAPGGQAWKQRPLRLAFEPNCIFRMGVQSALDAAGIPWTMAVESDSSRTIEASV
FT                   SADLAVHVSLAGAEPRYMERIPHGGTLPDLETSKVNLYVADPVHSLAVEGMAELIRRAY
FT                   AAQAAGASAPRPLAPVEGAAGEGPRFALRA"
FT   gene            complement(199619..200626)
FT                   /locus_tag="RSKD131_0200"
FT   CDS_pept        complement(199619..200626)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0200"
FT                   /product="Alcohol dehydrogenase, zinc-binding domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00060"
FT                   /db_xref="GOA:B9KM62"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B9KM62"
FT                   /protein_id="ACM00060.1"
FT                   /translation="MLKFGGLFPTRGPDPSMRAFRLRETGLAPDLTEEPLPEPGPGEIR
FT                   LRIAACALNFADLLMIQGRYQERPPLPLTLGMEVAGIVDALGEGVSGPAPGTRVAAFGS
FT                   CGGLAEFGCWPAGRCLPLPDSVSFRDAAAFQIAYGTGHLALDHRARLQPGERLLVTGAA
FT                   GGVGLAAVEIGRRMGAHVIATARGEERLAVARAAGAHEAIDSETEDLKGVLKALGGIDV
FT                   TYDTVGGAGFDAALRASRPEGRLLAIGFAGGDVPQVPANLLLVKNLSVIGLYWGGYMTF
FT                   APQVLIRSLETLLGWLADGSLRPHVSHELPLERAAEGLELLRTRQATGKVVITP"
FT   gene            200993..201301
FT                   /locus_tag="RSKD131_0201"
FT   CDS_pept        200993..201301
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0201"
FT                   /product="Transcriptional regulator, XRE family"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00061"
FT                   /db_xref="GOA:B9KM63"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:B9KM63"
FT                   /protein_id="ACM00061.1"
FT                   /translation="MVGMTQQQLADCVGIKFQQIQKYETGMNRVSASRLWDIAEALGVS
FT                   ISFFFEGLEGAGDQARQAEGDRITDKEALELVRSYYAIPEAQRRRLFDLARVLSEAA"
FT   gene            201390..202190
FT                   /locus_tag="RSKD131_0202"
FT   CDS_pept        201390..202190
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0202"
FT                   /product="Inositol monophosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00062"
FT                   /db_xref="GOA:B9KM64"
FT                   /db_xref="InterPro:IPR000760"
FT                   /db_xref="UniProtKB/TrEMBL:B9KM64"
FT                   /protein_id="ACM00062.1"
FT                   /translation="MQMLTDRETADIIDTAAEMAAAARDATLLHFRSRGLSADTKEADR
FT                   FDPVTVADRLCEERMRAILARRRPRDGILGEEMGVQAGDSGLTWVLDPIDGTRSYLCGT
FT                   PTWGVLISVADASGPIYGLIDQPYIGERFEGGFGLARVRGPRGEDRLATRAARALSEAI
FT                   LMSTFPEVGTAEEEAAFRRLSRQVKLTRYGTDCYAYALLAAGQIDLVVEAGLQPYDVQA
FT                   PMAVIEAAGGLMTDWEGRRNPQGGRVIAASCPEVHAAALEILRG"
FT   gene            202638..203027
FT                   /locus_tag="RSKD131_0203"
FT   CDS_pept        202638..203027
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0203"
FT                   /product="Cell wall hydrolase, SleB"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00063"
FT                   /db_xref="GOA:B9KM65"
FT                   /db_xref="InterPro:IPR011105"
FT                   /db_xref="InterPro:IPR042047"
FT                   /db_xref="UniProtKB/TrEMBL:B9KM65"
FT                   /protein_id="ACM00063.1"
FT                   /translation="MYFESHRSSRDGMVAVGTVVMNRVNSGQFPNTVCGVVGQRNQFAP
FT                   GVMSKRMDSRSLPRVREAARAVLRGERHPFVGNAMFFHTAGHRFPYDNMHYTLVTGGNA
FT                   FYEKRRSELVTQPVPPPPVDGLTGW"
FT   gene            203327..205690
FT                   /locus_tag="RSKD131_0204"
FT   CDS_pept        203327..205690
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0204"
FT                   /product="MscS Mechanosensitive ion channel precursor"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00064"
FT                   /db_xref="GOA:B9KM66"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR011014"
FT                   /db_xref="InterPro:IPR011066"
FT                   /db_xref="InterPro:IPR023408"
FT                   /db_xref="UniProtKB/TrEMBL:B9KM66"
FT                   /protein_id="ACM00064.1"
FT                   /translation="MTRLFRTLAAPLLLALTLFLGSTTAFLPAHAQTALLPGSGAEEPA
FT                   APTSAATLLDLLRNDQARAELIAELERVAAAGEPATPAVSAPSDEILSFGRSAALFTQQ
FT                   AAESVATSVRGLWDALKASPELFAGLSRLDLGVLGDALIELLLLIVATAAIFNLLRRAV
FT                   IPTYRRMGQRARSAGVVKRILLYVGALALDVLIVVGAWAIGYVLAIAVIGNAGQIGLRQ
FT                   TLYLNAFLAVELLRTAMRFVLSPSTGDLRIVALRDRPARYLSAAMSFSIALLGYGQLLI
FT                   VPIVEESTSRAAGRGVSALISVIGVLFVAFLVVRNRKAVAEWLLRETQPVSARHVAAEP
FT                   PAPPVVTTQEIDPDLAADIAAGTADAPPPPEAEPVEVTPEPHPRVRRSPALVALAQSWH
FT                   WFALAYLAVILVLSLVSPGGDAMGPTFASLRIAAVFVVGFFLSGALARAITRGVRLPAT
FT                   ANERLPLLERRLNRFVPQALLVLRLLIVAAVLFFTLHTIGLIDVGTWLESQLGRRLIGT
FT                   LIAVSAILAVAFAIWIALSSWIDYRLNPAFGHVATSREQTLLSLLRNAATIALVVITLM
FT                   FCLSEIGLNIGPLLASAGVLGLAIGFGAQKLVQDIITGIFIQFENAINVGDVVTVAGTS
FT                   GVVERLTVRSVSLRDLNGVFHIIPFSSVDMVSNFMRDFSFFVCDMGVAYREDVTEVRAA
FT                   MFDAFEELRRRPEHAAVILADLEWLGLDSFGDSAVILRARIKTLPGKQWGVGRAYNEIL
FT                   KRIFDERDIEIPFPHQTIYFGQPKQGQIPPQPES"
FT   gene            complement(205740..207041)
FT                   /locus_tag="RSKD131_0205"
FT   CDS_pept        complement(205740..207041)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0205"
FT                   /product="Guanine deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00065"
FT                   /db_xref="GOA:B9KM67"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR014311"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:B9KM67"
FT                   /protein_id="ACM00065.1"
FT                   /translation="MGDPAMTDLLLGQVLSFTADPFLEGEAAARHESHGAVLVEDGRIA
FT                   AVGPAEALRAAHPRARVTDYGQALISAGFIDAHVHYPQTAIIASWGKRLIDWLETYTFP
FT                   EEMRFGDPAYAAEISGRYLDLTLAHGTTTVCSYATIHPESVDAFFEAAAARGLRAYAGK
FT                   TCMDRNAPEGLRDTAESAYADSKRLLERWHGRGRLSYVITPRFSPTSTPEQLAALGALW
FT                   REHPDCLMQTHLSEQLDEIEWVKALHPQARDYLDTYEAQGLLREGAVFGHAIHLAPRER
FT                   ARLAEAGASLVHCPTSNTFIGSGLFDMGLVAEGIRVGLATDTGGGSSFSMLRTMAAAYE
FT                   IGQLRGQALHPAQLWWLATAGSARALRAEDRIGNLAPGMEADLVVVDLASTPAIAQATG
FT                   RAETIWQALFPTIMMGDDRAIRAVWVNGAPVPRG"
FT   gene            207158..208537
FT                   /locus_tag="RSKD131_0206"
FT   CDS_pept        207158..208537
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0206"
FT                   /product="Magnesium transporter"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00066"
FT                   /db_xref="GOA:B9KM68"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR006667"
FT                   /db_xref="InterPro:IPR006668"
FT                   /db_xref="InterPro:IPR006669"
FT                   /db_xref="InterPro:IPR036739"
FT                   /db_xref="InterPro:IPR038048"
FT                   /db_xref="InterPro:IPR038076"
FT                   /db_xref="UniProtKB/TrEMBL:B9KM68"
FT                   /protein_id="ACM00066.1"
FT                   /translation="MQVETGDTREEERSGVPDRVVDSVLEAVEERDEARLSDLLEPLHA
FT                   ADIADVLEQIGSAERRELLTLWSGGIDGEILSEISDSIREEVIEHLPPEVIAEAVRELD
FT                   TDDVVDILEDLEEPQQEAILGALDRADRVAVEQAMAYPEYSAGRLMQREVVVAPVHWTV
FT                   GETIDFLRETEELPDQFYHVILVDPRMKPAGYVTLGRLLSSRRDVKLTAIEEESFRTIR
FT                   ATMAESEVAYIFNQYHLISCPVVDENDRLVGIVTIDDAMNVLDEEHEEDILRLAGVGDE
FT                   SSLSDGPFATARQRLPWLAANLFTASLSALVISAFESTIAQLVTLAALMPIVASTGGIA
FT                   GTQSLAVAVRALATRDLTSANAPRVVRRELFAGLLNGIGLALILGLAGFVIFGDPVLGA
FT                   VLGMAMICNQVVAALGGVLVPLGLNRLGLDPALASGTFVTTLTDVMGFFAFLGLASLVL
FT                   I"
FT   gene            208534..209085
FT                   /locus_tag="RSKD131_0207"
FT   CDS_pept        208534..209085
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0207"
FT                   /product="5-formyltetrahydrofolate cyclo-ligase"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00067"
FT                   /db_xref="GOA:B9KM69"
FT                   /db_xref="InterPro:IPR002698"
FT                   /db_xref="InterPro:IPR024185"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:B9KM69"
FT                   /protein_id="ACM00067.1"
FT                   /translation="MTVAALKAEARRAAGAARALAHKAGQGQAAELLADWLVPHRGRVL
FT                   SGYMPIRSEIDPLPAMAAHDGSVCVPVIVAPGEPLRFREWSPGCPMVDGPFGARVPEDG
FT                   AWLEPEVLIVPLLAFDRRGFRLGYGGGFYDRTLERLRARHPVTAVGFAFTAQELPEVPI
FT                   DATDQPLDAILTEIGPIPLR"
FT   gene            complement(209092..210402)
FT                   /locus_tag="RSKD131_0208"
FT   CDS_pept        complement(209092..210402)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0208"
FT                   /product="ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00068"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B9KM70"
FT                   /protein_id="ACM00068.1"
FT                   /translation="MTVQSSDVTAPPAPRTLADTGLSLVMLRDILLKTMFRMNLELVSQ
FT                   IAPVICLPAPLAQELVDLARSQRLVEATGTLHATSGNEMGYQLTDQGKARALDALSQSE
FT                   YYGAMPVPLDRYRLQVERQSVRHIKLTRAQLTAAMGHLILPDELLDHLGPAVTSGRSIL
FT                   MYGPPGNGKSSISNGIRDALGDRIYVPRALEYSGQVITVYDPIVHRSAESAVDDPTSLR
FT                   RTSNRFDNRYVWCERPTVITGGELTLDMLDLTYNPVARTYQAPLQLKATGGIFIVDDLG
FT                   RQAEPPQKLVNRWIVPLEENRDILALQSGEKFTVPFDTLVIFSTNFHPNEIFDGAALRR
FT                   IFFKIKVDGPSQENFLKIFAMVAKKRKMPLDETALVHLMKAKFPTIDNRYANYMPVYLI
FT                   DQMISVCDFEGLPYQMTPVLIDRAWSNMFVRDEVIAK"
FT   gene            complement(210418..210921)
FT                   /locus_tag="RSKD131_0209"
FT   CDS_pept        complement(210418..210921)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0209"
FT                   /product="Peptidase A24A, prepilin type IV"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00069"
FT                   /db_xref="GOA:B9KM71"
FT                   /db_xref="InterPro:IPR000045"
FT                   /db_xref="UniProtKB/TrEMBL:B9KM71"
FT                   /protein_id="ACM00069.1"
FT                   /translation="MADLIATPAPAAAVFLPLVLPIALWVAWSDMKFMKIPNKAVLALA
FT                   AVFLVAGPFVLPLDDWLWRWLHLLVVLAVGFLMNMGRLIGAGDAKFAAAMALFVALEDL
FT                   RLALALFAASLLGAFASHRGLGLLGPFRRATADWESWRRRDFPMGLALAGMLILYLLAA
FT                   LFGR"
FT   gene            complement(210924..211772)
FT                   /locus_tag="RSKD131_0210"
FT   CDS_pept        complement(210924..211772)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0210"
FT                   /product="Hypothetical Protein"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00070"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:B9KM72"
FT                   /protein_id="ACM00070.1"
FT                   /translation="MRHPVLTALCLVGTALLSGCGGGRDAEVDRALKSLSAADESNLNE
FT                   IMLTVGAPDEAVAYFRGAVEKAPDRIDLKRSLAKSLVRAQRPAEAATVWSQVVNSHEGT
FT                   NADRVAFADTLIRSNDWSRAEAELSRIPPTYETFERYRLEAMVADSKKQWTKADSFYET
FT                   ATGMTTQPAGVLNNWGFSKLSRGDAAAAERLFYEALTYDPTSFTAKNNLVLARGAQRKY
FT                   DLPVIQMTQTERAQLIYTLALAAIKKGDVTVGKGLLQSAIDTHPQYFEAAVRSLEALDA
FT                   G"
FT   gene            complement(211810..212376)
FT                   /locus_tag="RSKD131_0211"
FT   CDS_pept        complement(211810..212376)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0211"
FT                   /product="Tetratricopeptide TPR_2 repeat protein precursor"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00071"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:B9KM73"
FT                   /protein_id="ACM00071.1"
FT                   /translation="MTRGLVFLLLCATLAACGGPDALSRQASERNAPFGVDPGRNGVDG
FT                   LLVGHRLLAAGESELALRAYLRAASEQGMTADVLSALGSANLRLGRLNQAEQLLRRAIE
FT                   LDPAFVPAVNNLGVVLMERGRAPEARLVFQQAFALDSGATDSIRENLRRAIAKSEASLY
FT                   VEPEERHAFSLVRRGQGQYVLLSQL"
FT   gene            complement(212383..213363)
FT                   /locus_tag="RSKD131_0212"
FT   CDS_pept        complement(212383..213363)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0212"
FT                   /product="Type II secretion system protein"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00072"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="UniProtKB/TrEMBL:B9KM74"
FT                   /protein_id="ACM00072.1"
FT                   /translation="MELLSLLETYLTDRLGPLGPLIAVGSLGILLIALTLPVMLKKRVE
FT                   PFDRIRAQRTAAVAAPVQKGQALRRASGSEKLDRFANLLEPKTAEEMSASRLKMMRAGY
FT                   RSKGAVRAFHAAQFALGVGFLAAGLLYAMVASAAAPLTMQQMVLYTILPGAIGYYLPVY
FT                   WIKRRAQERYDQIVSGFPDALDMMLVCVEAGQSLDQSILRVARESAAGYPALAEEFEMV
FT                   AHEVKAGKERVAVLKDMSERVGIPDVSSFVTTLIQSATFGTSIAEALRVYSSEMRDKRV
FT                   MRAEEKANTLPTKLTLGTMLLTVPPLMLILIGPSVYGIATQLGGQ"
FT   gene            complement(213367..214335)
FT                   /locus_tag="RSKD131_0213"
FT   CDS_pept        complement(213367..214335)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0213"
FT                   /product="Type II secretion system protein"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00073"
FT                   /db_xref="GOA:B9KM75"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="InterPro:IPR042094"
FT                   /db_xref="UniProtKB/TrEMBL:B9KM75"
FT                   /protein_id="ACM00073.1"
FT                   /translation="MQLSAAPIIYILIFVAVLLLVEGIYLTVFGKTISLNSRVSRRLAL
FT                   LEKNQNREQVLEQLRKEMSQHMNARGIPLYAILASKAQKANIAFSPKALVGIMVLLSAV
FT                   AYLGLTIGTSAAPLVRGAVAVVMGVGAVYVWVNGKAKKRMALIEEQLPDAVELMVRSLR
FT                   VGHPFSSAIQIVAKEVPDPLGTEFGVIADEAAYGRDVAECIRAFAERMESQDLRFLAVA
FT                   VTIQQQSGGNLAEILEGLAKVIRSRFKLFRRVKAITAEAKWSGTFLSAFPIVALVAISI
FT                   LKPDYYDGVKETPLFIPAALVVGAFLIANVIFMKIMVNIKV"
FT   gene            complement(214343..215800)
FT                   /locus_tag="RSKD131_0214"
FT   CDS_pept        complement(214343..215800)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0214"
FT                   /product="Type II secretion system protein E precursor"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00074"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B9KM76"
FT                   /protein_id="ACM00074.1"
FT                   /translation="MFSRYRKSPDGPKPAPSAAVGAATPSVTAPVAPAPAKPAAPPRPG
FT                   PAAPRTGAEAIASDKEKKRKERLMELKVELHRRLLDDLNLAALETASESSLRSEIAAIC
FT                   GEALEEMSVVLNKDERAILNQELYDEVMGLGPLEPLLKDETINDILVNGPYRIFVERSG
FT                   KLELTDTTFKDERHLLRIIDKIVSAVGRRVDESTPYVDARLADGSRFNAMVPPIAVDGS
FT                   LVSIRKFKKDKLGIADLVRFGAFTEEMAAYLQAAVATRLNIIVSGGTGSGKTTTLNALS
FT                   SFIDNSERILTIEDTAELQLQQAHVGRMESRPPNVEGKGAVTQRDCLRNALRMRPDRII
FT                   VGETRGEEVIDMLQAMNTGHDGSMTTIHANSARDGISRLENMVAMAGIEMPIKAVRAQI
FT                   ASAVNLIVQASRLQDGSRRMVSITEITGMEGDVISMQEIFRYERLGVEPSGKIIGRFNA
FT                   TGVRSHYSDRFRQWGYILPPTIYDPIP"
FT   gene            complement(215821..217092)
FT                   /locus_tag="RSKD131_0215"
FT   CDS_pept        complement(215821..217092)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0215"
FT                   /product="Response regulator receiver protein"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00075"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B9KM77"
FT                   /protein_id="ACM00075.1"
FT                   /translation="MNSVATLQPEPAPIVACTISRDVQNFEILINDMESELGESWGDLS
FT                   FEDAGLFLRQPEARTLEFVALAVDGEDEGDLARLTDIIRTAKEKAIKVILIANQVSPIA
FT                   LHQLLRLGADDFVPYPLPEGALHEAIDRIRKAPPPPAEANAAPPASPGLPHAPAFKARG
FT                   DRDAIVLPVHGMAGGVGASTFACNLAWELATVARTEGPRVCLIDLDLQFGAVSTYLDLP
FT                   RRESVFDILSDTEAADSDGFLQAMLTFNDRLHVFTAPPDMLPLDIMTAEDIGRLLDMAQ
FT                   ANFDFVVLDMPTTVVSWTEAVLTRSQAYFAMMELDLRSAQNVLRLVRALKAESLPHDKL
FT                   RFVLNRAPRFTDLSAKGRVKRMAESLDIEFELQLPDGGVAVTQANDHGLPLSESAAKNP
FT                   LRRELQKLAKSLYDHSRAVEAAKT"
FT   gene            complement(217439..218080)
FT                   /locus_tag="RSKD131_0216"
FT   CDS_pept        complement(217439..218080)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0216"
FT                   /product="OmpA/MotB domain protein precursor"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00076"
FT                   /db_xref="GOA:B9KM78"
FT                   /db_xref="InterPro:IPR006664"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="UniProtKB/TrEMBL:B9KM78"
FT                   /protein_id="ACM00076.1"
FT                   /translation="MRMRCAPLLALPLALALAACGDRPVSTEINDGTFGNATMNNSLLQ
FT                   MGAVSATQALGQRFASEVDPTITFPFDSAALTPEAQATLRRQADWIRQFPEVRFRVYGH
FT                   TDLVGSEAYNKRLGLRRAKAVVAYLASQGISPARLEALVSYGETRPVIPVAAPEERNRR
FT                   TVTEVSGFVTGRGGQMNGKYAAVVFREYVAGATREHPRNRVIATQVAPEG"
FT   gene            complement(218086..219471)
FT                   /locus_tag="RSKD131_0217"
FT   CDS_pept        complement(218086..219471)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0217"
FT                   /product="Type II and III secretion system protein
FT                   precursor"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00077"
FT                   /db_xref="GOA:B9KM79"
FT                   /db_xref="InterPro:IPR001775"
FT                   /db_xref="InterPro:IPR004846"
FT                   /db_xref="InterPro:IPR007055"
FT                   /db_xref="InterPro:IPR032789"
FT                   /db_xref="UniProtKB/TrEMBL:B9KM79"
FT                   /protein_id="ACM00077.1"
FT                   /translation="MSTKDIFRAGLAVLALAASMALTPAAAQTLRVMEGSASGALNVPM
FT                   NRAVVVESDRPFAELSIANPGIADISTLSETSIYVLGKAPGRTTLTLLGADGRLISNVD
FT                   VHVTPDVAEFKERLRQILPGENIEVRTANDGIVLSGTVTSTAKLDRALDLASRYAPDRV
FT                   SNLMSVGGTQQVMLKVRFAEMQRSVAKSLGSSIYARNGSGSVIGGTGTLLQNGIPPSGA
FT                   PISTSGNGALSLGFSVGALEFQVLLEALESKGVVRTLAEPNLTALSGQEAKFLAGGEYP
FT                   IPVASGDEKISIEYKPFGVELNFTPVVVDGNQINLMINAAVSSIDNTVTLESSGFTINA
FT                   FKRRETSTTVEMRDGESFAIAGLLQDDFRNLNGQVPWLGDIPILGALFRSAEYQRSQSE
FT                   LVIIVTPHLVTPTRGEALALPTDRVKLPSEKDLFLFGRVTGRGAAAEVARQDFSGSYGY
FT                   VME"
FT   gene            complement(219725..220549)
FT                   /locus_tag="RSKD131_0218"
FT   CDS_pept        complement(219725..220549)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0218"
FT                   /product="Flp pilus assembly protein CpaB precursor"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00078"
FT                   /db_xref="InterPro:IPR013974"
FT                   /db_xref="InterPro:IPR017592"
FT                   /db_xref="InterPro:IPR031571"
FT                   /db_xref="UniProtKB/TrEMBL:B9KM80"
FT                   /protein_id="ACM00078.1"
FT                   /translation="MRLVFAFVLLIGIALAGFAVYMAQGYISQTQIALEKERAARKKLG
FT                   PMVEVFVTNKPLNYGAPLTRADVRTIMWPANALPETIFQKESDLFPDPAKPRYVLRQME
FT                   KFEPVLGVKVTAPGIEAGIRLASGMRAFAIKVDVASGVSGFLQPGDRVDVYWTGSASSG
FT                   ETTRLIEKTIPIVAVDQTANADLATSAIIARTVTVEVSPQQVARLAQAQATGRLSLSLV
FT                   GRDDTTEATATPVDTRNLIGEPDKVVEVEEKPACIVRTRRGAEVMESIPCTN"
FT   gene            complement(220619..220801)
FT                   /locus_tag="RSKD131_0219"
FT   CDS_pept        complement(220619..220801)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0219"
FT                   /product="Hypothetical Protein"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00079"
FT                   /db_xref="GOA:B9KM81"
FT                   /db_xref="UniProtKB/TrEMBL:B9KM81"
FT                   /protein_id="ACM00079.1"
FT                   /translation="MLDGFVRAEDGAVTVDWIVLTAAIIALCLLVTIPAYTSSSGVAQA
FT                   LAARLVATVTSLSAP"
FT   gene            complement(220988..221206)
FT                   /locus_tag="RSKD131_0220"
FT   CDS_pept        complement(220988..221206)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0220"
FT                   /product="Hypothetical Protein"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00080"
FT                   /db_xref="GOA:B9KM82"
FT                   /db_xref="UniProtKB/TrEMBL:B9KM82"
FT                   /protein_id="ACM00080.1"
FT                   /translation="MKLLNIFKTFRNDEDGAVTVDWVVLTAAIVGLGIAVVTTVSGGLR
FT                   NAATTLTDDLGTTMTTAATAADEPDAE"
FT   gene            221572..222444
FT                   /locus_tag="RSKD131_0221"
FT   CDS_pept        221572..222444
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0221"
FT                   /product="Lytic transglycosylase, catalytic precursor"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00081"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:B9KM83"
FT                   /protein_id="ACM00081.1"
FT                   /translation="MLILALACAPGIAVAELGPGKDFTFRRVKPPGSGAGKRITVQIDP
FT                   AEQARWLAALPKVEPRKPDAPDPAAPAPSAPAVSGALWPEPGPAPQGASYGWFWERVPV
FT                   ALAAVQGRFPLALASLSQGPNGAAVRAPRMQHLQRIAERHGLEILKATLGTRVSPALVL
FT                   AVIGIESGGRVDAVSTAGARGLMQLIPATAQRFGVTDVLDPAQNIRGGVAYLDWLMGEF
FT                   GGDPLMVLAAYNAGEGAVKANGGVPPYAETRDYVPKVLAAWQVAQGLCLTPPELVSDPC
FT                   VFRILSAGL"
FT   gene            complement(222502..222792)
FT                   /locus_tag="RSKD131_0222"
FT   CDS_pept        complement(222502..222792)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0222"
FT                   /product="Hypothetical Protein"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00082"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR031165"
FT                   /db_xref="UniProtKB/TrEMBL:B9KM84"
FT                   /protein_id="ACM00082.1"
FT                   /translation="MTEFVIERESGPARGRYVIRRGGEEAELTWSVLSPTRIIADHTGV
FT                   PDSFRGTGAGRALVERLVADARAEGFTVVPLCPFVNAQRQRHPEWADVFAV"
FT   gene            complement(222785..223414)
FT                   /locus_tag="RSKD131_0223"
FT   CDS_pept        complement(222785..223414)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0223"
FT                   /product="Butyryl-CoA:acetate CoA transferase"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00083"
FT                   /db_xref="GOA:B9KM85"
FT                   /db_xref="InterPro:IPR004165"
FT                   /db_xref="InterPro:IPR012791"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:B9KM85"
FT                   /protein_id="ACM00083.1"
FT                   /translation="MAWDRNQMAARAAQELQDGWYVNLGIGIPTLVANYIPEGIEVTLQ
FT                   SENGMLGMGPFPFEGEEDADLINAGKQTITELPKTAYFDSAQSFAMIRGGKIAMAILGA
FT                   MEVAENGDLANWMIPGKLVKGMGGAMDLVAGVQRVVVVMDHTSKHGESKVLKHCTLPLT
FT                   GQGVVNRIVTNLGVLDVVPGGLRIVECAEGVTEAELRAATEATIVD"
FT   gene            complement(223430..224128)
FT                   /locus_tag="RSKD131_0224"
FT   CDS_pept        complement(223430..224128)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0224"
FT                   /product="3-oxoacid CoA-transferase, A subunit"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00084"
FT                   /db_xref="GOA:B9KM86"
FT                   /db_xref="InterPro:IPR004163"
FT                   /db_xref="InterPro:IPR004165"
FT                   /db_xref="InterPro:IPR012792"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:B9KM86"
FT                   /protein_id="ACM00084.1"
FT                   /translation="MKKVYDSAAAALDGLLFDGMLIAAGGFGLCGIPELLIRAIREAGT
FT                   RDLTVASNNAGVDGFGLGVLLESRQVRKMISSYVGENAEFMRQYLSGELELEFNPQGTL
FT                   AERMRAGGAGIPGFYTKTGVGTVIAEGKEHKEFDGETYILERGIVADLSIVKAWKADPS
FT                   GNLVFRKTARNFNPPAATCGKVCVAEVEEIVPLGSLEPDSIHLPGIYVHRLIQGTHEKR
FT                   IEQRTVRKRA"
FT   gene            224322..224405
FT                   /locus_tag="RSKD131_trnaLeu2"
FT   tRNA            224322..224405
FT                   /locus_tag="RSKD131_trnaLeu2"
FT                   /product="tRNA-Leu"
FT   gene            224716..225609
FT                   /locus_tag="RSKD131_0225"
FT   CDS_pept        224716..225609
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0225"
FT                   /product="Transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00085"
FT                   /db_xref="GOA:B9KM87"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B9KM87"
FT                   /protein_id="ACM00085.1"
FT                   /translation="MPLNALRAFEAVARHLSIKEAALELGVTPSAVSHQLRGLEDALGL
FT                   TLLRRVGPALELTEAGARLAPDLSEGFSRISAAVGGLRQDRSAGPLRLSMLPTFAAHWF
FT                   SPRLTRYPFERNGFDLLISATQEAVDLSAGVADAAVRHGRGCWEGLQADLLFDETVSLF
FT                   GAPPLGRYDPDDMRAQIARRTLFLSQHRKENYARWNATLPGGPIRPAAVMMVDSAGLAL
FT                   RAAMDGAGVALAGVEIAAFDVGAGRLAQLFAHRAPTGGGYFLVYPDALARDRRVRNLSR
FT                   WMVEASAGERALAQSG"
FT   gene            complement(225749..226270)
FT                   /locus_tag="RSKD131_0226"
FT   CDS_pept        complement(225749..226270)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0226"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00086"
FT                   /db_xref="GOA:B9KM88"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:B9KM88"
FT                   /protein_id="ACM00086.1"
FT                   /translation="MVSVPTVRALSAADAPRLADLMTAYRRAMRGPAEAMTPGQAAALI
FT                   ERALRAPDLLLLGADCGGALAGFALAFELPEIISGGRAGQLDDLFVMPEARGSGLARAL
FT                   IRQLTEIGTARGWTHLRWLVPQENATAIHLYRSIAEPAPWDSFRIDLSRRADEGPSARN
FT                   RRPAASVEKR"
FT   gene            complement(226264..226863)
FT                   /locus_tag="RSKD131_0227"
FT   CDS_pept        complement(226264..226863)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0227"
FT                   /product="DSBA oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00087"
FT                   /db_xref="GOA:B9KM89"
FT                   /db_xref="InterPro:IPR001853"
FT                   /db_xref="InterPro:IPR014440"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B9KM89"
FT                   /protein_id="ACM00087.1"
FT                   /translation="MSPIEFWFDFSSGYAFFAAQRIEAIAAELGRTVLWRPYMLGAAFS
FT                   VTGARGLSSTPLKRDYAQRDWARIARQRGLTFRPPADHPHVALAATRAFYWIEAQSPDA
FT                   ATAFAQRVFDLYFSDRLDTASPEAVSRLGPEVGLEPEALLAGIADPALKETVRKIGEDA
FT                   VARGIFGSPFFLVDDEPFWGWDRMEMMAEWIRTGGW"
FT   gene            complement(226860..227285)
FT                   /locus_tag="RSKD131_0228"
FT   CDS_pept        complement(226860..227285)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0228"
FT                   /product="Cupin 2, conserved barrel domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00088"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:B9KM90"
FT                   /protein_id="ACM00088.1"
FT                   /translation="MAAIAAPLGAAHLGARLVEVPPGKAAWPFHAHHANDELFVILSGN
FT                   GELRFGPARYPVAAGMVAVCPAGGAETAHQLIATGPDPLRYVAVSTMREPEVMTYPDSG
FT                   KLTVFAGAAPGGDKAKRRVAASFRTTDAVDYWEGEET"
FT   gene            227563..228495
FT                   /locus_tag="RSKD131_0229"
FT   CDS_pept        227563..228495
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0229"
FT                   /product="Alpha/beta hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00089"
FT                   /db_xref="GOA:B9KM91"
FT                   /db_xref="InterPro:IPR017208"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B9KM91"
FT                   /protein_id="ACM00089.1"
FT                   /translation="MRLKAERSASAMPDERFEVAAEDGYPIRGGIWHADTGPVVVIHAA
FT                   TAVRARYYARFAAWLSGQGATVLTFDYRGIGESRSVPVKDLQAGWIDWGALDAEAVLAF
FT                   AGRRWPDRPLRAVGHSIGGFALGLAGSAARLDRIVTVGAQFAYWRDYDARRRRAMVLRW
FT                   HLFMPAVTRLFGYFPGARLGWLEDVPRGVVRDWSRMGPRFETSVCSDLDPADLAARHGA
FT                   TRARLLAIGLTDDPFCTEAAAQRLLGYYSAADRTHLRIAPSDIAMPEIGHFAFFHARLE
FT                   QTLWPLAAAWLLSGRLPEEAPGRIVSPAG"
FT   gene            228524..229069
FT                   /locus_tag="RSKD131_0230"
FT   CDS_pept        228524..229069
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0230"
FT                   /product="Hypothetical Protein"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00090"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038727"
FT                   /db_xref="UniProtKB/TrEMBL:B9KM92"
FT                   /protein_id="ACM00090.1"
FT                   /translation="MNDRLFVITGGPGSGKTTLLSALARHGLATMPEAGRAIIQDQILI
FT                   GGPGWHGQDRQLFAELMLGWEMRSWHEAQGLRGPVIFDRGIPDVIGYLQLYEGEAPAHV
FT                   HAAAELFRYRPTVFLAPPWPEIFGQDAQRGQDFDEAVATAEAMEQAYAMAGYDLLPLPL
FT                   TTVEARVEFVLEVLDRSA"
FT   gene            complement(229113..230660)
FT                   /locus_tag="RSKD131_0231"
FT   CDS_pept        complement(229113..230660)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0231"
FT                   /product="Pyridoxal kinase"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00091"
FT                   /db_xref="GOA:B9KM93"
FT                   /db_xref="InterPro:IPR004625"
FT                   /db_xref="InterPro:IPR005302"
FT                   /db_xref="InterPro:IPR011037"
FT                   /db_xref="InterPro:IPR013749"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:B9KM93"
FT                   /protein_id="ACM00091.1"
FT                   /translation="MRPLTLLTGRAAPLPGSDVLSGIGKTPVAGPLTLGREGFEGDEQA
FT                   DRRVHGGPEKAVHHYPSDHYESWRAELGDLPAILAPGGFGENLSTAGLTEAEVAVGDTF
FT                   RLGGALIQVSQGRQPCWKLNHRFGVPDMARRVQLTGRTGWYYRVLEPGTVAPGDRLELI
FT                   DRRAPELDPATALAGSLCRPDEPCRTRRHGRARRAGRGLAQPCGPAAGKPAGRGLEQEA
FT                   GRHRMTRPPFVISIQSQVVFGHVGNSAALFPMQAAGLEVAAIPTVVFSNTPDYPTLRGR
FT                   ALPPEFFSDLLQGARERGLPERADYILTGYIGSLDVAEMVADFVAEAKAANPRLRYVCD
FT                   PVMGDTGPGLYVPEAIAGVMRDRLLPMADIATPNPFELAWLTGRQIRTLAELQAARAAL
FT                   SLAEAAHLIATGCVLDDTGPGRLETVLMGPEGLSRHPAERLPIALPGTGDLFAGLVVAG
FT                   LGRGLVLPRAIETAQTLTARALRHAEALGAGEVVLSEPEFRRALLALGTGEAEPPRP"
FT   gene            complement(230657..230905)
FT                   /locus_tag="RSKD131_0232"
FT   CDS_pept        complement(230657..230905)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0232"
FT                   /product="Glutamine amidotransferase class-I"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00092"
FT                   /db_xref="GOA:B9KM94"
FT                   /db_xref="UniProtKB/TrEMBL:B9KM94"
FT                   /protein_id="ACM00092.1"
FT                   /translation="MMTSAPILRHLAVEDPRPFAPVLARAGDPLHEIEPSNPLPDPVEP
FT                   DLIALTKALRQEARAQGPAPKASGQAAFGHWLRELDG"
FT   gene            230989..232407
FT                   /locus_tag="RSKD131_0233"
FT   CDS_pept        230989..232407
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0233"
FT                   /product="Transcriptional regulator, GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00093"
FT                   /db_xref="GOA:B9KM95"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B9KM95"
FT                   /protein_id="ACM00093.1"
FT                   /translation="MDMREPLALEIDPGHGGPLFLAIAEAITLDITRGRLRPGARLPGT
FT                   RALARALGVHRNTVDAAYQELLTQGWLQAEPARGTFVAQDLPQGMLVRRPAPAPVEPVA
FT                   MRAGLAFSDGAPDPELVPDKALARAFRRALLSPAFRAGADYGDARGTSSLREALAAYLA
FT                   SDRGVVADPARLLIARGSQMALFLAARAALAPGEAIAVEEPGYPLAWEAFRAAGAEVRG
FT                   VPVDGGGLRIDALEAALARDPRLRAVYVTPHHQYPTTVTMGAARRLQLLELAERHGLAL
FT                   IEDDYDHEYRFEGRPVLPLAARAPEGLPLIYVGSLSKLLSPGIRLGYALAPEPLLTRMA
FT                   AARAAIDRQGDAPLEAALAELIRDGDLGRHARKARRVYRARRDLLAERLTAQLAGRAAF
FT                   DLPAGGLALWLRCAGVSAETWAEAAGQAGLALLPGTRFALESPAPQAFRLGYAALDEGQ
FT                   IARAVEILARSFPG"
FT   gene            complement(232409..233395)
FT                   /locus_tag="RSKD131_0234"
FT   CDS_pept        complement(232409..233395)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0234"
FT                   /product="Biotin synthase"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00094"
FT                   /db_xref="GOA:B9KM96"
FT                   /db_xref="InterPro:IPR002684"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010722"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR024177"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9KM96"
FT                   /protein_id="ACM00094.1"
FT                   /translation="MIPSDLRTDWTVEEARAIHALPFPDLMHRAQTLHRAHFDPTAIET
FT                   ASLLSIKTGGCPEDCGYCAQSAHHDTGVKATKLMATEEVLAAARRAKAAGAQRFCMGAA
FT                   WRSPKDRDMDRLCDMVQGVAELGLETCMTLGMLSPGQVARLRAAGLDFYNHNIDTSPAY
FT                   YARIASTRTMEDRLETVEQVRRGGIKVCCGGILGMGEAEEDRIALLVTLATLPAHPDSV
FT                   PVNLWTEIEGVPVQGRARAVDPFALVRIVALARILMPASVLRLSAGRTEMSDELQALCF
FT                   LAGANSIFVGDQLLTTGNPAAWKDRDLLTRLGLHVAPARARPLVAAN"
FT   gene            complement(233392..233949)
FT                   /locus_tag="RSKD131_0235"
FT   CDS_pept        complement(233392..233949)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0235"
FT                   /product="BioY protein"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00095"
FT                   /db_xref="GOA:B9KM97"
FT                   /db_xref="InterPro:IPR003784"
FT                   /db_xref="UniProtKB/TrEMBL:B9KM97"
FT                   /protein_id="ACM00095.1"
FT                   /translation="MALLTPSLARPAALGRGLALALGGAALITLGAKIQIPFWPVPMTL
FT                   HSLAVFFLAAALGPRLGFAAMATYLAAGALGMPVFSGTPERGIGLVYMAGPTGGYLAGY
FT                   LLGAGLAGWLAEGRGAIGRFLAMLAGLTVVYATGLAWLAHFVPTSSLLAAGFLPFILGD
FT                   LVKLALAAGLVGALARFKGRGQ"
FT   gene            complement(234033..234701)
FT                   /locus_tag="RSKD131_0236"
FT   CDS_pept        complement(234033..234701)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0236"
FT                   /product="Transcriptional regulator, GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00096"
FT                   /db_xref="GOA:B9KM98"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B9KM98"
FT                   /protein_id="ACM00096.1"
FT                   /translation="MQKSPEETQSARIARILADRIISGEIPPGARLRQDHVATEFGASH
FT                   VPVREAFRELQTRGLAESEPRRGFRVTEFDVAELREVAEMRSSLESLALRHAAPNLTRA
FT                   LLKEAEEVTRHGDNAGTVREWEEANRHFHRLILSPCRMPRLLRTIDDLQAASARFLFAA
FT                   WRRDWEARTDHDHRAILDALRKGQTDLACSTLARHVGWVGRRRPSANNGDRPGTYDIHD
FT                   "
FT   gene            235223..236164
FT                   /locus_tag="RSKD131_0237"
FT   CDS_pept        235223..236164
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0237"
FT                   /product="TIM-barrel protein, yjbN family"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00097"
FT                   /db_xref="GOA:B9KM99"
FT                   /db_xref="InterPro:IPR001269"
FT                   /db_xref="InterPro:IPR004653"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018517"
FT                   /db_xref="InterPro:IPR035587"
FT                   /db_xref="UniProtKB/TrEMBL:B9KM99"
FT                   /protein_id="ACM00097.1"
FT                   /translation="MLDWTDRHCRFFHRLMTRRAMLYTEMVTAPAVIHGQRDRLLGFSE
FT                   AEHPVALQLGGSDPAELAQAVRLAEPYGYDEINLNVGCPSDRVQSGCFGAVLMERPSLV
FT                   ADCVAAMIAESPVPVTVKCRIGVDEQEPSEVLPAFLETLAAAGVRHFVIHARKAWLQGL
FT                   SPRENREIPPLDYPLVIAMKRRFPELTICLNGGVGSLTQAEALLAQGLDGIMIGRAAYN
FT                   EPELLLEADRLWGEEPPRDLAAVLADMRPYISAHLEGGGRLHQITRHMLGLFAGRPGAR
FT                   HWRRILSEGASRPGAGLALFDEALEAVQPRAA"
FT   gene            236245..237063
FT                   /locus_tag="RSKD131_0238"
FT   CDS_pept        236245..237063
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0238"
FT                   /product="Hypothetical Protein"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00098"
FT                   /db_xref="GOA:B9KMA0"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:B9KMA0"
FT                   /protein_id="ACM00098.1"
FT                   /translation="MTELSLLLPMLALLLAIGAFAGIIAGLLGVGGGLVLVPAYLYAFE
FT                   AMGYGGPSLMRVCLATSLATIIVTSLRSVHAHHRKGAVDLEILRRWGPWIALGAVAGTF
FT                   LASSMKSVVLQGIFGGVGVAVGLYMAFGKTSWRLGESLPQGAARAATGTGVGLLSVLMG
FT                   IGGGTFGVPLMSLFNVPIHRAVATAAGFGVIIALPSAALFLFTPTDAAPPLAVGAVNLP
FT                   AFGITIAMTLLTTPLGVKLAHAMDPKPLKRVFAVFIMIVALNMLRKAFLA"
FT   gene            complement(237378..238817)
FT                   /locus_tag="RSKD131_0239"
FT   CDS_pept        complement(237378..238817)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0239"
FT                   /product="Replicative DNA helicase"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00099"
FT                   /db_xref="GOA:B9KMA1"
FT                   /db_xref="InterPro:IPR007692"
FT                   /db_xref="InterPro:IPR007693"
FT                   /db_xref="InterPro:IPR007694"
FT                   /db_xref="InterPro:IPR016136"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036185"
FT                   /db_xref="UniProtKB/TrEMBL:B9KMA1"
FT                   /protein_id="ACM00099.1"
FT                   /translation="MLPHNIEAEQQLLGAILTNNDIFDRIASVIRAEHFFDPIHQRIFE
FT                   IAAARIQKNALASPVTLKAFLEEDAGLKELGGPAYLVRLAGAAISAFAARDYAQMIYDL
FT                   AVRRELIGLGRDIAAKAARVDVASEPKEQIVEAEQKLYRLGEQGQAERGFQSFLKAVTD
FT                   AVNVANAAYQRDGGLAGISTGLADLDKKLGGLHPSDLLILAGRPSMGKTSLATNIAFNI
FT                   AKAYRRGRLPDGAEGAIEGGVVGFFSLEMSAEQLAARILSEAAEVPSEQIRRGDMTEAE
FT                   FRRFVEAAKALEACPLYIDDTPALPISQVAARARRLKRTHGLDVLMVDYLQLLKGSGGS
FT                   RDNRVQEVSEITQGLKAIAKELNIPVVALSQLSRSVESRDDKRPQLSDLRESGSIEQDA
FT                   DVVMFVFREEYYREREKPGDHEMEKMAQWQAIMEQVHGKAEVIIGKQRHGPIGSVELSF
FT                   EGRFTRFGNLVRPWQQGIESY"
FT   gene            238806..238940
FT                   /locus_tag="RSKD131_0240"
FT   CDS_pept        238806..238940
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0240"
FT                   /product="RNA polymerase sigma factor"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00100"
FT                   /db_xref="UniProtKB/TrEMBL:B9KMA2"
FT                   /protein_id="ACM00100.1"
FT                   /translation="MRKHLRRFLRLRLPERPDLVHDSALCSRCAGATFSGRPSCLAGP"
FT   gene            complement(239137..239835)
FT                   /locus_tag="RSKD131_0241"
FT   CDS_pept        complement(239137..239835)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0241"
FT                   /product="Orotate phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00101"
FT                   /db_xref="GOA:B9KMA3"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR023031"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9KMA3"
FT                   /protein_id="ACM00101.1"
FT                   /translation="MIPTSFPPREEIARLTARMLLEIEAVHFRPQEPFTLASGLPSPTY
FT                   IDCRKLISYPRIRSTLMDFMAVTLLRDAGFEAFDNIAGGETAGIPFAALVAERLGLPMT
FT                   YVRKKPKGYGRNARIEGVMTEGQRVLLVEDLTTDGGSKLSFVDAIRETGASCAHTAVIF
FT                   YYGIFPETIGRLQAHGVTLHPLCTWWDVLAEARASGAFDAATLAEVESFLSNPRDWQDA
FT                   RKPADPTKSL"
FT   gene            complement(239878..240918)
FT                   /locus_tag="RSKD131_0242"
FT   CDS_pept        complement(239878..240918)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0242"
FT                   /product="Dihydroorotase"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00102"
FT                   /db_xref="GOA:B9KMA4"
FT                   /db_xref="InterPro:IPR002195"
FT                   /db_xref="InterPro:IPR004721"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:B9KMA4"
FT                   /protein_id="ACM00102.1"
FT                   /translation="MTQSLTLRRPDDWHLHLRDGAMLEGVLPETTRHFARAIVMPNLVP
FT                   PVVTAAEAQAYRARILRALPEGARFEPLMVLYLTETTDPADVRAAAASGLVTAVKLYPA
FT                   GATTNSASGVRDFDRVRGVLETMAEIGLPLCVHGEVTDPAVDIFDREAVFLDRVLDPIR
FT                   RATPGLRVVLEHVTTREGLDYVRGGGPDMAGTLTTHHLIINRNHILAGGIRPHYYCLPV
FT                   AKRETHRLALRAAATGGEACFFLGTDSAPHVDAAKESGCGCAGCFTAPNTLSILAHVFE
FT                   EEGALDRLEGFVSLHGPAFYRLPPNDERITLHKGVALALRGKIETGAGPVTVFDPGFPL
FT                   LWHVEP"
FT   gene            241063..241977
FT                   /locus_tag="RSKD131_0243"
FT   CDS_pept        241063..241977
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0243"
FT                   /product="ATPase associated with various cellular
FT                   activities"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00103"
FT                   /db_xref="GOA:B9KMA5"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011704"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B9KMA5"
FT                   /protein_id="ACM00103.1"
FT                   /translation="MTQSLPASIDAAAALLAGQGYVSDRALSTVVFLSLKLGRPLFLEG
FT                   EAGTGKTEIAKALAAALGRRLIRLQCYEGLDAASAVADWNFAAQMIAIRTAEASGGADR
FT                   SALRTELFTEEYLIERPLLQAMRPQPGGAPVLLIDELDRTDEPFEAFLLEALSDFQVTI
FT                   PELGTIRAPEPPLVILTSNRTREVHDALKRRCLYHWVDYPDFPREARILAARVPEAQEG
FT                   LSREIVAFVQRLRREDLFKRPGVAETIDWAKCLLALDVIELSPELIADTLGALLKYQDD
FT                   IQKIQGSEARRLLDEARRDLAPA"
FT   gene            242082..243278
FT                   /locus_tag="RSKD131_0244"
FT   CDS_pept        242082..243278
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0244"
FT                   /product="VWA containing CoxE family protein"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00104"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR008912"
FT                   /db_xref="InterPro:IPR011195"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:B9KMA6"
FT                   /protein_id="ACM00104.1"
FT                   /translation="MELEAPADGNLARNILWFARALRKAGLPIGSGRIADAVRAVEAAG
FT                   FTSREDFYWTLHACFVSRPEHRAVFAQVFRLFWRDPQFLEQMMSLLLPQLRGLQEDRPP
FT                   EPAEKRAAEALLDGAERPWRAAPEPEGSLIEIDASDTASGEERLRRLDFEQMSAEEIAA
FT                   ARRMLARLSLPVPPIRSRRLVAAAGGPRVDLRRTLARALRQGGEIPALARRRPALRWPN
FT                   LVVLCDISGSMSLYSRLVLQFIHAVANRKGQGWARVHAFTFGTRLTNITRHLRRRDVDA
FT                   ALAAAGAEAQDWSGGTRIGECLHIFNRDWSRRVLGQGAVVLLITDGLDRGDPAALSREM
FT                   ERLHLSARRLIWLNPLLRWEGFAPRAGGIRAMLPHVDSLRAAHSVASLEALSEALSRP"
FT   gene            243351..243827
FT                   /locus_tag="RSKD131_0245"
FT   CDS_pept        243351..243827
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0245"
FT                   /product="Hypothetical Protein"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00105"
FT                   /db_xref="UniProtKB/TrEMBL:B9KMA7"
FT                   /protein_id="ACM00105.1"
FT                   /translation="MRHADPMPRGRDHREKGQTMTFKLLQTTAALSLGLFALQPLAAAA
FT                   QTTTEDCIPSASVTCPPGASSVPGTESPGGTDDSTAAAPVDSTSTGGGASGSTSTTPMV
FT                   PGAEAPDGTDDSTAAAPVDPTSTGGGLTTEGMAPSVPGTESPDGTDDSNAAVPQ"
FT   gene            244057..246147
FT                   /locus_tag="RSKD131_0246"
FT   CDS_pept        244057..246147
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0246"
FT                   /product="OmpA/MotB domain protein precursor"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00106"
FT                   /db_xref="GOA:B9KMA8"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="UniProtKB/TrEMBL:B9KMA8"
FT                   /protein_id="ACM00106.1"
FT                   /translation="MTTTAALSVALSTFQPLPLMAQDANKAVCAQNPDLCPPKQKRGEG
FT                   AQKRKEQEQAKEKRKEERPAARAAQEEEGGAARARRANREQVEEGGQARRPAAEQDAPA
FT                   RGDKARARARDSEDGAARAQAEGNAADDTRLLQEGNGQGDAARPAKRARPAEEERPADR
FT                   ERAGERARAAEEGGAARDAVRAGDERPAAGAEGRKAETREASPDGDGPDAEELRRRLQG
FT                   EAPAKDRQARGDRDGGAAADEEGGRNAEARGDGQAREAEGRDAERPRNRDAEGRDADRE
FT                   RNRNAEDRTRPADAQARDGQGRQQAGDEARRARQQQPEREEARKSLARILESEDQGEES
FT                   AAAAAASAEDASEAAREARRQANRAERITEENSRSSNEEFRTLLNGNRDKKNDDDDDEG
FT                   GLSNFEKFGLLALGGLAVGTLLNNNRGEVVSNSGDRVVVQRSDGTYSVLKDDDTLLRRP
FT                   GSEVVTQSFDDGSTRSVVTRADGTQIVTIRDASGRVLRRTAVDGQGREVMLIDDLESYQ
FT                   AVDVSRLPEPAPVYSFVQTRDERDLRQALEQTRTRDLDRTYSLRQIREYREVRALAPAI
FT                   DVDQITFDTGSAAIDPDEAEKLASLGQTIADMIAERPEEVFLIEGHTDAVGDAASNLAL
FT                   SDRRAESVALALTEYFDVPPENMVVQGYGEEDLRVDSDGPEQRNRRVAVRLITPLMQTA
FT                   SN"
FT   gene            246263..247234
FT                   /locus_tag="RSKD131_0247"
FT   CDS_pept        246263..247234
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0247"
FT                   /product="Hypothetical Protein"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00107"
FT                   /db_xref="InterPro:IPR003777"
FT                   /db_xref="InterPro:IPR027051"
FT                   /db_xref="UniProtKB/TrEMBL:B9KMA9"
FT                   /protein_id="ACM00107.1"
FT                   /translation="MAGHDDIPELALDWHRAGRAPVIATVLETWGSAPRPAGSQLVIAD
FT                   DGEMMGSVSGGCVEGAVIAEAAEARADGRPRVLTFGVSDDEAFAVGLACGGTIRVLVEP
FT                   VGSALPEAVLADLVAARGGRRSVALVFHPETGGHRLTGPEEAAVAARLRSDRSGLEEDG
FT                   RFIGIHNPPLRLVVVGAVHIAQPLVAMARIAGYGPTLIDPRSAFGSEARFPGETILDAW
FT                   PDEALAGFAPDARTAVVTLTHDPKLDDPAILAAFDTPAFYIGCLGSPRTHAKRLDRLRA
FT                   AGVPEAQIARIHAPVGLDIGARSPAEIALSILAQITERLRRG"
FT   gene            247234..248238
FT                   /locus_tag="RSKD131_0248"
FT   CDS_pept        247234..248238
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0248"
FT                   /product="Transcriptional regulator, Fis family"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00108"
FT                   /db_xref="InterPro:IPR036425"
FT                   /db_xref="UniProtKB/TrEMBL:B9KMB0"
FT                   /protein_id="ACM00108.1"
FT                   /translation="MRFGAVPLDEAQGAVLAHSVALPGGRLRKGLVLGATEIADLAAAG
FT                   HRDVMAARLDPGDVPEDVAAARLAQALVPDERAALLARSSAFTGRVNLNATVPGLVSLD
FT                   TDRIHALNRIDPAITLATLAPLARIEPGMLVGTVKIIAYAVEETALAQAEALARGALRV
FT                   LPVVRRSAGLLLTEVPGQEAKLAAKGRRAVEKRLAALGMELAGVEVTAHETGPMAEALA
FT                   RLPGEMLLILTGSATSDVRDTGPEALRHAGGEVARFGMPVDPGNLLFHGRLGPRPVIGL
FT                   PGCARSPALNGADWVLERLACGLEVDDAAIAAMGVGGLLKEIPLRPQPRERRA"
FT   gene            complement(248310..248720)
FT                   /locus_tag="RSKD131_0249"
FT   CDS_pept        complement(248310..248720)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0249"
FT                   /product="Translation initiation factor IF-3"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00109"
FT                   /db_xref="GOA:B9KMB1"
FT                   /db_xref="InterPro:IPR001288"
FT                   /db_xref="InterPro:IPR019813"
FT                   /db_xref="InterPro:IPR019814"
FT                   /db_xref="InterPro:IPR019815"
FT                   /db_xref="InterPro:IPR036787"
FT                   /db_xref="InterPro:IPR036788"
FT                   /db_xref="UniProtKB/TrEMBL:B9KMB1"
FT                   /protein_id="ACM00109.1"
FT                   /translation="MMMAEEAGLDLVEISPNAEPPVCKIMDFGKFKYEQQKREAEARKK
FT                   QHIIEIKEIKFRPGTDTHDYDVKMRSVLKFLSEGDKVKVTLRFRGREMAHQELGLELLN
FT                   RVAAHVSEAEAGKVEAMPKLEGRQMVMMIAPK"
FT   gene            249020..249655
FT                   /locus_tag="RSKD131_0250"
FT   CDS_pept        249020..249655
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0250"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00110"
FT                   /db_xref="UniProtKB/TrEMBL:B9KMB2"
FT                   /protein_id="ACM00110.1"
FT                   /translation="MNRIAIIVGLVLLAAAGFGWYQYSYLPDQEAAEAARVAEEDAARA
FT                   ADEAREAAEAAREEAAAAAEETEDAAAQAASDAAAAADAATAAASDAAAAAAAATEEAA
FT                   RTAGEAASSAADAAVEAAKEAAAAATLAARNAADAAGELLPEDLLRVETFDRARVDAMI
FT                   DSSDLDPSTKERLKNTIDAAQSTPELLGPALETVRTSLGFAPSAAEAD"
FT   gene            complement(249770..250576)
FT                   /locus_tag="RSKD131_0251"
FT   CDS_pept        complement(249770..250576)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0251"
FT                   /product="Ferredoxin--NADP(+) reductase"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00111"
FT                   /db_xref="GOA:B9KMB3"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR008333"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR033892"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:B9KMB3"
FT                   /protein_id="ACM00111.1"
FT                   /translation="MNQNAAIVKTLPDAQTVTSVQHWTDRLFSFRVTRPQSLRFRSGEF
FT                   VMIGLLDDRGKPIMRAYSIASPNWDEELEFYSIKVPDGPLTSRLQHIQPGDQIILRPKP
FT                   VGTLVLDALLPGKRIWFLATGTGIAPFASLMRDPETYERYEQVIMMHTCREQAELEYGR
FT                   QLVENLKDDPLIGEMVGDKLLYYPTTTRETSDRMGRITDNLSSGKVFEDLGVPKMNLEE
FT                   DRAMVCGSLQFNLDVKTVLESFGLREGANSEPLQYVVEKAFVGDGI"
FT   gene            complement(250639..251046)
FT                   /locus_tag="RSKD131_0252"
FT   CDS_pept        complement(250639..251046)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0252"
FT                   /product="Hypothetical Protein"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00112"
FT                   /db_xref="InterPro:IPR008318"
FT                   /db_xref="UniProtKB/TrEMBL:B9KMB4"
FT                   /protein_id="ACM00112.1"
FT                   /translation="MSVIVTDKGFSADDWPGAIASLEALEDGAEAVDLSNTDDPARLGN
FT                   RLEQLGLIRIAFPSFSDGRGFTLAKRLRRMGYRGRLRAHGPLIADQYAMARRSGFDEVE
FT                   IPDDLAARQPEDQWLFRADWQNHDYQSQLKR"
FT   gene            complement(251043..251759)
FT                   /locus_tag="RSKD131_0253"
FT   CDS_pept        complement(251043..251759)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0253"
FT                   /product="Phosphoadenylylsulfate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00113"
FT                   /db_xref="GOA:B9KMB5"
FT                   /db_xref="InterPro:IPR002500"
FT                   /db_xref="InterPro:IPR004511"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:B9KMB5"
FT                   /protein_id="ACM00113.1"
FT                   /translation="MAALNGRYKHHGATAVLEHALKDADLGRVALVSSFGAESVVLLHL
FT                   VSVIAPETPVIFIDTRMLFQETLDYQRELADTLHLCDIRTIRATQPRIAFEDPDGTLNR
FT                   YNTDACCAVRKVEPLERALKHFDGWITGRKRYQSGTRAAVEFFEAEDDRRIKVNPLAHW
FT                   GREDLEDYIVNNNLPRHPLVARGYPSIGCEPCTSPVAEGEDPRAGRWRGSAKTECGIHF
FT                   INGRAVRGPVNKEDAA"
FT   gene            complement(251788..253458)
FT                   /locus_tag="RSKD131_0254"
FT   CDS_pept        complement(251788..253458)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0254"
FT                   /product="Nitrite/sulfite reductase, hemoprotein
FT                   beta-component, ferrodoxin domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00114"
FT                   /db_xref="GOA:B9KMB6"
FT                   /db_xref="InterPro:IPR005117"
FT                   /db_xref="InterPro:IPR006067"
FT                   /db_xref="InterPro:IPR036136"
FT                   /db_xref="UniProtKB/TrEMBL:B9KMB6"
FT                   /protein_id="ACM00114.1"
FT                   /translation="MYSYTDFDEAFVRTRVAQFSEQVRRRIDGSLTEDEFKPLRLMNGL
FT                   YLQLHAYMLRVAIPYGTLDSRKMRQLAMIAERWDKGYGHFTTRQNIQFNWPKLGDVPEI
FT                   LSALADVGMHAIQTSGNCVRNVTADHFAGAAADEIEDPRPVAELLRQWSTDHPEFQFLP
FT                   RKFKIAITGSPNDRAVTKAHDIGLRMVRNADGEPGFEVIVGGGLGRTPMIGRVVRDFLP
FT                   KADLLPYVEAILGVYNELGRRDNKYKARVKILVHETGLEPLREIIEERFLETRAEFGGQ
FT                   DMALLSEIERAFAPPAFRQAPTAAYDDFYRADPIFRAWADTNLARHRNADYAIVTISLK
FT                   AHGATPGDATADQMRVMADLAERYGHDELRISHEQNVILPHVHKADLPAVHAALAQAGL
FT                   ATANVGLISDIIACPGMDYCALATARSIPVAQEIATRFEALDLEHEVGPLKIKISGCIN
FT                   ACGHHHVGHIGILGLDRAGVENYQITLGGDGTETAAIGEKTGPGFAYDEIVPAVERIVR
FT                   TYLEVRSEPSETFLDTLRRVGHAPFKAALYEAEGKQDAA"
FT   gene            complement(253485..253790)
FT                   /locus_tag="RSKD131_0255"
FT   CDS_pept        complement(253485..253790)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0255"
FT                   /product="Hypothetical Protein"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00115"
FT                   /db_xref="InterPro:IPR021270"
FT                   /db_xref="UniProtKB/TrEMBL:B9KMB7"
FT                   /protein_id="ACM00115.1"
FT                   /translation="MSRPYIPKVVTANALLEGDVVYLTADDRWTRHHHEAELIEDEAHA
FT                   QLRLLHAAARRAEVVGPYLADAKAGPDGPEPIHFREVFRTRGPSNYRHGKQEAAAL"
FT   gene            complement(253787..254560)
FT                   /locus_tag="RSKD131_0256"
FT   CDS_pept        complement(253787..254560)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0256"
FT                   /product="Uroporphyrinogen-III C-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00116"
FT                   /db_xref="GOA:B9KMB8"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR003043"
FT                   /db_xref="InterPro:IPR006366"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:B9KMB8"
FT                   /protein_id="ACM00116.1"
FT                   /translation="MARMLNPLTAPGQVIFVGAGPGSIDHLTMGACRALTQAEVVIHDR
FT                   LVGPEILDLIPPQALRIEAGKEGFGPSTPQETINALIVDHAASGRRVVRLKSGDSGIFG
FT                   RLDEEIEALDAAGLGWRIVPGLTTAAAAAAAIGQGLTKRGRNAALRIVTGHDMAGYAEQ
FT                   DWRGLARVGEVAAIYMGKKSARFIQGRLMMHGADPETPATVIENVSRADERIVAATLAT
FT                   LPEAVAGLSGPAIVLYGLAPRRAAAALPLLKEATA"
FT   gene            254694..255155
FT                   /locus_tag="RSKD131_0257"
FT   CDS_pept        254694..255155
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0257"
FT                   /product="Transcriptional regulator, AsnC family"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00117"
FT                   /db_xref="GOA:B9KMQ5"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR019885"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B9KMQ5"
FT                   /protein_id="ACM00117.1"
FT                   /translation="MAVRLDEMDRKILAELQADASQSLDEIARKVGSSKTPVWNRIRRM
FT                   REAGVILRQTALLDAEALGLEACFFVLIRTSEHEAEWQRKFLKALRERPEVLEAHRLAG
FT                   DIDYILKVRVANARAYDTFYQALISEVRIYNVTALLSMEEIKATTVLPV"
FT   gene            complement(255339..256520)
FT                   /locus_tag="RSKD131_0258"
FT   CDS_pept        complement(255339..256520)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0258"
FT                   /product="Cytochrome P450"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00118"
FT                   /db_xref="GOA:B9KMQ6"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002397"
FT                   /db_xref="InterPro:IPR017972"
FT                   /db_xref="InterPro:IPR036396"
FT                   /db_xref="UniProtKB/TrEMBL:B9KMQ6"
FT                   /protein_id="ACM00118.1"
FT                   /translation="MQTLSQSPHDRRFLRNPYRFYREARAAGPFFHWEELGLVCTTSYA
FT                   AANAILRDRRFGREVPPGRASAVPDHLAPFAAVEAHSMLELEPPRHTRLRNLVLRAFTS
FT                   RRIGTMQPEIAALSESLVAAVPEGPFDLLPAFSQRLPITLIARLIGIPESLAPELLRWS
FT                   SAMVAMYQAGRTRKTEERAALAAADFSDFLRLHIEARRHAPADDLLTHLIAAEADGQQL
FT                   STDEIVSTCILILNAGHEAAVHAIGNAVAVLLRHRTPPEALAPPHLLGTVEELLRFDPP
FT                   LHLFRRMAYERVEIMGRTIEEGCEVALLLGAANRDPGPWERPDRFLWNRPEKTHLAFGA
FT                   GLHFCLGAPLARLELATALPILFGRLPNLQLVKPPSYGDSWHFRGLERLIVSA"
FT   gene            complement(256849..257598)
FT                   /locus_tag="RSKD131_0259"
FT   CDS_pept        complement(256849..257598)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0259"
FT                   /product="Triosephosphate isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00119"
FT                   /db_xref="GOA:B9KMQ7"
FT                   /db_xref="InterPro:IPR000652"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR020861"
FT                   /db_xref="InterPro:IPR022896"
FT                   /db_xref="InterPro:IPR035990"
FT                   /db_xref="UniProtKB/TrEMBL:B9KMQ7"
FT                   /protein_id="ACM00119.1"
FT                   /translation="MGKKMRKLAAGNWKMNGTEADLGEIDALLAAHPSPRCEMLICPPA
FT                   TLLARMAGRAAQGLMVGGQDCHPKTSGAHTGDVSAAMLADAGASHVILGHSERRADHGE
FT                   TDSLVRLKAEAAWGAGLVAIVCVGETEAQRDAGQTLDVIGAQLAGSVPEAATAANTVIA
FT                   YEPVWAIGTGRTPTTAEIAEVHAFLRARLAERFSDAEGFRLLYGGSVKPSNAAEIFAVP
FT                   NVDGALVGGASLKAADFGGIVAALSAA"
FT   gene            complement(257698..258054)
FT                   /locus_tag="RSKD131_0260"
FT   CDS_pept        complement(257698..258054)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0260"
FT                   /product="Iron-sulfur cluster assembly accessory protein"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00120"
FT                   /db_xref="GOA:B9KMQ8"
FT                   /db_xref="InterPro:IPR000361"
FT                   /db_xref="InterPro:IPR016092"
FT                   /db_xref="InterPro:IPR035903"
FT                   /db_xref="UniProtKB/TrEMBL:B9KMQ8"
FT                   /protein_id="ACM00120.1"
FT                   /translation="MFSIPGKQAVTLTPAAAKQIARLMQKQDSKGLRIGVKKGGCAGME
FT                   YTMDYVSDINPMDETVEQDGARVMIAPMAQMFLFGTEIDYETGLIESGFKFRNPNVVDA
FT                   CGCGESIKFREAEA"
FT   gene            complement(258138..258500)
FT                   /locus_tag="RSKD131_0261"
FT   CDS_pept        complement(258138..258500)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0261"
FT                   /product="Hypothetical Protein"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00121"
FT                   /db_xref="InterPro:IPR002744"
FT                   /db_xref="InterPro:IPR014291"
FT                   /db_xref="InterPro:IPR034904"
FT                   /db_xref="UniProtKB/TrEMBL:B9KMQ9"
FT                   /protein_id="ACM00121.1"
FT                   /translation="MNQQQDMIEGAPLIKPSTTDHPLYDSIVEACRTVYDPEIPVNIFD
FT                   LGLIYTIDVSAENEVEILMTLTAPGCPVAGEMPGWVQDAVEPIAGVKSVVVGMTFDPPW
FT                   GMDMMSDEARLELGFM"
FT   gene            258788..259591
FT                   /locus_tag="RSKD131_0262"
FT   CDS_pept        258788..259591
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0262"
FT                   /product="Hypothetical Protein"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00122"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:B9KMR0"
FT                   /protein_id="ACM00122.1"
FT                   /translation="MLKQVICINWGTKYGPRFINRLYAMVARNITPPFSFTCFTDNEEG
FT                   IRPEVDCQPLPPLDFVMPKNTKGKWPKARLWSPTLGDLKGPVLFLDLDLVITGSLDEFF
FT                   TYGDPDRVILARNPAKPFERLGQTSVFRFPVGKLVELQRIFLADPQAVADEYRFEQRFV
FT                   TMNAPGGVDLFPKAWVRHFRYQCMLPFPLNLALPPRLPQGAKVVIFPGGVHPEHAIQGG
FT                   WVRREGWTLGQHLKGLAERHADGSRWRYLRHYMRPTGWVADHWKE"
FT   gene            complement(260392..260553)
FT                   /locus_tag="RSKD131_0263"
FT   CDS_pept        complement(260392..260553)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0263"
FT                   /product="Transposase IS66"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00123"
FT                   /db_xref="InterPro:IPR039552"
FT                   /db_xref="UniProtKB/TrEMBL:B9KMR1"
FT                   /protein_id="ACM00123.1"
FT                   /translation="MTLIESAKLSGLDPQAYLADVLARINDHINPRLHELLPWNWKPLP
FT                   AGDKKIAA"
FT   gene            complement(260550..260891)
FT                   /locus_tag="RSKD131_0264"
FT   CDS_pept        complement(260550..260891)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0264"
FT                   /product="Hypothetical Protein"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00124"
FT                   /db_xref="InterPro:IPR004291"
FT                   /db_xref="UniProtKB/TrEMBL:B9KMR2"
FT                   /protein_id="ACM00124.1"
FT                   /translation="MAHNGSVYDIEARINGRSADERRAVRQAHSRPKVKAFKSWAEEQL
FT                   EYISGKSDLAKAFRYALNRWDAFCLFLEDGRVAIDNNPAERAMRPIGIGRKNWLFAGND
FT                   AGGEPWRAP"
FT   gene            complement(260866..262053)
FT                   /locus_tag="RSKD131_0265"
FT   CDS_pept        complement(260866..262053)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0265"
FT                   /product="Hypothetical Protein"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00125"
FT                   /db_xref="InterPro:IPR004291"
FT                   /db_xref="InterPro:IPR024463"
FT                   /db_xref="InterPro:IPR024474"
FT                   /db_xref="UniProtKB/TrEMBL:B9KMR3"
FT                   /protein_id="ACM00125.1"
FT                   /translation="MAMSLTASSLPDDPAALKAMILQLQASLRAHDLLVQSLRMRIARL
FT                   KRQAFGKGSEKIAREIEQLEFALESLQVAQAEVAPPPEPESVETALVCGTSDEPGDNEA
FT                   PEKAPRRRPRVSPDTPCERREFDPGDTCPDCGGALRLVGEDVSQILDMIAARLKLIEVA
FT                   RPKKSCRCCERMVQCPAPTRPILGSLAGPSLLAFILVAKYDDHLPLYRLNEIFARMGAD
FT                   IPDTTLAGWCGGAMKTLAPLVELIRADVLASDLLHADDTPIRVLDRSKKSELGKGVKEG
FT                   RIWAYVRDQRPWSGGAPPAVAYHFSPDSKGEHPQKHLGAGKGILQADAYAGFRDLYLAE
FT                   GNGEARFREAACWAHLRRAFFEVEKETGSDIAREALERIGLRHCARTNGAQWLSL"
FT   gene            complement(262199..262477)
FT                   /locus_tag="RSKD131_0266"
FT   CDS_pept        complement(262199..262477)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0266"
FT                   /product="IS66 Orf2 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00126"
FT                   /db_xref="InterPro:IPR008878"
FT                   /db_xref="UniProtKB/TrEMBL:B9KJN2"
FT                   /protein_id="ACM00126.1"
FT                   /translation="MRVFLAAGTTDMRCGIAGLCARAKKVLGEDPAGGALLVFRGRMGD
FT                   RLKILHWDGQGFCLYYKVLERGHFPWPKATEGKVALTPAQMAMLWEG"
FT   gene            complement(262495..262770)
FT                   /locus_tag="RSKD131_0267"
FT   CDS_pept        complement(262495..262770)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0267"
FT                   /product="Transposase IS3/IS911 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00127"
FT                   /db_xref="GOA:B9KMR5"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="UniProtKB/TrEMBL:B9KMR5"
FT                   /protein_id="ACM00127.1"
FT                   /translation="MNGARVADVARRHDLTRQHIYQWRAEFRRRGENLTEETDFLPVEM
FT                   TAEKTVTPAVATFPVEIVLMNGRRLRGIEGLSPAGLAQLIRVLEGA"
FT   gene            complement(263085..263157)
FT                   /locus_tag="RSKD131_trnaMet1"
FT   tRNA            complement(263085..263157)
FT                   /locus_tag="RSKD131_trnaMet1"
FT                   /product="tRNA-Met"
FT   gene            263264..264310
FT                   /locus_tag="RSKD131_0268"
FT   CDS_pept        263264..264310
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0268"
FT                   /product="Phosphoribosylformylglycinamidine cyclo-ligase"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00128"
FT                   /db_xref="GOA:B9KMR6"
FT                   /db_xref="InterPro:IPR004733"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9KMR6"
FT                   /protein_id="ACM00128.1"
FT                   /translation="MAEQQKGLTYADAGVDIDAGNALVERIKPAAKRTARPGTVSGLGG
FT                   FGALFDLKAAGYHDPVLVAATDGVGTKLRIAIDTGEVDTIGIDLVAMCVNDLVCQGAEP
FT                   LFFLDYFATGKLEVAQAARIIEGIAEGCAASGCALIGGETAEMPGMYHKGDFDLAGFAV
FT                   GAMERGADLPQGVAEGDVLLGLGSNGVHSNGYSFVRKVVELSGLGWDAPAPFGGDSLGR
FT                   ALLAPTRLYVKQALAAVRAGGVHALAHITGGGLTENLPRVLPEGLGARIDLSAWELPSV
FT                   FRWLAETASMAEPELLKTFNCGIGMIVVVAADRADEIAALLAAEGETVTRIGEVIAGEG
FT                   VSYDGRLL"
FT   gene            264307..264897
FT                   /locus_tag="RSKD131_0269"
FT   CDS_pept        264307..264897
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0269"
FT                   /product="Phosphoribosylglycinamide formyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00129"
FT                   /db_xref="GOA:B9KMR7"
FT                   /db_xref="InterPro:IPR001555"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR004607"
FT                   /db_xref="InterPro:IPR036477"
FT                   /db_xref="UniProtKB/TrEMBL:B9KMR7"
FT                   /protein_id="ACM00129.1"
FT                   /translation="MKRVAVLISGGGSNMLALLRSMEGAHPARPVLVASNDPAAAGLAR
FT                   AAELGVPVAAVDHRPFRGDRAAFEAALLEPILAAEPDILCLAGFMRVLTPAFVARFEGR
FT                   MLNIHPSLLPKYQGLHTHRRALEAGDAEAGCTVHEVTAALDDGPILGQARVPILPGDTA
FT                   ETLAARVLTREHALYPAVLRRFAAGDRTPLLLD"
FT   gene            264994..266151
FT                   /locus_tag="RSKD131_0270"
FT   CDS_pept        264994..266151
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0270"
FT                   /product="Ribonuclease D"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00130"
FT                   /db_xref="GOA:B9KMR8"
FT                   /db_xref="InterPro:IPR002121"
FT                   /db_xref="InterPro:IPR002562"
FT                   /db_xref="InterPro:IPR006292"
FT                   /db_xref="InterPro:IPR010997"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:B9KMR8"
FT                   /protein_id="ACM00130.1"
FT                   /translation="MQTITTTEALAAFCEAAKAEPYVTIDTEFLRERTYWSKLCLIQMA
FT                   LPGKTGEAVLVDPIEGPDMSLEPLYDLFRHEATVKVFHAARQDLEIFFVEGRAFPVPLF
FT                   DTQVAAMVCGFGEQVGYETLVKKIAREQLDKTSRFTDWSRRPLSDAQKTYAIADVTHLR
FT                   VIYEWLSAQIEKNGRQKWVEEELAILTDPETYTVRPEEAWLRIKTRTTSGRFLAVVKEL
FT                   ARFREDYAQKNNVPRSRVMKDDALLEIASTRPTNSEELGRSRLLLREGRRGDIADGILA
FT                   AVKAGMEVKNEDLPKPDLSREQLQVNPALADLLRVLLKAKSESLGVAARLIASASELDA
FT                   IAAGERDLPSLKGWRLEAFGADALRLCRGEIALSAKGNDVRVVKL"
FT   gene            complement(266189..266623)
FT                   /locus_tag="RSKD131_0271"
FT   CDS_pept        complement(266189..266623)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0271"
FT                   /product="Hypothetical Protein"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00131"
FT                   /db_xref="UniProtKB/TrEMBL:B9KMR9"
FT                   /protein_id="ACM00131.1"
FT                   /translation="MGLALVLALGACGSRLNPLNWFGGSEPAPVTLAPTDLPATAPDAR
FT                   PLMAQVISLEVEPNRGGAVVRAVGVPPTQGFWNAELVARPVQDGVMTYEFRALPPPRGA
FT                   AVGTQASREVTVGAYLTAYQLRSISQITVVSAGNALTSRR"
FT   gene            266759..267199
FT                   /locus_tag="RSKD131_0272"
FT   CDS_pept        266759..267199
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0272"
FT                   /product="Cysteine desulfuration protein SufE"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00132"
FT                   /db_xref="InterPro:IPR003808"
FT                   /db_xref="UniProtKB/TrEMBL:B9KMS0"
FT                   /protein_id="ACM00132.1"
FT                   /translation="MEGRMATQAFEEIAETFDFLDDWEDRYRHVIELGKAMPPLDEAFR
FT                   VPATKVEGCASQVWIRPVIEGEGGGARFDFQGDSDAMIVRGLIAVLHALYSGLSAAEVG
FT                   RVDAPAELARLGLDQHLSSQRSNGLRAMVERIRRVSAEVAAA"
FT   gene            complement(267222..267578)
FT                   /locus_tag="RSKD131_0273"
FT   CDS_pept        complement(267222..267578)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0273"
FT                   /product="Hypothetical Protein"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00133"
FT                   /db_xref="InterPro:IPR007361"
FT                   /db_xref="InterPro:IPR038694"
FT                   /db_xref="UniProtKB/TrEMBL:B9KMS1"
FT                   /protein_id="ACM00133.1"
FT                   /translation="MKDMQMNNHIRLRKAEGKWVIRTDSAVLGETLNAIELTEGSRDPV
FT                   IYFPREDVAMVMFDKSEKVTACPLKGEASYYSIVGASGTLKDAAWSYESPKEGLEAIAG
FT                   YLAFAPDCTKVGQY"
FT   gene            complement(267630..269426)
FT                   /locus_tag="RSKD131_0274"
FT   CDS_pept        complement(267630..269426)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0274"
FT                   /product="Peptidase M24"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00134"
FT                   /db_xref="GOA:B9KMS2"
FT                   /db_xref="InterPro:IPR000587"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR029149"
FT                   /db_xref="InterPro:IPR032416"
FT                   /db_xref="InterPro:IPR033740"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:B9KMS2"
FT                   /protein_id="ACM00134.1"
FT                   /translation="MFQTFHATSSPAQGPARLAALRQALAAEGLAGFLVPRSDAHQGEY
FT                   VAARDDRLQWLTGFTGSAGFCLVLPEVAGVFIDGRYRVQVKHQVDLAHFTPVAWPEIQP
FT                   GDWLREKLSQGVIGFDPWLHTADEIARLETALAGSGIALRPVENPLDRLWADQPDPPMG
FT                   RAFAHPDALAGETGEAKRQRLAQTLAAAGRKAVVLTLPDSICWLLNIRGSDVPRNPVLH
FT                   AFAVLHDDARVTLFAEAAKFDEATRAHLGAGVTLRPPQAFVPALRTLTGPVQVDRKTAP
FT                   LAVLLELQDAGVEAVDGDDPCRLPKACKTAAEIAGMRDAHLRDGAAMVEFLTWLDAEAA
FT                   KGGLTEIDVVTALEGFRRATNALHDISFDTICGAGPNGAIMHYRVTDDSNRPVQRDELL
FT                   LVDSGAQYADGTTDITRTVAVGDPGQEARECYTRVLQGLIAISRARWPKGLAGRDLDAL
FT                   ARYPLWLAGQDYDHGTGHGVGAFLSVHEGPQRIARISEVPLEPGMILSNEPGYYREGAF
FT                   GIRLENLIVVEEAPALGDNRRQLAFETLTFVPFDRRLILPQLLSSAERDWIDAYHRDVL
FT                   EKIGSRLSPAARDWLEAAAAPL"
FT   gene            complement(269426..271285)
FT                   /locus_tag="RSKD131_0275"
FT   CDS_pept        complement(269426..271285)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0275"
FT                   /product="Cobaltochelatase"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00135"
FT                   /db_xref="GOA:B9KMS3"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR006538"
FT                   /db_xref="InterPro:IPR025861"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:B9KMS3"
FT                   /protein_id="ACM00135.1"
FT                   /translation="MSKPSDNPADPFKKALAEATKTLACDPEMTVTFTVDPAGMNREGM
FT                   RLPQVSRRMTRDEVMLARGTADAFALRRRYHDDALSARYLPQGQMAREIYEAMETARCE
FT                   AVGARTMPGTAGNIDARIGHEAERKGYAQITQAADAPLATAAGYLVRHLATGRTLPGGA
FT                   DNVMELWRGFIEQQAGDTLQNLDEVLSDQAAFARLARKVISDLGYGDQLGDDPDTDEQD
FT                   EAGEDAETDEDDSQSQGEDESEESPEAQPERSQEEQQDPTEAQVSMDDQPDSDQGEEME
FT                   LPEGEAPLEPPPPAAYSEADPAYVVFATEFDEEIRAEDLAEPAELERLRAYLDQQLEPL
FT                   KGAVSRLANKLQRRLQAQQNRSWEFDREEGILDAGRLARVVANPTTPLSFKVEKDTEFR
FT                   DTCVTLLLDNSGSMRGRPISIAAICADVLARTLERCQVKVEILGFTTRAWKGGQSREKW
FT                   LAAGRPQQPGRLNDLRHIVYKGADAPWRRARENLGLMMKEGLLKENIDGEALEWAHRRL
FT                   SSRAETRKILMVISDGAPVDDSTLSVNPASYLEKHLRDVIAMVERKRQVELIAIGIGHD
FT                   VTRYYARAVTITDVEQLAGAMTEQLASLFDADPKKRIGKRRVA"
FT   gene            complement(271337..271666)
FT                   /locus_tag="RSKD131_0276"
FT   CDS_pept        complement(271337..271666)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0276"
FT                   /product="Hypothetical Protein"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00136"
FT                   /db_xref="GOA:B9KMS4"
FT                   /db_xref="UniProtKB/TrEMBL:B9KMS4"
FT                   /protein_id="ACM00136.1"
FT                   /translation="MDQAAVAARLAELHGSLETLRRQGRILGALAAVLVGAVVWLAAGS
FT                   ALLALAAGLLAALATGLLTRLRAAAVMRNLTDLERAHPEAVALAMDRYRLNRALDRAER
FT                   WKLFR"
FT   gene            complement(271668..271997)
FT                   /locus_tag="RSKD131_0277"
FT   CDS_pept        complement(271668..271997)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0277"
FT                   /product="Hypothetical Protein"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00137"
FT                   /db_xref="GOA:B9KMS5"
FT                   /db_xref="UniProtKB/TrEMBL:B9KMS5"
FT                   /protein_id="ACM00137.1"
FT                   /translation="MSIAALAERIAACEAARSRARRQILTLVPVLALAGAGLGFLLFGG
FT                   AGTALALALAGAAFGAAGAGLSLLSAGRRQVRLAVEHPDLYPAALERYRMVMATERAGR
FT                   YKLYC"
FT   gene            complement(271994..273028)
FT                   /locus_tag="RSKD131_0278"
FT   CDS_pept        complement(271994..273028)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0278"
FT                   /product="Hydrogenobyrinic acid a,c-diamide
FT                   cobaltochelatase"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00138"
FT                   /db_xref="GOA:B9KMS6"
FT                   /db_xref="InterPro:IPR006537"
FT                   /db_xref="InterPro:IPR011704"
FT                   /db_xref="InterPro:IPR025865"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B9KMS6"
FT                   /protein_id="ACM00138.1"
FT                   /translation="MFHQRPGARKGVRCGNKADGMLDMTVRPTEEISVRETFGIDTDMK
FT                   VKGFAERTDRVPDIDPTYKFDADTTLAILAGFAYNRRVMIQGYHGTGKSTHIEQVASRL
FT                   NWSCVRVNLDSHVSRIDLIGKDAIKLVDGKQVTTFQEGILPWALRNPCAIVFDEYDAGR
FT                   ADVMFVIQRVLETDGKLTLLDQNEVITPHPCFRLFATANTVGLGDTTGLYHGTQQINQG
FT                   QMDRWSLVATLNYLSHDAEVAIVLSKNPHYNTEKGRKQISQMVTVADLTRTAFMNGDLS
FT                   TVMSPRTVISWAQNAEIFRNVGYAFRLTFLNKCDELERQTVAEFYQRCFNEELPESAAS
FT                   TAMK"
FT   gene            complement(273134..273769)
FT                   /locus_tag="RSKD131_0279"
FT   CDS_pept        complement(273134..273769)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0279"
FT                   /product="Heat shock protein DnaJ domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00139"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:B9KMS7"
FT                   /protein_id="ACM00139.1"
FT                   /translation="MTNRPPFEFDIRVSSDKKRRKTGRRGMSGAFETSNRQCEYPDCSE
FT                   AGIYRAPKSPDLLDEFFWFCKDHVREYNLKWNFFQGSGEDEIKRIMEKDRLWGRETQPF
FT                   AKRPDEGRVWSRLGVDDPMEILGEKATQNPGKIATTATRKLPPTERKALEILDARDTWT
FT                   KLEIRKQYKSLVKDLHPDMNGGNRADEERLQEVVWAWDQIKDSRYFRD"
FT   gene            273844..274101
FT                   /locus_tag="RSKD131_0280"
FT   CDS_pept        273844..274101
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0280"
FT                   /product="BolA family protein"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00140"
FT                   /db_xref="InterPro:IPR002634"
FT                   /db_xref="InterPro:IPR036065"
FT                   /db_xref="UniProtKB/TrEMBL:B9KMS8"
FT                   /protein_id="ACM00140.1"
FT                   /translation="MGVVEEIRDRLEAAFAPEELEVMDESEQHRGHGGWREGGETHFRV
FT                   RMRAAAMATQTRLERHRAVNAALGKDLVGRIHALALDVAG"
FT   gene            complement(274210..276369)
FT                   /locus_tag="RSKD131_0281"
FT   CDS_pept        complement(274210..276369)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0281"
FT                   /product="Malate synthase G"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00141"
FT                   /db_xref="GOA:B9KMS9"
FT                   /db_xref="InterPro:IPR001465"
FT                   /db_xref="InterPro:IPR006253"
FT                   /db_xref="InterPro:IPR011076"
FT                   /db_xref="InterPro:IPR023310"
FT                   /db_xref="UniProtKB/TrEMBL:B9KMS9"
FT                   /protein_id="ACM00141.1"
FT                   /translation="MTDRIEKQGLQVDVRLAEFVAREALPDTGVSEETFWGGLADTVRT
FT                   LGPRNRALLDRRAELQAAIDDWHRTHRGERPSLREYTAFLREIGYLLPEGPDFIIETAH
FT                   VDPEIAEVAGPQLVVPVMNARYALNAANARWGSLYDSLYGTDALGDLPEGAEFDPARGA
FT                   RVIAWGRRFLDETAPLAQGSHADVEGYRVEGGALVPALADPAQFAGHAGPAEAPTAILL
FT                   KNNGLHLILDIDRKHRIGAADRAGVADIRMEAALSAIMDCEDSVAAVDGEDKALAYANW
FT                   LGLMRGDLSEAISKGGRMFVRELAPDLAFTAPEGGTVTLKGRALMLVRNVGHLMTTPAV
FT                   LDETGAEIFEGMLDAFATTLCALHDLAKSDGIRNSVAGSVYVVKPKMHGPDEVAFADEL
FT                   FTRVEEVLGLPRYTVKLGIMDEERRTSVNLKECIRAAKHRVAFINTGFLDRTGDEIFTG
FT                   MEAGPMVKKGDMKASRWIASYEDRNVDIGLACGLRGRAQIGKGMWAMPDRMAEMLAAKI
FT                   GHPKAGASCAWVPSPTAATLHATHYHQVDVTARQEEIAAGGPRGSLEDLLTLPVAEGMN
FT                   WSEAELRQEIENNAQGILGYVVRWVDQGVGCSKVPDINDVGLMEDRATCRISSQALVNW
FT                   LHHGVVSEDQVMAALKKMAAVVDAQNAGDPAYRPMAPGFDGAAFQAACDLVFKGREQPS
FT                   GYTEPVLHARRLQVKAERTPQVSRA"
FT   gene            complement(276469..277833)
FT                   /locus_tag="RSKD131_0282"
FT   CDS_pept        complement(276469..277833)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0282"
FT                   /product="Deoxyribodipyrimidine photo-lyase type I"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00142"
FT                   /db_xref="GOA:B9KMT0"
FT                   /db_xref="InterPro:IPR005101"
FT                   /db_xref="InterPro:IPR006050"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR036134"
FT                   /db_xref="InterPro:IPR036155"
FT                   /db_xref="UniProtKB/TrEMBL:B9KMT0"
FT                   /protein_id="ACM00142.1"
FT                   /translation="MNVLIWFRNDLRVADHPALARAADDRVLPLAIVDPAEWADPARSG
FT                   RQWAFRTECLADLRADLAALGAPLAVRVGDPQAVLSKLCRLHRIRRIFCLEDPAFAELD
FT                   LALQAWAAGTGLELIRLKPGPGAPAALTPLPAVEPGPIPPARALRLAEDRCPHRQPGGR
FT                   PQGQLLLQSFLERRGALYRDGRNRLLQAERASSRLSPHLAAGTLSREEVLAAVAARLAE
FT                   RPDADWVRSLGAFRAALASGATGARGAVCPPAAPEGAAPPEDIWTRLKGKPDALRLRLA
FT                   ALHAGETGLPFVDAALRAMAASGWLPARLRGMLASVALHHLGLSEQAAGAALAAGLTDH
FT                   SPPIHWAQMRRVALGRPVDPERLAGVLDPDGAFTRRWLPELAEVPDRVLQAPWRWEGAR
FT                   GLLGRRYPEPLVDPSAARAAGRTLARRPTARVEVIEGAAPRRPASAPTQQLCLDL"
FT   gene            complement(277881..278030)
FT                   /locus_tag="RSKD131_0283"
FT   CDS_pept        complement(277881..278030)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0283"
FT                   /product="Hypothetical Protein"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00143"
FT                   /db_xref="UniProtKB/TrEMBL:B9KMT1"
FT                   /protein_id="ACM00143.1"
FT                   /translation="MKDRVVAFATCLVKDAAGSAGSTRRASPAALDQRARDRKPMGDLP
FT                   FIIS"
FT   gene            278233..280836
FT                   /locus_tag="RSKD131_0284"
FT   CDS_pept        278233..280836
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0284"
FT                   /product="Aminopeptidase N"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00144"
FT                   /db_xref="GOA:B9KMT2"
FT                   /db_xref="InterPro:IPR001930"
FT                   /db_xref="InterPro:IPR012779"
FT                   /db_xref="InterPro:IPR014782"
FT                   /db_xref="InterPro:IPR024601"
FT                   /db_xref="InterPro:IPR027268"
FT                   /db_xref="InterPro:IPR035414"
FT                   /db_xref="InterPro:IPR037144"
FT                   /db_xref="InterPro:IPR038438"
FT                   /db_xref="InterPro:IPR042097"
FT                   /db_xref="UniProtKB/TrEMBL:B9KMT2"
FT                   /protein_id="ACM00144.1"
FT                   /translation="MRAPRRGLGCKIQEKIMTDTPIRLADYLPPSHLVDGVSLTFRLDP
FT                   GRTRVLSEIRFRPNPARTGRPDLRLDGEGLALVSAALDGAPLAAQPDATGLTLPGASLP
FT                   DAPFTFTAEVEIDPAANTALEGLYMSNGMYCTQCEAEGFRKITFYPDRPDVMAPFCVRI
FT                   ESDLPVLLSNGNEVASGPGWAEWHDPWPKPSYLFALVAGDLVAHSAGFTTASGRSVALN
FT                   IWVRPGDEARCAYAMDSLIRSMKWDEEVYGREYDLDTFNIVAVDDFNMGAMENKGLNIF
FT                   NSKYVLALPETATDDDFARIEAVIAHEYFHNWTGNRITCRDWFQLCLKEGLTVFRDQQF
FT                   SSDMRSAAVKRIEDVLTLRARQFREDDGPLAHPVRPEEYIEINNFYTATVYEKGAELIG
FT                   MLKRLVGDEAYARALDLYFERHDGQAATIEDWLTVFEDATGRDLAQFKLWYSEAGTPRL
FT                   KVSDRFEDGRYTLEFEQVNPPTPGQPVKQPKVIPVAVGLLNPNGDEVLPTTVLEMTEPR
FT                   QSFTFEGLGARPVPSILRGFSAPVVLERETSPEERAFLLAHDTDPFNKWEAGRALAKDV
FT                   LARMVTEGAQPGPDWLEALARVAVDETLDPAFRALALRLPGEDDMAQTLHAAAHVPDPA
FT                   RIHAARERMAGALAERLEPELGALIETLAEPGPFSPEARAAGRRALRLAALGLVTRRDG
FT                   GARAEAAFRAANNMTEEVGALACLLEIGRGQEELGLFETRWAGDRLVMDKWFALQILHT
FT                   APEETAATVERLTAHPAFDWKNPNRFRSVVGALSANHAGFHHASGVGYRLLADWLIRLD
FT                   PLNPQTAARMSTAFETRARYDADRQGMMLAELDRILATPGLSRDLGEMAGRMRHA"
FT   gene            280970..281854
FT                   /locus_tag="RSKD131_0285"
FT   CDS_pept        280970..281854
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0285"
FT                   /product="Phospholipid/glycerol acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00145"
FT                   /db_xref="GOA:B9KMT3"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="UniProtKB/TrEMBL:B9KMT3"
FT                   /protein_id="ACM00145.1"
FT                   /translation="MSLMMQSRIDPLIEERAPWLFSGRPHHEASRRLLCRVLGYDRTVE
FT                   IGDQLKDDPTPEIMRRVAQMIARDVEVSGLENLPRNGPALVVCNHPTGIADGVILHHIL
FT                   APLRPDLFFYANRDILRVLPQMEDLICPVEWRQEKRSLQKTRETMDYTRRAIEAGRLGV
FT                   IFPSGRLAKRTGLKLMERPWMASAAMIARKFDLPVVPVNIRARNSTLFYLFDLIHPTLR
FT                   DITLFHEVLNKHRQPFRLTMGRPIPAERLPSKSEEGIEMLREATLALGGQYSPAVSILQ
FT                   MTSLRGALRYARG"
FT   gene            282084..283187
FT                   /locus_tag="RSKD131_0286"
FT   CDS_pept        282084..283187
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0286"
FT                   /product="Aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00146"
FT                   /db_xref="GOA:B9KMT4"
FT                   /db_xref="InterPro:IPR001917"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:B9KMT4"
FT                   /protein_id="ACM00146.1"
FT                   /translation="MTGPRYTPLVESLPSTVPFVGPETQERARGRPFRARLGANESLFG
FT                   PSPRAVAAMAAAAAEVSLYGDPEIHALRTALATHHGVAPDQVTVGEGIDGLLGNLVRLL
FT                   VDEGAPVVTSEGAYPTFAFHVAGFGGRLHKVPYRGDHEDPEALAAEARKVGARIVYFAN
FT                   PDNPMGSHHPAASVRALIEALPEGTLLALDEAYVELAPEGTAPEIDPEDPRVIRFRTFS
FT                   KAYGMAGLRVGYAIGARDLIRAFDKVRNHFGVGRIAQAGALAALEDRAWLAHVRAEVQA
FT                   ARAEIGRIAEGCGLTPLPSATNFVTIDCGRDGVFARAVLTELVARDIFVRMPFVAPHDR
FT                   CIRVSCGRAEELRAFDEALPLALAAAG"
FT   gene            complement(283202..283639)
FT                   /locus_tag="RSKD131_0287"
FT   CDS_pept        complement(283202..283639)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0287"
FT                   /product="Hypothetical Protein"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00147"
FT                   /db_xref="InterPro:IPR025234"
FT                   /db_xref="UniProtKB/TrEMBL:B9KMT5"
FT                   /protein_id="ACM00147.1"
FT                   /translation="MPRFEYKVVPAPRKGEKVKGAKTATDRFAHALTQMMNDLGRDGWE
FT                   YLRAETLPCEERVGFTGKTTTYQNLLIFRRAVEEAAPAPAREELPADLPAFFRPERAPA
FT                   PSELAATLTPRGGDGRRAPTVQAPEGHAPAVGPARGGLVAE"
FT   gene            complement(283801..285312)
FT                   /locus_tag="RSKD131_0288"
FT   CDS_pept        complement(283801..285312)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0288"
FT                   /product="Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
FT                   subunit B"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00148"
FT                   /db_xref="GOA:B9KMT6"
FT                   /db_xref="InterPro:IPR003789"
FT                   /db_xref="InterPro:IPR004413"
FT                   /db_xref="InterPro:IPR006075"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR017958"
FT                   /db_xref="InterPro:IPR017959"
FT                   /db_xref="InterPro:IPR018027"
FT                   /db_xref="InterPro:IPR023168"
FT                   /db_xref="InterPro:IPR042114"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9KMT6"
FT                   /protein_id="ACM00148.1"
FT                   /translation="MLDLTYEAPKPKVIAGAKHDWELVIGMEIHAQVSSNAKLFSGAST
FT                   TFGAEPNSNVSFVDCAMPGMLPVINEFCVAQAVRTGLGLKAQINLFSAFDRKNYFYPDL
FT                   PQGYQISQLYHPIVGEGEVLVEMAPGIARLVRIERIHLEQDAGKSIHDMDPNLSFVDFN
FT                   RTGVALMEIVSRPDIRGPEEAAAYVAKLRQILRYLGTCDGNMQNGNLRADVNVSVCRPG
FT                   QYEKYQETQDFSHLGTRCEIKNMNSMRFIQQAIDYEARRQIAILEDGGKVVQETRLYDP
FT                   DKGETRSMRSKEEAHDYRYFPDPDLLPLEIEQGWVDEIAASMPELPDAKKARFMADYGV
FT                   TDYDANVLTAELEAAAYFEEVARGRDGKQAANWVINELFGRLNKQGLTIADTPVKAGQL
FT                   GGVLDLIASGEISGKMAKDLFEILWTEGGDPAEVAAARGMKQVTDTGAIETAVDEIIAA
FT                   NPAQVEKAKANPKLAGWFVGQVIKATGGKANPAAVNQIVAEKLGL"
FT   gene            285481..286077
FT                   /locus_tag="RSKD131_0289"
FT   CDS_pept        285481..286077
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0289"
FT                   /product="Lytic transglycosylase, catalytic precursor"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00149"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:B9KMT7"
FT                   /protein_id="ACM00149.1"
FT                   /translation="MKLRMVLIGLLLALPISCGEARPTSDVRNFLPVMRWDHRPEAKIW
FT                   TERTLLAVEQRDDFLTDTVPQDIGTWCPGYPDATPEERRAFWTGILSALAKHESTWNPV
FT                   ASGGGGRWIGLTQIAPQTAQAYGCRAQSAGALKDGALNLSCAVRIAARQVERDGLVAGN
FT                   GTRGLGRDWAPFRSASKRAEMAAWTRAQPYCKVKS"
FT   gene            complement(286081..286425)
FT                   /locus_tag="RSKD131_0290"
FT   CDS_pept        complement(286081..286425)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0290"
FT                   /product="Hypothetical Protein"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00150"
FT                   /db_xref="InterPro:IPR018961"
FT                   /db_xref="UniProtKB/TrEMBL:B9KMT8"
FT                   /protein_id="ACM00150.1"
FT                   /translation="MEVRMGWLDRIAERRMLKARAEGQLSGLSGEGQPLPERPSEAFTS
FT                   PGEAVGFRIMAEAGVLPEEIVLKKQAAEQRARLAGISDPEERRAAMAELARIEMRQAMA
FT                   EEARRRFLRG"
FT   gene            complement(286492..289455)
FT                   /locus_tag="RSKD131_0291"
FT   CDS_pept        complement(286492..289455)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0291"
FT                   /product="Valyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00151"
FT                   /db_xref="GOA:B9KMT9"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002303"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR019499"
FT                   /db_xref="InterPro:IPR033705"
FT                   /db_xref="InterPro:IPR037118"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9KMT9"
FT                   /protein_id="ACM00151.1"
FT                   /translation="MPMDKTFNAAEAEARLYDAWEKAGAFRAGANASRPETFCIMIPPP
FT                   NVTGSLHMGHAFNNTLQDILTRWHRMRGFDTLWQPGQDHAGIATQMVVERELARAGNPG
FT                   RREMGREAFLEKVWEWKEQSGGTIVNQLKRLGASCDWSRNAFTMDPNFQRAVLKVFVDL
FT                   YEKGFIYRGKRLVNWDPHFETAISDLEVEQVEVNGNMWRLRYRLADGATYRHPVAFDEE
FT                   GRPTDWEERDYLTVATTRPETMLGDTGIAVNPSDERYAHLIGKEVVLPLVGRRIPIVAD
FT                   DYADPSKGTGAVKITPAHDFNDWGVGQRTGLRAINVMTGRATMFLIENPDFTEGCAPSE
FT                   EALALDGLDRYEARKRVVALAEEQGWLDGIDQDRHMVPHGDRSKVAIEPMLTDQWFVDT
FT                   AQIIQPAIDAVRTGRTEILPERDAKTYFHWLENIEPWCISRQLWWGHQIPVWYGLDIWP
FT                   ARFEDDGDDTLDEVEIFELLEDGAFNHADPTHHCAFDFEGVSEKFLDDLASLPHPLNNA
FT                   RVIEVASRAEAIDRLAQALADYNLNEDPTHLVYPVWRDPDVLDTWFSSGLWPIGTLGWP
FT                   EETPELARYFPTNVLITGFDIIFFWVARMMMMQLAVVNEVPFKTVYVHALVRDEKGKKM
FT                   SKSLGNVLDPLELIDEFGADAVRFTLTAMAAMGRDLKLSTARIQGYRNFGTKLWNACRF
FT                   AEMNGVWEGHATQAAPPAATATVNRWIIGETGRVREEVDAALAAYRFDSAANALYAFVW
FT                   GKVCDWYVEFSKPLFDTEAAAETRATMGWVLDQCMVLLHPIMPFITEDLWATTGSRTKM
FT                   LVHTDWPSFGAELVDPAADREMSWVISLIEEIRSARAQVHVPAGLKLPVVQLALDAVGR
FT                   EALARNEALILRLARLEGFTEAASAPKGALTIAVEGGSFAIPLEGVIDIGAEKARLAKT
FT                   LEKLEKDMAGLRGRLNNPNFVASAPEEVVDEARTRLEQGEEERAKLSAALARLSEIA"
FT   gene            complement(289574..290005)
FT                   /locus_tag="RSKD131_0292"
FT   CDS_pept        complement(289574..290005)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0292"
FT                   /product="Transcriptional regulator, AsnC family"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00152"
FT                   /db_xref="GOA:B9KMU0"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B9KMU0"
FT                   /protein_id="ACM00152.1"
FT                   /translation="MDELDRNILGILGADARTSVATLSRRLKVARSTIQARLERLETSG
FT                   VIAGYTLKLGEQARQGRLRASVLLTIEPRTQAAILTRLKAISEVERVFTTSGRFDLLLQ
FT                   IAAPSTQVLDQVLDEVGAMTGVRSSESLIHLSTRIDRAV"
FT   gene            290225..291370
FT                   /locus_tag="RSKD131_0293"
FT   CDS_pept        290225..291370
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0293"
FT                   /product="Orn/DAP/Arg decarboxylase 2"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00153"
FT                   /db_xref="GOA:B9KMU1"
FT                   /db_xref="InterPro:IPR000183"
FT                   /db_xref="InterPro:IPR002433"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR022643"
FT                   /db_xref="InterPro:IPR022644"
FT                   /db_xref="InterPro:IPR022653"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:B9KMU1"
FT                   /protein_id="ACM00153.1"
FT                   /translation="MGLSKTIWTNPAEYLRALSPEAPVLFFSPSTLQATARRFIDGFPG
FT                   MVTYAVKSNPEEVVIENLAAAGIRGYDVASPHEIRMIRRIAPDAALHYNNPVRSRSEIG
FT                   VGVEMGVKSWSVDSASELAKLIELVPAEGCEIAVRFKLPVSGAAYNFGAKFGATVELAV
FT                   ELLRRVAEAGFIPSMTFHPGTQCTDPAAWETYIRTAAEIARDAGVTIARLNVGGGFPSH
FT                   RLNGVEPELEAIFHLIDRVTDEAFGADRPLLVCEPGRGICADAFTLAARIKAVRDDAHV
FT                   FLNDGVYGSLTELPLIGVIDRVAVLTPEGRRRDGETRDRIIFGPTCDSVDRLPGELPLA
FT                   ADVEEGDFLVFQGMGAYSAATNTRFNGFGELSMATVLSLKL"
FT   gene            291527..292630
FT                   /locus_tag="RSKD131_0294"
FT   CDS_pept        291527..292630
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0294"
FT                   /product="Hypothetical Protein"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00154"
FT                   /db_xref="InterPro:IPR018712"
FT                   /db_xref="UniProtKB/TrEMBL:B9KMU2"
FT                   /protein_id="ACM00154.1"
FT                   /translation="MSLIKSLRHWLRPHPTVATEPATPPARGAHRGRVDHVILFDGTCS
FT                   SLEAGHETNVGLIFKLLREERRSVQRTIYYEPGLQWGGWLRIGDLVQGKGLNRQIRRAY
FT                   GYLASHYQPGDRIFLFGYSRGAYAARSLAGVIDRVGLLRREEATERNVRLAWRHYEQGS
FT                   IRPHARAFSRRHCHARVEIEMVGIFDTVKALGLRLPLLWRLSEDRHAFHSHKLGRTVRH
FT                   GFHALALDETRTVFEPVLWDYPYHGQIVEQAWFRGGHGDIGGQLAGGRHGSRLLSNIPL
FT                   VWMLERATHCGLQLPEGWRARHPCDVTAPMTSMYAGWGKIFLSRQRRPTLRCPTEYIHP
FT                   TALRPEPRRRKWRLRWGGAPEGEPTQG"
FT   gene            complement(292659..293135)
FT                   /locus_tag="RSKD131_0295"
FT   CDS_pept        complement(292659..293135)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0295"
FT                   /product="Hypothetical Protein"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00155"
FT                   /db_xref="InterPro:IPR003736"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:B9KMU3"
FT                   /protein_id="ACM00155.1"
FT                   /translation="MSLFAERPEDFPAAATVAGLSGMDYMQAMLEGRVPEPTIGRIMGY
FT                   RLVSVEPGRVVWRGVPAFAHTNAFGGVHGGWYGTILDSAMGCAVMTGVPKGRRWTTLEF
FT                   KVNITRALPVGRDILAVGISDHAGRTTAVAHGEIRDAEDDRLYATGSTTCLLLG"
FT   gene            complement(293470..294756)
FT                   /locus_tag="RSKD131_0296"
FT   CDS_pept        complement(293470..294756)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0296"
FT                   /product="Citrate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00156"
FT                   /db_xref="GOA:B9KMU4"
FT                   /db_xref="InterPro:IPR002020"
FT                   /db_xref="InterPro:IPR010953"
FT                   /db_xref="InterPro:IPR016142"
FT                   /db_xref="InterPro:IPR016143"
FT                   /db_xref="InterPro:IPR019810"
FT                   /db_xref="InterPro:IPR024176"
FT                   /db_xref="InterPro:IPR036969"
FT                   /db_xref="UniProtKB/TrEMBL:B9KMU4"
FT                   /protein_id="ACM00156.1"
FT                   /translation="MTKSAKLTIGEKVIDLPIHSPTLGPDVVDIRKLYAEADVFTYDPG
FT                   FTSTAACESTITYIDGDKGELFYRGYPIEQLADRSHYLEVCYLLLYGELPNAAQQADFE
FT                   YRITRHTMLHEQIHYFFRGFRRDSHPMATMVGVVGAMSAFYHDSLDINDPWQREVAAIR
FT                   MIAKLPTIAAMAYKYSIGQPFNYPQNHLDYAGNFLHMCFAVPAEPYTVNPVLAKAMDRI
FT                   MMLHADHEQNASTSTVRLAGSSGANPFACIAAGIACLWGPAHGGANQACLEMLREIGTV
FT                   DRIPEYIRRAKDKDDPFRLMGFGHRVYKNFDPRAKVMKESADEVLGLLGIENNPTLQVA
FT                   KELERIALEDDYFVSKKLYPNVDFYSGIILDAMGFPTSMFTPIFAISRTVGWISQWKEM
FT                   IGDPTQKIGRPRQLYKGETRRDYVDLRHR"
FT   gene            complement(294863..296278)
FT                   /locus_tag="RSKD131_0297"
FT   CDS_pept        complement(294863..296278)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0297"
FT                   /product="Glutamyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00157"
FT                   /db_xref="GOA:B9KMU5"
FT                   /db_xref="InterPro:IPR000924"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR004527"
FT                   /db_xref="InterPro:IPR008925"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020058"
FT                   /db_xref="InterPro:IPR020751"
FT                   /db_xref="InterPro:IPR033910"
FT                   /db_xref="UniProtKB/TrEMBL:B9KMU5"
FT                   /protein_id="ACM00157.1"
FT                   /translation="MPAASDKPVVTRFAPSPTGYLHIGGGRTALFNWLYARGRKGTFLL
FT                   RIEDTDRERSTPEATDAILRGLTWLGLDWDGEVVSQFARKDRHAEVAREMLERGAAYKC
FT                   FSTQEEIEAFREAARAEGRSTLFRSPWRDADPTSHPDAPFVIRMKAPRSGETVIEDEVQ
FT                   GTVRFQNETLDDMVVLRSDGTPTYMLAVVVDDHDMGVTHVIRGDDHLNNAARQTMVYEA
FT                   MGWEVPVWAHIPLIHGPDGKKLSKRHGALGVEEYQAMGYPATGMRNYLARLGWSHGDDE
FT                   FFTSEQAMDWFDLGGIGRSPARLDFKKLESVCGQHIAVMEDAELMREIAAYLAAARKPA
FT                   LTDLQAARLEKGLYALKDRAKTFPELLEKARFALESRPIVADDAAAKALDPVSRGILRE
FT                   LTPMLQAASWSKQDLEAILTAFASEKGMGFGKLAAPLRTALAGRTVTPSVYDMMLVIGR
FT                   DETIARLEDAAAA"
FT   gene            296412..298466
FT                   /locus_tag="RSKD131_0298"
FT   CDS_pept        296412..298466
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0298"
FT                   /product="ComEC/Rec2-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00158"
FT                   /db_xref="GOA:B9KMU6"
FT                   /db_xref="InterPro:IPR004477"
FT                   /db_xref="InterPro:IPR025405"
FT                   /db_xref="UniProtKB/TrEMBL:B9KMU6"
FT                   /protein_id="ACM00158.1"
FT                   /translation="MAAFALRALWRPFEVLAAARGFLFPFVPVFLGAGIGLWFAPLSEP
FT                   GWPAYGAALSALALWALVRWRGPELLQPPVAALACLGAGFLAAGLRAALVAAPILGFHY
FT                   YGAIEGRVAAIDRSQSDALRLTLDRILLERTDPRRTPERVRITIHGEQPMEPAPGMTVA
FT                   LTGHLDPPLPPAEPGGFDFRRMAYFDRLGAVGFTRTPVVLLESAHAGDSPVNRLRTAIR
FT                   EGVQARFPGEAGAFTAAVLTGDEAGISAATMEDLRRSGLAHILAISGLNMSLLAGFVFG
FT                   LVRHGLALVPPLALRLPTKKIAAVAAFLGTGFYLLMSGGNVPALRSFVMIAVMLAAVLA
FT                   DRRALSMRSFALSAIIILLWQPETLLEAGFQMSFAATAALIWGFNALRERVHPKSLSRW
FT                   VAPFFMLVVASLIGGLSTGPFAAAHFNRIAVYGLLGNLMAVPVMELLVMPAAAVAALLA
FT                   PLGAAGPPLWVMEQGARWILWVAHWVAALPGAVRAVVSPGPWVLPLLALGALWLMLWRG
FT                   RARLAGLGGMATAFLLWSAAERPPLFVAADGALVGLMGPEGRALSDARGGGFAARSWLE
FT                   NDGDLADQAAAAARPGFEGPREARRFQLNGLPGVVLKGKGAADHLPEACASARLVILAA
FT                   PYEGPAPGACLLIDRTSLARTGALAIGEEAGDLRLQPARIGHRLWRGRP"
FT   gene            complement(298521..299189)
FT                   /locus_tag="RSKD131_0299"
FT   CDS_pept        complement(298521..299189)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0299"
FT                   /product="LexA repressor"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00159"
FT                   /db_xref="GOA:B9KMU7"
FT                   /db_xref="InterPro:IPR006197"
FT                   /db_xref="InterPro:IPR006199"
FT                   /db_xref="InterPro:IPR006200"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR039418"
FT                   /db_xref="UniProtKB/TrEMBL:B9KMU7"
FT                   /protein_id="ACM00159.1"
FT                   /translation="MELLDFIKTRMDRDGVPPSFDEMKDALDLRSKSGIHRLITALEER
FT                   GFIRRLAHRARAIEIVKLPEAMERAGFSARAAKAAAAPLPKGAVTVETAGALDLPLMGR
FT                   IAAGLPIEAINGGPQSVTVPGMMLSGRGQHYALEVKGDSMIAAGINDGDIVVIREQQTA
FT                   DNGDIVVALVADHEATLKRYRRRGGMIALEPANDSYETQVYPEQLVKVQGRLVGLIRSY
FT                   "
FT   gene            complement(299264..300448)
FT                   /locus_tag="RSKD131_0300"
FT   CDS_pept        complement(299264..300448)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0300"
FT                   /product="Molybdenum cofactor biosynthesis protein A"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00160"
FT                   /db_xref="GOA:B9KMU8"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR005110"
FT                   /db_xref="InterPro:IPR005111"
FT                   /db_xref="InterPro:IPR036135"
FT                   /db_xref="InterPro:IPR036425"
FT                   /db_xref="InterPro:IPR036688"
FT                   /db_xref="InterPro:IPR038987"
FT                   /db_xref="UniProtKB/TrEMBL:B9KMU8"
FT                   /protein_id="ACM00160.1"
FT                   /translation="MISVEEALARALALAAPLPVERVALGEARGRVMPSPALATRDQPP
FT                   FDASAMDGYALIGDPPAGATFPVLGEAAAGHGYEGALRPGEAVRIFTGAPVPEGATRVV
FT                   LQEDVTAEGGTIRLDAAATGGTHIRPRGQDFRTGDSLSPRRLRPNDLALLAAMNIPEVT
FT                   VTRRPSVALIATGDELVMPGEVPRPDQIVASNSFALKALVEAEGAEARLLPIARDTEDE
FT                   LRTVLDLASDADLIVTIGGASVGDHDLVGKVAAGMGLERAFYKIAMRPGKPLMAGRLRG
FT                   VPMLGLPGNPVSSIVCAHLFLLPMLRAMLGLPPAPAPLLRAELAVALPANPTRAHYMRA
FT                   RLTRQDGLPRIEPFSSQDSAILRLLAEADALLVRPVDDGPRAVGDLVDYISLNS"
FT   gene            complement(300445..300924)
FT                   /locus_tag="RSKD131_0301"
FT   CDS_pept        complement(300445..300924)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0301"
FT                   /product="Molybdenum cofactor biosynthesis protein C"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00161"
FT                   /db_xref="GOA:B9KMU9"
FT                   /db_xref="InterPro:IPR002820"
FT                   /db_xref="InterPro:IPR023045"
FT                   /db_xref="InterPro:IPR036522"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9KMU9"
FT                   /protein_id="ACM00161.1"
FT                   /translation="MSGLTHFDESGRAHMVDVSEKPVTARVAVARGAVKMSAETLALVT
FT                   EGRAEKGDVLGVARLAGIMGAKRTADLIPLCHPLPITKVALELTADPALPGVVVEATVK
FT                   TGGQTGVEMEALTAVSVACLTIYDMVKAVEKGMEITGIRLLLKEGGKSGRFEASA"
FT   gene            complement(300924..301736)
FT                   /locus_tag="RSKD131_0302"
FT   CDS_pept        complement(300924..301736)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0302"
FT                   /product="Indole-3-glycerol phosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00162"
FT                   /db_xref="GOA:B9KMV0"
FT                   /db_xref="InterPro:IPR001468"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR013798"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9KMV0"
FT                   /protein_id="ACM00162.1"
FT                   /translation="MSTILDRIKAYKLEEIAARKAERPLVAVEDAARAAPAPRGFARAL
FT                   STAAATGYGLIAEIKKASPSKGLIREDFDVPALARAYEAGGATCLSVLTDGPSFQGADD
FT                   FLRQAREAVKLPCLRKDFLYDTYQVAEARALGADCILIIMASVTDSQALELEAAASHWG
FT                   MDVLVEVHSRDELARAEHLKSRLIGINNRNLDTFEVSLDVTRDLARRVPEDRLIVSESG
FT                   LYTPEDLADLARYGARCFLIGESLMRQADVEAATRAILADPLTSQGGV"
FT   gene            complement(301767..302783)
FT                   /locus_tag="RSKD131_0303"
FT   CDS_pept        complement(301767..302783)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0303"
FT                   /product="Anthranilate phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00163"
FT                   /db_xref="GOA:B9KMV1"
FT                   /db_xref="InterPro:IPR000312"
FT                   /db_xref="InterPro:IPR005940"
FT                   /db_xref="InterPro:IPR017459"
FT                   /db_xref="InterPro:IPR035902"
FT                   /db_xref="InterPro:IPR036320"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9KMV1"
FT                   /protein_id="ACM00163.1"
FT                   /translation="MSDRLKPLIGTAATRPLSREEAEFAFECLFEGEATPAQMGGLLMA
FT                   LRTRGETVDEYAAAASVMRAKCHKVRAPHGAIDIVGTGGDGKGTLNISTATAFVVAGAG
FT                   VPVAKHGNRNLSSKSGAADALTEMGLNVMIGPEQVEACLLEAGIGFMMAPMHHPAMRHV
FT                   GPVRAELGTRTIFNILGPLTNPAGVKRQLTGAFSPDLIRPMAEVLSALGSEKAWLVHGG
FT                   DGTDELAISAASKVAALEGGQIREFELHPEEAGLPVHPFEEIVGGTPAENAQAFHALLD
FT                   GAPGAYRDAVLLNAAAALVVADRAADLREGVEIATDSILSGAAKAKVALLARLTNAA"
FT   gene            complement(302780..303367)
FT                   /locus_tag="RSKD131_0304"
FT   CDS_pept        complement(302780..303367)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0304"
FT                   /product="Anthranilate synthase, component II"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00164"
FT                   /db_xref="GOA:B9KMV2"
FT                   /db_xref="InterPro:IPR006221"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:B9KMV2"
FT                   /protein_id="ACM00164.1"
FT                   /translation="MLLLIDNYDSFTYNLVHYLGELGAEVVVRRNDALDVQAAMGMHPD
FT                   AIVLSPGPCDPAAAGICLPLTAAAAEARIPLLGVCLGHQTIGQAFGGKVVRCHEIVHGK
FT                   MGAMHHEGKGVFAGLPSPFLATRYHSLVVERDSLPDCLEVTAWLEDGTIMGLRHKSLPI
FT                   EGVQFHPESIASEHGHQMLRTFLDSARAAVTA"
FT   gene            303546..304979
FT                   /locus_tag="RSKD131_0305"
FT   CDS_pept        303546..304979
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0305"
FT                   /product="YibQ protein"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00165"
FT                   /db_xref="GOA:B9KMV3"
FT                   /db_xref="InterPro:IPR006837"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:B9KMV3"
FT                   /protein_id="ACM00165.1"
FT                   /translation="MSRGFLSGVVMGGIVGGIGLALASQMAPPPGTTWPEAQADEALAG
FT                   TAPDEASRPQVAAEGARKSDTADPDASPAESVSAGARAAQTPGAATDLAPPPGSEFARP
FT                   LPDAVPVVPSADRAPDRTDVSVVAAPEVPDGGAPDTETAARPQPLPLVPAAPVAPTAEA
FT                   AAPAVPGLTAATPARSEGAARPGAPAAEADPSAADLPPPPPLTPEEEAMLAEAAGQPAP
FT                   AEPRRIEPDPPRAPSEASRLPRIGDPAPAAEEEEPPLRRYAQPFENPGRKPLFSILLQD
FT                   TGGPLLDREALAALPFPVTFVIDPQAPDAATAAGIYRAAGHEVLMLASGLPEGARPADA
FT                   EVTLESAAAALPEAVGLIDLPAGGFQEARPLSTQVVEILAAQGRGLVTHDHGLNAADQV
FT                   ARREGLPAAVVFRRLDEGEADAASVRRALDRAAFKAAQDGRAMVLGDTRPETLKGLMEW
FT                   SLEGRADGVALAPATALLR"
FT   gene            complement(305143..306654)
FT                   /locus_tag="RSKD131_0306"
FT   CDS_pept        complement(305143..306654)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0306"
FT                   /product="Anthranilate synthase component 1"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00166"
FT                   /db_xref="GOA:B9KMV4"
FT                   /db_xref="InterPro:IPR005256"
FT                   /db_xref="InterPro:IPR005801"
FT                   /db_xref="InterPro:IPR006805"
FT                   /db_xref="InterPro:IPR015890"
FT                   /db_xref="InterPro:IPR019999"
FT                   /db_xref="UniProtKB/TrEMBL:B9KMV4"
FT                   /protein_id="ACM00166.1"
FT                   /translation="MSLVTSFESFERGWKAGQNQIVYARLTADLDTPVSLMLKLAEART
FT                   DTFMLESVTGGEIRGRYSVVGMKPDLIWQCHGQDSRINREARFDRQAFQSLEGHPLETL
FT                   RALIAESRIEMPADLPPIAAGLFGYLGYDMIRLVEHLPGINPDPLGLPDAVLMRPSVVA
FT                   VLDGVKGEVTVVAPAWVSSGLSARAAYAQAAERVMDALRDLDRAPPVQRDFGEVAQVGE
FT                   MRSNFTHEGYKAAVEKAKDYIRAGDIFQVVPSQRWAQDFRLPPFALYRSLRKTNPSPFM
FT                   FFFNFGGFQVVGASPEILVRLRDREVTVRPIAGTRKRGATPEEDRALEADLLSDKKELA
FT                   EHLMLLDLGRNDVGRVARIGTVRPTEKFIIERYSHVMHIVSNVVGEIAEGEDALSALLA
FT                   GLPAGTVSGAPKVRAMEIIDELEPEKRGVYGGGVGYFAANGEMDFCIALRTAVLKEETL
FT                   YIQSGGGVVYDSDPEAEYQETVNKARALRRAAEDAGLFARRAGNG"
FT   gene            complement(306665..308530)
FT                   /locus_tag="RSKD131_0307"
FT   CDS_pept        complement(306665..308530)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0307"
FT                   /product="YbaU"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00167"
FT                   /db_xref="GOA:B9KMV5"
FT                   /db_xref="InterPro:IPR000297"
FT                   /db_xref="InterPro:IPR027304"
FT                   /db_xref="UniProtKB/TrEMBL:B9KMV5"
FT                   /protein_id="ACM00167.1"
FT                   /translation="MSKLTSIEHHKPKKKGTQLVFWGLVGLMAVGLGGFGVTNFGGGLS
FT                   TVGSVGDRDITTGAYARALQQEMRALGAQINQPVTMEMAKAFGLDQQVRRRLVTEAALS
FT                   NEADRIGLSVGDARVAREITGTDAFHGPSGQFDRETYRLVLRQNNLSEGEFETGLREDM
FT                   ARSLLQGAVGGGFIAPAQMVDALHAYIAERRSFGLLRVTEANLAKPLAAPTDAELQAWY
FT                   EAHPADFTAPETKRITYAALLPQDVAATLPTDEAALRRLYDERHAEFVQPERRLVERLV
FT                   FPTAEAAAEARKRLDAGTPFETLVSERGLELADIDLGDASRDALGGAADAVFALTEPGI
FT                   AGPVETDLGPALFRVNGVIAAHETSFEEVRDDLLTEYQQEAAGRAIAGRREQIDDLLAA
FT                   GATLEDLAGEAGMKIATVDYAPGLDSDISGYEAFRTAADKLQKDDFPETILLNDGGLLA
FT                   MRLDEVVAPKLKPFEEVRDDVAEAAHKDALTKALAARATEIAKAAEEGTDLGSFGPVED
FT                   LGPMTRDGFVEGVPETLVPAAFEMQQGAFRAIEGADFAGVLRLDAVEPAAADDEAAKAL
FT                   KASLSAQIEQALSQDALALFSSSLMQEAGITLNDAAISAVQAQFQ"
FT   gene            308722..310710
FT                   /locus_tag="RSKD131_0308"
FT   CDS_pept        308722..310710
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0308"
FT                   /product="AsmA family protein precursor"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00168"
FT                   /db_xref="InterPro:IPR007844"
FT                   /db_xref="InterPro:IPR032712"
FT                   /db_xref="UniProtKB/TrEMBL:B9KMV6"
FT                   /protein_id="ACM00168.1"
FT                   /translation="MSMRWLVRLAAVLFGLAALFLVALVLMPRERVAELAAREFEAATG
FT                   RALTISGDVRPSIWPRLGVRTGPVTVANAPWTDEGPMLEARSLEIGLDTLALMSGAWRI
FT                   SRIALEEPVIRLERDAEGRANWDLSPPPRGTEAAAAEGQAGPAPASAQAGFPLFSLDEG
FT                   LVTGGRVLWIDRAAGLRTEISGLDMRVSLPEAGGPADLTLSGQANGHGFAVEGRLAEAG
FT                   TSLAGRVAPVRLSLVTGAARIGFDGEAGSAPPMAEGTIDAALGDLGDLAALFGQDRPTL
FT                   PEGLGRRQIALTGGLTLAEGGTLHLRNGQVTADGNRLAVEADLIPQGERPKLEANLRAE
FT                   TLNLASLSAGGGGTGGGGGAGKGWSRQPIDVSALSALDLGLALSAGSVDFGRLKLGATK
FT                   AILTLDRARLVADLREVAAYGGTLSGELIVNGRQGLSVGADLTLTGLQTEPFLGDLADF
FT                   DRLATQGDLRLKLLASGPHEEALMQSLSGTGSVRFGKGELRGLDIARMVRTLDAGSVGQ
FT                   GTRTIFDRMGASFTLEKGVLRNEDLTLEAPLMRATGKGQVGIGARTLDYRLLPTLLPQA
FT                   DGTGGVSVPLLVSGPWASPRYRLDLDALVRQPVGQKVKERLEEEAAERLGVVPEEGESL
FT                   EEAAKRRAREAVQGEAGRALNRLFGGN"
FT   gene            complement(310893..311516)
FT                   /locus_tag="RSKD131_0309"
FT   CDS_pept        complement(310893..311516)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0309"
FT                   /product="GcrA cell cycle regulator"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00169"
FT                   /db_xref="InterPro:IPR011681"
FT                   /db_xref="UniProtKB/TrEMBL:B9KMV7"
FT                   /protein_id="ACM00169.1"
FT                   /translation="MSWTDERVETLKRMWAEGQSASQIAKELGGVTRNAVIGKVHRLGL
FT                   SNRVGGNGSREEAEEEAAPAVGAAPASPPPAPPRPEPARPAEPPRAAEPRPAPERPAPA
FT                   PAAPAAPVPIRKPVVAAGQPLPPQPSANEISPEALASVREVEKRARRLTLMELTERTCK
FT                   WPIGDPATDDFWFCGLPSSAGKPYCEAHVGVAFQPMSARRDRRR"
FT   gene            311550..311990
FT                   /locus_tag="RSKD131_0310"
FT   CDS_pept        311550..311990
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0310"
FT                   /product="Hypothetical Protein"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00170"
FT                   /db_xref="UniProtKB/TrEMBL:B9KMV8"
FT                   /protein_id="ACM00170.1"
FT                   /translation="MPGFRRSPPSGRKGEIYTRPARVSSRSGAAAPPARPGGPRPEASG
FT                   RPAFAGDVAPTPRGHAGAGCRANERPKTSHPPTLRERQGCRRVPRRRANGETAHCRPSP
FT                   PGLSCRERGRPSEKQWTVRPHGATTHRMTCRTRALSDRRRRF"
FT   gene            312102..313283
FT                   /locus_tag="RSKD131_0311"
FT   CDS_pept        312102..313283
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0311"
FT                   /product="Acetylornithine aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00171"
FT                   /db_xref="GOA:B9KMV9"
FT                   /db_xref="InterPro:IPR004636"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:B9KMV9"
FT                   /protein_id="ACM00171.1"
FT                   /translation="MISAVLPTYNRAPLAFVAGEGSWLTAEDGSRYLDLGAGIAVNALG
FT                   HANPALVEVISAQAAKLWHVSNLYRIPEQERLAEKLVEATFADTVFFTNSGTEAAELSI
FT                   KMVRKYWSEKGQPDRIEILCFEGAFHGRSTGAIAAAGSEKMTKGYGPLMPGFRQLPFGD
FT                   HEALRAAISEKTAAVMLEPVQGEGGIRVLPDVCLKGLRDACDAVGALLVFDEVQCGMGR
FT                   TGRLFAHEWAGIEPDIMMVAKGIGGGFPLGAVLAKEAAAAAMTAGTHGSTYGGNPLGCA
FT                   VGAKVMEIVADPAFLAEVNRKAALFRQKLEGLVAAHPQVFEEVRGAGLMLGLKCRAPNA
FT                   DLVKAAYGQHLLTVPAADNVVRLLPALNIPDEDIAEAVARLDRAAGTLDAHAA"
FT   gene            313397..314323
FT                   /locus_tag="RSKD131_0312"
FT   CDS_pept        313397..314323
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0312"
FT                   /product="Ornithine carbamoyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00172"
FT                   /db_xref="GOA:B9KMW0"
FT                   /db_xref="InterPro:IPR002292"
FT                   /db_xref="InterPro:IPR006130"
FT                   /db_xref="InterPro:IPR006131"
FT                   /db_xref="InterPro:IPR006132"
FT                   /db_xref="InterPro:IPR024904"
FT                   /db_xref="InterPro:IPR036901"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9KMW0"
FT                   /protein_id="ACM00172.1"
FT                   /translation="MNHFLDIHKTDTAELRQMMDSAHAMKAARKGRPKGQFDEDQPLAG
FT                   RMVALIFEKPSTRTRVSFDVGVRQMGGQTMVLSGKEMQLGHGETIADTARVLSRYVDLI
FT                   MIRTFEEATLLEMAEHATVPVINGLTNRTHPCQIMADVMTYEEHRGPIAGRKVVWAGDG
FT                   NNVCASFLHAAGQFGFDFTFTGPPTLDPEAEFVGYAREKGRRVSIERDPAKAVAGADLV
FT                   VTDTWVSMHDPQSARERRHNQLRPYQVNEALMAQAKPDALFMHCLPAHRDDEATSAVMD
FT                   GPHSVIFDEAENRLHAQKAIMRWCLGL"
FT   gene            complement(314547..314795)
FT                   /locus_tag="RSKD131_0313"
FT   CDS_pept        complement(314547..314795)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0313"
FT                   /product="Hypothetical Protein"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00173"
FT                   /db_xref="UniProtKB/TrEMBL:B9KMW1"
FT                   /protein_id="ACM00173.1"
FT                   /translation="MFREDHANPFEEVDMIELAFVACLSAAPAACEKRSLYYADDLSPT
FT                   ACVLRAQPELAKWIFDHPRYHVASWSCRFRAASEQDA"
FT   gene            complement(314931..315425)
FT                   /locus_tag="RSKD131_0314"
FT   CDS_pept        complement(314931..315425)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0314"
FT                   /product="Transcription elongation factor"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00174"
FT                   /db_xref="GOA:B9KMW2"
FT                   /db_xref="InterPro:IPR001437"
FT                   /db_xref="InterPro:IPR023459"
FT                   /db_xref="InterPro:IPR036953"
FT                   /db_xref="UniProtKB/TrEMBL:B9KMW2"
FT                   /protein_id="ACM00174.1"
FT                   /translation="MSRAFVKEDGPDNTPLPDLPISPHPNLVTPRGLADLQARLLATQA
FT                   RLRALRAREDRLDRLPEAAAERDIRYLEARIASAILVDPAAQPLDEVAFGLAVTVEDEA
FT                   GRRTVWEITGEDEAQATARRIAPQAPLARALMGARLGEKVVWTRPAGEVTLTVTGIAHP
FT                   E"
FT   gene            complement(315451..315927)
FT                   /locus_tag="RSKD131_0315"
FT   CDS_pept        complement(315451..315927)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0315"
FT                   /product="NUDIX hydrolase, MutT"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00175"
FT                   /db_xref="GOA:B9KMW3"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="UniProtKB/TrEMBL:B9KMW3"
FT                   /protein_id="ACM00175.1"
FT                   /translation="MDKARGACEGRDMRSPRLAVRALILHENRLLLVNAWPGGVSDLWC
FT                   APGGGVEPGASLPDNLVREVAEETGLTVAVDDPCLVNEFHDPGTGFHQVDVYFRCRILA
FT                   GSLSAEWRDPAGIVTDRRFFAQAELARIRHKPDSLAGAAWGGGLLYDPLEVIVR"
FT   gene            complement(316405..318831)
FT                   /locus_tag="RSKD131_0316"
FT   CDS_pept        complement(316405..318831)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0316"
FT                   /product="ATP-dependent helicase HrpB"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00176"
FT                   /db_xref="GOA:B9KMW4"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR007502"
FT                   /db_xref="InterPro:IPR010225"
FT                   /db_xref="InterPro:IPR013689"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B9KMW4"
FT                   /protein_id="ACM00176.1"
FT                   /translation="MTETLPIDAALPGLIAALRAQRMAVLQAPPGAGKTTRVPLAILKA
FT                   GLTAGRIVMLEPRRLAARAAAERMAATLGEPVGRTVGYRIRGEARVSRETRIEVVTEGI
FT                   LTRTLQDDPELTGIGALLFDEFHERSLNADLGLALALEVRGALREDLLLLVMSATLDAG
FT                   PVAALMGGAPVVTSEGRAFPVETRWLSRPLPGGARLEPEVAALVRQAVAETEGDLLVFL
FT                   PGEGEIRRVEGLLGGLGCEVAPLFGALDLAAQRRALEEGPGRRIVLATSIAETSLTIPG
FT                   VRVVVDAGRARRARFDPSSGMSRLVTERVTRAEADQRRGRAGRVAEGICYRMWTRGEEG
FT                   ALAAFPPAEIEAADLTALALELAVWGSADLPFLTPPHPGVLAEARGLLEGLGALEDGRV
FT                   TAHGQALARLPLHPRLGHMLTVAGPSAAPLAALMSDRDPVRGPPDLALRLAALADPKRF
FT                   SDEHPHEVNRAALARIREEARRLARAVTTPEAGLSVGQMAALAYPDRVGLRRKGEAPRW
FT                   VLSGGKGAAMEPGQPLAGVRLIVATDLDGDAREAKVRQAAPIPESDLRALFAPQIRWRD
FT                   VCHWSRREGRVVARRQECFGALVLDDRTWPEVPPEALALAAVEGLRQIGLPWSASARRL
FT                   RARVELLRAEGAPMPDMSDAALLEDPDWLLPFLGGRRTEAELRALDLTEALRARLGWEG
FT                   MQLLDRLAPPQFETPLGRRVPIDYEGEAPGIEIRLQELFGVTEHPTVGPKRLPLRITLL
FT                   SPGQRPVQVTMDLPGFWASSYADVRRDMRGRYPRHPWPEDPTVAEPTLRAKPRGT"
FT   gene            complement(318877..319590)
FT                   /locus_tag="RSKD131_0317"
FT   CDS_pept        complement(318877..319590)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0317"
FT                   /product="Hypothetical Protein"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00177"
FT                   /db_xref="InterPro:IPR021457"
FT                   /db_xref="UniProtKB/TrEMBL:B9KMW5"
FT                   /protein_id="ACM00177.1"
FT                   /translation="MRIGFGIAALMLLLAGPAAAQSDEAVFDLVLRGVRAGTLSFAGSE
FT                   QDGRYAVNGRLQSGGLVSLLRTVRYDARASGRIVRGTPQASAYSEKADTGRRQSEVQLA
FT                   WRNGRPVVERYEPARKPRSYDVDPAAQRGTVDPLTALYAALRDVDPGQECRTSLEIFDG
FT                   RRRTQLVLGAPQAAEGGVACAGEFRRIAGYSEEDMAEKSRFPFTLRYEPTAEGRMRVVQ
FT                   VATDTIYGRATLRRR"
FT   gene            319697..320698
FT                   /locus_tag="RSKD131_0318"
FT   CDS_pept        319697..320698
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0318"
FT                   /product="LAO/AO transport system ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00178"
FT                   /db_xref="GOA:B9KMW6"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005129"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B9KMW6"
FT                   /protein_id="ACM00178.1"
FT                   /translation="MRQTLMPERPMDLTDLASRLASGDRRALARAITLVESRRADHREA
FT                   ALALLADLARSGREALRIGLSGTPGVGKSTFIESFGLRLTGQGLKVAVLAVDPSSARSG
FT                   GSILGDKTRMERLSRDPQAFIRPSPSQTHLGGVARRTREAVALCEAAGFDVILIETVGV
FT                   GQSETVVAQLCDLFLLLLAPAGGDELQGVKRGIMEMADLILVNKADGDLKPAALRTVAD
FT                   YAGALRLLRRRPQDPEGFPKAMPVSALEEQGLADAWTEMQALVAWRRETGHFARRRAEQ
FT                   ARHWFEEEVREGLLAVLTRPGPARERMARLGAAVTRGEITPEAAAAELLTTL"
FT   gene            320947..321201
FT                   /locus_tag="RSKD131_0319"
FT   CDS_pept        320947..321201
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0319"
FT                   /product="50S ribosomal protein L28"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00179"
FT                   /db_xref="GOA:B9KMW7"
FT                   /db_xref="InterPro:IPR001383"
FT                   /db_xref="InterPro:IPR026569"
FT                   /db_xref="InterPro:IPR034704"
FT                   /db_xref="InterPro:IPR037147"
FT                   /db_xref="UniProtKB/TrEMBL:B9KMW7"
FT                   /protein_id="ACM00179.1"
FT                   /translation="MTGNTVSHANNKSRRRFLPNLNDVTLISDVLGQSFKLRISAAALR
FT                   TVDHRGGLDAFLAKAKDDELSVKARAIKKEIEKAQATAA"
FT   gene            321377..321736
FT                   /locus_tag="RSKD131_0320"
FT   CDS_pept        321377..321736
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0320"
FT                   /product="Hypothetical Protein"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00180"
FT                   /db_xref="UniProtKB/TrEMBL:B9KMW8"
FT                   /protein_id="ACM00180.1"
FT                   /translation="MIGAMMRSLLACLLSLCLAAASLTVAEARGRAAGAQQVVICTGYG
FT                   VTAVALDAQGRPVGPLHPCPDCLGGLTLLALPQAPALPALSLGRGEALAVPPPIRATAA
FT                   ASPVPCARDPPVSSA"
FT   gene            321766..322248
FT                   /locus_tag="RSKD131_0321"
FT   CDS_pept        321766..322248
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0321"
FT                   /product="Hypothetical Protein"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00181"
FT                   /db_xref="InterPro:IPR007410"
FT                   /db_xref="InterPro:IPR036182"
FT                   /db_xref="UniProtKB/TrEMBL:B9KMW9"
FT                   /protein_id="ACM00181.1"
FT                   /translation="MTPFQAILAAAAVTFALPAFADSELAVTDAYARVASPAAQSGAIF
FT                   MVIENHGASDDRLVSAATDAAARVELHTHLAGQDGVMQMVEVKEGFPVPAHGSHALARG
FT                   GDHVMLMGLTKPLKEGDEIALTLTFESGKVLEVAAPVDTSREAPMGDHMKGMTHGN"
FT   gene            complement(322288..322599)
FT                   /locus_tag="RSKD131_0322"
FT   CDS_pept        complement(322288..322599)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0322"
FT                   /product="Hypothetical Protein"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00182"
FT                   /db_xref="UniProtKB/TrEMBL:B9KMX0"
FT                   /protein_id="ACM00182.1"
FT                   /translation="MKKPALAAAAFAALVLPTIASAGGPIERACLRSDRQAANVATCNC
FT                   IQQVADMTLPSGDQRRAAKFFANPDEAQDVRFSSRSSDTAFWKRYKSFGEAAQAYCGG"
FT   gene            complement(322807..323259)
FT                   /locus_tag="RSKD131_0323"
FT   CDS_pept        complement(322807..323259)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0323"
FT                   /product="Hypothetical Protein"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00183"
FT                   /db_xref="InterPro:IPR021866"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="InterPro:IPR038396"
FT                   /db_xref="UniProtKB/TrEMBL:B9KMX1"
FT                   /protein_id="ACM00183.1"
FT                   /translation="MRARTVLLGLGLLGLGAVALGAQSRGRPGWLRRLPSPAPHILAFE
FT                   LGGHVGRPEIRRMAETVLAAFDRFESVDMLVVLPEFTGLTPAAALDLKGLKAGFRSLGK
FT                   VRRYAVVEPPKIAALMIETSDWFMPVQARTFPLTQRDAAEAWVARR"
FT   gene            complement(323259..323399)
FT                   /locus_tag="RSKD131_0324"
FT   CDS_pept        complement(323259..323399)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0324"
FT                   /product="Hypothetical Protein"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00184"
FT                   /db_xref="UniProtKB/TrEMBL:B9KMX2"
FT                   /protein_id="ACM00184.1"
FT                   /translation="MEAMRADLAIGTARGAAIFPAMGCGDVGTGGRAARRRPVLRSGGL
FT                   R"
FT   gene            complement(323626..324114)
FT                   /locus_tag="RSKD131_0325"
FT   CDS_pept        complement(323626..324114)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0325"
FT                   /product="DHC, diheme cytochrome c precursor"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00185"
FT                   /db_xref="InterPro:IPR018588"
FT                   /db_xref="InterPro:IPR036280"
FT                   /db_xref="UniProtKB/TrEMBL:B9KMX3"
FT                   /protein_id="ACM00185.1"
FT                   /translation="MTLRILALALCLLPAGWTATYADDDGGEHGGRRAALVVTDPLTKT
FT                   ECSACHMAYPAALLPARSWTALMADLPNHFGEDASLDEASRGQIESYLVANAADSSGAG
FT                   RALRGLAQTDTPLRISELPWFKRKHADEVSPRMLEKARSMSNCAGCHTGAERGLFDDD"
FT   gene            complement(324129..324518)
FT                   /locus_tag="RSKD131_0326"
FT   CDS_pept        complement(324129..324518)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0326"
FT                   /product="Cytochrome c-type protein SHP precursor"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00186"
FT                   /db_xref="GOA:B9KMX4"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR015170"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:B9KMX4"
FT                   /protein_id="ACM00186.1"
FT                   /translation="MTRFLILSAVLAGPALAGDTSPAQLIAGYEAAAGAPADAERGRAL
FT                   FLSTQTGGKPDTPSCTTCHGADVTRAGQTRTGKEIAPLAPSATPDRFTDSARVEKWFGR
FT                   NCNSVIGRDCTPGEKADLLAWLAAQ"
FT   gene            complement(324522..325613)
FT                   /locus_tag="RSKD131_0327"
FT   CDS_pept        complement(324522..325613)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0327"
FT                   /product="Cytochrome B561"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00187"
FT                   /db_xref="GOA:B9KMX5"
FT                   /db_xref="InterPro:IPR011577"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="InterPro:IPR018588"
FT                   /db_xref="InterPro:IPR036280"
FT                   /db_xref="UniProtKB/TrEMBL:B9KMX5"
FT                   /protein_id="ACM00187.1"
FT                   /translation="MSRPPLVPVWDLPIRLFHWSLAASVGLAAATGFLGGAQAIRWHLG
FT                   GGLAALALVLGRIIWGFTGPTHARFRDFLPSPAAVLGHLRSASPRHLGHNPLGALMVLA
FT                   LIGLILLIGLSGLILLGGLFKTGPLAFWSFEAGRAWHMLHEAAAWAVLGLVALHLGGVA
FT                   FESRRSRENLARAMLTGSKEARPGDHPAEEIPARGPLALVLLLLVGSGLWAASSALSAR
FT                   APQGMPVAFDATTRDECSACHMAYHPSLLPAASWRMLMAGLADHFGEDARLDPATAAEI
FT                   EAWLTGHAAETADTLPAHAFAETAPGAPFTLTETPGWKRLHGGLPDRLFRQPSVRSPAT
FT                   CTACHADAESGLFSPFSIHLPKE"
FT   gene            325806..326006
FT                   /locus_tag="RSKD131_0328"
FT   CDS_pept        325806..326006
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0328"
FT                   /product="Hypothetical Protein"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00188"
FT                   /db_xref="UniProtKB/TrEMBL:B9KMX6"
FT                   /protein_id="ACM00188.1"
FT                   /translation="METAMSLSAATPSARLLPMAVRPDPPHAEGVVSRLQDPCGRCTFS
FT                   WCDAPWSSGRTGCPACAGRAT"
FT   gene            complement(327048..327176)
FT                   /locus_tag="RSKD131_0329"
FT   CDS_pept        complement(327048..327176)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0329"
FT                   /product="Hypothetical Protein"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00189"
FT                   /db_xref="UniProtKB/TrEMBL:B9KMX7"
FT                   /protein_id="ACM00189.1"
FT                   /translation="MGAELNALPRLEAAPDEDPERALAGRAGPDAKRIGPARAGYI"
FT   gene            complement(327161..327661)
FT                   /locus_tag="RSKD131_0330"
FT   CDS_pept        complement(327161..327661)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0330"
FT                   /product="Hypothetical Protein"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00190"
FT                   /db_xref="GOA:B9KMX8"
FT                   /db_xref="InterPro:IPR018723"
FT                   /db_xref="UniProtKB/TrEMBL:B9KMX8"
FT                   /protein_id="ACM00190.1"
FT                   /translation="MGQSAHQLWFVSSVMIGLGALLALGAAADRKITGAAGEAPWFVPV
FT                   SAPAEARDLMSTPVTAMVPATSLIFSISMGVLTLAATQFGPRLVRNFMSMRQTQLTLGT
FT                   FVMTIVYGLITLTLMAQTQAARPGPSPPSRLRWRAWGFSARSSTGSPGRSWRRQSSRGW
FT                   VPS"
FT   gene            328189..328395
FT                   /locus_tag="RSKD131_0331"
FT   CDS_pept        328189..328395
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0331"
FT                   /product="Cold-shock DNA-binding protein family"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00191"
FT                   /db_xref="GOA:B9KMX9"
FT                   /db_xref="InterPro:IPR002059"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012156"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019844"
FT                   /db_xref="UniProtKB/TrEMBL:B9KMX9"
FT                   /protein_id="ACM00191.1"
FT                   /translation="MANGTVKWFNATKGFGFIAPAGGSKDVFVHISALERAGIRQLNDG
FT                   QAVTFDLETDRNGRESATNLALA"
FT   gene            complement(329035..329925)
FT                   /locus_tag="RSKD131_0332"
FT   CDS_pept        complement(329035..329925)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0332"
FT                   /product="Transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00192"
FT                   /db_xref="GOA:B9KMY0"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B9KMY0"
FT                   /protein_id="ACM00192.1"
FT                   /translation="METGLKGLEAVLAIARKGSFRAAALDLGVSTTALSHTIGRLEASF
FT                   GVRLFHRTTRSVALTEAGRDFVARIAPALTEIRAAMDTVRSQRATPAGMLRINASVQAG
FT                   RAVAPLVLAFLRRYPKMQVDLVTEGRLVDIVAEGFDLGIRPTDLVPRDMIALSLGRPVR
FT                   HAVVASPDWLARHPEPRSPADLDPGQCLRVRLPNGALLRWPFEKDGLALPFEAKGRLSV
FT                   DEPAIARAAVLDGAGIGYFIEADVAEDIANGRMIRLLEDWTPNRPGFSLYYSGRRNPSA
FT                   GFTAFLSLMRERAEA"
FT   gene            330024..330347
FT                   /locus_tag="RSKD131_0333"
FT   CDS_pept        330024..330347
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0333"
FT                   /product="Hypothetical Protein"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00193"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="UniProtKB/TrEMBL:B9KMY1"
FT                   /protein_id="ACM00193.1"
FT                   /translation="MTLPAPIQTYFTAEAPQDGARFAAAFAPDAIVHDEARDHCGPAEI
FT                   AAWWTAAKAKYRHCAEPLEVIEAGGKTVVRARVSGDFPGSPAVLTFTFGLSGDRITDLR
FT                   VGG"
FT   gene            330344..331123
FT                   /locus_tag="RSKD131_0334"
FT   CDS_pept        330344..331123
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0334"
FT                   /product="Short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00194"
FT                   /db_xref="GOA:B9KMY2"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B9KMY2"
FT                   /protein_id="ACM00194.1"
FT                   /translation="MTGFLTLQGKRALITGGTQGAGAATLALFRELGAEVLTSARRRPG
FT                   DLPEDMFVAADLTTPAGCETVAAAVRDRLGGVDILVHMLGGSSAPGGGFAALGEAEWQA
FT                   ELNLNLMPAVRLDRALLPGMVARGAGVVVHVTSIQRLLPLPEATTGYAAAKAALSAYSK
FT                   SLSKEVAPKGVRVVRVAPGWIATEASLRLAERLAAEAGTDLEDGKRRIMASLGGIPLGR
FT                   PSAPAEIANLIAFLASDRAVSITGTEYVIDGGTVPTV"
FT   gene            331709..332077
FT                   /locus_tag="RSKD131_0335"
FT   CDS_pept        331709..332077
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0335"
FT                   /product="Integrase, catalytic region"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00195"
FT                   /db_xref="UniProtKB/TrEMBL:B9KMY3"
FT                   /protein_id="ACM00195.1"
FT                   /translation="MALRANPLDIRERYEKQLKDLQEAYGEAMLELRTRKEAGGPPGAG
FT                   GRQLMRTLHQSLLADGITVPLTKLCAWFGVPRRTVSYKPTKAAPKVDPRFADPIKALIE
FT                   KEPPFGYRTVAWLYWLQQ"
FT   gene            complement(332553..332696)
FT                   /locus_tag="RSKD131_0336"
FT   CDS_pept        complement(332553..332696)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0336"
FT                   /product="Hypothetical Protein"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00196"
FT                   /db_xref="UniProtKB/TrEMBL:B9KMY4"
FT                   /protein_id="ACM00196.1"
FT                   /translation="MLEAVEALAVDGLLFQRPADHALDHPGIRHKGRGPGPWICYPHGW
FT                   RQ"
FT   gene            332892..333020
FT                   /locus_tag="RSKD131_0337"
FT   CDS_pept        332892..333020
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0337"
FT                   /product="Hypothetical Protein"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00197"
FT                   /db_xref="UniProtKB/TrEMBL:B9KMY5"
FT                   /protein_id="ACM00197.1"
FT                   /translation="MRGFADEDGYRLQRLQCKTRLLPKSDRAAPSQIHPLPLRPMV"
FT   gene            complement(333491..333991)
FT                   /locus_tag="RSKD131_0338"
FT   CDS_pept        complement(333491..333991)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0338"
FT                   /product="Hypothetical Protein"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00198"
FT                   /db_xref="InterPro:IPR004291"
FT                   /db_xref="InterPro:IPR039552"
FT                   /db_xref="UniProtKB/TrEMBL:B9KMY6"
FT                   /protein_id="ACM00198.1"
FT                   /translation="MAHNGSVYDIEARINGRSADERRAVRQAHSRPKVKAFKSWAEEQL
FT                   EYISGKSDLAKAFRYALNRWDAFCLFLEDGRVAIDNNPAERAMRPIGIGRKNWLFAGND
FT                   AGGETLARAMTLVESAKLSGLDPQAYLADVLARINDHINPRLHELLPWNWKPLPAGDNK
FT                   IAA"
FT   gene            complement(333966..335153)
FT                   /locus_tag="RSKD131_0339"
FT   CDS_pept        complement(333966..335153)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0339"
FT                   /product="Hypothetical Protein"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00199"
FT                   /db_xref="InterPro:IPR004291"
FT                   /db_xref="InterPro:IPR024463"
FT                   /db_xref="InterPro:IPR024474"
FT                   /db_xref="UniProtKB/TrEMBL:B9KMY7"
FT                   /protein_id="ACM00199.1"
FT                   /translation="MAMSLTASSLPDDPAALKAMILQLQASLRAHDLLVQSLRMRIARL
FT                   KRQAFGKGSEKIAREIEQLEFALESLQVAQAEVAPPPEPESVETALVCGTSDEPGDNEA
FT                   PEKAPRRRPRVSPDTPCERREFDPGDTCPDCGGALRLVGEDVSQILDMIAARLKLIEVA
FT                   RPKKSCRCCERMVQCPAPTRPILGSLADPSLLAFILVAKYDDHLPLYRLNEIFARMGAD
FT                   IPDTTLAGWCGGAMKTLAPLVELIRADVLASDLLHADDTPIRVLDRSKKSELGKGVKEG
FT                   RIWAYVRDQRPWSGGAPPAVAYHFSPDRKGEHPQKHLGAGKGILQADAYAGFRDLYLAE
FT                   GNGEARFQEAACWAHLRRAFFEVEKETGSDIAREALERIGLRHCARTNGAQWLSL"
FT   gene            complement(335299..335577)
FT                   /locus_tag="RSKD131_0340"
FT   CDS_pept        complement(335299..335577)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0340"
FT                   /product="IS66 Orf2 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00200"
FT                   /db_xref="InterPro:IPR008878"
FT                   /db_xref="UniProtKB/TrEMBL:B9KJN2"
FT                   /protein_id="ACM00200.1"
FT                   /translation="MRVFLAAGTTDMRCGIAGLCARAKKVLGEDPAGGALLVFRGRMGD
FT                   RLKILHWDGQGFCLYYKVLERGHFPWPKATEGKVALTPAQMAMLWEG"
FT   gene            complement(335595..335942)
FT                   /locus_tag="RSKD131_0341"
FT   CDS_pept        complement(335595..335942)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0341"
FT                   /product="Hypothetical Protein"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00201"
FT                   /db_xref="GOA:B9KMY9"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="UniProtKB/TrEMBL:B9KMY9"
FT                   /protein_id="ACM00201.1"
FT                   /translation="MTGVERRRRWSDAEKRSILAEVGVNGARVADVARRHDLTRQHIYQ
FT                   WRAEFRRRGKSLTEETGFLPVETTPENCVPSVPAVTTPVEIVLVNGRRLRGIEGLSPAG
FT                   LAQLIRVLEGA"
FT   gene            complement(336574..337107)
FT                   /locus_tag="RSKD131_0342"
FT   CDS_pept        complement(336574..337107)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0342"
FT                   /product="Hypothetical Protein"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00202"
FT                   /db_xref="UniProtKB/TrEMBL:B9KMZ0"
FT                   /protein_id="ACM00202.1"
FT                   /translation="MSHIHRHGGATFFTPFMLFSSHDNRRMMIAHMAHSQAARDKMLGV
FT                   HWALQNQFRHIGRGSLFELGYDARLDPQPALFQFAEEDRAQLLLELENELPSHIATNLG
FT                   HGPLEVADLLFDVGNRTAAMNSDLFQVLTLMSAEKEVEVRKADGGLKRPGTKVEISDRL
FT                   HLPGQRTLFAKYIK"
FT   gene            337492..337623
FT                   /locus_tag="RSKD131_0343"
FT   CDS_pept        337492..337623
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0343"
FT                   /product="Hypothetical Protein"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00203"
FT                   /db_xref="UniProtKB/TrEMBL:B9KMZ1"
FT                   /protein_id="ACM00203.1"
FT                   /translation="MFDVILVLVDENEVSIDRKRLASVPIQLLYCIVDRPEEDQRAS"
FT   gene            complement(337843..338412)
FT                   /locus_tag="RSKD131_0344"
FT   CDS_pept        complement(337843..338412)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0344"
FT                   /product="Phage Gp37Gp68"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00204"
FT                   /db_xref="InterPro:IPR011101"
FT                   /db_xref="UniProtKB/TrEMBL:B9KMZ2"
FT                   /protein_id="ACM00204.1"
FT                   /translation="MLWKKPRMIFVNSMSDLFLKDIDRGYIDRVFDAMEAADWHVYQVL
FT                   TKRSSLMRNYVRSRYDSGPVPRHIWLGVSVEDAAHTSRIGHLKEINSEARFISFEPLLG
FT                   PIGTVDLTGVAWAIVGGESGPGARPMEHEWASELRRTCERDKVAFFFKQWGGPRPKSKG
FT                   RTLDGHEWNGFPWQIVPESILHQLQR"
FT   gene            339023..339157
FT                   /locus_tag="RSKD131_0345"
FT   CDS_pept        339023..339157
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0345"
FT                   /product="Hypothetical Protein"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00205"
FT                   /db_xref="UniProtKB/TrEMBL:B9KMZ3"
FT                   /protein_id="ACM00205.1"
FT                   /translation="MPQHLMTEVVLSRCHKQQYIRAVAFTLLGNVEELPSCCGKARGI"
FT   gene            339627..339743
FT                   /locus_tag="RSKD131_0346"
FT   CDS_pept        339627..339743
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0346"
FT                   /product="Hypothetical Protein"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00206"
FT                   /db_xref="UniProtKB/TrEMBL:B9KMZ4"
FT                   /protein_id="ACM00206.1"
FT                   /translation="MKILKGRWQEGGERAKAMMRRDFERHAIPKTPFAFLGL"
FT   gene            complement(339818..340264)
FT                   /locus_tag="RSKD131_0347"
FT   CDS_pept        complement(339818..340264)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0347"
FT                   /product="Hypothetical Protein"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00207"
FT                   /db_xref="GOA:B9KMZ5"
FT                   /db_xref="UniProtKB/TrEMBL:B9KMZ5"
FT                   /protein_id="ACM00207.1"
FT                   /translation="MSAFILLVGWPLVAILARVAGSVISAMIVAALAEPAAASTGSDLL
FT                   TTLAPSLLDLAGVALTALIGFATIRFQRWTGIQIEARHREALHSAIMTAARSAVARGLT
FT                   REDAAEFVSSYARASVPDALKRLSPSAKTLETLVRSKLLEAGGR"
FT   gene            complement(340313..341122)
FT                   /locus_tag="RSKD131_0348"
FT   CDS_pept        complement(340313..341122)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0348"
FT                   /product="Hypothetical Protein"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00208"
FT                   /db_xref="GOA:B9KMZ6"
FT                   /db_xref="InterPro:IPR009045"
FT                   /db_xref="InterPro:IPR039561"
FT                   /db_xref="UniProtKB/TrEMBL:B9KMZ6"
FT                   /protein_id="ACM00208.1"
FT                   /translation="MENDVTTSDIQRLLSAAGLYRGAIDGDAGPLTQAAVLAALEGEPV
FT                   PWRAWPAPRQRIAAGQAVLARLRHAPGRIDGLLGPNTREALTAWASEPVRAAVDRVPQP
FT                   GHAVADAQGAYPRQESVATFYGVAGGPDCTAGIVELPIPFRLAWDLTTSITSFRCHKLV
FT                   AAPMTRIFRETVAHYGAAEFENLRLNLFGGCFNHRPMRGGSALSMHAWGIAVDLDPERN
FT                   PLRWGRDRASFAAPAYEPFWTIVEAAGATSLGRACNRDWMHFQFARL"
FT   gene            complement(341174..341953)
FT                   /locus_tag="RSKD131_0349"
FT   CDS_pept        complement(341174..341953)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0349"
FT                   /product="D12 class N6 adenine-specific DNA
FT                   methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00209"
FT                   /db_xref="GOA:B9KMZ7"
FT                   /db_xref="InterPro:IPR012263"
FT                   /db_xref="InterPro:IPR012327"
FT                   /db_xref="InterPro:IPR023095"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B9KMZ7"
FT                   /protein_id="ACM00209.1"
FT                   /translation="MAPWLGGKKRLHPLILERIEAIPHRAYVEPFVGMGGIFLRRRFRP
FT                   RLEVMNDRNGEIINLFRILQRHYPQLLEIMRFQICSRREFDRLRLTDPATLTDLERAAR
FT                   FLYLQRLSFGGKLDGVFGVSAGHGPRFSLARLEPVLDAAHERLDGVVFESLDWADLIPR
FT                   YDTAETLFYLDPPYFGGENDYGRGIFDRAQFARIAEILGSLKGAFLLSINDTPEIRALF
FT                   GRFHLEPVRLNYSVSASGSTEAQELLVSNRERIATLL"
FT   gene            341984..342145
FT                   /locus_tag="RSKD131_0350"
FT   CDS_pept        341984..342145
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0350"
FT                   /product="Hypothetical Protein"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00210"
FT                   /db_xref="UniProtKB/TrEMBL:B9KMZ8"
FT                   /protein_id="ACM00210.1"
FT                   /translation="MILPHKAPALARGGRQSERLRTGWRGRGETLAAWFGLLTQPGPCL
FT                   RGAAGALK"
FT   gene            complement(343168..343485)
FT                   /locus_tag="RSKD131_0351"
FT   CDS_pept        complement(343168..343485)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0351"
FT                   /product="Hypothetical Protein"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00211"
FT                   /db_xref="GOA:B9KJN5"
FT                   /db_xref="InterPro:IPR032126"
FT                   /db_xref="UniProtKB/TrEMBL:B9KJN5"
FT                   /protein_id="ACM00211.1"
FT                   /translation="MPEKGLIDTITALWGGAIATLIAAAMGRLMYHTGEVRARRRAFFG
FT                   RELLWEIPALVAMAFVGEALSSYLDLDGRAAMGLVAMLAYLGPRGTTAMLERLWRGRSA
FT                   G"
FT   gene            complement(343616..343930)
FT                   /locus_tag="RSKD131_0352"
FT   CDS_pept        complement(343616..343930)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0352"
FT                   /product="Hypothetical Protein"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00212"
FT                   /db_xref="UniProtKB/TrEMBL:B9KJN6"
FT                   /protein_id="ACM00212.1"
FT                   /translation="MTNATIDYSRLVKARDIKAQAEARARGPSEITLLQAMIVVGEEKW
FT                   AEAMAIAEDASYPWAMRAALRGATVLVRDSETMDTLAFLLGFSPEETDRLFLDAAQVRL
FT                   "
FT   gene            complement(343955..344239)
FT                   /locus_tag="RSKD131_0353"
FT   CDS_pept        complement(343955..344239)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0353"
FT                   /product="Hypothetical Protein"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00213"
FT                   /db_xref="UniProtKB/TrEMBL:B9KN01"
FT                   /protein_id="ACM00213.1"
FT                   /translation="MYELTLFRVQGDTLICNDMVYDFSGVEEGDVLPWDAMDNTWVTSN
FT                   VTRVDGVLEFEVVFPHGYYGDLPLPNPGILEVEDQDIPIPPYLPPSSED"
FT   gene            complement(344279..345763)
FT                   /locus_tag="RSKD131_0354"
FT   CDS_pept        complement(344279..345763)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0354"
FT                   /product="Hypothetical Protein"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00214"
FT                   /db_xref="UniProtKB/TrEMBL:B9KN02"
FT                   /protein_id="ACM00214.1"
FT                   /translation="MDFFSPPPTPPNSGNPGTFNDDADAFLGWFPAFVAELNALLPYLT
FT                   GAGFGDGTAAAPELFWKGDPDTGFFRPGSNALGVTAGGVLRLTVSALALTSTVPLRAPL
FT                   GTAAAPGIAFEADPNTGIRSDGADVLHFVTGGATRGFFSTTHFQSTLPAVLPGGAAAAP
FT                   ALTFAGDLDTGIFRAAADLLGIAAGGEERFRVGSGRVASLVPFSVPSGTQTFPGFTFNE
FT                   EVGSNTGFFLAAENELGVTCQGTERARFTPSGMELKGLLSGTAVTQSDLDTTPGRLLKV
FT                   GDYGLGGTARPIPGSDADQIGTTGFYQVTGNTLNRPAGMGVGTLQHIQHGANRAVQIAY
FT                   PQTASDTGRWCRQKDTSWGDWFLTYDQRNIVGAVSWSSGFPRGGIIEKGETAGAEYVRF
FT                   ADGTQLCRLVQTGVPGPTTPQGSLYRTEWQTVTLPVEFVSGALNGHCVTGGCRGGSVIS
FT                   LLGRPGASNVAAYMLLAPTSYASTQTVDLLVTGRWR"
FT   gene            complement(345779..346669)
FT                   /locus_tag="RSKD131_0355"
FT   CDS_pept        complement(345779..346669)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0355"
FT                   /product="Hypothetical Protein"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00215"
FT                   /db_xref="UniProtKB/TrEMBL:B9KN03"
FT                   /protein_id="ACM00215.1"
FT                   /translation="MRIILPTPVTPAALLASNIPEDDHPAWGPGQTYDRGARVVAHHGV
FT                   WESVADGNQGHDPAADVLGSWWLRIGATNRWRAFDERIGGQTVGGPTIAYSIRLPRTLN
FT                   RIAFFNLDAASVRVKVTTPGGATIHDRTEGLVARDPVGTFWEYVFTEFAFTPNLIVAAP
FT                   LPAGATLDITVTGGAVTRVGEIVMGRDTPVGTTVAGTGLGLVDYSVKQRDEWGGLYIVP
FT                   RPVTRTVSLAFQVPLEGAARVQSIMERVSSRLAVFYAGEGVDLWGTTVAGILRDYDLTL
FT                   GHAICDGRAEVESLA"
FT   gene            complement(346669..351567)
FT                   /locus_tag="RSKD131_0356"
FT   CDS_pept        complement(346669..351567)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0356"
FT                   /product="Hypothetical Protein"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00216"
FT                   /db_xref="GOA:B9KN04"
FT                   /db_xref="UniProtKB/TrEMBL:B9KN04"
FT                   /protein_id="ACM00216.1"
FT                   /translation="MSAVIGALRVNLGLDSAEFQKGLKKAQSSLGAAAKAFGALSAIGV
FT                   TVGTAMTAIVAPTARAANEISRLSQVAGTTPAALQRWSAGAKTVGIEQEKLADILKDVN
FT                   DKVGDFLSTGGGPMKDFFEQIAPRVGVTAEQFRKLSGPDALQLYVTSLQRAGLAQSEMT
FT                   FYMEAIASDSTLLLPLLRDNGAEMERLGAAASSLGAVLGDDAVEALRRAHLALGDVSTA
FT                   LQGARDRMAAELAPAVEAMAAAFTNSMREGGALRTVLDGLGGVAASAVQGIASLADHAD
FT                   ILASALVGIAATAIPSMMTAVAGMTTGLGLATIATNTLTGALGYLRAAVALAGGPWGIL
FT                   AGAVASTAAYFLVFRDNAGLAETAAYNVRDAELALRGELEAFATASSPAAREESRKRVI
FT                   SHFEHARAALQAAQAELALAQAMGEDIKPGSLMDMAASEEGTRSLDARSKKVQELTANV
FT                   TRMAEAVKQATATGGGGETVIPQPSAITPTTKAVKDLGSAGRSAGRQIKDGMNGAKESA
FT                   NEFADALRQNVVQSISSAVGSAVDWMLDGFEGGFKGLLDIAKTTLKQIIGMFMTNRITL
FT                   SLGLGVSGGAAGVAGAAAAGVPGMGGGGLGMLGSLFGGGGGGGVLGSIGSAFSAFGSGA
FT                   LGSLGNFFSGGLSGGFAYIGQSLGMATSSLVGLAQAAGAILGPVAAVAAAFSFFGSKTK
FT                   LLDAGLRVTVRELDAMVESYRKVEKSRFGGLSKSRRTSYGLADGAVAGPIVKAVSQMQA
FT                   SVMDVADTLGIGAEAFKGFAASVKFSTKGLSDEEIGAKLQEKLTELGDNFAARAFGYVG
FT                   RNDQAIRDLETRIAEGTSDAVVTGLKGSIGDRLLSAFFGRKQQGDLAELIAGNSLVSTR
FT                   PELAALVKEGESFVEALQRLSAAMSGVNGVMDTLGHSFRAVDMVTAGMASDLAALFGGL
FT                   DGLVSATSSYYQAFYSEAERMETATRQATEALAKLGVALPETRAEYRRLVEAQDLTTER
FT                   GRELYAALVGMAGVMDQILPSVASFSAGLAGLVGTITTDLDGMISGAAEAQRAAAAAAK
FT                   GWYQVTVALRDYIGDLRSAASELISPAVAAAQSQARYQTMLAGAMAGDQEAAKAVSGAA
FT                   SAYIDAVRGQARSAVDVARAQAQVLSDLQLLQGVTGLEGAKEDVLAGLYREQVDLLTEV
FT                   RDYLAGGGALKPEQIAALNAQLGSLEDAIAAAKEISYAALRERIDVTVGLTATADIPAD
FT                   LRRILKNATSGVEVSLDMVLRRMDLTPDLVWIAAKRSSDHLARITYLAKADALPDDLRA
FT                   LAAVRVAQSVRRLALVMDRPASDLGMAELLKAIGAKGGRITLGGSFAFDPSTGFSSWFE
FT                   TATQGAITAPMTALRTALDDLRDAILAQERAAGQRERGAALSAYAGGLATNAAGDILAT
FT                   DKQIMTMAAKAGISTDGKTIGQVMRAIEGFSPLDGIETIRRLPGSLKDYLWGIFQQRNG
FT                   RIPLDTADYLRLYPDVAADEFGYDPTIHYRNHGREAILAGLRPFKPEVFDWSALGLDVP
FT                   GFAAGGLHTGGLRLVGELGPELEATGPSRIHSAGRTADILGGAAMGASEVAGAVRDLQA
FT                   ELVALRAENAQIARELAEMKVWARKGAEASTATAKDLRRIGTVGVRIDPTEAL"
FT   gene            complement(351672..351917)
FT                   /locus_tag="RSKD131_0357"
FT   CDS_pept        complement(351672..351917)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0357"
FT                   /product="Hypothetical Protein"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00217"
FT                   /db_xref="UniProtKB/TrEMBL:B9KN05"
FT                   /protein_id="ACM00217.1"
FT                   /translation="MLGVLEGDYKRRRREIEDRRVLQHEFATLVAFAFHQPSKMPDYKP
FT                   PAEASAPPAQKADAGCDADHERVRGLLIGMALRGRG"
FT   gene            complement(351992..352384)
FT                   /locus_tag="RSKD131_0358"
FT   CDS_pept        complement(351992..352384)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0358"
FT                   /product="Hypothetical Protein"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00218"
FT                   /db_xref="UniProtKB/TrEMBL:B9KN06"
FT                   /protein_id="ACM00218.1"
FT                   /translation="MNMMRGAVAFEAEGRERFIRLTTNAQVRYQERAGETLVDAIVAMQ
FT                   GEGSQGDMLRLRRLIWAGMGHEGLSEDAAGDLIDEIGLAEASRLLGDAIRAAFPEAARA
FT                   EPETGSEDAGGNAPAPAKAKAKPAAA"
FT   gene            complement(352381..352824)
FT                   /locus_tag="RSKD131_0359"
FT   CDS_pept        complement(352381..352824)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0359"
FT                   /product="Hypothetical Protein"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00219"
FT                   /db_xref="UniProtKB/TrEMBL:B9KN07"
FT                   /protein_id="ACM00219.1"
FT                   /translation="MASKQIIAYGAKVERSTDGTSGWTVIPEAKGIAVPVVEQDYQDVT
FT                   SLDSEGGYRDYIKGLKDIGQITIPMGYTSAGYAAMIADQEAPNPIHYRVTMKPAPDQST
FT                   GDVFEFRGFPVPQIEAGDLGAPVGINLNIRGTGAPTWTRGTEA"
FT   gene            complement(352834..353214)
FT                   /locus_tag="RSKD131_0360"
FT   CDS_pept        complement(352834..353214)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0360"
FT                   /product="Hypothetical Protein"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00220"
FT                   /db_xref="InterPro:IPR021508"
FT                   /db_xref="UniProtKB/TrEMBL:B9KN08"
FT                   /protein_id="ACM00220.1"
FT                   /translation="MEEALRALLLGTPAVAVLVGRRVNFGAHPQGEPLPALVLSTVSDR
FT                   EGLTLAGPDGLQRARVQIDCYAESYGAAKQLSRAVRAVLHGHSGGGFRGVFLDGARDLR
FT                   EPGDDTGRPYRVSLDFLTIYSA"
FT   gene            complement(353219..353386)
FT                   /locus_tag="RSKD131_0361"
FT   CDS_pept        complement(353219..353386)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0361"
FT                   /product="Hypothetical Protein"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00221"
FT                   /db_xref="UniProtKB/TrEMBL:B9KN09"
FT                   /protein_id="ACM00221.1"
FT                   /translation="MTEEKRHPDTVVRQLADLAAQHGYGLMAVELVSRTPVGVTVPRHI
FT                   YGAPRPASEG"
FT   gene            complement(353383..353856)
FT                   /locus_tag="RSKD131_0362"
FT   CDS_pept        complement(353383..353856)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0362"
FT                   /product="Hypothetical Protein"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00222"
FT                   /db_xref="InterPro:IPR010064"
FT                   /db_xref="UniProtKB/TrEMBL:B9KN10"
FT                   /protein_id="ACM00222.1"
FT                   /translation="MSVTVSVTGLRELEAQLAKLSKATGKAALRRALKTAAQPLADLAQ
FT                   SKAPVGDTRTLAPSITVGTRLSERQAKRHRRMFRDDRASVEMFVGAGPLPSAHNQEFGN
FT                   IHMAAQPFLRPAWDQDREALLERLRADLWQQVSKAIVRAEKRAARATAKRTGS"
FT   gene            complement(353853..354158)
FT                   /locus_tag="RSKD131_0363"
FT   CDS_pept        complement(353853..354158)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0363"
FT                   /product="Hypothetical Protein"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00223"
FT                   /db_xref="InterPro:IPR008767"
FT                   /db_xref="InterPro:IPR038666"
FT                   /db_xref="UniProtKB/TrEMBL:B9KN11"
FT                   /protein_id="ACM00223.1"
FT                   /translation="MQIQRATPADDGFASVEVWADHGSPLWAARADLSDSERWNAGEVA
FT                   ASVTTRFTLHRTAFARGLTPKDRLLSEGRTFEISGIKESGAGRRFLELTCSARTDR"
FT   gene            complement(354182..354688)
FT                   /locus_tag="RSKD131_0364"
FT   CDS_pept        complement(354182..354688)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0364"
FT                   /product="Hypothetical Protein"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00224"
FT                   /db_xref="UniProtKB/TrEMBL:B9KN12"
FT                   /protein_id="ACM00224.1"
FT                   /translation="MRVIEPPALAVSVEAFKRAVHLDGPDDDLLIAELLAAATEVVETA
FT                   ARRPLMPRLVAFETPAGRWSRWYLPIAPVIELVEISDPAARLVRSFTEPALERPEAEGA
FT                   VSLTALCGHEDPAQIPRGLCQAVILLAKEWHDAGIGPAESAPPLSFGIQRLIRQARYAR
FT                   PMVSE"
FT   gene            complement(354693..354977)
FT                   /locus_tag="RSKD131_0365"
FT   CDS_pept        complement(354693..354977)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0365"
FT                   /product="Hypothetical Protein"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00225"
FT                   /db_xref="UniProtKB/TrEMBL:B9KN13"
FT                   /protein_id="ACM00225.1"
FT                   /translation="MKTIVTFIRPWNRYNRGETAGFDPATAAALIGVHAVPYRPAEAAP
FT                   IASAAPPVEPATPAPSFEAAMAALETPPETAPKASATGTADLPVQGRRK"
FT   gene            complement(355073..356398)
FT                   /locus_tag="RSKD131_0366"
FT   CDS_pept        complement(355073..356398)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0366"
FT                   /product="phage-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00226"
FT                   /db_xref="InterPro:IPR024455"
FT                   /db_xref="UniProtKB/TrEMBL:B9KN14"
FT                   /protein_id="ACM00226.1"
FT                   /translation="MARQNLDDLRRARKAAADTMAAVAARIGALEAAETPDAAALEAET
FT                   AAFAAAEAAFARADAAVTRAAAVEAAQAAAAQGDGAGAGSGTGADAVPAVAADPAHRGV
FT                   AAGFMVQALARTKGDRDKAARLLEAEGHGAISAALSGASEGAGGVTIPRPQAAELIEML
FT                   RARVVVRASGARTLPMPAGEMRHAKQVGSAVAAYAAENAAIAPSQPSFDKIDQSFKKLV
FT                   GMVPIGNSLLRHSGVAMAQLVRDDLLKVMALREDLAFLRGDGSADTPKGLRHWMLPANW
FT                   TAAPVAATPAAAEAAIRRAVSLVEDADVGMVSPGWIMRASTKNWLASLKDANGNPLFPS
FT                   IGASAQLMGFPIRTSSQIPDNLGAGGDETEIYFGDFDEAMIGDSMALVVGSSTDASFVD
FT                   GNGATVSAFQNDLTLMRAISEHDFAPAHDEAFAGFNATGWTL"
FT   gene            356653..357396
FT                   /locus_tag="RSKD131_0367"
FT   CDS_pept        356653..357396
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0367"
FT                   /product="transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00227"
FT                   /db_xref="GOA:B9KN15"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:B9KN15"
FT                   /protein_id="ACM00227.1"
FT                   /translation="MNGEALLLSGAFLVTALLYAAVGQAGASGYIAIMGLAGFGPLAMK
FT                   TTALSLNLLVAAIGTALFLRAGRLSWQNVWPFAVLGFPFSLLGGAIRLPEGIYFPVVSA
FT                   VLILSALQMARTAILRPGPDPAEAGCPPFAAALATGAVIGFVSGTTGTGGGVFLAPIIL
FT                   TMKWGSARQTAATTAVYNLINSSAALLGAYAAWDQAPSALPVWLVAVAAGGTIGAYIGS
FT                   RYLSDRWLRGTLSVLLLMSGIKLIW"
FT   gene            complement(357407..358321)
FT                   /locus_tag="RSKD131_0368"
FT   CDS_pept        complement(357407..358321)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0368"
FT                   /product="Periplasmic serine protease"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00228"
FT                   /db_xref="GOA:B9KN16"
FT                   /db_xref="InterPro:IPR002142"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR033855"
FT                   /db_xref="UniProtKB/TrEMBL:B9KN16"
FT                   /protein_id="ACM00228.1"
FT                   /translation="MTRTLASLFGPLQPMALAEDLAAPLLAMPILEGAAGAAAARAEAA
FT                   GPSVPDRFTVARGLAVVPVRGILTPNMAQYERWFGWATYHGLAETLAHLAASEDAAAIV
FT                   LEIDSPGGLVCGIEAAAEAIAAAAVVKPVHALVSPLAASAAYWLASQATEIVMTPGAVA
FT                   GSIGVALTAAAHVQPGANGAQIFEMSSRHARAKRPDASTEAGRAELQRSLDEAEAAFHA
FT                   AVSAGRAIPAAELAARLSVTDDPQDGGATFRAPEAIRRGLADRTETRAAFYARLTARTA
FT                   PKPRSPSRAFAARAAAAKAVARS"
FT   gene            complement(358318..359553)
FT                   /locus_tag="RSKD131_0369"
FT   CDS_pept        complement(358318..359553)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0369"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00229"
FT                   /db_xref="InterPro:IPR006427"
FT                   /db_xref="InterPro:IPR006944"
FT                   /db_xref="UniProtKB/TrEMBL:B9KN17"
FT                   /protein_id="ACM00229.1"
FT                   /translation="MAGASVRTEPPVTAPQAAAEASGTAAPKPWLQEVGWSSGGASRIR
FT                   TLPRVSAEIAQRHATVYACCAVIAGDLAKVPLKLFQRTGDGREVRVRDHAAPYLLNVEA
FT                   APGVAASVVRFALGYAFTLRGNAFAWAPRDGAGELELIDLVRQSGCSVLRAGRDRFYDF
FT                   EDGAGLRRRAPARAMIHLRYMAEDGWTGRSPLEVAAESVGLALAGQESAARAASGVTAR
FT                   AVIRLRDDYEDDEARVRSARRVAAALRAPEVEGFPILGEGEDVKTLDMKAADQELLGSR
FT                   KFDREQIAAIYRVPPAKLQMMEYGVKANGEQQAIDYLTDCLLHWAKQIEDQLALGVLTE
FT                   AERRAGFYLKHDFGALLRPTTRERYEALAKAVGGPILTPNEARRIDGYDPIEGGDRLNP
FT                   APNMTRSEETDP"
FT   gene            359771..360121
FT                   /locus_tag="RSKD131_0370"
FT   CDS_pept        359771..360121
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0370"
FT                   /product="Embryonic flower 1-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00230"
FT                   /db_xref="UniProtKB/TrEMBL:B9KN18"
FT                   /protein_id="ACM00230.1"
FT                   /translation="MLQAECRMMDHFASRLCGIEGQGQHIFRRDGSHDQPRIAPEAEPA
FT                   IVSWIANENGSLEGRPQSQDCGGHQGAPDPSAVSGRQDRERPDQAPAILRPDPGSGCGE
FT                   ITNHPAIVFRHE"
FT   gene            complement(360264..360527)
FT                   /locus_tag="RSKD131_0371"
FT   CDS_pept        complement(360264..360527)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0371"
FT                   /product="Hypothetical Protein"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00231"
FT                   /db_xref="InterPro:IPR018654"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9KN19"
FT                   /protein_id="ACM00231.1"
FT                   /translation="MNISRNEQRALHVLALGGRILHERDDRRKITAVTCVTREGMILSD
FT                   FALETFLRLRRKRLIESRSGSPYCISKRGRLSVRAQLDNQGA"
FT   gene            complement(360858..362516)
FT                   /locus_tag="RSKD131_0372"
FT   CDS_pept        complement(360858..362516)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0372"
FT                   /product="Hypothetical Protein"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00232"
FT                   /db_xref="InterPro:IPR005021"
FT                   /db_xref="UniProtKB/TrEMBL:B9KN20"
FT                   /protein_id="ACM00232.1"
FT                   /translation="MEPIDHPVSRYALDVVEGRETAGELVRLACLRHLTDLETGRDRGL
FT                   WFDCKAASRVLNFAELIQHTTGPLAGRPLTLRPWQAFRHGSVFGWKKEGGLRRFRTTYH
FT                   QVAKKNGKTTDTAVPALFTALFDREAAPQGYCAATTRDQAGLLFRELKRMIRASPHLSA
FT                   LMQVWRTSIEVPATEGLIACLSRDGNSSDGINPHFAARDEVHRWTDRELAEVLTNSMIA
FT                   RAQPIDWAITTAGADRASLCGEMRDYAEEVVRGTVSDDSFFAYVAEPPPDCDVADPRFW
FT                   KMANPNLGVAFSEERFGEMYREATVISGKMPNFRRLHMNLWTEGAQTWIARDVWDRGAE
FT                   PFDPRALYGLPAWVGLDLSKTTDLTAISVAVPKDGQIYLLAYSFLPEGPKGFIARAQKE
FT                   KREYVAWRDAGWLEVHSGGVIDEDQVIERLETIRARFDLRELAYDRWGMKYMAKELLKR
FT                   RFPLVEHGQGYGSMSSPMKRFEEAVAKGRIRHAGNPVLAWAVGNVHRDEDAAENIKPNK
FT                   ARSKGRIDPAVAAIMALGRAEAAEGRRRAREVETA"
FT   gene            complement(362503..362940)
FT                   /locus_tag="RSKD131_0373"
FT   CDS_pept        complement(362503..362940)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0373"
FT                   /product="Hypothetical Protein"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00233"
FT                   /db_xref="InterPro:IPR006448"
FT                   /db_xref="UniProtKB/TrEMBL:B9KN21"
FT                   /protein_id="ACM00233.1"
FT                   /translation="MRGQKPKVSNVIPMKGDLAAPVPEAPGWMSAEGRDVWERLAPVLI
FT                   AKKRLEPAFEDPFAVYCEAVADVIRFTGDIAAFGSWYEVETRNGRQQKKRAVWGQRQDA
FT                   IAVMNQLAARFGLTPVDEARVRVTGQGDLFDEILKTLDGAD"
FT   gene            complement(363203..363616)
FT                   /locus_tag="RSKD131_0374"
FT   CDS_pept        complement(363203..363616)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0374"
FT                   /product="Hypothetical Protein"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00234"
FT                   /db_xref="GOA:B9KN22"
FT                   /db_xref="InterPro:IPR002711"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="UniProtKB/TrEMBL:B9KN22"
FT                   /protein_id="ACM00234.1"
FT                   /translation="MIRKLCCAPGCEELAPAGQAHCPEHAAEAEARARSRKARAKAGAA
FT                   AQAGAAFYATGRWRRARARFLAAHPLCADCAGLGLVVAAAEVDHIRPHRGDPGLMWDRA
FT                   NWQPLCRPCHSRKTAREVFHPPGGIGKSEGSAR"
FT   gene            complement(363721..364260)
FT                   /locus_tag="RSKD131_0375"
FT   CDS_pept        complement(363721..364260)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0375"
FT                   /product="Hypothetical Protein"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00235"
FT                   /db_xref="UniProtKB/TrEMBL:B9KN23"
FT                   /protein_id="ACM00235.1"
FT                   /translation="MKGAKGRKAMKAKLVSLKLAPWDLGPLTPAQIAGKRIEEAAEVDP
FT                   KTGKKSNPNRVIRTRRETWVDRYHRQGKLSVEQANIAAELFEAASGIPARDPLAAIVRV
FT                   DTSGDQDPQAAQVDRRRKFFRMWESVPTFARPVIQHVVLDDQSLRSLGSWSNAREEARH
FT                   LDRLQRGLDALSEAWR"
FT   gene            complement(364466..365044)
FT                   /locus_tag="RSKD131_0376"
FT   CDS_pept        complement(364466..365044)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0376"
FT                   /product="Hypothetical Protein"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00236"
FT                   /db_xref="UniProtKB/TrEMBL:B9KL18"
FT                   /protein_id="ACM00236.1"
FT                   /translation="MAMTKAEERARVKALVVDRLEQAGMVRRRGTAAAAHEAAMARLCE
FT                   QLGYMGAENLMTLAEVLIDSAADGVWPSEVLIRQFARAIEEPPPAERRLVSSWLASVEG
FT                   PKAEAGGHLVELYRWLLKHPRPPLAMDLREIRDQAQDNARRCELIRDRIDRETASREDR
FT                   DWLELYLRDRAQARALVDAGRARKEGAAA"
FT   gene            complement(365248..365904)
FT                   /locus_tag="RSKD131_0377"
FT   CDS_pept        complement(365248..365904)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0377"
FT                   /product="Hypothetical Protein"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00237"
FT                   /db_xref="UniProtKB/TrEMBL:B9KL17"
FT                   /protein_id="ACM00237.1"
FT                   /translation="MPHDRLTETEPATEILGDFWEYPLAFGDTLSSHEWVPLHINRLLT
FT                   SRFVARALAENRRADIGTALLLWCEAFRQDPAGTLPDDDLELARLAGYGADLESWRAAR
FT                   EGALYGWRETHISNQEEAPGNRRLGHVMIAGIARDMHRRKRGRDQARTEGSKAMARTRV
FT                   RRKLVEIKCGRAAESPDVVNEIAEWLGQRDLFITSDNVRAAFEATHGGPKVVQLT"
FT   gene            complement(365944..366495)
FT                   /locus_tag="RSKD131_0378"
FT   CDS_pept        complement(365944..366495)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0378"
FT                   /product="Hypothetical Protein"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00238"
FT                   /db_xref="InterPro:IPR015235"
FT                   /db_xref="InterPro:IPR027269"
FT                   /db_xref="UniProtKB/TrEMBL:B9KL16"
FT                   /protein_id="ACM00238.1"
FT                   /translation="MTAAAPLPVQDAATSPGAAASGAFRSNGWAALRRHPAGRADLLRW
FT                   GATPALVARHARWGRPVYLATPYTFRAVGPDGRWSRDRSEAAMAEAAREVARLLEVGVT
FT                   AISPVVLSAAALHATMFPRLRIDPFNPVLWEDWCRPLLTVCAAVVVPEIRGWAQSTGIR
FT                   HEVASALEAQVPVFIYGGLP"
FT   gene            complement(366492..366770)
FT                   /locus_tag="RSKD131_0379"
FT   CDS_pept        complement(366492..366770)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0379"
FT                   /product="Hypothetical Protein"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00239"
FT                   /db_xref="GOA:B9KL15"
FT                   /db_xref="UniProtKB/TrEMBL:B9KL15"
FT                   /protein_id="ACM00239.1"
FT                   /translation="MITIMRKVLVAEITAAIHLGAVADFWAAHARKRLGKLSQHFPQDA
FT                   SCDAEEETYRDDTPRSRGPYRMPSGWWLVPSVLAGSAILATALGSLL"
FT   gene            complement(366767..366979)
FT                   /locus_tag="RSKD131_0380"
FT   CDS_pept        complement(366767..366979)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0380"
FT                   /product="Hypothetical Protein"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00240"
FT                   /db_xref="UniProtKB/TrEMBL:B9KL14"
FT                   /protein_id="ACM00240.1"
FT                   /translation="MTYRAFFAARWSRFVRENFDSPEHAAMTFGVDGSTARKWWDGSHS
FT                   PSGFVVGLAYQNFPAEAATTLQAQE"
FT   gene            complement(367096..367308)
FT                   /locus_tag="RSKD131_0381"
FT   CDS_pept        complement(367096..367308)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0381"
FT                   /product="Hypothetical Protein"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00241"
FT                   /db_xref="UniProtKB/TrEMBL:B9KL13"
FT                   /protein_id="ACM00241.1"
FT                   /translation="MDPNIIISEIDAHSEATGLKPTTICQKALGNARLYDRMKRRACKY
FT                   AEEARALRAWMAANSPKEQSTGTLK"
FT   gene            368009..368218
FT                   /locus_tag="RSKD131_0382"
FT   CDS_pept        368009..368218
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0382"
FT                   /product="Hypothetical Protein"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00242"
FT                   /db_xref="UniProtKB/TrEMBL:B9KL12"
FT                   /protein_id="ACM00242.1"
FT                   /translation="MEHFMPATAIRYPAAAPVARFALLDLTEPQLRRLLAAAEAGLPQL
FT                   DAADAETDAELAAILGQAREALGA"
FT   gene            368215..368547
FT                   /locus_tag="RSKD131_0383"
FT   CDS_pept        368215..368547
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0383"
FT                   /product="Hypothetical Protein"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00243"
FT                   /db_xref="GOA:B9KL11"
FT                   /db_xref="UniProtKB/TrEMBL:B9KL11"
FT                   /protein_id="ACM00243.1"
FT                   /translation="MSRILPLTPRDLNAVRHRAEHAPDGASRDLARRALADHAFAVASG
FT                   RALHRARPRPAFRTSRPSPLGPNRTGFLVGALALLGFLFVATVLWAHATDVAETMRQQA
FT                   SAMRGM"
FT   gene            368547..368942
FT                   /locus_tag="RSKD131_0384"
FT   CDS_pept        368547..368942
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0384"
FT                   /product="Hypothetical Protein"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00244"
FT                   /db_xref="InterPro:IPR018753"
FT                   /db_xref="UniProtKB/TrEMBL:B9KL10"
FT                   /protein_id="ACM00244.1"
FT                   /translation="MEAAPHPAPRSGPVPVEGLNAVDLDRMAAAIDSGRIRRPPMKETP
FT                   ADRAVAEAAYQVAADELRQFIERFEQLEAEKKEIGGQQKELMAEAKGRGYAPKILRMIV
FT                   ALRKRTPDDISEEETLLELYKAALGMA"
FT   gene            369065..370876
FT                   /locus_tag="RSKD131_0385"
FT   CDS_pept        369065..370876
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0385"
FT                   /product="ParB family protein"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00245"
FT                   /db_xref="InterPro:IPR003115"
FT                   /db_xref="InterPro:IPR036086"
FT                   /db_xref="UniProtKB/TrEMBL:B9KN33"
FT                   /protein_id="ACM00245.1"
FT                   /translation="MAKDFISRGDLRLIPLAELRLSPLNSRQEIAAEEVEAMAESLAVA
FT                   GLLQNLIGHLTPAGIEIVGGGTRLRALQRLAAEGWSRHPDLIPIDPVPVKVTADLQEAV
FT                   AWAGTENSARSALHPADEVRAYAAMRERGASLSRIARSFARSEAHVERRLKLADLPAEA
FT                   LTALRANEISLEMAKALTLAPSGARCLEVLTSVRGRDVRPEQVRRELTPGTVPSTDRRA
FT                   VFVGLEAYLAAGGTSQRDLFADRTHLEDEALLDRLFAEKGAAEAERIRAAEGWEWATWV
FT                   PEEYVPWTATQKLVRLHARPGKLSDGEEAELAALEDREADGALDEAGRARLAELEARRE
FT                   GGFTDAQRASAGIFVYCSSRDGLSVERAYQQPRAVPRGAPEAAPDLPQSLIEDLHRIRL
FT                   GALQARLMDQSELMLDLLAWSLGGGLRPWARPLAISPTDQPIAPEKGEGTSYPPRLAAR
FT                   LEPNTSLGPDGTPAEFEAFRAQGKKHRNQILTEALARTFCTGSSGLSAALARQLAVEVR
FT                   RIWTPTAQGFLGRCSAGYLDRLWSELVPAAEADQSFQKLKKGEKAKRLEALFADPATRE
FT                   ALGLSREDCAKIDAWVPAELGWPEVTG"
FT   gene            371039..371182
FT                   /locus_tag="RSKD131_0386"
FT   CDS_pept        371039..371182
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0386"
FT                   /product="Hypothetical Protein"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00246"
FT                   /db_xref="UniProtKB/TrEMBL:B9KN34"
FT                   /protein_id="ACM00246.1"
FT                   /translation="MRGLPIPRKVLGGKRLYDRLELEAYADSLSTEGEVKANSCDGAFG
FT                   IT"
FT   gene            371266..372207
FT                   /locus_tag="RSKD131_0387"
FT   CDS_pept        371266..372207
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0387"
FT                   /product="Tyrosine recombinase"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00247"
FT                   /db_xref="GOA:B9KN35"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:B9KN35"
FT                   /protein_id="ACM00247.1"
FT                   /translation="MPEDDPRFVAAWLAEEQRAPTVRSRSQAGTIAAACEAYLGSRSYR
FT                   ELSDGYRPVIRRHVERIKEQGEKALLKDLLPRHIRADLEPLSPPVASSRLKAWRKLAEF
FT                   WLLKGMLDADPSEGVKRKKMGKVAGFTEWTAEDLEAFRARWPIGTAQRLALELYQWTGA
FT                   RCVDVIRLGPQMVGRDGVLTYVQQKTGNPAHVPWTCPAFGLEEQRADLMRCLPVGSPVY
FT                   MLTEYGKPRTQKGVSQWFSAAAREAGLEGRTAHGLRKYRMNALAEHGASVLVMQSWVGH
FT                   TTLLEVQEYTRRADRRRVISGGQPVKRDPAGA"
FT   gene            complement(372241..372317)
FT                   /locus_tag="RSKD131_trnaArg1"
FT   tRNA            complement(372241..372317)
FT                   /locus_tag="RSKD131_trnaArg1"
FT                   /product="tRNA-Arg"
FT   gene            complement(372361..372831)
FT                   /locus_tag="RSKD131_0388"
FT   CDS_pept        complement(372361..372831)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0388"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00248"
FT                   /db_xref="GOA:B9KN36"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:B9KN36"
FT                   /protein_id="ACM00248.1"
FT                   /translation="MPPADVDIRRADPTDPTFQPIFVRHLTLMRETSPPESVHALDPAD
FT                   LAAPGVFFYGMRVGGALVGMGAFKAIDATHCEIKSMHVLSEARGQGLARRLLEHLLAEA
FT                   RGAGFRRMSLETGVEPPFAPARLLYERAGFETCGPFEGYWDDPNSVFMTRSL"
FT   gene            complement(373147..373422)
FT                   /locus_tag="RSKD131_0389"
FT   CDS_pept        complement(373147..373422)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0389"
FT                   /product="ETC complex I subunit conserved region"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00249"
FT                   /db_xref="GOA:B9KN37"
FT                   /db_xref="InterPro:IPR006885"
FT                   /db_xref="InterPro:IPR038532"
FT                   /db_xref="UniProtKB/TrEMBL:B9KN37"
FT                   /protein_id="ACM00249.1"
FT                   /translation="MQSGTGKAKGWVLVFESREARDIDPLMGWTSSADTQNQVVLQFDS
FT                   REAALDYAKAHRIEVEVTEAKPRKANIRPRGYGENFATDRRGAWTH"
FT   gene            complement(373549..373722)
FT                   /locus_tag="RSKD131_0390"
FT   CDS_pept        complement(373549..373722)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0390"
FT                   /product="UvrB protein"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00250"
FT                   /db_xref="UniProtKB/TrEMBL:B9KN38"
FT                   /protein_id="ACM00250.1"
FT                   /translation="MRHDDSLQPLRFDPFLFANKGGAAGSLPSINPRPLERQGKQQNAV
FT                   GRLHPTPHPPLP"
FT   gene            373714..375897
FT                   /locus_tag="RSKD131_0391"
FT   CDS_pept        373714..375897
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0391"
FT                   /product="UvrABC system protein B"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00251"
FT                   /db_xref="GOA:B9KN39"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR004807"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR024759"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036876"
FT                   /db_xref="InterPro:IPR041471"
FT                   /db_xref="UniProtKB/TrEMBL:B9KN39"
FT                   /protein_id="ACM00251.1"
FT                   /translation="MPHNNTNLPMHRPEVLTRPKLEGGRRFEMKTPFQPAGDQPTAIAE
FT                   LAAGVQGGEQNQVLLGATGTGKTFTMAKIIEETQRPAIILAPNKTLAAQLYGEFKGFFP
FT                   DNAVEYFVSYYDYYQPEAYVARSDTYIEKESQINEQIDRMRHSATRALLERDDVIIVAS
FT                   VSCIYGIGSVETYSAMTQDLIVGESYDQRQVIAELVAQQYRRNDQAFQRGSFRVRGDSL
FT                   EVWPAHLEDRAWRFSFFGEELESIVEFDPLTGAKTDSFKQIRIYANSHYVTPRPTMQQA
FT                   IQGIKRELRQRLDQLVNEGKLLEAQRLEQRTNFDLEMLEATGVCNGIENYSRYLTGRAP
FT                   GEPPPTLFEFIPDNAIVFADESHVTVPQIGGMYRGDYRRKFTLAEHGFRLPSCMDNRPL
FT                   KFEEWDAMRPQSVFVSATPAAWELEQAGGVFAEQVIRPTGLLDPVVEIRPVEMQVDDLL
FT                   DEIRRVAAAGLRVLVTVLTKRMAEDLTEYFHEQGIRIRYMHSDIDTIERIEILRDLRLG
FT                   AFDVLVGINLLREGLDIPECGLVAILDADKEGFLRSETSLIQTIGRAARNADGRVIMYA
FT                   DRITGSMERALRETERRREKQIAYNIEHGITPQTVRKNVEDVLSGLWQGDTDQSRVTAK
FT                   VDKPMVGANLAAHLDGLRVSMRKAAENLEFEEAARLRDEIKRLEAVELAIADDPLARQT
FT                   AVEEAAEAAVKSSGRSTAGRAGQRGGNKRRRGH"
FT   gene            376282..376950
FT                   /locus_tag="RSKD131_0392"
FT   CDS_pept        376282..376950
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0392"
FT                   /product="Hypothetical Protein"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00252"
FT                   /db_xref="UniProtKB/TrEMBL:B9KNH4"
FT                   /protein_id="ACM00252.1"
FT                   /translation="MPASGLAGPWARETGRVFLTLSQQQDGAGESWTGLWAEYGLTPRI
FT                   TLGLDAGRSGRGDGKLILWAQKAWERGPHRIAASAGLGAVRLEGALAPLAQLGGAWGRG
FT                   IETRFGPGWLALEMRGIVTGRNVTLEQRLDAQTVATVAFLVPETSAKAELTLGLSPRDR
FT                   LKVIEQLQLEYGRDSGFDARLATSLVYDLARPTKLEMGLILPIESASEPALKLGLWLEF
FT                   "
FT   gene            complement(376956..377291)
FT                   /locus_tag="RSKD131_0393"
FT   CDS_pept        complement(376956..377291)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0393"
FT                   /product="Hypothetical Protein"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00253"
FT                   /db_xref="GOA:B9KNH5"
FT                   /db_xref="UniProtKB/TrEMBL:B9KNH5"
FT                   /protein_id="ACM00253.1"
FT                   /translation="MRQRGPEAPPAAFDPQQGEKIMEEFIQGVGIVGLVVLALVGLAAG
FT                   WIASAVAGGRHRGRYMIIGLLAALATPLLLLALGVTVLAASGLVAMVVAALIGAAVVLF
FT                   LAKLIFD"
FT   gene            complement(377329..377646)
FT                   /locus_tag="RSKD131_0394"
FT   CDS_pept        complement(377329..377646)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0394"
FT                   /product="Antibiotic biosynthesis monooxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00254"
FT                   /db_xref="GOA:B9KNH6"
FT                   /db_xref="InterPro:IPR007138"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:B9KNH6"
FT                   /protein_id="ACM00254.1"
FT                   /translation="MTQIDPAFTGQTVITTFEMTPGTCADLLEELQATLDSFIRHQPGF
FT                   ISASLHVNDAQTRIANYSQWQRREDFQAMLRTAEMRERARRFATLCRSFEPVMYEVVAG
FT                   F"
FT   gene            377852..378040
FT                   /locus_tag="RSKD131_0395"
FT   CDS_pept        377852..378040
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0395"
FT                   /product="Hypothetical Protein"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00255"
FT                   /db_xref="GOA:B9KNH7"
FT                   /db_xref="UniProtKB/TrEMBL:B9KNH7"
FT                   /protein_id="ACM00255.1"
FT                   /translation="MQLIDPNHPFFRAAWRRWLTAILPIAWSGVELFALHSPIWAVIFL
FT                   LLGAYAFWVLVIKGPDA"
FT   gene            378294..378437
FT                   /locus_tag="RSKD131_0396"
FT   CDS_pept        378294..378437
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0396"
FT                   /product="Entericidin EcnAB precursor"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00256"
FT                   /db_xref="GOA:B9KNH8"
FT                   /db_xref="InterPro:IPR012556"
FT                   /db_xref="UniProtKB/TrEMBL:B9KNH8"
FT                   /protein_id="ACM00256.1"
FT                   /translation="MKKSFLLLPLLALMGLAACETVEGAGQDLSAAGSAISQESREAQS
FT                   GM"
FT   gene            complement(378475..380283)
FT                   /locus_tag="RSKD131_0397"
FT   CDS_pept        complement(378475..380283)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0397"
FT                   /product="GTP-binding protein lepA"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00257"
FT                   /db_xref="GOA:B9KNH9"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006297"
FT                   /db_xref="InterPro:IPR013842"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035654"
FT                   /db_xref="InterPro:IPR038363"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9KNH9"
FT                   /protein_id="ACM00257.1"
FT                   /translation="MPRMTQLDLIRNFSIVAHIDHGKSTLADRLIQLTGTVAERDMKAQ
FT                   ILDSMEIERERGITIKANTVRIDYPAKDGRTYVLNLIDTPGHVDFAYEVSRSMRAVEGS
FT                   LLVVDASQGVEAQTLANVYQALDAGHEIVPVLNKIDLPAAEPERVKSQIEDVIGLDASD
FT                   AVLISAKSGLGIPDVLEAIVHRLPPPKGDREAPLKAMLVDSWYDAYLGVVVMIRVMDGV
FT                   IRKGDRVKMMQTGAVYGIDRLAVLKPQMVDIAELGPGEIGVLTASIKQVRDTRVGDTIT
FT                   HEKKGCAAPLPGFKPAQPVVFCGLFPVDANDFEALREAMEKLALNDASFTYEMETSAAL
FT                   GFGFRCGFLGLLHLEVVRDRLEREYDLDLITTAPSVVYQIYMKDGTLQELHNPTDMPDL
FT                   TYVDHIEEPRIRATIMVPDEYLGDVLKLCQDRRGIQLDLSYAGARAMVVYDLPLNEVVF
FT                   DFYDRLKSVTKGYASFDYQITGYREDFLVKMSILVNDEPVDALSMMVHRDRADMRGRAM
FT                   VEKLKELIPRHMFKIPIQAAIGGRVIARETISAMRKDVTAKCYGGDATRKRKLLDKQKA
FT                   GKKKMRQFGKVEIPQQAFINALKMDS"
FT   gene            complement(380681..380755)
FT                   /locus_tag="RSKD131_trnaGly1"
FT   tRNA            complement(380681..380755)
FT                   /locus_tag="RSKD131_trnaGly1"
FT                   /product="tRNA-Gly"
FT   gene            complement(381209..384691)
FT                   /locus_tag="RSKD131_0398"
FT   CDS_pept        complement(381209..384691)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0398"
FT                   /product="Pyruvate carboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00258"
FT                   /db_xref="GOA:B9KNI0"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR001882"
FT                   /db_xref="InterPro:IPR003379"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005481"
FT                   /db_xref="InterPro:IPR005482"
FT                   /db_xref="InterPro:IPR005930"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR011764"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:B9KNI0"
FT                   /protein_id="ACM00258.1"
FT                   /translation="MPGGERMAEFRKILIANRGEIAIRVMRAANEMGKKTVAVYAEEDK
FT                   LSLHRFKADEAYRIGEGLSPVGAYLSIPEIIRVAQMSGADAIHPGYGLLSENPDFVEAC
FT                   DAAGIAFIGPKAETMRALGDKASARRVAMAAGVPVIPATEVLGDDMEEIKRQAAEIGYP
FT                   LMLKASWGGGGRGMRPITSEAELADKVREGRREAEAAFGNGEGYLEKMIQRARHVEVQI
FT                   LGDKFGAIYHLYERDCTVQRRNQKVVERAPAPYLTEEQRAEICELGRRICAHVNYECAG
FT                   TVEFLMDMDSEKFYFIEVNPRVQVEHTVTEEVTGIDIVQSQIRIAEGATLAEATGCPSQ
FT                   DDIKLSGHALQCRVTTEDPQNNFIPDYGRLTAYRSATGMGIRLDGGTAYAGGVITRYYD
FT                   SLLVKVTAWAPTPEKAIARMDRALREFRIRGVATNIAFVENLLKHPSFLDYSYTTKFID
FT                   TTPDLFNFKPRRDRATKILTYIADITVNGHPETAGRARPSAELKDPKAPEPKGAPQPGT
FT                   RTLLEEKGPQAVADWMAAQTRVLMTDTTMRDGHQSLLATRMRSIDMIKVTPAYAANLGG
FT                   LFSVECWGGATFDVAYRFLQECPWQRLRDIRARLPNVMTQMLLRASNGVGYTNYPDNVV
FT                   QEFVRQAAETGVDVFRVFDSLNWVENMRVAMDAVIEANKVCEGTICYTGDLLDPDRSKY
FT                   DLNYYVGMGRALRDAGAHVLGLKDMAGLLKPAAARVLVKALKEEVGLPIHFHTHDTSGI
FT                   AGATVLAACDAGVDAVDAAMDAFSGGTSQPCLGSIVEALKHTDRDTGLDIAAIREISDY
FT                   WGHVRQQYSAFESGLPSPASEVYLHEMPGGQFTNLKAQARSMGLEERWSEVAQAYADAN
FT                   RMFGDIVKVTPSSKVVGDMALMMVAQGLTREEVEDPEVEVSFPDSVVDMLKGNLGQPHG
FT                   GWPEPILKKVLKGEAPSTERPGAHLPPVDIAAAREKLLSEIKQGDDDPLDTAVDAEDLN
FT                   GYLMYPKVFTDYRARHRIYGPVRTLPTRTFFYGMEPGEEISAEIDPGKTLEIRLSAVGE
FT                   TSDDGDAKVFFELNGQPRVIRVANRAVKAKTATRPKAQDGNPAHVGAPMPGSVASVAVS
FT                   AGQKVKPGDLLVTIEAMKMETGLHADRAATVKAVHVGPGAQIEAKDLLVELED"
FT   gene            384713..384859
FT                   /locus_tag="RSKD131_0399"
FT   CDS_pept        384713..384859
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0399"
FT                   /product="Hypothetical Protein"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00259"
FT                   /db_xref="UniProtKB/TrEMBL:B9KNI1"
FT                   /protein_id="ACM00259.1"
FT                   /translation="MVPRCGAIAQGRRPGRKSDRSGACRNRFCERLRNTSLTPGRGRLD
FT                   WRA"
FT   gene            384847..387207
FT                   /locus_tag="RSKD131_0400"
FT   CDS_pept        384847..387207
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0400"
FT                   /product="ATP-dependent DNA helicase, Rep family"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00260"
FT                   /db_xref="GOA:B9KNI2"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR013986"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR018260"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="UniProtKB/TrEMBL:B9KNI2"
FT                   /protein_id="ACM00260.1"
FT                   /translation="MAGMSQFDESEAFEAAVPLSQRAMAARPRPYIDELNPAQRAAVLA
FT                   LDGPVLMLAGAGTGKTKALTARIVHLLDSGKARPNEILAVTFTNKAAREMKDRVARLLG
FT                   QVEGMPWMGTFHAISVKILRRHAELVGLKSNFTILDTDDQLRLLKQLIVAANIDEKRWP
FT                   ARMLAGLIDHWKNRAWTPAKVPASEASAYNNRGTELYDQYQQRLRELNATDFGDLLLHV
FT                   LTIFQSHPDVLEQYRRWLRYILVDEYQDTNVAQYMWLRLLAQTHRNICCVGDDDQSIYG
FT                   WRGAEVGNILRFEKDFPGAQVIRLEQNYRSTPHILAAASGIIAANAGRLGKTLWTERQE
FT                   GEKVRLIGHWDGEEEARWIGDEVESFQRGRGDLGPFRLDDMAILVRASHQMRAFEDRFL
FT                   TIGLPYRVIGGPRFYERLEIRDAMAYFRLAVSPDDDLAFERVVNQPKRGLGDKAQQEIQ
FT                   REARAHGTSLLEGARSLLARGGIGGKGAGQLRAFVDGMDRWHGTTLDRDHDHIRLAEQI
FT                   LDESGYTAMWQADKTPEAPGRLENLKELVKALEQFENLQGFLEHVALIMENETEESVDK
FT                   VTIMTLHAAKGLEFPVVFLPGWEDGLFPSQRAMDETGLKGLEEERRLAYVGITRAEQLC
FT                   TISFAANRRVYGQWQSQLPSRFIDELPSAHVEVLTPPGLYGGGYGAAGMASSLEAQALR
FT                   ADVYDSPGWKRMQTRAGGRPMAQPRESRHVTIDLEAVSAFAEGDRVFHQKFGYGHVMGI
FT                   EGDKLDIDFEKAGAKKVVARFVVAAHQADDIPF"
FT   gene            complement(387228..388373)
FT                   /locus_tag="RSKD131_0401"
FT   CDS_pept        complement(387228..388373)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0401"
FT                   /product="Benzoate transporter precursor"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00261"
FT                   /db_xref="GOA:B9KNI3"
FT                   /db_xref="InterPro:IPR004711"
FT                   /db_xref="UniProtKB/TrEMBL:B9KNI3"
FT                   /protein_id="ACM00261.1"
FT                   /translation="MRLSLLSAALVAALVGYGSTIALVLAAAAALGATEAQTASWVLAI
FT                   CLGKAVGSAFLSWRSRVPVILAWSTPGAALVAATEGITMPEAVGAFLLAGLLIALTGAL
FT                   KPLGRAVALIPDGIAGGMLAGVLLPFCLKLAGAAEALPLLVLPAIAVFALVRLWNPALA
FT                   VLAALAGGSALAFAGEAAMPELPLALPTLTFIPPAFDPTVLIGLGLPLYLVTMASQNLP
FT                   GFAVLRAAGYEPPVRSALTVTGGLSALTAPFGAHTVSMAAITAAICLGDEVHPDRSRRW
FT                   IVGLVYAAVWVGLGLFGPAILACIAALPPALVTALVGLALLGPLTGALTAAFAHPEQRF
FT                   AAVVTLAVTGSGVAIAGIGAAFWGLLAGLAVHVTERAARRR"
FT   gene            complement(389295..389447)
FT                   /locus_tag="RSKD131_0402"
FT   CDS_pept        complement(389295..389447)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0402"
FT                   /product="Hypothetical Protein"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00262"
FT                   /db_xref="InterPro:IPR009506"
FT                   /db_xref="UniProtKB/TrEMBL:B9KNI4"
FT                   /protein_id="ACM00262.1"
FT                   /translation="MASVKLALAQRRIYRQTVRELNSLTTRELADLGIHRSMITRIAME
FT                   AAYGL"
FT   gene            389780..390841
FT                   /locus_tag="RSKD131_0403"
FT   CDS_pept        389780..390841
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0403"
FT                   /product="Septum formation inhibitor-activating ATPase-like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00263"
FT                   /db_xref="GOA:B9KNI5"
FT                   /db_xref="InterPro:IPR000808"
FT                   /db_xref="InterPro:IPR002744"
FT                   /db_xref="InterPro:IPR019591"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033756"
FT                   /db_xref="InterPro:IPR034904"
FT                   /db_xref="UniProtKB/TrEMBL:B9KNI5"
FT                   /protein_id="ACM00263.1"
FT                   /translation="MPIARESVLAVLDRIPLPDGGTLVSRDLIRALTVEGDAVRFVIEA
FT                   PSAEAARALEPVRAEAERALRALPGVAGVQAVMTAHGPAAPSLKIGQHPTPQAAGPQPI
FT                   AGIDRIIAIGSGKGGVGKSTVSSNLAVALARQGRKVGLLDADIYGPSQARMMGVNRRPA
FT                   SPDGKTILPPSAHGVTMMSLGLMLKEDEAVIWRGPMLMGALQQLLGQVAWGELDVLLVD
FT                   LPPGTGDIQLTLCQRTQVTGAIVVSTPQDVALLDARKALDMFRKLKTPVLGLIENMSSY
FT                   VCPNCGHEAHIFGHGGVAEEARRLDVPFLGELPLDLSVRLAGDEGRPVAAGEGPIAEAY
FT                   ADLARRLVAGGMA"
FT   gene            complement(391465..391638)
FT                   /locus_tag="RSKD131_0404"
FT   CDS_pept        complement(391465..391638)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0404"
FT                   /product="Hypothetical Protein"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00264"
FT                   /db_xref="UniProtKB/TrEMBL:B9KNI6"
FT                   /protein_id="ACM00264.1"
FT                   /translation="MPVPSLGVQLRTHTWGDVCSHARRICHWMKAGACMKPAFRLFGVC
FT                   RPCSLSRSHLVS"
FT   gene            391741..392247
FT                   /locus_tag="RSKD131_0405"
FT   CDS_pept        391741..392247
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0405"
FT                   /product="Protein mraZ"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00265"
FT                   /db_xref="GOA:B9KNI7"
FT                   /db_xref="InterPro:IPR003444"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR020603"
FT                   /db_xref="InterPro:IPR035642"
FT                   /db_xref="InterPro:IPR035644"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="InterPro:IPR038619"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9KNI7"
FT                   /protein_id="ACM00265.1"
FT                   /translation="MAEAFRGEYNQKVDAKARVSIPAPFRRVIEAGDPKFSGGRSSFVL
FT                   VYGGDRSYVECYTISEMERIEERIRSLPMGTPKRRYLERNMITLALNMELDEDGRIVLP
FT                   PKGREKLGISPDELKGGTEATFAGTLNKFQIWKADIYAAELAAEEEVLLPPGADMLSLL
FT                   EETGL"
FT   gene            392251..393246
FT                   /locus_tag="RSKD131_0406"
FT   CDS_pept        392251..393246
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0406"
FT                   /product="S-adenosyl-L-methionine-dependent
FT                   methyltransferase mraW"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00266"
FT                   /db_xref="GOA:B9KNI8"
FT                   /db_xref="InterPro:IPR002903"
FT                   /db_xref="InterPro:IPR023397"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9KNI8"
FT                   /protein_id="ACM00266.1"
FT                   /translation="MAEADTERRPHIPVLLRPLLAAVAPVEGTWLDGTFGAGGYARGLL
FT                   EAGADRVIGVDRDPLALEMASGWAGDYGDRLRLVAGTFSQLDSHAGAPLDGVVLDLGVS
FT                   SMQLDLAERGFSFQKDGPLDMRMSQEGESAADLVNTASEETLADILYHYGEERASRRIA
FT                   RAIVEARAAAPITRTLALAEIVARCLPRPKPGQMHPATRSFQAIRIAVNAEFSELVEGL
FT                   EAAERALRPGGRLAVVTFHSLEDRIVKRFLQLRSGGEGQGNRYAPETRADAPRFTLPLR
FT                   RAISPDEAELAENPRARSARLRVGVRTDAPAGKVDPQALGTPLIPKKGRR"
FT   gene            393247..393606
FT                   /locus_tag="RSKD131_0407"
FT   CDS_pept        393247..393606
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0407"
FT                   /product="FtsL"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00267"
FT                   /db_xref="UniProtKB/TrEMBL:B9KNI9"
FT                   /protein_id="ACM00267.1"
FT                   /translation="MRPVLYVLTFLAVMGLAFWAYRENYATQQALKDVSALNREIATLR
FT                   ESLSVQRAEWAYLNRPDRLRELAALNFDRLGLLPLEAVQFGSAAQVSYPPDPLQVVTPQ
FT                   DLRPGDISGEVGEPL"
FT   gene            393603..395396
FT                   /locus_tag="RSKD131_0408"
FT   CDS_pept        393603..395396
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0408"
FT                   /product="Peptidoglycan glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00268"
FT                   /db_xref="GOA:B9KNJ0"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR005311"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR036138"
FT                   /db_xref="UniProtKB/TrEMBL:B9KNJ0"
FT                   /protein_id="ACM00268.1"
FT                   /translation="MIRTPLRPLARILDARAKGENPDSIERENRRIRHEAMRDKARNRA
FT                   EGRLLLLGLSFFLAFSVIGARMGLLASTQPMEPRAAASGAEILNQRADITDRSGRILAT
FT                   NLLTHSLYAHPQDMVDPLRVARELAAIFPELKEEDLAKRFTDGRRFLWIRKKLSPEQMQ
FT                   QVHDIGDPGLLFGPREMRLYPNGRLAAHVLGGTSFGAEGVHSAEVIGTAGIEKALDTRL
FT                   RDPAAAGEPLQLSIDLTVQAAITEVLGAGMKMMNAKGATAILMEAHSGEILALASLPDF
FT                   DPNDRPAPLVDRNADPGDSPLFNRAVQGVYELGSTFKIFTVAQAMELGLVNPQTIVDAD
FT                   APMRWGRFLIKEFKNHNYGPLLSVTDVIVKSSNVGVARLALQIGGLRQQAFLRSLGFFD
FT                   PTPVELVEAPYARPLVPAKWAEITTITTSYGHGLAASPMHLAAAYGTIANGGITVKPTL
FT                   LHGNERPQGTRAMRAEVAHDALSMLRQVVTRGTASYGDVEGYEVAGKTGTADKPNPRGG
FT                   YYHDKVVNTFATIFPASDPRYVLIVTLDEPVETSGPQPRRTAGYTAVPVAAEIIRRTAP
FT                   LLGLRPKVEAPPVDRITAVRN"
FT   gene            395411..396898
FT                   /locus_tag="RSKD131_0409"
FT   CDS_pept        395411..396898
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0409"
FT                   /product="UDP-N-acetylmuramoylalanyl-D-glutamate--2,
FT                   6-diaminopimelate ligase"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00269"
FT                   /db_xref="GOA:B9KNJ1"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005761"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR035911"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:B9KNJ1"
FT                   /protein_id="ACM00269.1"
FT                   /translation="MADRAATLSALGLTPAGGRGGDIAVTGLAVDSRQVRPGTLFAALP
FT                   GSRSHGASFVPAALAAGATAILTDAAGAALAREALAGSGAALVVAEDPRQTLAGAAALW
FT                   FGRQPATVVAVTGTNGKTSVATFTRQIWAALGHAAINIGTTGVEGAFAAPSAHTTPEPI
FT                   TLHRLLAEAAEAGVTHAAMEASSHGLEQRRLDGVHLAAAGFTNFTQDHLDYHETFEAYF
FT                   AAKAGLFTRVLPDEGTAVVNLDDPRGPEIAALARARAQRVIGTGFHADADLRLLSQRFD
FT                   ATGQDLRFSWQGEVHLARLPLIGGFQAWNVAVAASLAIGAGDAPERVFATFSRLQGVRG
FT                   RMQLAATRKNGASVFVDYAHTPDALATALKALRPHVMGRIVVVFGAGGDRDRGKRPLMG
FT                   RAAADHADVLYVTDDNPRTEDPAAIRRAILEACPEAHEVGDRAEAILRGVDALTPGDAL
FT                   LIAGKGHESGQVVGTDIFPFDDAEQASIATAALDGLI"
FT   gene            396987..398420
FT                   /locus_tag="RSKD131_0410"
FT   CDS_pept        396987..398420
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0410"
FT                   /product="UDP-N-acetylmuramoylalanyl-D-glutamyl-2,
FT                   6-diaminopimelate--D-alanyl-D-alanyl ligase precursor"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00270"
FT                   /db_xref="GOA:B9KNJ2"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005863"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR035911"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:B9KNJ2"
FT                   /protein_id="ACM00270.1"
FT                   /translation="MTPLWTSDEAAAATGGCATRAFAATGVSIDTRSLGPGDLFVALTD
FT                   QRDGHAFVAEALARGAAAALVSRCPEGLPEDAPLLLVPDVLEGLRALGRAARARTRARV
FT                   VGVTGSVGKTSTKEMLRATLGGQGTVHAAEASYNNHWGVPLTLARMPADVDFAVVEIGM
FT                   NHPGEIAPLSRLARPHLALITTVAAAHLEAFDSLAAIAEEKAAILEGLEPGGRAILPAG
FT                   LEVSPVLAARAAALGVPAVTFGQSADADWRLADIQITPEATVARASHAGGTFLFKVLTP
FT                   GRHFASNALATLAAAEALGLDLTIAACDLGLWTPPSGRGTRERIALDPVDEAGFDLIDD
FT                   AFNANPASMAASLELLAAMAPTDGVGRIAAGRRIAILGDMLELGPTEAELHRAVADHPA
FT                   LAEIALVHCVGPRMRALHEALPRRQRGEWVETAAELVPRARLLVDAGDIVLVKGSKGIK
FT                   VSLVVDALRKLGQSSPSRT"
FT   gene            398433..399515
FT                   /locus_tag="RSKD131_0411"
FT   CDS_pept        398433..399515
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0411"
FT                   /product="Phospho-N-acetylmuramoyl-pentapeptide-transferase"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00271"
FT                   /db_xref="GOA:B9KNJ3"
FT                   /db_xref="InterPro:IPR000715"
FT                   /db_xref="InterPro:IPR003524"
FT                   /db_xref="InterPro:IPR018480"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9KNJ3"
FT                   /protein_id="ACM00271.1"
FT                   /translation="MLYLLTAFSDGGDIFNLFRYLTFRAGAAFFTALIFGFLFGRPLID
FT                   FLRRKQGKGQPIRDDGPTTHFAKAGTPTMGGLLILSALVVSTLLWARLDNPYVWIVLLV
FT                   TVAFGLIGFADDYAKVKKQNTKGVPGRVRFLIGLLIAALAAIAAAWSHPPDLTLQLAMP
FT                   FFKDALINLGWFFVPFAMVVIVGAANAVNLTDGLDGLAIMPVMIAGTTLGVIAYVVGNF
FT                   NLTDYLGVHFVPGTGELLIFSSALVGGGLGFLWYNAPPAAVFMGDTGSLALSGALGAIA
FT                   VCTKHEIVLAIVGGLFVTEALSVIIQVLYFKRTGRRVFLMAPIHHHFEKKGWAEPQIVI
FT                   RFWIISLILALIGLSTLKLR"
FT   gene            399612..400193
FT                   /locus_tag="RSKD131_0412"
FT   CDS_pept        399612..400193
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0412"
FT                   /product="Transport-associated"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00272"
FT                   /db_xref="InterPro:IPR007055"
FT                   /db_xref="UniProtKB/TrEMBL:B9KNJ4"
FT                   /protein_id="ACM00272.1"
FT                   /translation="MAKAPHESPEEGDPKDPYATGDAARPGSATMADRETEQPRDIDDT
FT                   GRTDASGYDVDPPPDARTRHSHDIGLSDEDAEHQGWREFDSTVEWEGEEPYPAEPATDV
FT                   EEAAEEEALADEDLADDTGEEAPVADLAEAVTALLEDDLEIDVADLSVEVRGATVILRG
FT                   SAGGAEDSERAAERAAGVPGVRAVENELSV"
FT   gene            400569..401966
FT                   /locus_tag="RSKD131_0413"
FT   CDS_pept        400569..401966
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0413"
FT                   /product="UDP-N-acetylmuramoylalanine--D-glutamate ligase"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00273"
FT                   /db_xref="GOA:B9KNJ5"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005762"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9KNJ5"
FT                   /protein_id="ACM00273.1"
FT                   /translation="MIPVRGLEGRKVAVLGLGRSGLATARALEAGGAEPLLWDDSPEAR
FT                   AKAEGQGFTVTDLTRDRAFEGVALLVTSPGIPHLYPAPNPVIARAMAAGVPVDNDIGLF
FT                   FRSFATRDWDAFDQMPRVVCVTGSNGKSTTTALIHHILSEAGRPTQMAGNIGRGVLDLD
FT                   PARDGEVVVLELSSYQTDLARALTPDVAVFTNLSPDHLDRHGGMGGYFAAKRRLFAEGG
FT                   PDRAVIGVDEPEGLYLAGQLSVAPEDDRVIRISSGQKLERFGWSVFARKGFLAEWRKGR
FT                   QMASIDLRAMPGLPGAHNHQNACAAYAACRTLGLAPRQIEAALASFAGLPHRSQTVGEK
FT                   GGVRFVNDSKATNVDSAAKALQAFPKIRWIAGGLGKDGGIVALQPHLGSVVKAYLIGHS
FT                   ARDFALQIGATDHEICETMERAVARAAEEAQPGEVVLLAPAAASFDQYPNFEKRGEDFM
FT                   EKVKALL"
FT   gene            402022..402492
FT                   /locus_tag="RSKD131_0414"
FT   CDS_pept        402022..402492
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0414"
FT                   /product="Glutathione-dependent formaldehyde-activating,
FT                   GFA"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00274"
FT                   /db_xref="GOA:B9KNJ6"
FT                   /db_xref="InterPro:IPR006913"
FT                   /db_xref="InterPro:IPR011057"
FT                   /db_xref="UniProtKB/TrEMBL:B9KNJ6"
FT                   /protein_id="ACM00274.1"
FT                   /translation="MEGRCICGEVAYRLTERPLFVHCCHCSWCQRESGSAFALNALIET
FT                   DRIELLTGQPESVAIPSHSGKGQEVLRCPRCRVAVWSHYAGAGPLMAFVRVGTLAEPAA
FT                   CPPDIHIYTTTKLPWVRLDEGVPAMADYYARSQHWPEPSLARWKILRERMSG"
FT   gene            complement(402840..403310)
FT                   /locus_tag="RSKD131_0415"
FT   CDS_pept        complement(402840..403310)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0415"
FT                   /product="Activator of Hsp90 ATPase 1 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00275"
FT                   /db_xref="InterPro:IPR013538"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:B9KNJ7"
FT                   /protein_id="ACM00275.1"
FT                   /translation="MADEIQIGPGSATRLEFRRHFAATPEQLWAALTSPALLPAWLFAR
FT                   GWPMTECVFEPHKGGLIRQVWTGPEGRTRGLTGRVILAEPPHRLIHSELYDEDWTGGET
FT                   LVTLQLLPVEGGTELAMAVDYATPEARDAVAASAMAAEMEEAYRHLDRMLAA"
FT   gene            403496..404653
FT                   /locus_tag="RSKD131_0416"
FT   CDS_pept        403496..404653
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0416"
FT                   /product="Cell division protein FtsW"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00276"
FT                   /db_xref="GOA:B9KNJ8"
FT                   /db_xref="InterPro:IPR001182"
FT                   /db_xref="InterPro:IPR013437"
FT                   /db_xref="UniProtKB/TrEMBL:B9KNJ8"
FT                   /protein_id="ACM00276.1"
FT                   /translation="MVYGSMPVRATEPVLPRWWRTIDKWSLTSILVLFGIGLLLGLAAS
FT                   VPLATRNGLDPFYYVQRQAFFGGMAIVAMFAVSMMSPDMVRRLGVLGFAGAFVALVLLP
FT                   FFGTDFGKGAVRWFSFGFASVQPSEFLKPGFVILGAWLMAASQELNGPPGKSFSFALTT
FT                   VIVLLLAMQPDFGQAALVLFGWSVMYFVAGAPMTLIAIIMSIVGAGAFFAYNSSEHFAR
FT                   RIDGFLNPDLDPRTQLGYATNAIQEGGFFGVGVGEGQVKWSLPDAHTDFIIAVAAEEYG
FT                   LILVLIILALYGTVTVRSLFRLMRERDPFIRLAGTGLACIFGVQAMINMGVAVRLLPAK
FT                   GMTLPFVSYGGSSVIAAGVTVGMLLAMTRSRPQGEIGDILFKRGR"
FT   gene            404703..405749
FT                   /locus_tag="RSKD131_0417"
FT   CDS_pept        404703..405749
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0417"
FT                   /product="UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide)
FT                   pyrophosphoryl-undecaprenol N-acetylglucosamine
FT                   transferase"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00277"
FT                   /db_xref="GOA:B9KNJ9"
FT                   /db_xref="InterPro:IPR004276"
FT                   /db_xref="InterPro:IPR006009"
FT                   /db_xref="InterPro:IPR007235"
FT                   /db_xref="UniProtKB/TrEMBL:B9KNJ9"
FT                   /protein_id="ACM00277.1"
FT                   /translation="MFPAQALAEAMVRRGWRVKLSTDARGARYAGGFPHVVEIEEVSSA
FT                   TFARGGPLAKALVPLRIAGGVASAVAGFLRDRPSVVVGFGGYPSIPALSAAVALRLPRM
FT                   IHEQNGVLGRVNRLFAPRVQAVCCGTWPTDLPEGVEGYYTGNPVRAAVLERAAAPYIVP
FT                   GDYPMSLVVIGGSQGARVLSDVVPEAIARLPEEILASLRIAHQAREEDVARVTEAYDRA
FT                   GLLAEVKTFFTDIPRRLSEAQLVISRSGASSVADISIIGRPAILVPFAAATADHQTANA
FT                   RGLVEAEAAILIPESALDPAALSEHIAAVLSQPDAARQMARNALAHGRPDATERLVEVV
FT                   EHLARKET"
FT   gene            405746..407158
FT                   /locus_tag="RSKD131_0418"
FT   CDS_pept        405746..407158
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0418"
FT                   /product="UDP-N-acetylmuramate--L-alanine ligase"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00278"
FT                   /db_xref="GOA:B9KNK0"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005758"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9KNK0"
FT                   /protein_id="ACM00278.1"
FT                   /translation="MNAATKLPGELGPIHFVGIGGIGMSGIAEVLMTLGYRVQGSDAKA
FT                   SKITERLVSLGATFFEGQRAGNLGEAAVVVISSAIKKGNPELEEARLRGLPVVRRAEML
FT                   AELMRMRSNIAIAGTHGKTTTTTMVATLLDKGGFDPTVINGGVIHAYGSNARAGAGEWM
FT                   VVEADESDGSFNRLPATIAIVTNIDPEHMEHWGSFDALRKGFYDFVTNIPFYGLAVCCT
FT                   DHAEVQALVGRVTDRRIVTFGFNAQADVRAINLRYENGIAHFDVALQSEGTGHVIEGMS
FT                   LPMPGDHNVSNALAAVAVARHLGMKKDEIREALAAFGGVNRRFTKVGEVGGVTIIDDYG
FT                   HHPVEIAAVLKAARQAVKGRVIAVHQPHRYSRLHSLFDDFCTCFNEADVVAIAEVYAAG
FT                   EDPIPGAGRDDLVAGLIAHGHRHARAILCEDDLERLVREQARPGDMVVCLGAGTISAWA
FT                   NNLPARLMGKAA"
FT   gene            407172..407426
FT                   /locus_tag="RSKD131_0419"
FT   CDS_pept        407172..407426
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0419"
FT                   /product="Hypothetical Protein"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00279"
FT                   /db_xref="GOA:B9KNK1"
FT                   /db_xref="InterPro:IPR018919"
FT                   /db_xref="UniProtKB/TrEMBL:B9KNK1"
FT                   /protein_id="ACM00279.1"
FT                   /translation="MVAPLLLAGLWVVAAMAVHHLPARVHWLGLALLILAGIPLLGWVT
FT                   YRHGPFLGMFALILGAASLYWPVGRFGGRLRRPPPEHVE"
FT   gene            407423..408349
FT                   /locus_tag="RSKD131_0420"
FT   CDS_pept        407423..408349
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0420"
FT                   /product="UDP-N-acetylenolpyruvoylglucosamine reductase"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00280"
FT                   /db_xref="GOA:B9KNK2"
FT                   /db_xref="InterPro:IPR003170"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR011601"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="InterPro:IPR036635"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9KNK2"
FT                   /protein_id="ACM00280.1"
FT                   /translation="MMPPVRGTLTEGRILADLTWLRVGGPADWLFQPADEADLEQFLAA
FT                   LDPAVPVFPMGVGSNLIVRDGGLRAVVIRLGRGFNAIRIEGDRVIAGAAALDAHVARRA
FT                   ADAGRDLTFLRTIPGSIGGAVRMNAGCYGSYVADHLIEVRAVTREGRAVILPAAELGLA
FT                   YRQSALPEGCVLTEATFRAEAGDPAELARRMEEQIARRDSSQPTRERSAGSTFRNPAGF
FT                   SSTGRADDTHELKAWKLIDEAGMRGARRGGAQMSEMHSNFLINTGGATAADLEGLGEEV
FT                   IKRVFQSSGIRLEWEIMRVGELPVNKE"
FT   gene            408428..409312
FT                   /locus_tag="RSKD131_0421"
FT   CDS_pept        408428..409312
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0421"
FT                   /product="D-alanine--D-alanine ligase"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00281"
FT                   /db_xref="GOA:B9KNK3"
FT                   /db_xref="InterPro:IPR000291"
FT                   /db_xref="InterPro:IPR005905"
FT                   /db_xref="InterPro:IPR011095"
FT                   /db_xref="InterPro:IPR011127"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:B9KNK3"
FT                   /protein_id="ACM00281.1"
FT                   /translation="MLMGGASTEREVSLSSGHSCSAALRDAGYEVTEVDAGPDLARVLA
FT                   ELSPDAVFNALHGRWGEDGCVQGLLEWLRIPYTHSGVLASALAMDKARAKEVFAAAGLP
FT                   VTQSVLATPEEVRARHILPPPYVVKPNAEGSSVGVYIVHEDANGPPQLAADMPQNLMVE
FT                   TYVPGRELTVTVMGDRVLAVTDILSDGWYDYDAKYRPGGSRHIVPADLPAEITEACHDI
FT                   ALRAHRALGCRGISRSDLRWDESRGLAGLILLETNTQPGMTPTSLSPEQAAHCGYSFPE
FT                   FCAWLVEDASCSR"
FT   gene            409300..410226
FT                   /locus_tag="RSKD131_0422"
FT   CDS_pept        409300..410226
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0422"
FT                   /product="Cell division protein FtsQ"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00282"
FT                   /db_xref="GOA:B9KNK4"
FT                   /db_xref="InterPro:IPR005548"
FT                   /db_xref="InterPro:IPR013685"
FT                   /db_xref="InterPro:IPR026579"
FT                   /db_xref="InterPro:IPR034746"
FT                   /db_xref="UniProtKB/TrEMBL:B9KNK4"
FT                   /protein_id="ACM00282.1"
FT                   /translation="MQSLSFPPNRRTPRPAPPRRDTGRRDPAPSRWAYRAQRLWLTPMF
FT                   RTALRVGLPIVGVLLVVALVFASADRRAAMAGAFTGLVDSFQQRPEFMVTLLSVDGASP
FT                   ELSDRIRATLALKLPLSSFDIDLTAARARIESIDAVAQAEVRVRSGGLLEVRVTERKPA
FT                   IIWRRAANLVLLDETGRRVDDLAFRSERGDLAVIAGEGAERAVPEALEILAAARPILKR
FT                   IRGLVRMGERRWDIVLDRGQRIQLPVEEPVAAVERMIALDEAEDLLDRDVISVDLRIKD
FT                   RPVLRLAPYALNAVRRARGIDTSGSDL"
FT   gene            410223..411557
FT                   /locus_tag="RSKD131_0423"
FT   CDS_pept        410223..411557
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0423"
FT                   /product="Cell division protein FtsA"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00283"
FT                   /db_xref="GOA:B9KNK5"
FT                   /db_xref="InterPro:IPR003494"
FT                   /db_xref="InterPro:IPR020823"
FT                   /db_xref="UniProtKB/TrEMBL:B9KNK5"
FT                   /protein_id="ACM00283.1"
FT                   /translation="MTDLYQSQRAMRNMRRAAMQRGVIAILDVGSSKITCLILRFDGPD
FT                   RLREHDGVGPMAGQSSFRVIGAATTRSRGVHFGEISVMNETERAIRTAVQAAQKMANVR
FT                   VDHVIACFAGADPRSYGLAGEWELQDSVVTEQDVARVMAACDVPDFGQGREVLHAQPVN
FT                   FALDHRTGLGDPRGQIGNRLAVDMHLLTVEADAIQNLLYCIKRCDLELAGIASSAYVSG
FT                   VSSLVEDEQELGAACIDMGGGATGLSIFIKKHMIFADSVRMGGDHVTSDISKGLQVPLA
FT                   TAEKIKTRHGGVVATGMDDREMIDIGADTGDWDKDRRTVSRAELIGIMRPRVEEILEEA
FT                   RARLDAAGFEHLPSQQIVITGGGSQIPGLDGLAARILGQRVRLGRPLRVQGLPQQVSGP
FT                   GFSSAVGLCLFAAHPQDEWWDFDIPAERYPARSLRRAIKWFKDNW"
FT   gene            411737..413395
FT                   /locus_tag="RSKD131_0424"
FT   CDS_pept        411737..413395
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0424"
FT                   /product="Cell division protein FtsZ"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00284"
FT                   /db_xref="GOA:B9KNK6"
FT                   /db_xref="InterPro:IPR000158"
FT                   /db_xref="InterPro:IPR003008"
FT                   /db_xref="InterPro:IPR008280"
FT                   /db_xref="InterPro:IPR018316"
FT                   /db_xref="InterPro:IPR020805"
FT                   /db_xref="InterPro:IPR024757"
FT                   /db_xref="InterPro:IPR036525"
FT                   /db_xref="InterPro:IPR037103"
FT                   /db_xref="UniProtKB/TrEMBL:B9KNK6"
FT                   /protein_id="ACM00284.1"
FT                   /translation="MALNLMMNNAREELKPRITVFGVGGAGGNAVNNMIEQQLEGVEFV
FT                   VANTDAQALQQSRATSKIQMGVKVTEGLGAGARPSVGAAAAEETIEEIVDHLAGAHMCF
FT                   ITAGMGGGTGTGAAPIIAQAARELGVLTVGVVTKPFQFEGAKRMRQAEDGIDALQKVVD
FT                   TLIIIPNQNLFRLANERTTFTEAFALADDVLYQGVKGVTDLMVRPGLINLDFADVRAVM
FT                   DEMGKAMMGTGEAMGEDRALQAAEKAIANPLLDEISLNGAKGVLINITGGYDLTLFELD
FT                   EAANVIREKVDSDANIIVGSTLDTSMEGMIRVSVVATGIDATKPAQDMPVPRRSMAAPL
FT                   PASFSQPEPTPAPQPAPRREMPAPRAAQPAAPQPAPQPEPQPAPEPAAHHFDPAASQHY
FT                   EQDHYVDEDDMPPPAYRPQPQAQPRATNVHEQDAAAFVAPRPRAPGQPSPEALARLQAA
FT                   VNKNPAQNRPGMAAGQQRPAAPVQRPAAAASAEKPRFGIGSLINRMAGHGEQQPEPRPQ
FT                   QSRQQPPVTSYEDEPEMSADQERIEIPAFLRRQAN"
FT   gene            413413..413592
FT                   /locus_tag="RSKD131_0425"
FT   CDS_pept        413413..413592
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0425"
FT                   /product="Hypothetical Protein"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00285"
FT                   /db_xref="UniProtKB/TrEMBL:B9KNK7"
FT                   /protein_id="ACM00285.1"
FT                   /translation="MERPGTSGPFSFADQRVPAGRRRGGLDDVSLLHAVTKSELRRNAR
FT                   HPNSRWQDGLKPST"
FT   gene            413623..414543
FT                   /locus_tag="RSKD131_0426"
FT   CDS_pept        413623..414543
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0426"
FT                   /product="UDP-3-O-(3-hydroxymyristoyl) N-acetylglucosamine
FT                   deacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00286"
FT                   /db_xref="GOA:B9KNK8"
FT                   /db_xref="InterPro:IPR004463"
FT                   /db_xref="InterPro:IPR011334"
FT                   /db_xref="InterPro:IPR015870"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/TrEMBL:B9KNK8"
FT                   /protein_id="ACM00286.1"
FT                   /translation="MQSTLKSAAKFTGVGLHSGEPVRMVVKPASADYGIWFRRVDVTSG
FT                   DALIPARWDAVVPSRLCTLIANPSGVTVSTIEHVMAALAGCGIHNALIEIDGPEVPILD
FT                   GSSVPFVEAFLARGIREQAEPVRAIRILEPVEVREGEAVARLEPADDFEIDFSIEFAEA
FT                   AIGRQEKSLNMANGAFVRELCDSRTFCRQADVDAMRANGLALGGTFENAVVFEGDRILS
FT                   PGGLRHADEPVRHKMLDALGDLSLAGGPIIGRYTGIRAGHALTNRLLRTLFARRDAFRL
FT                   VDCGLMTGCKLPGVGVHRSDIPALR"
FT   gene            414658..415494
FT                   /locus_tag="RSKD131_0427"
FT   CDS_pept        414658..415494
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0427"
FT                   /product="Tetratricopeptide TPR_2 repeat protein precursor"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00287"
FT                   /db_xref="GOA:B9KNK9"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR017689"
FT                   /db_xref="InterPro:IPR039565"
FT                   /db_xref="UniProtKB/TrEMBL:B9KNK9"
FT                   /protein_id="ACM00287.1"
FT                   /translation="MVKSGARLLGTALCVALVAGCGGGSQKEPPLENFTAEQIYQRGEY
FT                   ELEARTKPDRAIRYFSEVERLYPYTEWAKRALIMQAYSYHKAKDYEEARGAAQRFLDFY
FT                   PGDEDAAYAQYLLALSYYDQIDEVGRDQGLTFQALQALRVVIEDYPESEYAQSAILKFD
FT                   LAFDHLAAKEMEIGRYYLKRGHYTAAINRFRTVVEDFQTTTHTAEALHRLVESYLALGL
FT                   VNEAQTAGAILGHNYRSSPFYEDSYKLLTGRGLSMEAKGDSWLSKVYRQMIRGEWL"
FT   gene            415522..417162
FT                   /locus_tag="RSKD131_0428"
FT   CDS_pept        415522..417162
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0428"
FT                   /product="DNA repair protein RecN"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00288"
FT                   /db_xref="GOA:B9KNL0"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR004604"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B9KNL0"
FT                   /protein_id="ACM00288.1"
FT                   /translation="MLRSLDIRDMLIIDRLSLAFQPGLNVLTGETGAGKSILLDSLGFV
FT                   LGWRGRAELVRAGADKGEVTAVFDLPPGHAARAVLDEAGIEAEDELILRRVNFADGRKT
FT                   AWVNDRRVSGEVLRGLSDRLVELHGQHDDRGLLNPRGHRQMLDTFAGLDLSACRRAWTA
FT                   LGAARRTLLAAEEALAAVRAEEDFLRHAVAELDKLDPQPGEEALLDTRRREMQGAEKIR
FT                   DDIARAHRALSAEGAETLLVDALRWLETASDRAGNRLEAPLAALSRALLELGEAQDGVE
FT                   ACLADLDFDPRDLEALEERLFAIRALARKHSVLPDELGTFAEELRGRLAALDGGTKQID
FT                   ALRRALAEAEAAWEAEAAILSEARREAAGRLDAAMAAELAPLKMERAVFETQVTEADPG
FT                   PEGRDAVAFTVATNPGAPAGPLNRIASGGELSRFLLALKVCLTGDSPGLTLIFDEIDRG
FT                   VGGATADAVGRRLKALAEGAQVLVVTHSPQVAALGAHHWRVEKRVAHGMTTSTVSPLGA
FT                   GDRIEEIARMLAGDTITDAAREAARALLD"
FT   gene            complement(417171..417563)
FT                   /locus_tag="RSKD131_0429"
FT   CDS_pept        complement(417171..417563)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0429"
FT                   /product="Hypothetical Protein"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00289"
FT                   /db_xref="InterPro:IPR011944"
FT                   /db_xref="InterPro:IPR027843"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:B9KNL1"
FT                   /protein_id="ACM00289.1"
FT                   /translation="MSAPTPEDFPRRFAALWAARDAEALSELLAQDATMLTLTGLWCEG
FT                   RKEILAALKAELAGAFARSRLVTGKTELRPLGPGATLVHQRFVLSGLVDAEGRDAGRIG
FT                   AVLTAVLLARKAGSEAVTLHFTVVEG"
FT   gene            complement(417560..418933)
FT                   /locus_tag="RSKD131_0430"
FT   CDS_pept        complement(417560..418933)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0430"
FT                   /product="D-lactate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00290"
FT                   /db_xref="GOA:B9KNL2"
FT                   /db_xref="InterPro:IPR004113"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016171"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:B9KNL2"
FT                   /protein_id="ACM00290.1"
FT                   /translation="MRIDAALGDIEAVLGERLSRSRPVREQHAQSETHLHAGPPDAVAF
FT                   PRSTAEVARIAEICTAHRVPMVGWGAGTSLEGHALALKGGVTIDFAQMDRILELRPEDM
FT                   IVRVQPGLTREGLNAALRDTGLFFPVDPGADASLGGMAATRASGTTAVRYGTMRDNVLG
FT                   LEVVLSDGRVIRTGTAAPKSSAGYDLTALMVGSEGTLGLITELTLRLHGQPEAVSAAVC
FT                   AFPDMGAAVGCVIETIQHGIPMARIEFLDAASVAACNAYAQMEMPAVPHLLIEFHGTEA
FT                   GVAEQAERFGEIAAEHGSAGFQWATRTEDRARLWKMRHAAYRACLALRPGAEGWVTDVC
FT                   VPISRLAEAVEETQADLAASPVPGPILGHVGDGNFHAILLVDPQSAEELAEAERLSGRM
FT                   AERALRLGGTVTGEHGIGFGKLGYMEAEHGEGWAVMGAIKQALDPLGLMNPGKMVASA"
FT   gene            complement(419069..419701)
FT                   /locus_tag="RSKD131_0431"
FT   CDS_pept        complement(419069..419701)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0431"
FT                   /product="Hypothetical Protein"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00291"
FT                   /db_xref="InterPro:IPR012437"
FT                   /db_xref="UniProtKB/TrEMBL:B9KNL3"
FT                   /protein_id="ACM00291.1"
FT                   /translation="MMGPDDRRLSDEGLAPEGTGRIRLIACGALAHEILALKRANGWDH
FT                   LDLQCLPAKLHLRPEKIVEAVEAAVRAAAGPVFVVYADCGTGGALERKCRDLGVEMVEG
FT                   PHCYSFFEGNAAFAARADAEFTAFYLTDFLVRQFDAFVWRPMGLDRHPELRDMYFGHYT
FT                   TLVYQAQTEDPALDAKAEDCARRLGLAYERRFTGYGDLAPRLAGLGG"
FT   gene            complement(419698..419850)
FT                   /locus_tag="RSKD131_0432"
FT   CDS_pept        complement(419698..419850)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0432"
FT                   /product="Hypothetical Protein"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00292"
FT                   /db_xref="GOA:B9KNL4"
FT                   /db_xref="UniProtKB/TrEMBL:B9KNL4"
FT                   /protein_id="ACM00292.1"
FT                   /translation="MPPALLFAMIATVLLAAGVTVALFHGAGWPLGALGLVALVASLLL
FT                   RLRRP"
FT   gene            complement(419903..420601)
FT                   /locus_tag="RSKD131_0433"
FT   CDS_pept        complement(419903..420601)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0433"
FT                   /product="Methionine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00293"
FT                   /db_xref="GOA:B9KNL5"
FT                   /db_xref="InterPro:IPR003759"
FT                   /db_xref="InterPro:IPR006158"
FT                   /db_xref="InterPro:IPR036594"
FT                   /db_xref="InterPro:IPR036724"
FT                   /db_xref="UniProtKB/TrEMBL:B9KNL5"
FT                   /protein_id="ACM00293.1"
FT                   /translation="MADDEEIILSELDDEELVLQMHDDLYDGMKDEIEEGVNILIERGW
FT                   TPYDVLTKALVSGMTIVGNDFRDGILFVPEVLLAANAMKAGMTILKPLLVETGAPRMGK
FT                   MVIGTVKGDIHDIGKNLVAMMMEGAGFEVVDLGINNPVEKYLEALETEKPDILGMSALL
FT                   TTTMPYMKVVIDTMKEKGVRDDYIVLVGGAPLNEEFGRAIGADAYCRDAAVAVETAKVQ
FT                   VARRHNRLNA"
FT   gene            420758..421846
FT                   /locus_tag="RSKD131_0434"
FT   CDS_pept        420758..421846
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0434"
FT                   /product="Radical SAM domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00294"
FT                   /db_xref="GOA:B9KNL6"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR040086"
FT                   /db_xref="UniProtKB/TrEMBL:B9KNL6"
FT                   /protein_id="ACM00294.1"
FT                   /translation="MSSRDPSLSPTLRLRARGALANETGRFETERREAFDDGWDLPEEE
FT                   RLLRTEVRTERPRSALTYNRSPDLPFDRSVNPYRGCEHGCIYCFARPSHAYLNLSPGLD
FT                   FETRLIARPGIAAVLERELRARSYRAAPIALGTNTDPYQPIEATHRLMREILEVLAAFR
FT                   HPVAITTKGTLIERDLDLLAPMAAEGLLRVGLSITTLDPDLSRRLEPRAPSPQRRLQTI
FT                   RRLAEAGVPVRAMIAPVIPGLTDSELDRLLAAAAGAGAVAASWIMLRLPREVAPLLRAW
FT                   AEEHYPDRAAKMLARIREIHGGRDYDPAFGKRMRGEGIWADLIACRFRLAAARHGLDRA
FT                   QPALRSDLFRPPPRPGDQLSLF"
FT   gene            complement(421946..422953)
FT                   /locus_tag="RSKD131_0435"
FT   CDS_pept        complement(421946..422953)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0435"
FT                   /product="Homocysteine S-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00295"
FT                   /db_xref="GOA:B9KNL7"
FT                   /db_xref="InterPro:IPR003726"
FT                   /db_xref="InterPro:IPR017226"
FT                   /db_xref="InterPro:IPR036589"
FT                   /db_xref="UniProtKB/TrEMBL:B9KNL7"
FT                   /protein_id="ACM00295.1"
FT                   /translation="MTDALSRLLQTRDWLMADGATGTNLFNMGLSSGEPPELWTVERPD
FT                   NIRSLYRAAVEAGSDIFLTNSFGGNAARLKLHEAQGRVGELNRIAAELGREVADAAGRP
FT                   VVVAGSMGPTGEIFEPMGTLTHRMAVEIFHEQAEALKAGGADVLWVETISAAEEFKAAA
FT                   EAARLAGMPWCGTMSFDTAGRTMMGITAATLVDLVTKLPNPPLAFGANCGVGASDLLRT
FT                   VLGFAAQGIEVPIIAKGNAGIPKYHDGHIHYDGTPELMAEYAVLARDAGARIIGGCCGT
FT                   MPEHLKAMRAALEGRPRGPRPSLETISETLGGFSSASDGSDDAGPTRERRRRRS"
FT   gene            complement(423165..423485)
FT                   /locus_tag="RSKD131_0436"
FT   CDS_pept        complement(423165..423485)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0436"
FT                   /product="Hypothetical Protein"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00296"
FT                   /db_xref="InterPro:IPR009945"
FT                   /db_xref="InterPro:IPR038293"
FT                   /db_xref="UniProtKB/TrEMBL:B9KNL8"
FT                   /protein_id="ACM00296.1"
FT                   /translation="MTTFDDRERAFESKFAHDAEMQFRAEVRRNKLVGLWAAELLGKTG
FT                   EEAQVYARAVIQADLHEPGFEDVVRKVSADLGDRASADMVRGKMLELLPVAKAQLMTET
FT                   QA"
FT   gene            423668..424420
FT                   /locus_tag="RSKD131_0437"
FT   CDS_pept        423668..424420
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0437"
FT                   /product="Phosphoribosylaminoimidazole-succinocarboxamide
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00297"
FT                   /db_xref="GOA:B9KNL9"
FT                   /db_xref="InterPro:IPR028923"
FT                   /db_xref="InterPro:IPR033934"
FT                   /db_xref="UniProtKB/TrEMBL:B9KNL9"
FT                   /protein_id="ACM00297.1"
FT                   /translation="MARRKKVYEGKAKILYEGPEPGTLIQYFKDDGSAASTPPQTALEG
FT                   KGVLNNRLSEFFMNGLNAIGVPTHFIRRLNMREQLVRMAEIIPLEVVVRNFAAGGISKR
FT                   LGIPEGTPLPRPIVEYYFKDDKLGCPLVSEEHIIAFGWASQQDLDDVVALALRVNDFLS
FT                   GVMMGVGIRLADFRIEVGRIWEGDYMRLIVADEISPDSCRLWDVRAEGEGGAPREPGPL
FT                   QDVYTELARRLGVLPSNVTHSPKPTLIN"
FT   gene            424435..424674
FT                   /locus_tag="RSKD131_0438"
FT   CDS_pept        424435..424674
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0438"
FT                   /product="Phosphoribosylformylglycinamidine synthase, purS"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00298"
FT                   /db_xref="GOA:B9KNM0"
FT                   /db_xref="InterPro:IPR003850"
FT                   /db_xref="InterPro:IPR036604"
FT                   /db_xref="UniProtKB/TrEMBL:B9KNM0"
FT                   /protein_id="ACM00298.1"
FT                   /translation="MKARVHVMLKDGVLDPQGEAVKHALGTLGFSGVEGVRQGKVIELD
FT                   LAATDRAAAEAEVRRMCEKLLANTVIEKYTVEIA"
FT   gene            424906..425574
FT                   /locus_tag="RSKD131_0439"
FT   CDS_pept        424906..425574
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0439"
FT                   /product="Phosphoribosylformylglycinamidine synthase 1"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00299"
FT                   /db_xref="GOA:B9KNM1"
FT                   /db_xref="InterPro:IPR010075"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:B9KNM1"
FT                   /protein_id="ACM00299.1"
FT                   /translation="MKAAVITFPGSNCDRDLATAFEKAGADVTRVWHKDTALPEGVDVV
FT                   GVPGGFSFGDYLRCGAIAARSPIAAAMIRHAERGGYVLGICNGFQVLTETGLLPGALMR
FT                   NAGLKFICRRVDLRVATADSAFTSGWAAGDAVRFPIAHHDGNYTADPETLARLRGEDRV
FT                   AFTYLDNPNGSMEDIAGILSANRRVLGLMPHPERAVEEAQGGADGMGLFGALLGGMALV
FT                   "
FT   gene            425622..427385
FT                   /locus_tag="RSKD131_0440"
FT   CDS_pept        425622..427385
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0440"
FT                   /product="Sensor protein"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00300"
FT                   /db_xref="GOA:B9KNM2"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR017055"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B9KNM2"
FT                   /protein_id="ACM00300.1"
FT                   /translation="MQDTGFQNDAPVPPPGHGRRVKIAVVAIIVVAVAVVLVTNRWMSE
FT                   RFTESTRSRAELRLALYSGNMLTELQRTSVVPLLLARDPSLIGALGSGDFSTTSQRLIS
FT                   FQTEIGAASIMLLDRDGRTVGATNRNLIGTNHRSQPYFIDAQRARDTVFTAAQRDAGIF
FT                   DFTYSKAILSDNRLVGVIVVAVDLMKYERAWAGLQDAVMVTDSTGTVILATEPRWRGLT
FT                   IKEALAARDAPSAIRRALQATADWAQQPPDAYLKGEAVMKTDARVPFRGWRIVTFTAYD
FT                   SVRERVNGILALEIMGFAILLALTFYVLSRRAWSQSMSFQRESAELRLLNARLQREIAE
FT                   REKVQKDLAVAELTLAQSSKLAALGEMSAAVSHELNQPLAAMKTYLAGAKLLLQRRRTE
FT                   EALASFQRIDDLIERMGAITRQLKSYARKGGEAFEPVDMRLCVSSALTMMEPQLKIRVV
FT                   RITRALPRQPVMVMADRLRLEQVIINLLRNALDATKTVPSPQIDLVLAAGETATLTVRD
FT                   NGHGIEDLDNLFEPFYTTKKPGEGVGLGLAISSGIVTDLGGRLTARNADGGGAVFEVQL
FT                   PILGADIKAAE"
FT   gene            427407..428723
FT                   /locus_tag="RSKD131_0441"
FT   CDS_pept        427407..428723
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0441"
FT                   /product="Two component, sigma54 specific, transcriptional
FT                   regulator, Fis family"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00301"
FT                   /db_xref="GOA:B9KNM3"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B9KNM3"
FT                   /protein_id="ACM00301.1"
FT                   /translation="MKVAIVDDEADMRQSISQWLALSGFDTETYASAEDALKGLNADFP
FT                   GVVVSDIKMPGMDGMTFLKKLMSMDSGLPVILITGHGDVPMAVEAMRVGAFDFLEKPFN
FT                   PDRMTELAKRATQLRRLTLDNRALRRELSDGTVLMKKLIGSSPVMERLREDILDLGQAD
FT                   SHVLIDGETGTGKTLVAHALHAVGARAGRKFVTISCAAWSEDQLSSKLFGPAEDGSLPL
FT                   VEEARGGTLCLEDIESLSHPLQSRLLTVINEQGTPPETRIIAICNEHAPDTTLENVLRS
FT                   DLYYRLGAMTIVLPPLRTRGEDILTLFTRMSEQFAEEYGCEAPQVTAQEAAQLLQAPWP
FT                   GNVRQLVNIAERAVLQNRRGSGSIASLLMADNEASGPALTTEGKPLKDYVEAFERMLID
FT                   NTMRRHKGSIVAVMEELCLPRRTLNEKMAKYGLSRADYV"
FT   gene            complement(428701..429261)
FT                   /locus_tag="RSKD131_0442"
FT   CDS_pept        complement(428701..429261)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0442"
FT                   /product="Urea amidolyase related protein"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00302"
FT                   /db_xref="GOA:B9KNM4"
FT                   /db_xref="UniProtKB/TrEMBL:B9KNM4"
FT                   /protein_id="ACM00302.1"
FT                   /translation="MGGIDKHFLGHLIPWHPDNGLWPEQAPAGIRCAWWLVRAKLRRGP
FT                   ERAEPHGPLAQSGSRSARLIAVLYPGTPGRPLYWPDPSGTWRAIVGTFRSDCLLRPRFG
FT                   RLVRMARTAEKLVRKLLPIAGGLRRCDISGSDGQKTMAYFCPTACNRRSSAPCGPPIRV
FT                   GRPDPEPKERVSEELRIRRSRRG"
FT   gene            429241..431913
FT                   /locus_tag="RSKD131_0443"
FT   CDS_pept        429241..431913
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0443"
FT                   /product="RNAse E"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00303"
FT                   /db_xref="GOA:B9KNM5"
FT                   /db_xref="InterPro:IPR004659"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019307"
FT                   /db_xref="InterPro:IPR028878"
FT                   /db_xref="UniProtKB/TrEMBL:B9KNM5"
FT                   /protein_id="ACM00303.1"
FT                   /translation="MLIDATHPEETRVVVVDGNKVEEFDFETVNKRQLAGNIYLAKVTR
FT                   VEPSLQAAFVDYGGNRHGFLAFAEIHPDYYQIPVADRKALLEEERAYARAEDDEDHGRS
FT                   RRRSRPAPAAAASGDAVQSGDVAGMDVVDLGEETGADALYETDGSDAGAADSGQPEASD
FT                   ADEKPYRAMDHASDGDDEIESVADEDVAEEIPAPRKPRSRRYKIQEVIKVRQIMLVQVV
FT                   KEERGNKGAALTTYLSLAGRYCVLMPNTARGGGISRKITQAADRKKLKEIASELEVPEG
FT                   AGLIIRTAGAKRTKQEIRRDYEYLLRLWEQIRDLTLKSVAPAPIYEEGDLIKRTIRDLF
FT                   NREIEEVLVEGETGYRTAKDFMRMIMPAHARQVIRYDEPMPLFARYQVESYLSGMFNPV
FT                   VQLKSGGYIVIGVTEALVAIDVNSGRATKEGSIEETALKTNLEAAEEVARQLRLRDLAG
FT                   LIVIDFIDMEERKNNAAVEKRLKDKLKTDRARIQVGRISGFGLMEMSRQRLRPGMLEST
FT                   TQPCAHCHGTGLIRSDDSLALQVLRQLEEEGTRKRSKEVLLRAPIAVVNFLMNSKREHI
FT                   ALIEARYGMAVRVEADPSLSSPDYVIEKFKTATRVVPEAVKVISGSADLMGAPVDEPED
FT                   DWVEEEPEIVEEAEEVAEAAEAAPSEGQPKKKRRRRRRRRNGVNGANGSDAQENGDEGD
FT                   ESDEDEGDAADEPEAVEAAAAVPELAPEAVVSAPEPAAVEPEPAPAEPVAAPAAEEPAA
FT                   PRKRTRTRKPKVTEEAPAEAAAEAPAEAPAAEAPAKEPKKPRTRTSRSRKTAAAAEAAP
FT                   AVEVAVTVDETPAEASLEIARTTEAAPETTPEAPAAEAPAAETPVAETPAPQPEPVAEE
FT                   TGEGEDNKPKRRGWWSIGR"
FT   gene            complement(432096..432323)
FT                   /locus_tag="RSKD131_0444"
FT   CDS_pept        complement(432096..432323)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0444"
FT                   /product="SirA family protein"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00304"
FT                   /db_xref="InterPro:IPR001455"
FT                   /db_xref="InterPro:IPR036868"
FT                   /db_xref="UniProtKB/TrEMBL:B9KNM6"
FT                   /protein_id="ACM00304.1"
FT                   /translation="MEFDEDLDCAGLLCPLPVLRARKRLMAMAPGRVLRVTATDPMAVI
FT                   DLPHFCAEAGHEVLSCDRVGAESIWLIRRG"
FT   gene            432468..433214
FT                   /locus_tag="RSKD131_0445"
FT   CDS_pept        432468..433214
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0445"
FT                   /product="Cytochrome c biogenesis protein, transmembrane
FT                   region"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00305"
FT                   /db_xref="GOA:B9KNM7"
FT                   /db_xref="InterPro:IPR003834"
FT                   /db_xref="UniProtKB/TrEMBL:B9KNM7"
FT                   /protein_id="ACM00305.1"
FT                   /translation="MFGLDLIDAGLLPAMLIALVAGVLSFLSPCVLPIVPPYLAYMGGI
FT                   SMKELNQGARRGPLMAALFFVLGLSTVFLFLGFTASAFGAFFLSNAETFATLAGVIVMA
FT                   FGAHFVGVYRIPFLDREMRMDAGDRGGSAFGAYVLGLAFAFGWTPCIGPQLGAILTLAA
FT                   SEASIARGTTLLAIYAAGLGIPFLLVAAFFPRLTGVMGWMKRHMERIERIMGLLLWTIG
FT                   LLMLTGGFSSFSYWLLETFPALARLG"
FT   gene            433243..434457
FT                   /locus_tag="RSKD131_0446"
FT   CDS_pept        433243..434457
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0446"
FT                   /product="Hypothetical Protein"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00306"
FT                   /db_xref="GOA:B9KNM8"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B9KNM8"
FT                   /protein_id="ACM00306.1"
FT                   /translation="MDLLAEPKLRRPFRRRVFLIPGGEPVPPAFYRELYLRQGAAQADL
FT                   AEMALALRPGRGPASWRVSGAMEVGFCDTEVELLPWADLVPGAAGQAILPALAGRLGTL
FT                   WIYLATGALLRLFRLRPVAVLAILVPPAVLSGLAALALGAGLLLAQALAALIWPPAGWL
FT                   AGLLLAGILLLRVRFPPLPFADLGLLAEQRGAVPPALAERMGRFRAALSEALRSECDEL
FT                   LVVGHSTGAALAVSLMADLLRGGLPGRRPALALLTLGQRVPLLSFLPEARQVRRDLNAL
FT                   AAAAELTWVDVSAPEDPLCFALCDPVSVSGVAPEGQLWPLAISAALAETLSPARRRRLR
FT                   GRPGLRHLQYLCAYDRPGDYDVFRVTAGPRPLAARFQGRGRIERASSGHATTGAPRAEA
FT                   QRPVR"
FT   gene            complement(434439..434660)
FT                   /locus_tag="RSKD131_0447"
FT   CDS_pept        complement(434439..434660)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0447"
FT                   /product="Hypothetical Protein"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00307"
FT                   /db_xref="InterPro:IPR027373"
FT                   /db_xref="InterPro:IPR038268"
FT                   /db_xref="UniProtKB/TrEMBL:B9KNM9"
FT                   /protein_id="ACM00307.1"
FT                   /translation="MNGRPEKHSLTLKGHRTSVSLEADFWRAFREIAAERGLPLNALAA
FT                   EVDEARDPEVGLASALRVFVLRHYRTGR"
FT   gene            complement(434657..434860)
FT                   /locus_tag="RSKD131_0448"
FT   CDS_pept        complement(434657..434860)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0448"
FT                   /product="Hypothetical Protein"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00308"
FT                   /db_xref="InterPro:IPR025227"
FT                   /db_xref="UniProtKB/TrEMBL:B9KNN0"
FT                   /protein_id="ACM00308.1"
FT                   /translation="MAEIVNLRAKRKAAERDARRRKGDENAAKHGRTKAERRLEETRAE
FT                   KARAHLEGHRRETDAPDEPTDP"
FT   gene            complement(434860..436254)
FT                   /locus_tag="RSKD131_0449"
FT   CDS_pept        complement(434860..436254)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0449"
FT                   /product="Fumarase"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00309"
FT                   /db_xref="GOA:B9KNN1"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR005677"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR018951"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="UniProtKB/TrEMBL:B9KNN1"
FT                   /protein_id="ACM00309.1"
FT                   /translation="MTATRTETDSFGPLEVPADKYWGAQTQRSIQNFPIGWEKQPVAIV
FT                   RALGVIKKACALVNVAQGDMPEELGQAIAAAATEVIEGRFDDNFPLVVWQTGSGTQSNM
FT                   NANEVISNRAIEMLGGTMGSKKPVHPNDHVNMGQSSNDTFPTAMHVAIGMMARDVLLPG
FT                   LEKLHAALLAKSEEFKDIIKIGRTHTQDATPLTLGQEFSGYAKQVEKGIARVKACLPDI
FT                   YELAQGGTAVGTGLNTRQGWDSRVAAKIAEITGLPFVTAPNKFEALAAHDAMVMFSGAL
FT                   KTVAASLFKIANDMRLLGSGPRSGLGELILPENEPGSSIMPGKVNPTQAEALTMVCAHV
FT                   MGNDAAIGFAGSQGHFELNVYNPMMSYNVLQSMQLLGDAAGSFTDNMVVGTQANVARID
FT                   KLMKESLMLVTALAPTIGYDNATKVAKTAHKNGTTLREEAIALGLVDAETFDRVVRPED
FT                   MIGPKG"
FT   gene            complement(436421..436882)
FT                   /locus_tag="RSKD131_0450"
FT   CDS_pept        complement(436421..436882)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0450"
FT                   /product="Hypothetical Protein"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00310"
FT                   /db_xref="InterPro:IPR007481"
FT                   /db_xref="InterPro:IPR036760"
FT                   /db_xref="UniProtKB/TrEMBL:B9KNN2"
FT                   /protein_id="ACM00310.1"
FT                   /translation="MARSIDYGNLMHRAMRGLIQSVLEDVAEHGLPGAHHFFITFDTTH
FT                   PDVAMADWLRARYPQEMTVVIQHWYENLSADDHGFSVTLNFGNQPEPLVIPFDAVRTFV
FT                   DPSVEFGLRFETHEEEDEEGETGGDEDPDGDDEPPRHDAQVVSLDKFRK"
FT   gene            complement(436985..437641)
FT                   /locus_tag="RSKD131_0451"
FT   CDS_pept        complement(436985..437641)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0451"
FT                   /product="von Willebrand factor type A domain protein
FT                   precursor"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00311"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR010607"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:B9KNN3"
FT                   /protein_id="ACM00311.1"
FT                   /translation="MIRTLALALSLACSGQARACETALLLAIDVSGSIDRGEYALQAEG
FT                   LALALSDPAVADLLLAGESALAIVHWSGVGRQALALPWRRMLAPSDVAAVAGASRTLPR
FT                   AFTASDTAVGEAISFSLAQFAAVGDCRRRVIDISGDGPENAGFTVARARRAAEAAAVEI
FT                   NAIAIEDMGASAPITAFYRRWAVTRTGFVLTARGLQDYRRAIREKLLRELGKPAS"
FT   gene            complement(438537..439601)
FT                   /locus_tag="RSKD131_0452"
FT   CDS_pept        complement(438537..439601)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0452"
FT                   /product="ABC polyamine transporter, periplasmic
FT                   substrate-binding protein precursor"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00312"
FT                   /db_xref="GOA:B9KNN4"
FT                   /db_xref="InterPro:IPR001188"
FT                   /db_xref="UniProtKB/TrEMBL:B9KNN4"
FT                   /protein_id="ACM00312.1"
FT                   /translation="MFQGAYMIRRTTLLASAAALVALPALAADPDLIVFDWAGFESEGL
FT                   MKSYIEKNGQMPTYALYGDDDEAFQKVASGFKSDVTHPCSQMVSKYRDAGLIEPWDVSR
FT                   IPEYDNIAPRFKDSKIFNDDQGVWYIPTDYAYTAIAYNTDSVPAEDVASVQSFLDPKYA
FT                   GRISLPDNTDDIWSLALLATGVSDWTNLTEEQFQAGAQWLRQAHENVRAYWADPSELAQ
FT                   LMATGEVQLAWTWNDAIALMRQEGFPVGFQRQSKEGSATWFCGYVNMKDAPGSEDKAYD
FT                   FINSWLAHSSAASLLETHGYALTNEAAMAEITPEALKAAELDPVDTTLLAQTPLDPAMR
FT                   DRMLEEFEKIKAGF"
FT   gene            439922..441160
FT                   /locus_tag="RSKD131_0453"
FT   CDS_pept        439922..441160
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0453"
FT                   /product="Aminotransferase, class V"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00313"
FT                   /db_xref="GOA:B9KNN5"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:B9KNN5"
FT                   /protein_id="ACM00313.1"
FT                   /translation="MTLLDIGYVRSCFPAFSEPALAGQAFFENAGGSYTCRPVIDRLSR
FT                   FYHQRKVQPYAPYAASHAAGAEMDEARSRLAALMGLEEDELSFGPSTSANTYVLAQAVR
FT                   GWLSREGGAIVVTNQDHEANSGVWRRLAHEGIEVREWRIDPETGHLDPAGLPPLLADGR
FT                   VRLVCFPHCSNVVGEINPVAEICATARAAGAFTCVDGVSYAPHGLPDMGALGADIYLFS
FT                   AYKTYGPHQGILLMRRALAELLPAQGHWFNADTLFKRFTPAGPDHAQVAACAGLADYVD
FT                   ALAAHHGAGGAAPLERSRAVHRLMREHEIRLLRPLLDQLAARNDLRLIGPRTPETRAPT
FT                   VALALDRPVAPVAAALAAHGIMASAGDFYAVRPLEALGIDPARGVLRLSFVHYTSEAEV
FT                   AQLMLALDAVLGR"
FT   gene            441312..442727
FT                   /locus_tag="RSKD131_0454"
FT   CDS_pept        441312..442727
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0454"
FT                   /product="Deoxyribodipyrimidine photo-lyase type I"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00314"
FT                   /db_xref="GOA:B9KNN6"
FT                   /db_xref="InterPro:IPR002081"
FT                   /db_xref="InterPro:IPR005101"
FT                   /db_xref="InterPro:IPR006050"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR036134"
FT                   /db_xref="InterPro:IPR036155"
FT                   /db_xref="UniProtKB/TrEMBL:B9KNN6"
FT                   /protein_id="ACM00314.1"
FT                   /translation="MMADAPLILWFRRDLRLADNPMLAEAAATGRPLIPLFILDPETEA
FT                   LGAAPKWRLGLGVEAFARALEGLGSRLVLRRGPALAVLEALVAETGAAGVHWSRLWEPA
FT                   WRARDEGVKAGLRQAGIEAASHAGHTIFEPREVETGQGGFYRVYTPFWKAVKDRPVAAS
FT                   SPPPARLPSPAEWPVSERLACWDLGRAMNRGAAVVAPHLAVGEAAAAERLARFLSGPLD
FT                   RYAAERDRPDAPVTSRLSENLTYGEISARSLWHAGMRARAEGRAGAEKFLQEIAWREFG
FT                   WHLLYHTPEIARRNWRGDWDAFPWRGDNPDAERWRRGMTGEPFVDAAMRELFVTGTMHN
FT                   RARLIAGSYLTKHLLTDWRVGQAWFEDCLIDWDPASNALGWQWVAGSGPDASPYFRIFN
FT                   PATQAEKFDPESAYRQRFVAEIARRPGPEALAFFEAVPRSWGLRPDRCYPGPVVGLAEG
FT                   RERALAAYGRRNN"
FT   gene            442761..443972
FT                   /locus_tag="RSKD131_0455"
FT   CDS_pept        442761..443972
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0455"
FT                   /product="Cyclopropane-fatty-acyl-phospholipid synthase"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00315"
FT                   /db_xref="GOA:B9KNN7"
FT                   /db_xref="InterPro:IPR003333"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B9KNN7"
FT                   /protein_id="ACM00315.1"
FT                   /translation="MTALTSTRGQQDLPRYFSQVFDVMQGLRHGRLDFVLDDGRRFRVE
FT                   GQGPGPVAELDIHDADLFARLIREGDLGFCEAYLDGGWSTPDLQAFMDLIHADNDDVYD
FT                   GFPGQGLLRAYENLRHWLRGNSKRQARRNIAAHYDLGNDFYALWLDESMTYSSALFRTG
FT                   QESLEEAQRAKYASMVDRIGAKPGEHVLEIGCGWGGFAEYAARERGLRVTGLTISQAQH
FT                   DYAVERIARAGLSDRVEIRLQDYRDERGSFDGIASIEMFEAVGEKYWPVYFQTLRERLK
FT                   PGRNATLQIITVQDKRWEVYRRGVDFIQKYIFPGGMLPSPTALRVEVAKAGLHVTDSLE
FT                   FGESYSMTLRRWHETFNDRWDRVAALGFDERFRRMWNFYLTSCAGSFDGGNCDVTQITV
FT                   TRAA"
FT   gene            443998..444438
FT                   /locus_tag="RSKD131_0456"
FT   CDS_pept        443998..444438
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0456"
FT                   /product="TrgA"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00316"
FT                   /db_xref="GOA:B9KNN8"
FT                   /db_xref="UniProtKB/TrEMBL:B9KNN8"
FT                   /protein_id="ACM00316.1"
FT                   /translation="MPTAAKLVAALAFAALGYLGGRLFAGEVPEGTPTALFGPWGALAG
FT                   LFCGWAISGARAGRGYWPALGTGVRTVVTGVFLALLGYSLYIMVLRAMRMLYDGPIEAL
FT                   LGVFDLMLDQAQLLARPEILGTLALGGMIAGSLTEWAGRRWK"
FT   gene            444435..445523
FT                   /locus_tag="RSKD131_0457"
FT   CDS_pept        444435..445523
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0457"
FT                   /product="Tellurite resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00317"
FT                   /db_xref="GOA:B9KNN9"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR004385"
FT                   /db_xref="InterPro:IPR013024"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="UniProtKB/TrEMBL:B9KNN9"
FT                   /protein_id="ACM00317.1"
FT                   /translation="MMRVFLCGPLASDGLRQRVLGSAPDGVPARLADHALGAAGATVSP
FT                   MPAPGASVAGLVMELGVEAGARLLHYQTATGHEARTLAVAGAPALVFFAPPEGLEPWDE
FT                   AAWSALWGPIVAATAGDVMALWPQVPAERIARRYRLMLVQGASRVRAAADPGPARRRHA
FT                   AQPGDVRIVRRSQPYANFFAVEEYDLSFRSFGGGMSPTLNRAVFISGDAVTVVPYDPVR
FT                   DRVLLIEQFRPGPLGRGDAQPWLLEPIAGRVDPGETPEAAARREAVEEAGLDLGALLPV
FT                   ASYYPTPAAKAEYLYSYVALAELDEGIEGIFGMEGEGEDIRGHLMSFDEMMALIRSGEI
FT                   CNGPLLLTAFWLDRERPRLRGA"
FT   gene            445871..446905
FT                   /locus_tag="RSKD131_0458"
FT   CDS_pept        445871..446905
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0458"
FT                   /product="Cysteine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00318"
FT                   /db_xref="GOA:B9KNP0"
FT                   /db_xref="InterPro:IPR001216"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:B9KNP0"
FT                   /protein_id="ACM00318.1"
FT                   /translation="MRIQRDLAEAIGNTPLIRLRKASELTGCEILGKCEFLNPGQSVKD
FT                   RAALYIIRDAVAKGLLQPGGTIVEGTAGNTGIGLSLVGASMGFRTVIVIPETQSQEKKD
FT                   MLRLAGAHLVQVPAAPYRNPNNYVRYSGRLAEALARTEERGAIWANQFDNTANRQAHVE
FT                   TTGPEIWEQTDGKVDGFICAVGSGGTLAGVAMALQPRGVKIGLADPEGAALHSFYTEGT
FT                   FEAPGSSITEGIGQGRITANLEGLTPDFSYRIPDAEALPIIFDLMQEQGLCLGGSSGVN
FT                   IAGAIRMAREMGPGHRIVTVLCDYGNRYQSKLFNPQFLRDKGLPVPQWLDEAPPAIPAV
FT                   FEDL"
FT   gene            446909..449452
FT                   /locus_tag="RSKD131_0459"
FT   CDS_pept        446909..449452
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0459"
FT                   /product="MscS Mechanosensitive ion channel precursor"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00319"
FT                   /db_xref="GOA:B9KNP1"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR006686"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR011014"
FT                   /db_xref="InterPro:IPR011066"
FT                   /db_xref="InterPro:IPR022249"
FT                   /db_xref="InterPro:IPR023408"
FT                   /db_xref="UniProtKB/TrEMBL:B9KNP1"
FT                   /protein_id="ACM00319.1"
FT                   /translation="MKALRSMRLWLVWACLACAALHSFAPAPALAQGILGPAASADELA
FT                   PPDYKQWEKTATRAEREIADRETDSVAYEAMRGYLVEWRDTFLRAQGINASRIASVRGQ
FT                   IDALGPAPAEGATEPDDIAQRRKELTEQLAELRAPVVSAEEAYQRADGLIREIDRVVRE
FT                   RQTQELLRLWPMPLNPANWPAAASETSTLAVDLWNEGATRFGSERARATARDNLPAILG
FT                   LLVVGLLLIARGRALMERLTQTLQDQASARGRKVGSLLVSLGQIVAPVAGVVAVSHAIT
FT                   LSAMAGPRTTLVIEVLPAVSLILYAAGWLAGRVFPKNGLQTSPLNLSEDRRREGRFHTA
FT                   MFGVVMALDALRTVALPPARVGEAATSVMAFPFIVVAGLLLFRIGQLMLASVRNDLGDD
FT                   EPSSFRNSVIDLLGRGAIAIGVIAPLLALPGYIAAATALVYPAGLTLGLIGVLFVLQTL
FT                   VVDLYGLATRNEDGGRDALLPVLIGFLLALALVPLLALVWGARVADLTEIWARFREGYQ
FT                   VGSTRISPTSFLLLAIVFSIGYGITRLLQGALKSQILPKTRLDQGGRNAVVSGVGYLGI
FT                   ILAALVAVNSAGLDLSNLAIVAGALSVGIGFGLQNIVGNFVSGIILLIERPVSEGDWIE
FT                   VGGVQGTVKSISVRSTRIQTFDRTDVIVPNQDLVAGQVTNWTRYNMTGRLIVPVGVAYG
FT                   SDTRHVERVLREIAEAQPLAILNPPPSIVFMGFTQEFLSFEIRVILRDVNFSLSVRSDI
FT                   NHMIAKRFAEEGIGLTHIPREIWPAPEPEVENGLTEEEIAALLVVEPPHRPQKDNVPKG
FT                   THAVDLHHQTEEEEDADGDGEADAEGASEGTGSTR"
FT   gene            449452..450171
FT                   /locus_tag="RSKD131_0460"
FT   CDS_pept        449452..450171
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0460"
FT                   /product="Ala-tRNA(Pro) hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00320"
FT                   /db_xref="GOA:B9KNP2"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR012947"
FT                   /db_xref="InterPro:IPR018163"
FT                   /db_xref="InterPro:IPR018164"
FT                   /db_xref="InterPro:IPR018165"
FT                   /db_xref="UniProtKB/TrEMBL:B9KNP2"
FT                   /protein_id="ACM00320.1"
FT                   /translation="MTEPLFRTDPYLREAEARVLGLTPEGGILVDRSIFYATGGGQPGD
FT                   SGFLDWEGGRIDVATAVKADGGRIALVPAEAGPLPPEGASVRQTLDWERRHRHMRVHTA
FT                   LHLLSVVIPLPVTGGQIGAERGRLDFDMPEPPADPAALEAELNALIARDLAVTEDWITD
FT                   EELLADPSIVKTMSVMPPTGQGRVRLVRIGQGAEQVDLQPCGGTHVARTGEIGRVLLGK
FT                   IEKKGRQNRRVSIALAD"
FT   gene            complement(450295..450999)
FT                   /locus_tag="RSKD131_0461"
FT   CDS_pept        complement(450295..450999)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0461"
FT                   /product="glycosyl transferase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00321"
FT                   /db_xref="GOA:B9KNP3"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:B9KNP3"
FT                   /protein_id="ACM00321.1"
FT                   /translation="MRVACLIPAYNEAARIGAVLAVVLGHPSIGRVLVVDDGSTDGTAE
FT                   VARAAGAEVLALPRNGGKTAAVAAGIAALEARWILMLDSDLQGLDRAAVSALLAPVLCG
FT                   EAEVAISLRGNAPLLWRLIGLDYISGERVLPRAQIARHGPALAALPRFGIEVFLNRLWI
FT                   ADGCRVAVVRWPGVASPPKARKRGLWRGIRADLAMLADIFRTIPAPEALHQIRALRRQS
FT                   RGPLPQPRRQPG"
FT   gene            complement(450996..451547)
FT                   /locus_tag="RSKD131_0462"
FT   CDS_pept        complement(450996..451547)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0462"
FT                   /product="DedA family, membrane protein precursor"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00322"
FT                   /db_xref="GOA:B9KNP4"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="UniProtKB/TrEMBL:B9KNP4"
FT                   /protein_id="ACM00322.1"
FT                   /translation="MIEPGTALSLIAAHGIALVAPLALVEGPIVTIIAAWLAQRDLLDL
FT                   RAVVAVVVLADLVGDALVYAAGRTGGDRVARLLRLRPARVEALALRLRQNAGRLLIGAK
FT                   LTHAAGAAVLFAAGAARVPFGWFMLCNTAATLPKSLAFVALGWWAGESYDRIGAWILPV
FT                   SLALILMAGAAVLLARRRCP"
FT   gene            complement(451544..452635)
FT                   /locus_tag="RSKD131_0463"
FT   CDS_pept        complement(451544..452635)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0463"
FT                   /product="Ceramide glucosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00323"
FT                   /db_xref="GOA:B9KNP5"
FT                   /db_xref="InterPro:IPR025993"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:B9KNP5"
FT                   /protein_id="ACM00323.1"
FT                   /translation="MMSLSAAAFSLLAVHLAAAGLAAAQGRRRPAPPSARPFVCLLRPV
FT                   CGQDRFDRETLASSFGLDWPDYEIVFCAAREEDAAVPLVRELIRLHPGARARLMIGEER
FT                   ITANPKLNNLAKGWAGTGARMIAIADANLLLPRDYLEQLASEWRPGVALVSSPPAGGRA
FT                   EGLWGALEAGFLNGLQGRWQLAAARLGFGFAQGKTMYLDRALLDRQGGLAALGGELAED
FT                   VAATRLVRAAGGTVRLVPRPFTQPIGRRRLRDVWARQLRWSRIRRQGFPALFALEPLLS
FT                   PVLPLLMLAPTAPLTIPLFLALWYGGEALLCRAMGWPAGRRDLAAWVLRDLMLPVLWAA
FT                   TFARQGFEWRGTAMAPAPDRPAA"
FT   gene            complement(452632..453438)
FT                   /locus_tag="RSKD131_0464"
FT   CDS_pept        complement(452632..453438)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0464"
FT                   /product="Metallo-phosphoesterase precursor"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00324"
FT                   /db_xref="InterPro:IPR024654"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:B9KNP6"
FT                   /protein_id="ACM00324.1"
FT                   /translation="MDMTLLPPPRRHRSLFLSDLHLGSRGCRADRILAFLRDHTAPDIY
FT                   LVGDILDLWHPPFPHWTPSHDAILALLLGRVQQGTRIHYLTGNHDAAMRVYLGEHFQRI
FT                   TVAEETVHAAADGRRYLVTHGDACDPRILRFHVMTRIGSRLDWMLRNLDGRLKRMRRTA
FT                   DSERRSLIEALLKGVDAALAFGTAYEERLVARARRAGCDGVICGHFHKPALHEAHGLVY
FT                   ANCGDWVDSFTALAEDAAGHLTLLQGSPAPEPASGFAPAFPLPAEA"
FT   gene            complement(453572..454873)
FT                   /locus_tag="RSKD131_0465"
FT   CDS_pept        complement(453572..454873)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0465"
FT                   /product="Hypothetical Protein"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00325"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:B9KNP7"
FT                   /protein_id="ACM00325.1"
FT                   /translation="MTSRTAQIRATARSDRRAAEDMLARLIHDLFGIAVRDLAINLDRY
FT                   SLNSLNGFFESDEGPCFFKFHQEEGEEAMRGEYYRADLLAEAGLPVDRPIRVSSLPGEQ
FT                   ILIYRRRSDPRFSDLLRGLDLAPDAAAMARALEAEGVLNDRLLAVAQESLHPITPAQSQ
FT                   AEPIHRLFHERLVEPGSRAYPGGRLSGFYVGKPFDLPGLTLPWEVLAHAPLVIDGMAYD
FT                   RTLAQLFDAAHARLAPERLADAGGITAHGDAHNANVWYERGSEADRLVFFDPAFAGSHV
FT                   PSLLAEVKSTFHNILAHPLWLYDPEEVAPRWQVTARLQEGALHLDSDWQPGALREGLLE
FT                   VKARRFWRPWLAHLAAEGLLPPDWEEVVRLALFLCPTLVMSLRAGPGAGPHTPASSALG
FT                   LMAAVRAGARPVTGEDRLVRFFDAVRPRGLPVQD"
FT   gene            complement(454875..456200)
FT                   /locus_tag="RSKD131_0466"
FT   CDS_pept        complement(454875..456200)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0466"
FT                   /product="histidinol dehydrogenase 2"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00326"
FT                   /db_xref="GOA:B9KNP8"
FT                   /db_xref="InterPro:IPR001692"
FT                   /db_xref="InterPro:IPR012131"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR022695"
FT                   /db_xref="UniProtKB/TrEMBL:B9KNP8"
FT                   /protein_id="ACM00326.1"
FT                   /translation="MVQVNFQVLAELDAAGRAALLRRSETDLSMFLEKVGPILEAVRTE
FT                   GDSALVRFGRELDRAEGLTREGLKVTEAEFDEAFGLVEPEIVEAIRFAIGNIRTFHEEQ
FT                   APEPMWLKELRPGAFAGDRFTPIRSVALYVPRGKGSFPSVTMMTSVPAVVAQVPQIAIF
FT                   TPPAPDGRVDAATLVAARLAGVETVYKVGGAQAVAAAAYGTETVTPALKIVGPGSPWVV
FT                   AAKRLLAGVIDPGLPAGPSESIILADETVHGGLAALDLLIEAEHGPDSSAWLVTHSRQV
FT                   AEEALAALPGHWAAMTPQRVDFSQAVLCGRAGGIVLTGSAEESHAFVNDYAPEHLQILS
FT                   EKPFEHLGRITEAAEVLMGPHTPITIANFCLGPNAVLPTSRGARTWGPLSVHDFLRRSS
FT                   VGYVTAPAYPELAEVAKRLAEYEGFSSHANAVGPMRDAYLKR"
FT   gene            complement(456210..457007)
FT                   /locus_tag="RSKD131_0467"
FT   CDS_pept        complement(456210..457007)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0467"
FT                   /product="Binding-protein-dependent transport systems inner
FT                   membrane component precursor"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00327"
FT                   /db_xref="GOA:B9KNP9"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B9KNP9"
FT                   /protein_id="ACM00327.1"
FT                   /translation="MTTAGQRLAIWSLVWISILILSAPTVVVLGASVTSGNMIAFPPEG
FT                   FSLKWYEKIAMARDLRQAFGRSLVVATVCTLVALPVGTLAGIALSRYRLRFANALQVYL
FT                   LLPFTVPLIGSGIGLMLVFGEWRVLGSLWPVGVACAVINLPFLVWSVSSSATLLDPDLE
FT                   HAAANCGAGRVQTFLHVTLPAVMPGVITGSLLMFILAMNEFLVSLLLTDARTVTLPVQI
FT                   YNSIRSIITPDLAAVSVVFIVIAGAAIAVLDRLVGLEIFLKSK"
FT   gene            complement(457004..457939)
FT                   /locus_tag="RSKD131_0468"
FT   CDS_pept        complement(457004..457939)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0468"
FT                   /product="Binding-protein-dependent transport systems inner
FT                   membrane component precursor"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00328"
FT                   /db_xref="GOA:B9KNQ0"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B9KNQ0"
FT                   /protein_id="ACM00328.1"
FT                   /translation="MSSFRYPLRWRLMDALERAADLLWPERLSRFTGWLMIAPALLLVG
FT                   LLVLGLVEMADGSLRTLDRATFLPSEELSLANYETALGSATYWRVFGRSILGATLATAL
FT                   TLALAFPYAYALVRVPGAVTRKALLVVLFLPFFIGQVVRAYGWLIILGNGGMVNEALGL
FT                   VGIAPQRLLFNFPAVVFGLVQYLLPFAVLMLAPALTAIPAETETAARSLGASWLRTIWH
FT                   VVLPMARPGLIGAGLVTMTLALTDFATPAMLGGGSQDFIANAIYDQFFRTADQGLGSAL
FT                   ALMLVAAGSAIVALVLGLFGAGTLAMGARR"
FT   gene            complement(457988..458419)
FT                   /locus_tag="RSKD131_0469"
FT   CDS_pept        complement(457988..458419)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0469"
FT                   /product="Hypothetical Protein"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00329"
FT                   /db_xref="UniProtKB/TrEMBL:B9KNQ1"
FT                   /protein_id="ACM00329.1"
FT                   /translation="MRAPRRVQASGRTRPTVRQTRPGLQQSPHRPRTLPALPPSLRPAS
FT                   PRPGSAVRPIRPPFPFDKPASSPPASAACRSVRLLSARLRRPSDPASRLPARRASRFRR
FT                   LPAPPAAPPPSSATCPIRPPLLLPAPPPARSVRSSPPPA"
FT   gene            complement(458512..459609)
FT                   /locus_tag="RSKD131_0470"
FT   CDS_pept        complement(458512..459609)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0470"
FT                   /product="Extracellular solute-binding protein, family 1
FT                   precursor"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00330"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="UniProtKB/TrEMBL:B9KNQ2"
FT                   /protein_id="ACM00330.1"
FT                   /translation="MIHRLTRRGLLRGTAAAGSAALLGSVAGTRLWAQEPEKPAELIVR
FT                   AWGGSWVEALKAGVSDPFTKATGIAVRHDLTEDNEIQPKVWAAVAQGRVPPIHINWDTT
FT                   TNATKSALRGVTEDLSGLPNLAATTDLAKPVGLDGYPIVNTYGYVYVLAYRPEVFPDGP
FT                   PKSWEVLLEPRFKGRIALYNDGIGFHFPAQVAGGGSLEDIPGNMQPAWDFIAKVKEQQP
FT                   LLGEDPDFTAWFQNGEIDLACTISTNAREARKNGVDIAWTVPEEGCKFDTDGLWIPKGL
FT                   PENELYWAKQYINFAITPEAQQVWLDGLGLPGVVPGLTPPADLANDPSYPTKPEDFEHL
FT                   IRVSAQVQVENESDWFAKFKEIMQG"
FT   gene            complement(459629..460762)
FT                   /locus_tag="RSKD131_0471"
FT   CDS_pept        complement(459629..460762)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0471"
FT                   /product="ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00331"
FT                   /db_xref="GOA:B9KNQ3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B9KNQ3"
FT                   /protein_id="ACM00331.1"
FT                   /translation="MTPLPRPDRAPDPGQPAVLVRDVDMDFGSGPLAVAGASFALARGR
FT                   FLTILGPSGSGKTTLLRIIAGFQQPTRGEIRLGGQAVTATAPHRRSIGMVFQKLALFPH
FT                   MTAAENVAFPLKMRRHDPATIPGKVERYLDLVRLGGLGGRRIHELSGGQQQRVAIARAL
FT                   VFEPELLLLDEPLAALDRKLREEMQLEFRRIQKELGVTTINVTHDQREALVVSDEIIVM
FT                   DHGRIQQHARPVEMYRLPANPFVAGFVGVSTFLEGRRTATGLDAGGAACAGTPVGAIPE
FT                   GAPVQGAIRAEQIRIEADPARLAGCDTVLRGIVRDTIFEGERLLYLVEVPALGLALQVY
FT                   HHDPEEFALFDAGAEVSLGWNARDLLIFNRQDGRDGR"
FT   gene            complement(460839..461603)
FT                   /locus_tag="RSKD131_0472"
FT   CDS_pept        complement(460839..461603)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0472"
FT                   /product="Short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00332"
FT                   /db_xref="GOA:B9KNQ4"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B9KNQ4"
FT                   /protein_id="ACM00332.1"
FT                   /translation="MSDFLQGLFSLTGRRAMVTGASRGLGQAIALGLAEAGADLVLTAR
FT                   TAGALEQTAASVRALGREALCLALDQSDPASVAAPMEAAGRIDILVNNAGTEEVCPSEA
FT                   VTPELWDRILDTNLRGAFFVTQAAARGMLARGQGSIVNLCSLTSFVGVPTAVPYGSSKS
FT                   GLLGMTRALAAEWAPRGVRVNAIAPGYFRTALTEVFYQNEDWAQAMQARIPQGRFGEGR
FT                   DLVGAAVFLASDASAYVTGQCLGVDGGYLGSI"
FT   gene            complement(461799..462506)
FT                   /locus_tag="RSKD131_0473"
FT   CDS_pept        complement(461799..462506)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0473"
FT                   /product="Phosphoesterase, PA-phosphatase related"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00333"
FT                   /db_xref="GOA:B9KNQ5"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="InterPro:IPR036938"
FT                   /db_xref="UniProtKB/TrEMBL:B9KNQ5"
FT                   /protein_id="ACM00333.1"
FT                   /translation="MLASIAALDLHISLFVNSAMGSLPTFDQLLHIVERNSLFKGVFSM
FT                   MLFWGLWFAASRDVARTHARLLATLVVAVLAVAVGRTLAMVLPYRPRPIHDPDLGFLLH
FT                   SGLSHETLDGWSSMPSDHAVLYFALATGIFLAHRAVGVVALLHAIFIICLPRIYFGLHY
FT                   TGDIVAGAIIGIAMAVVLVPVLARQFQRLDLPGYAASHGALFYPAVFFVTWQVALMFGP
FT                   VRDLLRDLAAALA"
FT   gene            462800..463603
FT                   /locus_tag="RSKD131_0474"
FT   CDS_pept        462800..463603
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0474"
FT                   /product="Lytic murein transglycosylase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00334"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR031304"
FT                   /db_xref="UniProtKB/TrEMBL:B9KNQ6"
FT                   /protein_id="ACM00334.1"
FT                   /translation="MISSLRPASLALVAGLLAGPVAAAPCSDTGANYESWKPQMAQEAA
FT                   AVGVGQRGIAALMGTSYSSRTIAADRNQKSFKYSLDKFMQVRGSETIVKQGRARKAKSP
FT                   DLYAALERRYGVPAGVLLAIHGMETGFGNFMGDTNVVSAIATLAYDCRRSDFFTPHLLA
FT                   ALVLVDRGSISTASVGAKHGEIGHTQFLPGNALTYGVDGNGDGRVDLTNLTDALASTAN
FT                   FLAAKGWQPGLGYQPGEPNFAVIREWNAASVYQQAIAIMGQRIDR"
FT   gene            463657..463731
FT                   /locus_tag="RSKD131_trnaGlu1"
FT   tRNA            463657..463731
FT                   /locus_tag="RSKD131_trnaGlu1"
FT                   /product="tRNA-Glu"
FT   gene            complement(463973..464449)
FT                   /locus_tag="RSKD131_0475"
FT   CDS_pept        complement(463973..464449)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0475"
FT                   /product="Transcriptional regulator, AsnC family"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00335"
FT                   /db_xref="GOA:B9KNQ7"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B9KNQ7"
FT                   /protein_id="ACM00335.1"
FT                   /translation="MEAQAGRMQLELDRFDHAILRVLAADGRVSATELARRIGLTKSPT
FT                   QARMKRLEAAGVITGYGARLDPIRMGLAHVAFVEVKLSDTRESALQAFNRAVLAVPEVE
FT                   ECHMIASRFDYLLKVRTADIQDYRRVLGEKLSTLPFVASTSTHVAMESVKEARG"
FT   gene            464539..467979
FT                   /locus_tag="RSKD131_0476"
FT   CDS_pept        464539..467979
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0476"
FT                   /product="Delta-1-pyrroline-5-carboxylate dehydrogenase /
FT                   L-proline dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00336"
FT                   /db_xref="GOA:B9KNQ8"
FT                   /db_xref="InterPro:IPR002872"
FT                   /db_xref="InterPro:IPR005933"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR024082"
FT                   /db_xref="InterPro:IPR024089"
FT                   /db_xref="InterPro:IPR025703"
FT                   /db_xref="InterPro:IPR029041"
FT                   /db_xref="UniProtKB/TrEMBL:B9KNQ8"
FT                   /protein_id="ACM00336.1"
FT                   /translation="MLAAAVHPTSSDTLDEAGLVARLIAEADLDPSARARIVARGADLV
FT                   RRIRQGSRPGLMEGFLAEYGLSTDEGIALMCLAEALLRVPDAETMDALIEDKIAPSDWN
FT                   RHLGRSASSLVNASTWALMLTGKVLDDREPGVAGHLRGLVRRLGEPVIRKAVARAMKEM
FT                   GRQFVLGETIEGAMARAAELEARGYSYSYDMLGEAARTEADARRYHLAYSRAITAIAAA
FT                   AKSRDIRDNPGISVKLSALHPRYEVAKRARVLAELVPRVTALAGLARAAGLGFNIDAEE
FT                   ADRLDLSLEVIAAALAEPSLAGWDGFGVVVQAYGRRAGEVLDRLYGMAVRLDRKLMVRL
FT                   VKGAYWDGEVKRAQVLGLADFPVFTRKMATDVSYIAQARKLFSMSDRIYPQFATHNAHT
FT                   VAAILELAEGRPFEFQRLHGMGERLHDLVLTEEKTRCRIYAPVGAHRDLLAYLVRRLLE
FT                   NGANSSFVNQIVDESVSPEAVAACPLTAMERTEPVRNPVLRAGTDLFPGRRNSRGFDLA
FT                   SAEDLALIESARTPHRTALFDARPILAESLAGGQRAEVTDPSTGARVGNVLPASLPDVE
FT                   TALHHAVPWEARPEDRAEVLRRAADLYEASFGPIFALLAREAGKTLPDAVGELREAVDF
FT                   LRYYAAEGEALIAPPLGTVVCISPWNFPLAIFTGQIAAALMAGNAVLAKPAEQTPLIAA
FT                   LAVELLHRAGVPATALQLLPGEGGTVGAALTRDPRVGGVVFTGSTETARAIRQSMAAHL
FT                   DPAAPLIAETGGLNAMIVDSTALPEQAVRDILASAFQSAGQRCSALRCLYLQEDVAEGV
FT                   IEMLCGAMDELQAGEPWDLATDLGPVIDAEAQAGIRDWIAAARAEGRVLKELAVPARGT
FT                   FVGPTVIRVGSIREMDREIFGPVLHVATFRATEIDRVIAEIDATGYGLTFGLHSRIDDR
FT                   VQALVGRLRVGNIYVNRNQIGAVVGSQPFGGEGLSGTGPKAGGPAYLARLVKRPAPDCA
FT                   GGEAPAQPAAEVQAALDRLAPKAGELVGTRALPGPTGESNRLSLLRRPPLLCLGPGAAA
FT                   ARAQAEAVQALGGLAVEAPGLAPEALATLRGFAGALFWGGAEDARPRAQALASREGPIL
FT                   PLIGGLPDEAHVAVERHLCIDTTASGGNAELLAAASGGR"
FT   gene            468211..468951
FT                   /locus_tag="RSKD131_0477"
FT   CDS_pept        468211..468951
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0477"
FT                   /product="Rhomboid family protein"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00337"
FT                   /db_xref="GOA:B9KNQ9"
FT                   /db_xref="InterPro:IPR022764"
FT                   /db_xref="InterPro:IPR035952"
FT                   /db_xref="UniProtKB/TrEMBL:B9KNQ9"
FT                   /protein_id="ACM00337.1"
FT                   /translation="MFPIRDHNPSGRTPYVTYALIAANVLIFLAMHYGSASPLALEAAF
FT                   FDWGLVPAELMQGQGYEGLLTSMFLHGGWAHLLGNMLFLYIYGDNLEDVLGHGGFSLFY
FT                   LAAGLAAAGAQVLADPFSWIPMVGASGAIAGVMGGYLLLFPRAKVDVLIIILIFFRIIP
FT                   VPAFLLLGLWFLFQIVSGVAVPTDQGGVAYWAHAGGFGAGILLTLPAFIARGGPAFWQR
FT                   THGLPPHPEAALPRSNVPLVRRKR"
FT   gene            468948..469304
FT                   /locus_tag="RSKD131_0478"
FT   CDS_pept        468948..469304
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0478"
FT                   /product="Glutathione-dependent formaldehyde-activating,
FT                   GFA"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00338"
FT                   /db_xref="GOA:B9KNR0"
FT                   /db_xref="InterPro:IPR006913"
FT                   /db_xref="InterPro:IPR011057"
FT                   /db_xref="UniProtKB/TrEMBL:B9KNR0"
FT                   /protein_id="ACM00338.1"
FT                   /translation="MKGTCHCGAVEIEVDLLNGFADARRCDCSFCRRRGAIAATARLSD
FT                   LRVVRGAENLTLYQFGTRTAKHWFCRTCGIYTHHQRRSNPGEYGVNVAILEGVNPRDLG
FT                   EVPWTDGVNHPSDR"
FT   gene            complement(469529..470329)
FT                   /locus_tag="RSKD131_0479"
FT   CDS_pept        complement(469529..470329)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0479"
FT                   /product="Inositol monophosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00339"
FT                   /db_xref="GOA:B9KNR1"
FT                   /db_xref="InterPro:IPR000760"
FT                   /db_xref="InterPro:IPR020550"
FT                   /db_xref="InterPro:IPR020583"
FT                   /db_xref="InterPro:IPR022337"
FT                   /db_xref="InterPro:IPR033942"
FT                   /db_xref="UniProtKB/TrEMBL:B9KNR1"
FT                   /protein_id="ACM00339.1"
FT                   /translation="MEPGRMQGSANLNLMIKAARKAGRSLVKDFREVENLQVSSKGPGD
FT                   FVSKADREAERIIREELMGARPTYGWLGEETGETAGQDPTRRWIVDPLDGTTNYLHGLP
FT                   HWAVSIALEHKGEIVAGVIFDAAKDELYWAEKGAGAWMNESRLRVSGRRHMIEAIFATG
FT                   VPFGGRSTLPATLQDLARLMPTCAGVRRWGSAALDLAYVAAGRYDGYWERGVSAWDVAA
FT                   GVVLVREAGGLISGIREDQNPIDGSLICGNQNLFEPFRKVIRGE"
FT   gene            complement(470445..471962)
FT                   /locus_tag="RSKD131_0480"
FT   CDS_pept        complement(470445..471962)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0480"
FT                   /product="Phosphate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00340"
FT                   /db_xref="GOA:B9KNR2"
FT                   /db_xref="InterPro:IPR001204"
FT                   /db_xref="UniProtKB/TrEMBL:B9KNR2"
FT                   /protein_id="ACM00340.1"
FT                   /translation="MTLPPTRPAETAGTPEAGAPINQWKTLDKDLKRIVQLEQAGQFVG
FT                   RPLLSLGIALVFIVVAGVAASVIVGGTPNALVIVAAAAFGAYMALNIGANDVANNMGPA
FT                   VGANALTMTGALAIAAVFETAGALIAGGDVVSTISGGIVDPASVAEAGIFVWAMMAALI
FT                   AAAVWLNVATAIGAPVSTTHSIVGGVMGAGMVAAGLGAVNWPVMGQIAASWVISPVLGG
FT                   VFAALFLAFIKHRLIDAEDKIAAARFWVPLLIGVMAAAFSAYLVLKGLRKLMEVDLPAA
FT                   LLIGLVFGVLTVYLTRPLVRRQSEGLENRKKSLKKLFGLPLVVSAALLSFAHGANDVAN
FT                   AVGPLAAIVHAVSDGDTAAKVSIPLWVMIIGAGGISFGLVLFGPKLIRMVGSEITKLNP
FT                   MRAYCVALSAAITVIVASGLGLPVSSTHIAVGGIFGVGFYREWQAERRSRALGLIKGKP
FT                   LPPEERKRRKLVRRAHFLTIGAAWVVTVPATAALSAVIFLGLRTLGN"
FT   gene            complement(472090..472995)
FT                   /locus_tag="RSKD131_0481"
FT   CDS_pept        complement(472090..472995)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0481"
FT                   /product="Transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00341"
FT                   /db_xref="GOA:B9KNR3"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037406"
FT                   /db_xref="UniProtKB/TrEMBL:B9KNR3"
FT                   /protein_id="ACM00341.1"
FT                   /translation="MHLELRHLRTIRAIHQAGGLARAADVLHMTQSALSHQVKGLEDQA
FT                   GIELFVRRSKPLKLSAAGIRLLRLAERILPEIDALEDEFRALRSGRTGRLHIAIECHAC
FT                   FEWLFPVLELFRHAWPEIDVDIRAGLAFEALPALMREEVDLVISSDPVTVEGMVFNPLF
FT                   DYHPTFVAAASNPLAAREFISAEDFRDQMLITYPVSRDRLDVFTEVLTPAKVEPRGTRQ
FT                   VELTAVILMLVASNRGVSVLPDWVLRDVRSHADYVTRPLGPKTVTKRLYAATRTEDATK
FT                   PFMAHFLRLGRSEPVKLQRA"
FT   gene            473090..473956
FT                   /locus_tag="RSKD131_0482"
FT   CDS_pept        473090..473956
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0482"
FT                   /product="5,10-methylenetetrahydrofolate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00342"
FT                   /db_xref="GOA:B9KNR4"
FT                   /db_xref="InterPro:IPR003171"
FT                   /db_xref="InterPro:IPR004620"
FT                   /db_xref="InterPro:IPR029041"
FT                   /db_xref="UniProtKB/TrEMBL:B9KNR4"
FT                   /protein_id="ACM00342.1"
FT                   /translation="MARPRISFEFFPPQTLEASFRLWETAQMLAPLKPDFVSVTYGAGG
FT                   TTRKLTHDAVETIHTHYKLNVAAHLTCVDATKAETLEIAASYAEAGVTEIVALRGDAPK
FT                   GSDRFTPHPEGFASSVELVEALAATGRFKLRVGAYPEPHPDAADTLADVRWLKRKIEAG
FT                   ATSAITQFFFEAETFLRFRDLCAKEGITAPIIPGILPIENWSGVKKFAARCGAQVPGWL
FT                   DDAFDHARRDGREELFSVALCTELCDRLLSEGVEDLHFYTLNRPTLTREVCHALGILPE
FT                   VALQNVA"
FT   gene            complement(474108..474653)
FT                   /locus_tag="RSKD131_0483"
FT   CDS_pept        complement(474108..474653)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0483"
FT                   /product="BioY protein precursor"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00343"
FT                   /db_xref="GOA:B9KNR5"
FT                   /db_xref="InterPro:IPR003784"
FT                   /db_xref="UniProtKB/TrEMBL:B9KNR5"
FT                   /protein_id="ACM00343.1"
FT                   /translation="MERNVTLIALFAALIAVLGLVPQITLMSGVPVTAQSLGVMLCGAV
FT                   LGARRGALAVLLFLVLVFLGLPLLSGGRGGLGVLAGPTVGFVVGFPVAAFVTGLVVEKW
FT                   RAVPVTLAAFVGALLGGVVALYAFGLVGMAFVLGKTLPEAALLLTPFIAGDVLKAAIAG
FT                   LVTRGLSRVRPGVLLSRS"
FT   gene            complement(474667..475263)
FT                   /locus_tag="RSKD131_0484"
FT   CDS_pept        complement(474667..475263)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0484"
FT                   /product="Cobalt transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00344"
FT                   /db_xref="GOA:B9KNR6"
FT                   /db_xref="InterPro:IPR003339"
FT                   /db_xref="UniProtKB/TrEMBL:B9KNR6"
FT                   /protein_id="ACM00344.1"
FT                   /translation="MLTLTSPVETPLHRLPAGAKLTALALSAVALVPLDSLPLLAPAAL
FT                   ATALLYGAQGRAFARHGLALLRPLWPFLLILALWHGWTGEFARGGAVALKLLIAVALAN
FT                   LVTMTTRLDDMIAVLERVARPLRRLGLAPQVLAISIALVIRFTPVLLARAERLAEAWRA
FT                   RSPRRPSWRIVAPLALGALDDAEQVAEALRARGGL"
FT   gene            complement(475238..475978)
FT                   /locus_tag="RSKD131_0485"
FT   CDS_pept        complement(475238..475978)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0485"
FT                   /product="ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00345"
FT                   /db_xref="GOA:B9KNR7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B9KNR7"
FT                   /protein_id="ACM00345.1"
FT                   /translation="MQPASPTETGLRLDRAAFGVGKRAILQDISLHLTEQRIAILGPNG
FT                   SGKTTLLRLMAGLIAPTAGRVTVDGIEPATNRRAMLGAIGILFQNPEHQIIFPTVEEEL
FT                   AFGLKQMGRSAAEARAMARATLAAHGRGHWAAAPVATLSQGQKQFLCLLAVLAMAPGTI
FT                   LLDEPFSGLDLPTQIRLARRLAALPQRLVTITHDPAVVTGFDRAIWLEDGRVRADGPAA
FT                   SVACAYRAEMNRLGSLDADADLAG"
FT   gene            complement(476279..477559)
FT                   /locus_tag="RSKD131_0486"
FT   CDS_pept        complement(476279..477559)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0486"
FT                   /product="4-aminobutyrate aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00346"
FT                   /db_xref="GOA:B9KNR8"
FT                   /db_xref="InterPro:IPR004632"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:B9KNR8"
FT                   /protein_id="ACM00346.1"
FT                   /translation="MMLNADVSRRRTEAVSRGVGMQTQIYADRALNAEIWDIEGRRYID
FT                   FAAGIAVVNTGHCHPKVMAAVAEQMGRFTHTCHQVLPYENYIRLAERLNAAAPGDFAKK
FT                   TVFVTTGAESVENAIKIARIHTGRSAVVAFGGGFHGRTFMTMSLTGKVEPYKKGFGTMM
FT                   PEVYHVPFPQALHGISTEEAMAALARLFKADLDPGRVAAIIFEPVQGEGGFYPAPPDLV
FT                   RAIRQLCDAHGIVMIADEVQTGFARTGTLFAMHGYDVAPDLVTMAKGLGGGLPIAAVTG
FT                   RAEIMDAAHPGGLGGTYGGNPLGIAAAHAVLDVIEEENLCARATELGSRLKQKLAEIRA
FT                   TAPEIADIRGPGFMVGAEFADPGSKAPDAGFTNRVREEALKRGLILLTCGVHGNVIRFL
FT                   APITIPEPHFAEALEILEASVAAARQG"
FT   gene            477809..478927
FT                   /locus_tag="RSKD131_0487"
FT   CDS_pept        477809..478927
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0487"
FT                   /product="DNA protecting protein DprA"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00347"
FT                   /db_xref="GOA:B9KNR9"
FT                   /db_xref="InterPro:IPR003488"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR041614"
FT                   /db_xref="UniProtKB/TrEMBL:B9KNR9"
FT                   /protein_id="ACM00347.1"
FT                   /translation="MRAKAQKSISSPAEAERLDRLRLIRSRRVGPATWRRLMAEHGTAA
FT                   GALAALPGVAAAAGIEGYEVCPLPVALKEMAAARAAGAAMLWLDESGYPPLLGQIADAP
FT                   PLLWLQGDPGLLARPMVALVGARNASSLGLRMARKLAAALGEAGYVVVSGLARGIDAEA
FT                   HAAALGQGTVAVQAGGVDVIYPAENAGLAAEIAARGCRISEQPMGLVPQARHFPLRNRI
FT                   VSGLARAVVVVEAAARSGSLITAREALDQGREVLAVPGHPFDPRAAGGNQLIREGATLV
FT                   RHAADVIEAIGTAHPAARSPEPQPDPPRRPLYEISAVHSRILDRLGPVPVPEDQLIRDL
FT                   SLPAGRVAQELVALELEGRIQRDPGGLVSRPE"
FT   gene            complement(478985..479173)
FT                   /locus_tag="RSKD131_0488"
FT   CDS_pept        complement(478985..479173)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0488"
FT                   /product="ATP-dependent RNA helicase MRH4"
FT                   /note="similar to mitochondrial ATP-dependent RNA helicase"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00348"
FT                   /db_xref="GOA:B9KNS0"
FT                   /db_xref="UniProtKB/TrEMBL:B9KNS0"
FT                   /protein_id="ACM00348.1"
FT                   /translation="MPCDLRISAAPCGGSRANVNARLGGGSPAALPPDGGPHRPGGAQR
FT                   ASRAGRAAVGDSLRKRL"
FT   gene            479186..481840
FT                   /locus_tag="RSKD131_0489"
FT   CDS_pept        479186..481840
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0489"
FT                   /product="DNA topoisomerase I"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00349"
FT                   /db_xref="GOA:B9KNS1"
FT                   /db_xref="InterPro:IPR000380"
FT                   /db_xref="InterPro:IPR003601"
FT                   /db_xref="InterPro:IPR003602"
FT                   /db_xref="InterPro:IPR005733"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR013497"
FT                   /db_xref="InterPro:IPR013498"
FT                   /db_xref="InterPro:IPR013824"
FT                   /db_xref="InterPro:IPR013825"
FT                   /db_xref="InterPro:IPR013826"
FT                   /db_xref="InterPro:IPR023405"
FT                   /db_xref="InterPro:IPR023406"
FT                   /db_xref="InterPro:IPR025589"
FT                   /db_xref="InterPro:IPR028612"
FT                   /db_xref="InterPro:IPR034149"
FT                   /db_xref="UniProtKB/TrEMBL:B9KNS1"
FT                   /protein_id="ACM00349.1"
FT                   /translation="MAVVVVESPAKAKTINKYLGSDYTVLASYGHVRDLPPKDGSVDPE
FT                   HEFAMTWEVAADSKKHVRAIADALKTDDTLILATDPDREGEAISWHLQEALASSLKKGK
FT                   TVRRVTFNAITKSAVTEAMKAPREVDTALVEAYLARRALDYLVGFTLSPVLWRKLPGAK
FT                   SAGRVQSVCLRLIVEREMEIEAFRAREFWTVSAVLATPRGQEFEARLTVLGGKKLEKFD
FT                   LATSEAAELAVQAVTSRPLKVASVEAKPASRNPSAPFMTSTLQQEASRKFGMGAKQCMS
FT                   AAQRLYEAGHITYMRTDGIDMAPEAVMAARDEIKRRFGANYVPDSPRMYKNKAKNAQEA
FT                   HECIRPTDMSASPEKLGLTDTDQRKLYELIWKRTLASQMAAARLERTTVEIASPDGQVG
FT                   LRATGQVVLFDGFLKVYEEGRDDRSDGDEDDEGRLPQIMANEAVEKKSITPEQHHTQPP
FT                   PRYTEATLVKRMEELGIGRPSTYASIVSTIQDREYVRKDKNRLIPEDKGRLVTAFLANF
FT                   FRKYVEYDFTADLEGELDDVSAGERNYKEVLARFWRDFSAAVAETADLRIGEVLDKLDE
FT                   FLAPHLYPPRPDGSDPRICPTCGSGRLHLKTARGGGAFIGCGNYPDCRYTRPISVTGDE
FT                   ENAISPDGKLLGHDEDGAPISLRSGRFGPYVQKGEVTAEVPKPPRASLPKGWAPDTVDL
FT                   DRALMLLNLPRLVGSHPEDGQPVEAAIGRYGPYVKHGSTYANLPDVEEVFTIGMNRAVE
FT                   VLAQKAAGRRGASAPAQPIKELGEHPDGGLLAVMPGRYGPYVKWGKVNATIPKGIEPEA
FT                   ITLEEALALVAEKAGKAPKKKAPARKAKAEEGAPKKAAPKKAAAKTTKTAAKKPAAAKS
FT                   TAKKKAAPDTDAA"
FT   gene            complement(481889..482917)
FT                   /locus_tag="RSKD131_0490"
FT   CDS_pept        complement(481889..482917)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0490"
FT                   /product="ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00350"
FT                   /db_xref="GOA:B9KNS2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR022473"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B9KNS2"
FT                   /protein_id="ACM00350.1"
FT                   /translation="MTAVEFDRVSIVFGDHPERALPLMDRGQSRSEVQAETGQVLGVHD
FT                   CSLTVAEGEILVLMGLSGSGKSTLLRGVNGLNPVVRGEVRVSDGDRMVSVTNATAADLR
FT                   RLRLSRIAMVFQQFGLLPWRTVRDNVGLGLEMAGMSPKDRRALVDEQLTLVNLSAWADR
FT                   KVGELSGGMQQRVGLARAFVTQAPILLMDEPFSALDPLIRSRLQDELLDLQRKLKRTII
FT                   FVSHDLDEAFKIGNRIALMEGGRIVQCGTARQIIANPVSDYVADFVAHMNPLGVLTARD
FT                   VMEAGPSPAGQSVGADCTVRTVMEMLRDGAGELAVTESGSVIGTIRPEAVMGRLIDPRG
FT                   TV"
FT   gene            complement(482914..483774)
FT                   /locus_tag="RSKD131_0491"
FT   CDS_pept        complement(482914..483774)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0491"
FT                   /product="Binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00351"
FT                   /db_xref="GOA:B9KNS3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR017784"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B9KNS3"
FT                   /protein_id="ACM00351.1"
FT                   /translation="MRMLDWLTDLGWLTDHKLPVGRWSKMGFDWLNANGGPFFNLISRM
FT                   MQAVIDAMLNVLDAAPPLLVIVILAALAWVLQRNWRVTALVVAGFAFILNQGYWDETMQ
FT                   SLTLILLACVTCMAIGVPLGIAAAHRPRLYQAMSPVLDLMQTLPTFVYLIPAIVFFGLG
FT                   MVPGLIATVIFVLPAPIRLTHLGIASTPMALKEAATAFGATPRQRLWKVELPYAFPQIM
FT                   TGLNQTIMLSLSMVVIAALVGANGLGVPVVRALNTVNTALGFESGFIIVVVAIVLDRML
FT                   RVTRK"
FT   gene            complement(483873..484799)
FT                   /locus_tag="RSKD131_0492"
FT   CDS_pept        complement(483873..484799)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0492"
FT                   /product="Substrate-binding region of ABC-type glycine
FT                   betaine transport system precursor"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00352"
FT                   /db_xref="GOA:B9KNS4"
FT                   /db_xref="InterPro:IPR007210"
FT                   /db_xref="InterPro:IPR017783"
FT                   /db_xref="UniProtKB/TrEMBL:B9KNS4"
FT                   /protein_id="ACM00352.1"
FT                   /translation="MTPIRQALLAAASTLAMAGTALAQDQCREVTFSDVGWTDITVTTS
FT                   ATRQVLEALGYDVEVDILGVPVTYASMDKGDVDVFLGTWLPAQESAIGPYLEKGSIEEI
FT                   TTNLEGTKYTLAVPTYLYDKGLKSYGDIAKFKDELEGKVYGIEPGNEGNEYLISLTEAG
FT                   KPLEGFEVVQSSEQGMLAQVARFYPQEKGVVFLGWEPHPMNATFSLKYLPGGEDFFGED
FT                   GVVKTVARKGFKEDCPNVTKMLSQQKFTLPMENEIMGKILDDGMEPDAAVMEWLKANPE
FT                   TVDPWLAGVTTVDGKDALPVVKEALGL"
FT   gene            484901..485470
FT                   /locus_tag="RSKD131_0493"
FT   CDS_pept        484901..485470
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0493"
FT                   /product="Transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00353"
FT                   /db_xref="GOA:B9KNS5"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR017757"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR039538"
FT                   /db_xref="UniProtKB/TrEMBL:B9KNS5"
FT                   /protein_id="ACM00353.1"
FT                   /translation="MEPIRKAALVKATIVEIGRAGSLDVTVSQIAKRAGMSSALAHHYF
FT                   GGKEALFIAAMRHVLSLYGAEVRGALLGAETPAARITAILQASFSATNFRREVVGAWLN
FT                   FYVLAQTAPQARRLLAIYQRRLRSNLLVGLRPLAGERAADLADGLGALIDGLYLREVLK
FT                   EGPPDSAAAVACARAYLNAHLKECPL"
FT   gene            485467..486918
FT                   /locus_tag="RSKD131_0494"
FT   CDS_pept        485467..486918
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0494"
FT                   /product="Betaine aldehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00354"
FT                   /db_xref="GOA:B9KNS6"
FT                   /db_xref="InterPro:IPR011264"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9KNS6"
FT                   /protein_id="ACM00354.1"
FT                   /translation="MRAQPAASHFVDGRPLEDETGAPIPVIYPATGEEIARLHEATPAV
FT                   IEAALASGARAQAAWAAMRPVERARILRRASDLIRARNEELSLLETLDTGKPLQETLVA
FT                   DWASGADALEFFAGLAPAVTGETVPLGQDFVYTIREPLGLCVGIGAWNYPSQIACWKAA
FT                   PALALGNAMVFKPSEVTPLGALKLAEILIEAGLPPGLFNVVQGRGGVGAALVTDSRVAK
FT                   VSLTGSVPTGRRVYAAAAEGVRHVTMELGGKSPLIVFDDADLESAIGAAMLGNFYSAGQ
FT                   ICSNGTRVFVQKGIKEAFLARLAERADAIRMGDPLDPEVQMGPLVSQAQLEKVLAYIEK
FT                   ARAEGGRLVCGGEASVSPGCYVQPTVFADVTDAMTLACEEVFGPVMAVLDFETEEEAIA
FT                   RANATDFGLAAGVFTADLTRAHRVVAQLQAGTCWINAYNLTPVEAPFGGVKLSGVGREN
FT                   GRAAVEHYTQVKSVYVGMGPVDAPY"
FT   gene            486928..488574
FT                   /locus_tag="RSKD131_0495"
FT   CDS_pept        486928..488574
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0495"
FT                   /product="Choline dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00355"
FT                   /db_xref="GOA:B9KNS7"
FT                   /db_xref="InterPro:IPR000172"
FT                   /db_xref="InterPro:IPR007867"
FT                   /db_xref="InterPro:IPR011533"
FT                   /db_xref="InterPro:IPR012132"
FT                   /db_xref="InterPro:IPR027424"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B9KNS7"
FT                   /protein_id="ACM00355.1"
FT                   /translation="MFDYIIVGAGSAGCAMAYRLGEAGRSVLVVEHGGTDAGPFIQMPA
FT                   ALSYPMNMGIYDWGLKTEPEPHLDGRVLATPRGKVIGGSSSINGMVYVRGHARDFDHWA
FT                   ESGATGWGFADVLPYFKRMENWHVPGDVEWRGHDGPLHVTRGPRSNPLFNAFIEAGRQA
FT                   GYPVTDDYNGAAQEGFGPMEATIWQGRRWSAANAYLRPAMKRFGVKLTRALALKVVIEE
FT                   GRAVGVEVQRRGGREVIRAGREVILAASSLNTPKLLMLSGIGAAAHLAEHGIPVVADRP
FT                   GVGQNLQDHLEVYMQFASLQPVTLFKHWNLRGKVSIGAQWLFTGRGLGASNQFEACAFI
FT                   RSKPGVDYPDIQYHFLPIAVRYDGKAAAEGHGFQVHVGPMRSPSRGSVRLRSADPEAPP
FT                   VIRFNYMSTEEDWQDFRRCVRLTREIFGQEAFKPFVRHEIQPGSACASDAEIDAFIREH
FT                   VESAYHPCGTARIGRADDPMAVVDPECRVIGVEGLRVADSSIFPRVTNGNLNAPSIMVG
FT                   EKAADHILGRTPLAPLNLEPVMNPNWRTAQR"
FT   gene            488823..489503
FT                   /locus_tag="RSKD131_0496"
FT   CDS_pept        488823..489503
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0496"
FT                   /product="Nuclease"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00356"
FT                   /db_xref="InterPro:IPR016071"
FT                   /db_xref="InterPro:IPR035437"
FT                   /db_xref="UniProtKB/TrEMBL:B9KNS8"
FT                   /protein_id="ACM00356.1"
FT                   /translation="MHPARRGGHVCGMLRLRSLLVLAALLPLPVLAAPVEGPARVIDGD
FT                   TLEIEGVRVRLFGIDAPEHDQTCGDPDRLWPCGAWATERLELMLGGGAVRCEGDERDRY
FT                   GRLLATCEASGEDVGARMVRDGAAVAYRRYSARYVLEEARAEAEGLGVWSGPMQRPEDY
FT                   RHAPPAPPPPGECAIKGNVSRNGRIYHMPGQADYARTVISGPEEQWFCTAAEAESAGFR
FT                   PAKR"
FT   gene            complement(489827..491212)
FT                   /locus_tag="RSKD131_0497"
FT   CDS_pept        complement(489827..491212)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0497"
FT                   /product="Transcriptional regulator, MerR family"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00357"
FT                   /db_xref="GOA:B9KNS9"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010359"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR018653"
FT                   /db_xref="InterPro:IPR026281"
FT                   /db_xref="UniProtKB/TrEMBL:B9KNS9"
FT                   /protein_id="ACM00357.1"
FT                   /translation="MAQKLYAGAKLRELRVKLGLTQKVFAERLGASLPYLNQMENNHRP
FT                   VSATVVLALAQEFGVDVTKLTTSEAERIVTDMREALADPVFTDSPPLADLRLVASNAPA
FT                   FARAFLDLHRAYRQTHERLASLDEALGRDEADLRPSPWEEVRDFFHYCDNYLDAVDRAA
FT                   EHYAAPGGVRRDVFSAAMETLTRAGLDLQISDMPAIRSREGNALRLSARAAAPTQRFQL
FT                   LHQVALLTQNDLLEATLDLARFQTAEAREIAKIGLANYFAGAALLPYRPFLQAAAETRH
FT                   DLERLADLFGASIEQVAHRLSTLQRPGAKGVPFFFVRVDQAGTITKRHSATRFQFARFG
FT                   GACPLWNVHRAFETPGRFLRQLAQTPDGVRYLLLARDVSKPGGSFTAPVRRYAIGLGCE
FT                   VQHADALVYADGLDLKGSFEPIGISCRICDRQECHQRSVPPLEKRLRVDPDRRGLLPYE
FT                   IVD"
FT   gene            complement(491274..492494)
FT                   /locus_tag="RSKD131_0498"
FT   CDS_pept        complement(491274..492494)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0498"
FT                   /product="Drug resistance transporter, Bcr/CflA subfamily
FT                   precursor"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00358"
FT                   /db_xref="GOA:B9KNT0"
FT                   /db_xref="InterPro:IPR001958"
FT                   /db_xref="InterPro:IPR004812"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B9KNT0"
FT                   /protein_id="ACM00358.1"
FT                   /translation="MIALPPPRFLDRRSPPHILTLVMLTGLAALAMNIFLPSLPGMSAW
FT                   FDAPYQLLQLSVALYLGLSALLQVAVGPISDRFGRRNVILWSLGLFLAATVGTLLAPSA
FT                   EVFLVFRMAQAVIAAGMVLSRAVVRDMVPDEQAASMIGYVTMGMSLVPMIGPVIGGMLD
FT                   EAFGWQANFTLLLVLGLLVTALVWADLGETSEIRPVSFGAQLRQYPALLGSQRFWGYVL
FT                   CAAFASGCFFAYLGGAPFVGTEIFHLSSSQVGLYFSAPAIGYALGNFLSGRFSIRMGMN
FT                   RMVLWGTVATTLGLAILMAGTLAGLHHPLFFFGMMTAVGLGNGMVLPNANAGMLSIHPQ
FT                   LAGTASGLGGAIMIGGGAALAALAGVVLTVEGGEMPLILIMLFSGAASVAAILWVMRRA
FT                   RALGLAT"
FT   gene            complement(492530..492883)
FT                   /locus_tag="RSKD131_0499"
FT   CDS_pept        complement(492530..492883)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0499"
FT                   /product="Hypothetical Protein"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00359"
FT                   /db_xref="GOA:B9KNT1"
FT                   /db_xref="InterPro:IPR007437"
FT                   /db_xref="UniProtKB/TrEMBL:B9KNT1"
FT                   /protein_id="ACM00359.1"
FT                   /translation="MPTLPVPLVTIGLLLASNIFMTFAWYGHLKYKSAPLLIVIFVSWG
FT                   IAFFEYLLQVPANRIGHTHFSAAQLKTIQEVITLLVFAAFSVFWLKEPLHWNHLLGFAF
FT                   IGLGAFFIFHSWS"
FT   gene            492904..494544
FT                   /locus_tag="RSKD131_0500"
FT   CDS_pept        492904..494544
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0500"
FT                   /product="Carboxyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00360"
FT                   /db_xref="GOA:B9KNT2"
FT                   /db_xref="InterPro:IPR011762"
FT                   /db_xref="InterPro:IPR011763"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR034733"
FT                   /db_xref="UniProtKB/TrEMBL:B9KNT2"
FT                   /protein_id="ACM00360.1"
FT                   /translation="MRFAGGLCKVICKYPEIFFRSEGLLTMVRRNSRGKAMKDILQELE
FT                   DRRAIARAGGGQRRVEAQHKRGKLTARERIELLLDEGSFEEFDMFVRHRCTDFGMQDDR
FT                   PAGDGVVTGWGTINGRMVYVFSQDFTVFGGSLSETHAQKICKIMDMAMQNGAPVIGLND
FT                   SGGARIQEGVASLAGYADVFQRNIMASGVIPQISVIMGPCAGGAVYSPAMTDFIFMVRD
FT                   TSYMFVTGPDVVKTVTNEVVTAEELGGASTHTKKSSVADGAFENDVEALYEIRRLVDFL
FT                   PLSNRTPAPVRPFFDDVARIEDSLDTLIPDNPNQPYDMKELILKIADEADFYEIQKDFA
FT                   ANIITGFIRLEGQTVGVVANQPMVLAGCLDIDSSRKAARFVRFCDAFNIPILTLVDVPG
FT                   FLPGTGQEYGGVIKHGAKLLFAYGEATVPKVTVITRKAYGGAYDVMASKHLRGDFNYAW
FT                   PTAEIAVMGAKGATEILYRSELGDKEKIAARAKEYEDRFANPFVAAERGFIDEVIMPHS
FT                   TRRRVSKAFASLRNKKLANPWKKHDNIPL"
FT   gene            494702..495049
FT                   /locus_tag="RSKD131_0501"
FT   CDS_pept        494702..495049
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0501"
FT                   /product="Hypothetical Protein"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00361"
FT                   /db_xref="UniProtKB/TrEMBL:B9KNT3"
FT                   /protein_id="ACM00361.1"
FT                   /translation="MTETDPIAVPSGQAVTLIDTIWNEPGPAGLTFRFRFLTPGIAAGG
FT                   GVDYDTAFSDMVALCESYVLPRVAEVVPPPAQVIVSLSDRPVPFGEADPDSTQYFEAFS
FT                   IRDGHCIWEAF"
FT   gene            495471..495869
FT                   /locus_tag="RSKD131_0502"
FT   CDS_pept        495471..495869
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0502"
FT                   /product="Hypothetical Protein"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00362"
FT                   /db_xref="UniProtKB/TrEMBL:B9KNT4"
FT                   /protein_id="ACM00362.1"
FT                   /translation="MLKHRGFPSRLPGTDLQYTIRRANKEGATRIIRRERYRDRKAVDR
FT                   AADAGFLAALWAHFGEEPFERGNLDAGRLSWLFGREVVAAEDPFDPESYDALLRIDRRK
FT                   AEAAFPEVFAPDAPPAAFEDDWDDADED"
FT   gene            complement(495866..496003)
FT                   /locus_tag="RSKD131_0503"
FT   CDS_pept        complement(495866..496003)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0503"
FT                   /product="Hypothetical Protein"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00363"
FT                   /db_xref="UniProtKB/TrEMBL:B9KNT5"
FT                   /protein_id="ACM00363.1"
FT                   /translation="MPRRGEGFRFFNMGRIRRADKGQVGVHFAMREIRPQEQMLARLHA
FT                   "
FT   gene            496183..496410
FT                   /locus_tag="RSKD131_0504"
FT   CDS_pept        496183..496410
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0504"
FT                   /product="Hypothetical Protein"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00364"
FT                   /db_xref="UniProtKB/TrEMBL:B9KNT6"
FT                   /protein_id="ACM00364.1"
FT                   /translation="MSNITKFLLLGAIAATVSACDTATGRAGGGALAGAALADATDENM
FT                   VAGAALGALAGAASCGVAGLPPCRSGGNYY"
FT   gene            496590..498593
FT                   /locus_tag="RSKD131_0505"
FT   CDS_pept        496590..498593
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0505"
FT                   /product="Propionyl-CoA carboxylase alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00365"
FT                   /db_xref="GOA:B9KNT7"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001882"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005481"
FT                   /db_xref="InterPro:IPR005482"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR011764"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR041265"
FT                   /db_xref="UniProtKB/TrEMBL:B9KNT7"
FT                   /protein_id="ACM00365.1"
FT                   /translation="MMFKKILIANRGEIACRVIKTARKMGIQTVAVYSDADRNALHVSM
FT                   ADEAIHIGPPPANQSYIVIDKIMEAIKASGAEAVHPGYGFLSERMDFAAALEAAGVVFI
FT                   GPPSGAIEAMGDKITSKKLAKEAGVSTVPGYMGLIADADEAVKISNEIGYPVMIKASAG
FT                   GGGKGMRIAWSEAEVKEGFESSKNEAANSFGDDRIFIEKFVTQPRHIEIQVLADKHGNC
FT                   VYLHERECSIQRRNQKVIEEAPSPFLDEATRKAMGEQACALAKAVGYASAGTVEFIVDG
FT                   QKNFYFLEMNTRLQVEHPVTELITGIDLVEQMIRVAAGEKLPFQQSDLKINGWAMESRL
FT                   YAEDPYRNFLPSIGRLTRYRPPVESVTPTSVVRNDTGVYEGGEISMYYDPMIAKLCTWA
FT                   PTREAAIEEMRLALDTFEVEGIGHNLPFVGAVMDHPRFVSGDITTAFIAEEYPDGFQGA
FT                   VLDEPTLRRVAAAAAAMNRVAEIRRTRISGTMNNHERHVGVDWVVALQGESYHVSIAAD
FT                   REGSTVSFSDGSSLRVTSDWTPGQPLASLMVDGRPLVMKVGKIPMGFRLRLRGADLKVN
FT                   VRTPRQAELALLMPEKLPPDTSKYLLCPMPGLVVKINVAEGDEVQEGQALATVEAMKME
FT                   NILRAERRGTVKKIAAAPGASLRVDDVIMEFE"
FT   gene            complement(498595..498900)
FT                   /locus_tag="RSKD131_0506"
FT   CDS_pept        complement(498595..498900)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0506"
FT                   /product="Hypothetical Protein"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00366"
FT                   /db_xref="InterPro:IPR025232"
FT                   /db_xref="UniProtKB/TrEMBL:B9KNT8"
FT                   /protein_id="ACM00366.1"
FT                   /translation="MVVFADTEADPNFIRQMEMIAARLDFLDERDVVVIFDTSPDDPSK
FT                   IRRTLHPRGFSLVILDKDGQVKLRKPLPWDVREIGRAIDKFPLRRDELLERNPAGR"
FT   gene            499130..501259
FT                   /locus_tag="RSKD131_0507"
FT   CDS_pept        499130..501259
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0507"
FT                   /product="Methylmalonyl-CoA mutase"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00367"
FT                   /db_xref="GOA:B9KNT9"
FT                   /db_xref="InterPro:IPR006098"
FT                   /db_xref="InterPro:IPR006099"
FT                   /db_xref="InterPro:IPR006158"
FT                   /db_xref="InterPro:IPR006159"
FT                   /db_xref="InterPro:IPR016176"
FT                   /db_xref="InterPro:IPR036724"
FT                   /db_xref="UniProtKB/TrEMBL:B9KNT9"
FT                   /protein_id="ACM00367.1"
FT                   /translation="MTEDLDAWRKLAEKELKGKSPDSLTWNTLEGIPVKPLYTRADLAG
FT                   MEHLDGLPGVAPFTRGVRATMYAGRPWTIRQYAGFSTAEASNAFYRKALAAGQQGVSVA
FT                   FDLATHRGYDSDHPRVVGDVGKAGVAIDSIEDMKILFDGIPLEKISVSMTMNGAVIPIL
FT                   ANFIVTGEEQGVPRAALSGTIQNDILKEFMVRNTYIYPPEPSMRIIADIIEYTSKEMPK
FT                   FNSISISGYHMQEAGANLVQELAYTLADGREYVRAALARGMNVDDFAGRLSFFFAIGMN
FT                   FFMEAAKLRAARLLWHRIMSEFAPKKPGSLMLRTHCQTSGVSLQEQDPYNNVIRTAYEA
FT                   MSAALGGTQSLHTNALDEAIALPTEFSARIARNTQIILQEETGVTRVVDPLAGSYYVES
FT                   LTAELAEKAWALIEEVEAMGGMTKAVASGMPKLRIEESAARRQAAIDRGEDVIVGVNKY
FT                   RLAKEDPIEILDIDNVAVRDAQIARLEKMRATRDEAACQAALDELTRRAAEGGNLLEAA
FT                   VDASRARASVGEISMAMEKVFGRHRAEVKTLSGVYGAAYEGDDGFAQIQRDVESFAEEE
FT                   GRRPRMLVVKMGQDGHDRGAKVIATAFADIGFDVDVGTLFQTPEEAAQDAIDNDVHVVG
FT                   ISSLAAGHKTLAPKLIEALKEKGAGDILVICGGVIPQQDYEFLQQAGVKAIFGPGTNIP
FT                   SAAKHILDLIREARS"
FT   gene            complement(501390..501782)
FT                   /locus_tag="RSKD131_0508"
FT   CDS_pept        complement(501390..501782)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0508"
FT                   /product="Helicase"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00368"
FT                   /db_xref="GOA:B9KNU0"
FT                   /db_xref="UniProtKB/TrEMBL:B9KNU0"
FT                   /protein_id="ACM00368.1"
FT                   /translation="MRGTAWTVPRPAVPPLSLAPEIVIPSAGRPASLQSLRNRTVLAPE
FT                   SLPGRLLLRHRGRPRILPILWLSPSPAAKRLSSGKEHDAFAAKGDMGVRRMVRAGRRPS
FT                   RFRQGLREGRPRTGALPPHPRDIWAE"
FT   gene            501813..502946
FT                   /locus_tag="RSKD131_0509"
FT   CDS_pept        501813..502946
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0509"
FT                   /product="Aminomethyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00369"
FT                   /db_xref="GOA:B9KNU1"
FT                   /db_xref="InterPro:IPR006222"
FT                   /db_xref="InterPro:IPR006223"
FT                   /db_xref="InterPro:IPR013977"
FT                   /db_xref="InterPro:IPR027266"
FT                   /db_xref="InterPro:IPR028896"
FT                   /db_xref="InterPro:IPR029043"
FT                   /db_xref="UniProtKB/TrEMBL:B9KNU1"
FT                   /protein_id="ACM00369.1"
FT                   /translation="MSDETPGLRRLPLHDLHVRLGGRMVPFAGWEMPVQYPAGVMKEHL
FT                   HTRTAAGLFDVSHMGQLLLRPRGGMAALGAAFERLMPVDVLGLAEGRQRYGILTNETGG
FT                   IRDDLMFANRGDHLYVVVNAACVAEDTAHLRAALGDAAEVVTVDDRGLLALQGPAAEAV
FT                   LASLVPAAAAMRFMDVIAADWQGAELWISRSGYTGEDGFEISVPVEAIAAFAEALLARE
FT                   EVAPIGLGARDSLRLEAGLCLYGHDIDTTTSPVEAGLAWAIQKARRPGGVRAGGFAGDQ
FT                   RILADLEAGPERLRVGLSPSGRAPMREGTELFTPDGTPVGRVTSGGFGPSVEAPIAMGY
FT                   VATSHAAPGTGLVGEVRGKRLPVTVVDLPFRPSTYKR"
FT   gene            502955..503311
FT                   /locus_tag="RSKD131_0510"
FT   CDS_pept        502955..503311
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0510"
FT                   /product="Glycine cleavage system H protein"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00370"
FT                   /db_xref="GOA:B9KNU2"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR002930"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR017453"
FT                   /db_xref="InterPro:IPR033753"
FT                   /db_xref="UniProtKB/TrEMBL:B9KNU2"
FT                   /protein_id="ACM00370.1"
FT                   /translation="MKYTKEHEWLRVEGDLVVVGITEHAATQLGDVVFIELPEIETVVA
FT                   EGDEVAVIESVKAASDISAPMDGEIVAVNEKLVDKPGLVNDDPMAAWFFKMKVDDLSVL
FT                   DDFMDEDEYQDLIG"
FT   gene            503315..506185
FT                   /locus_tag="RSKD131_0511"
FT   CDS_pept        503315..506185
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0511"
FT                   /product="Glycine dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00371"
FT                   /db_xref="GOA:B9KNU3"
FT                   /db_xref="InterPro:IPR003437"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR020581"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9KNU3"
FT                   /protein_id="ACM00371.1"
FT                   /translation="MSFTPTDYNAYDFANRRHIGPSPSEMEEMLRVVGVSSLDQLIEET
FT                   VPASIRQETPLDWAPLAEHELLARMREVAAKNRVMTSLIGQGYYGTVTPPAIQRNILEN
FT                   PAWYTAYTPYQPEIAQGRLEALLNYQTMVADLTGLPVANASLLDEATAAAEAMTMAERA
FT                   SKSKARAFFVDADCHPQTISVIRTRAEPLGIEVIVGHPAQLVPEDVFGALFQYPGTYGL
FT                   VRDFTRDIAALHEAKALAVVATDLLALCLLKEPGAMGADIAIGSSQRFGVPMGYGGPHA
FT                   AFMSCKDDLKRSMPGRLVGVSVDARGNKAYRLALQTREQHIRREKATSNVCTAQALLAV
FT                   MASFYAVFHGPRGLRAIAERVHLNTVRLATALKEAGARVSPEAFFDTITVEVGVGQAGI
FT                   LAAARHRGINLRKVGRDRVGISLDETTDAGVIARVLDAFGIHEPAPAKVGLGFPEPLLR
FT                   ETGYLSHPVFQMNRAESEMMRYMRRLSDRDLALDRAMIPLGSCTMKLNAAAEMMPITWP
FT                   EFGTLHPFAPADQAAGYHEAIGDLAQRLCRITGYDAMSMQPNSGAQGEYAGLLTILAYH
FT                   RARGDAERTICLIPVSAHGTNPASAQMAGMKVVVVKSAPNGDVDLEDFRDKAAAAGDRL
FT                   AACMITYPSTHGVFEETVREVCRITHEHGGQVYIDGANMNAMVGLVQPGAIGGDVSHLN
FT                   LHKTFAIPHGGGGPGMGPIGVKAHLAPYLPGHPEVTGPLTGGHDEAADEGPVSAAPYGS
FT                   ASILLISWAYCLMMGGEGLTQATRVAILNANYIAARLRGAYKVLFMGNRGRVAHECILD
FT                   TRPFAEAGVTVDDIAKRLIDNGFHAPTMSWPVPGTLMVEPTESETKAEIDRFVAALLAI
FT                   REEIRAVEEGEIAAADSPLRHAPHTVEDLVADWDRKYPREQGCFPPGSFRVDKYWPPVG
FT                   RVDNAWGDRNLVCTCPPVESYSIAAQ"
FT   gene            complement(506359..508560)
FT                   /locus_tag="RSKD131_0512"
FT   CDS_pept        complement(506359..508560)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0512"
FT                   /product="3-hydroxyacyl-CoA dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00372"
FT                   /db_xref="GOA:B9KNU4"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR006108"
FT                   /db_xref="InterPro:IPR006176"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B9KNU4"
FT                   /protein_id="ACM00372.1"
FT                   /translation="MTDFTSRTDADGVCTITWDVPGKSMNVMSMAGFAELDGLIAAALD
FT                   DPSVKGVILTSGKKDFAAGMDLNVIARMKEEGGDDPARAVFEGVMEMHAVLRRIERAGM
FT                   DPKTLKGGKPIVAALPGTALGLGLELPLACHRIIAADNPKAKIGLPEIMVGIFPGGGGT
FT                   TRLVRRLGAMMAAPLLLEGKLNDPRGAKAMGVVDEVVPADQLLARAKEWVLGAKDSDLV
FT                   KPWDAKGYKMPGGAPYHPAGFMTFVGASAMVTGKTMGVYPAAKGLLAAVYEGALVPFDT
FT                   ALKIEARWFTHVLMNPSSSAMIRSLFINKEALEKGAVRPALPDQSVRKLGVIGAGMMGA
FT                   GIAHVAANAGIEVVLIDATQEAADRGKSHSEGLLDKGMKRGKVSAEKKAEVLGRIAATT
FT                   DYAALSGCDLIVEAVFEDPGVKAEVTQKVEAAVGPDCIFATNTSTLPISGLAKASRDPA
FT                   QFIGIHFFSPVDKMMLVEIIRGKATGDRAVAKALDFVRQIRKTPIVVHDARFFYANRCI
FT                   IPYLNEGIRMVAEGVAPALIENAAKLVGMPLGPLQLVDETSIDLGVKIAKATKAALGEA
FT                   YPDAAVDAVIFPLADEGRLGRKAGAGFYAYDAAGKRDGLWPGLADRWPLAETQPELAEV
FT                   QHRLLFAQVLEAVRALEEGVLTDIREGDVGAILGWGFAPWSGGPFSWLDMIGAPRAVEI
FT                   CEGLAERHGPRFAPPKLLVEMAGKGESFYARFAPQARAA"
FT   gene            complement(508575..509786)
FT                   /locus_tag="RSKD131_0513"
FT   CDS_pept        complement(508575..509786)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0513"
FT                   /product="Acetyl-CoA acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00373"
FT                   /db_xref="GOA:B9KNU5"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020610"
FT                   /db_xref="InterPro:IPR020613"
FT                   /db_xref="InterPro:IPR020615"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:B9KNU5"
FT                   /protein_id="ACM00373.1"
FT                   /translation="MTEAYIYDALRTPRGKGRPDGALHEVTSVALSAKVLNAVKERNHL
FT                   DGAAVEDVIWGNATQVGEQGGCLARSAVLLSDLDESIPGLSINRFCASGMEAVNLAANQ
FT                   VRAGAGEAYIAGGVEMMSRVAMGSDGAAVAADPSLAMKTYFVPQGISADIIATRYGFSR
FT                   DEADALAVESQKRAAAAWAEGRFAQSVVPVRDQNGVTILERDEYLRPNTDMQSLGALKP
FT                   AFKEMGEQMPGFDKLALMKYPELERVEHIHHAGNSSGIVDGAAAVLIGSRAFGEARGLR
FT                   PRARIRATAKIGTDPTIMLTGPVPVTQKILREAGMQISDIDLFEVNEAFAAVVLRFQQA
FT                   FGVDPARVNPNGGAIAMGHPLGATGAIIIGTLLDELERTDRSVGLATLCVASGMGAATI
FT                   IERV"
FT   gene            complement(509857..510243)
FT                   /locus_tag="RSKD131_0514"
FT   CDS_pept        complement(509857..510243)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0514"
FT                   /product="Glutathione-dependent formaldehyde-activating,
FT                   GFA"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00374"
FT                   /db_xref="GOA:B9KNU6"
FT                   /db_xref="InterPro:IPR006913"
FT                   /db_xref="InterPro:IPR011057"
FT                   /db_xref="UniProtKB/TrEMBL:B9KNU6"
FT                   /protein_id="ACM00374.1"
FT                   /translation="MRFSVPAGPKKSTVCHCRMCQRATGNAFAPLLEVLTADVVWEGTP
FT                   AVWASSSVAERGFCATCGTPLFYRSDDTTELMAGTLAGFDFRPTANHGIEGRMGWLGGL
FT                   AALPDQATRPELLSRVVSHQAPEE"
FT   gene            complement(510326..512101)
FT                   /locus_tag="RSKD131_0515"
FT   CDS_pept        complement(510326..512101)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0515"
FT                   /product="Acyl-CoA dehydrogenase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00375"
FT                   /db_xref="GOA:B9KNU7"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR020953"
FT                   /db_xref="InterPro:IPR025878"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:B9KNU7"
FT                   /protein_id="ACM00375.1"
FT                   /translation="MPIYNAPVTDMQFILHEVLKVSGSGIPGYDELEPDFTSAVLEEAG
FT                   KLARDVLAPLNRVGDMQGCRLENGVVRTPEGFAEAFAQLKEGGWTALDCDPEYGGQGLP
FT                   YVMQTAVGEIFVSANMAFNMYQGLTHGAYSAIHAHGSEEQKRTWLPKMVSCDWTGTMNL
FT                   TEPHAGTDLGMMRTRAEPQEDGSYLVTGEKIFISAGDHDMAENIVHLVLAKAPGGGEGT
FT                   KGVSLFIVPKYLVNPDGSLGERNNVTVGKIEHKMGIHGNATCVLNYDGAKGWLLGELHK
FT                   GMRAMFTMMNEARLGVGLQGYAVAETAYQNAVAYARDRLQGRSLSGQGTTAGPADPLIV
FT                   HPDIRRNLMDQKSFVEGARALTFWGAQLIDRSVRQGDAEAEGLISLLTPVIKGFQTDKG
FT                   LESAVAAQQVWGGHGYVEENGMSQFVRDARIAMIYEGANGIQALDLVGRKLAAEGGKPA
FT                   MAFFQMIRSFLKENEEDARLKGFLEPLKQASKDTQKAAMFFAEKGMKNPDEALAGSYDF
FT                   MTMMGHLCLGYMWAQMARAAMAALDAGRGDRDALEAKIATGRYYMARHLPATALHLARI
FT                   ESGAEPVMGLPAEAF"
FT   gene            complement(512120..512518)
FT                   /locus_tag="RSKD131_0516"
FT   CDS_pept        complement(512120..512518)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0516"
FT                   /product="Transcriptional regulator, MerR family"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00376"
FT                   /db_xref="GOA:B9KNU8"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR015358"
FT                   /db_xref="UniProtKB/TrEMBL:B9KNU8"
FT                   /protein_id="ACM00376.1"
FT                   /translation="MMTSDVMTIREMCDAYDVTPRTLRFYESKELLFPIRDGTRRLFTR
FT                   RDRARLKLILRGKRFGFSLEEIRQLLDLYDRDGSQELQLARTYQVAQQRLEQMERQRAE
FT                   LDEAIAELKDQLAWGEEALAAFRRAAAE"
FT   gene            complement(512640..513020)
FT                   /locus_tag="RSKD131_0517"
FT   CDS_pept        complement(512640..513020)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0517"
FT                   /product="Transcriptional regulator, MerR family"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00377"
FT                   /db_xref="GOA:B9KNU9"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR015358"
FT                   /db_xref="UniProtKB/TrEMBL:B9KNU9"
FT                   /protein_id="ACM00377.1"
FT                   /translation="MSDTRLTFKEMCARFDVTPRTLRYYEYIELLQPEKEGRARFYGPR
FT                   EIARMTLILRGRRFGFGLEEIRQWLLIYQQKGTRPQLEAWIEMADRQLKELARQRAELE
FT                   VAIADLQALRDSTAAELAAPGS"
FT   gene            513128..513619
FT                   /locus_tag="RSKD131_0518"
FT   CDS_pept        513128..513619
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0518"
FT                   /product="Hypothetical Protein"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00378"
FT                   /db_xref="InterPro:IPR003736"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:B9KNV0"
FT                   /protein_id="ACM00378.1"
FT                   /translation="MTDIALARQFIEAIPHSRALAMQLDEIGAGRAVISMPWDARFVGD
FT                   PSTGVIHGGAVSALMDTASGAAVMSHPEAGATTATLDLRIDYMRPAAPGQRIRAVAECY
FT                   HVTRTVAFVRAVATDEDETRPVATATGAFTVERARAAAGDPARATAAVAGAAEAGRAAE
FT                   "
FT   gene            513616..514122
FT                   /locus_tag="RSKD131_0519"
FT   CDS_pept        513616..514122
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0519"
FT                   /product="Thioesterase superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00379"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:B9KNV1"
FT                   /protein_id="ACM00379.1"
FT                   /translation="MTRAQPEPVQVVKQRRDAALRALVSGVPYITYLGIQFDRRGDELT
FT                   AVLPFDEKLIGNPMLPAIHGGVTAAFLEVASIIELSWSVLWHEMEQGRLDPDQIEARLP
FT                   RLPKTIDFTVDYLRSGLPRDAYARARVNRSGRRYASVHVEAWQDNRLRPFAQATGHFLM
FT                   PARNE"
FT   gene            514115..515449
FT                   /locus_tag="RSKD131_0520"
FT   CDS_pept        514115..515449
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0520"
FT                   /product="MATE efflux family protein"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00380"
FT                   /db_xref="GOA:B9KNV2"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:B9KNV2"
FT                   /protein_id="ACM00380.1"
FT                   /translation="MSDTPAVAPPDLTHARILRMALPIVISNATVPLLGAVDTGVVGQL
FT                   GQAAPIGAVGLGAVVLATLYWIFSFLRMGTSGLAAQAHGAGDEAERSAILLRSLLIGLG
FT                   AGLCFILLQLPVIWGTFRVAPASAEVEALTRTYLSIRIWGAPATIGLYAVTGWLVALER
FT                   TRGILVLQLWMNGLNIGLDLLFVLGLGYGVGGVAVATLVAEWTGLALGLWLCRDAFGPV
FT                   LAAARARLADAEAIRRMLGVNRDIMIRSVLLQGSFTAFVFLGAGFGDVTLAANQVLLQF
FT                   LEVSAYALDGFAFAAEALVGQAVGARSVGRVRRASIMLGQWGAGGAALIALGIALFGPA
FT                   VIDLISTAPEVRAEARAYLPWLVAAPLIGVASWIFDGIFIGATRTREMMQAIIVSVTLY
FT                   GLALLLFVPLLGNHGLWAALAVLNAARGVTMALLYPRVERSAARV"
FT   gene            complement(515461..516219)
FT                   /locus_tag="RSKD131_0521"
FT   CDS_pept        complement(515461..516219)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0521"
FT                   /product="Hypothetical Protein"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00381"
FT                   /db_xref="GOA:B9KNV3"
FT                   /db_xref="InterPro:IPR019088"
FT                   /db_xref="UniProtKB/TrEMBL:B9KNV3"
FT                   /protein_id="ACM00381.1"
FT                   /translation="MIRLLVLILAFCAPAALAQDERIVLGLSETRVAITADFQGSQIMI
FT                   YGAVQRYSPEPDGDLGVIVTVSGPPTQVMVRKKERRLGIWINREKVRIGRAPSFYAVAT
FT                   SGPIGEVLSATDNLRYKITIPRAIRAIGISAQAENAPSFVEALERIRTREDRYVMAEGM
FT                   VRVTGGTLFRTDVQLPANLIEGNYDVRVFLTRDGHVVDVFEDSIGVQKAGVERFIHALA
FT                   HEQPLIYGLLSLVMAVAAGWGASAAFRFVR"
FT   gene            complement(516216..517136)
FT                   /locus_tag="RSKD131_0522"
FT   CDS_pept        complement(516216..517136)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0522"
FT                   /product="Hypothetical Protein"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00382"
FT                   /db_xref="GOA:B9KNV4"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:B9KNV4"
FT                   /protein_id="ACM00382.1"
FT                   /translation="MQLYLPIAEVSVNIFLLLGLGGIVGFMSGMFGVGGGFLITPLLFF
FT                   IGIPPAVAVATGANQVVASSVSGVLAQLKRKTVDFRMGLVLLAGGVAGSAFGVAVFARL
FT                   NTLGQVDLFVQLSYVLFLGLVGALMLQESVRALRRARRPDAPVKRARQHGWAHKMPFKM
FT                   KFRASGLYISVIPPLMVGAFVGFLAAIMGVGGGFIMVPAMIYLLGMPTKIVIGTSLFQI
FT                   IFVTAFTTVMHAVTSQTVDMALAFLLIVGGVVGAQIGARIGVRLRAEQLRILLSLLVLA
FT                   VCGKIAADLLIRPNELYSLTVGVLP"
FT   gene            complement(517222..518022)
FT                   /locus_tag="RSKD131_0523"
FT   CDS_pept        complement(517222..518022)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0523"
FT                   /product="Purine nucleotide phosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00383"
FT                   /db_xref="GOA:B9KNV5"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR011268"
FT                   /db_xref="InterPro:IPR011269"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="UniProtKB/TrEMBL:B9KNV5"
FT                   /protein_id="ACM00383.1"
FT                   /translation="MQVERLASLIRARAGHQPVRLGLVLGSGLGHLAEAVEGVSLPYEE
FT                   LAGFPEAGVSGHQPRLVVGDLEGVRVAVFGGRAHYYESGNPAAMRVPLAVLKHLGAEAL
FT                   IATNAAGSLRAELPPGSLMLLSDHINLSGANPLIGEPSEARFVPMTDAHDPDLRARLRA
FT                   AAEAAGVPLGEGVYAWFSGPSFETPAEIRMARVLGADAVGMSTVPEVILARFLGLKVAA
FT                   ISTVTNMGAGLSDEAISHEHTKAMAPLGAAKLETLLREFLRRLR"
FT   gene            complement(518024..518992)
FT                   /locus_tag="RSKD131_0524"
FT   CDS_pept        complement(518024..518992)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0524"
FT                   /product="Inner-membrane translocator"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00384"
FT                   /db_xref="GOA:B9KNV6"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:B9KNV6"
FT                   /protein_id="ACM00384.1"
FT                   /translation="MMDLPTLLQILDSTIRLGTPLLLACLAGLFSERAGIFDIGLEGKM
FT                   LAAAFLSAAVAFVTGSVWLGLIAGIVASLLMSAIHGLASITFRGNQLISGVAINFLASG
FT                   LTVLLGQYWFALGGRTPSLEGAARFAPITLPFAEELRGVPVLGPIYRELISGHTALVYI
FT                   ALLAVPASWWLLYRTRFGLRLRAVGENPAAVDTAGVSVVGIRYAAVAICGLLTGLAGAY
FT                   LACSLSAGFVKEMTAGRGYIALAALIFAKWRPWQALGATMLFGLLEAVANRYQSLNLWG
FT                   LPLPVQFMQALPYILTVIILAGFVGKAIPPRAGGQPYVKER"
FT   gene            complement(518989..520074)
FT                   /locus_tag="RSKD131_0525"
FT   CDS_pept        complement(518989..520074)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0525"
FT                   /product="Inner-membrane translocator"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00385"
FT                   /db_xref="GOA:B9KNV7"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:B9KNV7"
FT                   /protein_id="ACM00385.1"
FT                   /translation="MPAWADALLVPLISLVVAFAISSGVILAIGENPWEALKIMVTGAL
FT                   GSSYGWGYTLYYATNFIFTGLAVAVAFHASLFNIGGEGQATLGGLGVALACLFVPWPHW
FT                   SLALIGAAAMGAAFGAAWAAVPAWLQARRGSHIVITTIMFNFIAASLLNYILVNVLRPT
FT                   GSMDPATARFPGATNLPGIGDMLTAVGIPFAKTTPANVTLFIALGACLLVWALIWRTRL
FT                   GYEIRAFGKSEKAAIYAGISPVRITMLAMLISGALAGLMAINNVMGEAERLVLNSVEGA
FT                   GFIGIAVALMGRSHPFGVLLAALLFGFLYQGGAELALWTSIPRELITVIQALVILFTGA
FT                   LDNMVRQPVEALFLRARKGAK"
FT   gene            complement(520083..521660)
FT                   /locus_tag="RSKD131_0526"
FT   CDS_pept        complement(520083..521660)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0526"
FT                   /product="ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00386"
FT                   /db_xref="GOA:B9KP93"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B9KP93"
FT                   /protein_id="ACM00386.1"
FT                   /translation="MAERQAQGRPEAAALPPAIELRGISKAFGPVQANRDISVRVARGT
FT                   IHGIVGENGAGKSTLMSILYGFYRADAGEILIGGRPTPIPDSQSAIRAGIGMVFQHFKL
FT                   VPNFTVLENVVLGAEEGALLRPSLARARRELTRLAEDYELDVDPDALVEDLSVGHQQRV
FT                   EILKALYRQADILILDEPTGVLTPAEADHLFRILKGLKAQGKTIVLITHKLREIMEITD
FT                   EVSVMRRGEMVATVRTEATSPEALAELMVGRKVLLRVDKAPAAPGRTVLEIEDLRVRDG
FT                   HGVERLKGVSLTLRAGEILGIAGVAGNGQSELLELLGGIAQGTGRVRLNGTELDLSGRG
FT                   CNGRTRRAAGIAHVPEDRQHLGMILDFAAWENVAFGYQDASEYRAGRFFMDNDALRADC
FT                   EGKMARFDVRPPLPALAGKNFSGGNQQKLIVAREIERNPDLLLIGQPTRGVDIGAIEFI
FT                   HKQIVALRDAGKAILLVSVELDEIMSLSDRIAVMFDGRIMGLRDPARTDERELGLMMAG
FT                   MDGTRGAA"
FT   gene            complement(521661..522656)
FT                   /locus_tag="RSKD131_0527"
FT   CDS_pept        complement(521661..522656)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0527"
FT                   /product="Basic membrane lipoprotein precursor"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00387"
FT                   /db_xref="GOA:B9KP94"
FT                   /db_xref="InterPro:IPR003760"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:B9KP94"
FT                   /protein_id="ACM00387.1"
FT                   /translation="MTLFQTLAGTAAALALTAGAALADPALIFDLGGKFDKSFNEAAFN
FT                   GAQRWKEETGGSYKELEMQSEAQREQALRRLAETGSNPIVMTGFAFGEVLDKVAPDYPD
FT                   TKFAIIDAVVEQPNVRSVVFSEHEGSYLVGMMAAMASKSGTVGFVGGMDIPLIRKFACG
FT                   YAQGFKAVKPDGKIIINMTGTTPAAWNDPVKGTELAKSQVSQGADVIYAAAGSTGMGVL
FT                   QAAADENVLSIGVDSNQNHLHPGKVLTSMIKRVDNTVYDAFKSGTDLETGTVVADLKGD
FT                   GVGYALDENNAALVSDEMKTAVDAAAEKIKSGEIEVHDYMTDNTCPAATF"
FT   gene            complement(522810..523202)
FT                   /locus_tag="RSKD131_0528"
FT   CDS_pept        complement(522810..523202)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0528"
FT                   /product="Ribosomal-protein-alanine acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00388"
FT                   /db_xref="GOA:B9KP95"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:B9KP95"
FT                   /protein_id="ACM00388.1"
FT                   /translation="MPEFRALLGEPSVFLLTEPQPGSASETLQPAAPDGFLMGRAIAGE
FT                   AEILTLAVAPEARRQSLGARLVAAFLLAARARGAESAFLEVAADNEPALALYRVAGFAE
FT                   AGRRRGYYRTPEGRPLDALVMSRPLG"
FT   gene            complement(523289..523897)
FT                   /locus_tag="RSKD131_0529"
FT   CDS_pept        complement(523289..523897)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0529"
FT                   /product="Peptidase M22, glycoprotease"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00389"
FT                   /db_xref="GOA:B9KP96"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR022496"
FT                   /db_xref="UniProtKB/TrEMBL:B9KP96"
FT                   /protein_id="ACM00389.1"
FT                   /translation="MRPEPAILAFDTSAAHCAAALLSGDRLLALRTEPMEKGQAERLMP
FT                   LLKAVLAEGSLGWADLDALAVGTGPGNFTGVRIAVAAARGLALALGKPALGVSRFEALV
FT                   LGLPAPVAVLEDARRGEVYLADGSLPPRLVALEGLSVTAPRQVGSAAFADRLEPLYPLP
FT                   EAIARVAAGQLGQPQPRPAPFYLRGADAAPAADPPPVIL"
FT   gene            complement(523887..524447)
FT                   /locus_tag="RSKD131_0530"
FT   CDS_pept        complement(523887..524447)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0530"
FT                   /product="Nitrogen-fixing NifU domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00390"
FT                   /db_xref="GOA:B9KP97"
FT                   /db_xref="InterPro:IPR001075"
FT                   /db_xref="InterPro:IPR014824"
FT                   /db_xref="InterPro:IPR034904"
FT                   /db_xref="InterPro:IPR035433"
FT                   /db_xref="InterPro:IPR036498"
FT                   /db_xref="UniProtKB/TrEMBL:B9KP97"
FT                   /protein_id="ACM00390.1"
FT                   /translation="MFIQTESTPNPATLKFLPGQMVLEAGTADFATPEAAATSPLARRI
FT                   FAAGGVSAVFFGTDFVAVTKADEVAWDHIKPAILGAIMEHYQSGAPVLEGEQAASGHAS
FT                   HDGPDEDVVRQIKELLDTRVRPAVAQDGGDITFHGFDRGIVYLHMQGACAGCPSSTLTL
FT                   KMGIENLLRHYIPEVLEVRPVAA"
FT   gene            complement(524594..525052)
FT                   /locus_tag="RSKD131_0531"
FT   CDS_pept        complement(524594..525052)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0531"
FT                   /product="UspA domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00391"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:B9KP98"
FT                   /protein_id="ACM00391.1"
FT                   /translation="MMRKFLVVLDDSRECLNAMRFAALRAAHTGAGVQILSIIPPEEYQ
FT                   HWMGVSDLMRTEARERIEAHFEVFAKWMRDRQGIDPELVIREGDPVQEILAQVKEDPAI
FT                   GVLVLGASTEKAGPGPLVTQMSRNSGNLPIPITIVPGEMSKERLEAIT"
FT   gene            complement(525103..525966)
FT                   /locus_tag="RSKD131_0532"
FT   CDS_pept        complement(525103..525966)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0532"
FT                   /product="Aminotransferase, class IV"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00392"
FT                   /db_xref="GOA:B9KP99"
FT                   /db_xref="InterPro:IPR001544"
FT                   /db_xref="InterPro:IPR018300"
FT                   /db_xref="InterPro:IPR036038"
FT                   /db_xref="UniProtKB/TrEMBL:B9KP99"
FT                   /protein_id="ACM00392.1"
FT                   /translation="MAFGRNIRTFFEGRWHEGDLAVMRAADHGIWQGSSVFDGARWFDG
FT                   VAPDLEAHCARVNRSAEALMITPTVGTEEMVAIAREGLRAYGRDQAVYIRPMYWALDGS
FT                   DLGVAPKPGATGFALCLEEVAMPAPEVTTTLTRTRFRRPVLEDNVCNAKAGCLYPNNAR
FT                   MLVEARSKGFGNALVADAMGNVAETATANVFMVKDGVVFTPVPNGTFLSGITRARHIAN
FT                   LRSDGVDVVETVLTFEDFHGADEVFLSGNFAKVTPVTGFDETVYQVGPVTRLVRQLYWD
FT                   WAHSAG"
FT   gene            complement(526037..526531)
FT                   /locus_tag="RSKD131_0533"
FT   CDS_pept        complement(526037..526531)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0533"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00393"
FT                   /db_xref="GOA:B9KPA0"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR018146"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:B9KPA0"
FT                   /protein_id="ACM00393.1"
FT                   /translation="MQERAMTLPPQTRIGHVHLKVADLDRAIAFYGGVLGFELQQKLGS
FT                   RAAFLSAGGYHHHIGLNSWESLGGEPPAPGTTGLYHTAILFPDRASLGAAVRRVLDAGV
FT                   ALEGAADHGVSEAVYLRDPDGNGVELYRDRAPEDWPRDAQGALAMGSEWLDLAALLAEA
FT                   D"
FT   gene            526573..526764
FT                   /locus_tag="RSKD131_0534"
FT   CDS_pept        526573..526764
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0534"
FT                   /product="Hypothetical Protein"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00394"
FT                   /db_xref="UniProtKB/TrEMBL:B9KPA1"
FT                   /protein_id="ACM00394.1"
FT                   /translation="MRPRTETERKRASRPVRGQGPDASPPDRRNSPAERIRELPGFPGG
FT                   TTLGAGRGHESQPLKKRQ"
FT   gene            526779..527321
FT                   /locus_tag="RSKD131_0535"
FT   CDS_pept        526779..527321
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0535"
FT                   /product="ErfK/YbiS/YcfS/YnhG family protein precursor"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00395"
FT                   /db_xref="GOA:B9KPA2"
FT                   /db_xref="InterPro:IPR005490"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR038063"
FT                   /db_xref="UniProtKB/TrEMBL:B9KPA2"
FT                   /protein_id="ACM00395.1"
FT                   /translation="MQKLNLRRRGILSAAAAAFAGLALAGGAREALAEESTDWQDHFET
FT                   LEHGAVLADLRQRVVLFWSEDGTVHRRYPAAMPDTRAFPRLGGTRIIRKVEGPTWRPTP
FT                   AMRARDPELPWSLPPGPGNPFGTHALHLEWQHYRIHGTHDPSTIGGVTAHGCIGLSNAH
FT                   IAELFAHTTVGTQVRLV"
FT   gene            complement(527356..528237)
FT                   /locus_tag="RSKD131_0536"
FT   CDS_pept        complement(527356..528237)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0536"
FT                   /product="Lipid A biosynthesis acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00396"
FT                   /db_xref="GOA:B9KPA3"
FT                   /db_xref="InterPro:IPR004960"
FT                   /db_xref="UniProtKB/TrEMBL:B9KPA3"
FT                   /protein_id="ACM00396.1"
FT                   /translation="MASRRTGPAAWAQDRLLRALIGALLLLPYAWRVPLCGWVMSRLIA
FT                   PFAGWDRRVRTNLARVLPDLPEAEVRRLMRRVPDNVGRAVIESYSGQAFVERAARAPVT
FT                   GPGLATLTAAHEAGRPVVIVTGHFGNYDASRAALRARGFEIGGLYRPMNNRYFNEHYVR
FT                   AMAAIGGPVFARGKAGLAGMLRHLKGGGMLGLLIDVHMRDGAVLRFFGHPAKTALSAAD
FT                   LALKYDAPLVPVYAIRAENGLDFEIRVDAPIPRGTPAEMTQALNDSLEAVVREHLDQWF
FT                   WIHRRWRVAPAA"
FT   gene            complement(528537..529568)
FT                   /locus_tag="RSKD131_0537"
FT   CDS_pept        complement(528537..529568)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0537"
FT                   /product="Flagellar motor switch protein FliG"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00397"
FT                   /db_xref="GOA:B9KPA4"
FT                   /db_xref="InterPro:IPR000090"
FT                   /db_xref="InterPro:IPR011002"
FT                   /db_xref="InterPro:IPR023087"
FT                   /db_xref="InterPro:IPR028263"
FT                   /db_xref="InterPro:IPR032779"
FT                   /db_xref="UniProtKB/TrEMBL:B9KPA4"
FT                   /protein_id="ACM00397.1"
FT                   /translation="MSLDGEEDGPRPLSRREKAAIIVRLLLAEGAPLPLTSLPDDMQEG
FT                   LAEQMARMRTVDRSTMTAVIEEFVEELESVGLSFPGGLDGALAVMDGHISPSAATRLRR
FT                   QAGVKGDPWERIVTLPADKLLKVVEEESVEVAAVMLSKLPVPKAAEVLGKLPGEKARRV
FT                   AYAVSMTGSVEPETVRRIGLSLLGQLEAEPPRAFTATPVERVGAILNVSAAVTRDEVLR
FT                   GLDEADAAFAEQVRKAIFTFEHVPRRVLGRDVPKVTRVVEQARLVAVIAAASSRPELSE
FT                   GVEFLLSNMSQRLAQSLREDAAARGRVKDKEAEEAMNAVVAGIRQLEAAGELVLVVEEE
FT                   EGG"
FT   gene            complement(529670..529825)
FT                   /locus_tag="RSKD131_0538"
FT   CDS_pept        complement(529670..529825)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0538"
FT                   /product="Hypothetical Protein"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00398"
FT                   /db_xref="UniProtKB/TrEMBL:B9KPA5"
FT                   /protein_id="ACM00398.1"
FT                   /translation="MTKLTLATLALIAAPALAMADCPMKHQTTASACGDGQVYDSATKA
FT                   CTTVTG"
FT   gene            complement(529952..531256)
FT                   /locus_tag="RSKD131_0539"
FT   CDS_pept        complement(529952..531256)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0539"
FT                   /product="Adenylosuccinate lyase"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00399"
FT                   /db_xref="GOA:B9KPA6"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR004769"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR019468"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="UniProtKB/TrEMBL:B9KPA6"
FT                   /protein_id="ACM00399.1"
FT                   /translation="MIPRYSRPDMVAIWSPETKFRIWFEIEAHACDAQAALGVIPKANA
FT                   EAVWKAAEATFDVARIDEIEAVTKHDVIAFLTHLAEIVGADEARFVHQGMTSSDVLDTT
FT                   LNIQLVRASDLLLAGLDRVLAALKARALEHKDTVRIGRSHGIHAEPTTMGLTFARFYAE
FT                   MARNRTRLVNARAEIATGAISGAVGTFANIDPAVEEHVCAQLGLVPETVSTQVIPRDRH
FT                   AMFFATLGVIASSIENVAIEIRHMQRTEVLEAEEFFSPGQKGSSAMPHKRNPVLTENLT
FT                   GLARLVRMAVVPAMENVALWHERDISHSSVERAIGPDATITLDFALHRLAGVIEKLVVY
FT                   PENMLKNMNKFRGLVMSQRVLLALTQAGVSREDAYRLVQRNAMKVWEQGRDFKEELLAD
FT                   PEVTAALSPAEIEEKFDLGYHLKHVDTIFARVFGA"
FT   gene            complement(531364..531618)
FT                   /locus_tag="RSKD131_0540"
FT   CDS_pept        complement(531364..531618)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0540"
FT                   /product="Hypothetical Protein"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00400"
FT                   /db_xref="InterPro:IPR005590"
FT                   /db_xref="UniProtKB/TrEMBL:B9KPA7"
FT                   /protein_id="ACM00400.1"
FT                   /translation="MFLSRAPLLLILALPACDGPDPAPVAAPGDLHRSGMANPASVYCT
FT                   QRGGRLEIRSEGAGQTGYCHLPDGRILEEWELYRDAEPL"
FT   gene            complement(531776..534922)
FT                   /locus_tag="RSKD131_0541"
FT   CDS_pept        complement(531776..534922)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0541"
FT                   /product="Acriflavin resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00401"
FT                   /db_xref="GOA:B9KPA8"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:B9KPA8"
FT                   /protein_id="ACM00401.1"
FT                   /translation="MSTLPEPDERELAHSNTALFIRRPILAFVLNALILIAGLAALYGA
FT                   DVRELPDVDSPVITVTTTFDGASSETIDQEVTDEIEGAASRVAGVKSISSSSRFGRSQV
FT                   TVEFNDDTNLDVAASDMRDSISRIRNNLPDDADEPRIVKADANSEAVMRVAVTSARRSA
FT                   QELTQIVEDQIESRLLAAPGVADLQIYGDRTPIFRVDVGQMLLASRGLTLADLRTALGN
FT                   VAYDAPAGSLTSDRQSLVVRTTATVTTPAAFEALEIAPDVRLGDVATVELGPEPGASYL
FT                   RANGENGVGLGIIRQAQSNTLEISKAVREIVAGLQADLPQDVRIFVTSDDATFINGAIH
FT                   EVEIALGLSVLIVVAIIYLFLRDMRATLIPTLAIPVALVGTLAAIWIAGFSINILTLLA
FT                   LVLATGMVVDDAIVVLENIVRWRAQGIGPRAAAVLGTQQVFFAVIATTTTLAAVFIPLS
FT                   FLPGQTGGLFREFGFTLAISVLLSSVTALSLCPVLASRFLRAGDESHARGPVVWLGRTL
FT                   AAFYRRTLHWALDAPAVTLAVATGFALTAVFLFGTLKQELTPSEDRSVILMSVQAPQGV
FT                   ALEYTDGKMREIEDLIAPLREKGEVFSVFAIAGSGSRDNRGFMVISLAPWEERDRSQQE
FT                   IAAELNEGLSRIVGIRAFAIQPNSLGVRGAGQGLSFAVVGDSYARLAEGAQELVDRMEE
FT                   NPAFGQVRLGYETTQPQLFIEVDRTRASDLGIEITGLGEALQAVLDGRTVGTVFLDDAS
FT                   YDIQMLSTTDPVNDPGDLERIFVQSGDGQMVPISSFVTLTERAVAPELSREGQLRAVPI
FT                   SASLTPELALGEALDEVERLAADILPGDSRIEPLAEAATLGETSSGLTATFGFAIVIVL
FT                   LVLAAQFESFVSAFIVMATVPLGLACAIFALVATGGSLNVYSQIGLVLLVGIMAKNGIL
FT                   IVEFANQLRDEGLPVRRAIEDACAIRLRPVMMTMIATVLGGLPLVFAAGAGAEAREVLG
FT                   WIIVGGLGLATVATLYLTPVAYLLLAGLSRPKAEEQSRLLRELHDATRMPPPVEGRPAE
FT                   "
FT   gene            complement(534926..536092)
FT                   /locus_tag="RSKD131_0542"
FT   CDS_pept        complement(534926..536092)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0542"
FT                   /product="Efflux transporter, RND family, MFP subunit"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00402"
FT                   /db_xref="GOA:B9KPA9"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:B9KPA9"
FT                   /protein_id="ACM00402.1"
FT                   /translation="MSLVKQGLLVLAVAAAVLVIWVLYVPAARPMLARVGLLDPMERMG
FT                   LVAQDSEAQAAPGPRGGPGGAPATRVVAAPPEERPLNAIVTAVGSARAVRAVTLAPEVE
FT                   GRIDAIPIEPGSRVAAGDLIASLDSEAARIAVNRAELILADAREDLARAERLAGSGVTS
FT                   DLARQEALLAVRTAELELQQARFELSQHRIVAPFDGWVGIIEVEVGDQISRGDLLTQLD
FT                   DRTSLLVDFRVPERVVGKVGIGDRVTATPLSGPQEPLEGRISALDNRVDEASRTLRIRA
FT                   TIPNADDRLRAGMSFSIRLELPGEPRPAVDPLAIQWGADGSYVWVVREGRSERVSARIL
FT                   QRDADAVLVQATFRPDDLVVVEGVQTLRPGGPVALVEPEAAAPSGSKS"
FT   gene            536335..537006
FT                   /locus_tag="RSKD131_0543"
FT   CDS_pept        536335..537006
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0543"
FT                   /product="Hypothetical Protein"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00403"
FT                   /db_xref="UniProtKB/TrEMBL:B9KPB0"
FT                   /protein_id="ACM00403.1"
FT                   /translation="MFIVSPSTIWNRNALETRQVPRRIFGRVMLLPRRGFPLRLVWRMA
FT                   FETQMLRFLGVLAPFVAAMFVWPQSALAIAQAPLLMIVAILYVETNVLRIPKERRAKMI
FT                   DRAEADRGLDLLQVRGRAILTRIAARRQLASGVLHLVVEQSDMAYITPLTFVSVQSEAE
FT                   PEVVRLSREEEAMIRRDLFGAPLTERKLLRINLLENVFLRDVALDMRGVSAHARLAALS
FT                   G"
FT   gene            complement(537274..539358)
FT                   /locus_tag="RSKD131_0544"
FT   CDS_pept        complement(537274..539358)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0544"
FT                   /product="Glycogen debranching enzyme GlgX"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00404"
FT                   /db_xref="GOA:B9KPB1"
FT                   /db_xref="InterPro:IPR004193"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR011837"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:B9KPB1"
FT                   /protein_id="ACM00404.1"
FT                   /translation="MKRPTRPAPPLKFDMSSAHPNRLGADFDGEGTNFALFSENATRVE
FT                   LCLFDETGQTQTHCLDLPSYEGGIWYGYLPGIREGQTYGYRVHGPHAPEEGHRFNPNKL
FT                   LIDPYARELRGDLIWDDALFGYPVGGDDLELDPRDSAPFMPKAVVVDPAFDWEADKALR
FT                   HRWQDTVIYEAHVKGLTMRHPGVPEEDRGTFKGLASPAVIDHLKAIGVTAIELLPIHGF
FT                   LNDRHLIEKGLSNYWGYNTLSFFAPYRPYTKSGSMREVKRAIKRFHDAGIEVILDVVYN
FT                   HTCEGNEKGPTLSFRGIDNASYYLLSPEAKRHSFDTTGTGNTLNVAHPMVLRMVMDSLR
FT                   YWVEVMHVDGFRFDLASTLGREPEGFERGGTFFAAIRQDPVLSMVKLIAEPWDIGEGGY
FT                   QVGGFPWPFREWNDKARDDLRAFWRRDPGLIGDVSQRLLGSPVQFSHSHRPATSSVNFI
FT                   AAHDGFTAWDLVSYDEKHNEANGEDNRDGHSHNLSHNLGAEGPTDDPGILEARLRRVKA
FT                   MLATLFLSQGVPMILAGDEFGQSQQGNNNAYCQDNEIAWLDWEEARDELIQAVADLAEF
FT                   RKAEGGIARARFAVGPDAVQHDTPVAAWLHPAGREMEEGDWNDGELRLFALRLDLPRGR
FT                   DLLVVLNAGDDGDFALPEGEWRLKIDTSRERVACDEPALGTLPVGWQSVMVLVAAEDAD
FT                   "
FT   gene            complement(539355..540503)
FT                   /locus_tag="RSKD131_0545"
FT   CDS_pept        complement(539355..540503)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0545"
FT                   /product="Glucose-1-phosphate adenylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00405"
FT                   /db_xref="GOA:B9KPB2"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR005836"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:B9KPB2"
FT                   /protein_id="ACM00405.1"
FT                   /translation="MTSRECKPALPFAGPRRIVDFTLANAARSGLTRMIVATQYRPETL
FT                   AHHLESRWASRFAGGSLRLREGTAVTGTPQGYGGTAAAVAANLAELQSEGVRELVVLAA
FT                   DHVYEMDYAAMVAAHRASGASATVAVDTVPADRASEFGVVRTTEAGRIESFLEKPAVVP
FT                   ADPAVPGRAQVSMGIYVFDLDWLASVLRIIPGTTQDFGHDILPLAVALGEAHAYRVPGD
FT                   NFYWRDVGTLDAYRLAQLEFQTGEAPCALPPRIAASEHEMKAATGELIQFAFRMQTGGI
FT                   ALHSPRLGGDLPGRWTMLDESVLLPGARVAPGVRLTRTIVAPGTSVPAGLVIGEDPDED
FT                   ARWFRRTEEGTVLVTTPMLARRAADRGRLVAPFADSRMGRSA"
FT   gene            complement(541054..541584)
FT                   /locus_tag="RSKD131_0546"
FT   CDS_pept        complement(541054..541584)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0546"
FT                   /product="PAS domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00406"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:B9KPB3"
FT                   /protein_id="ACM00406.1"
FT                   /translation="MDQKQFEKIRGIFDRSGVALTLVDMSLSEQPLVLANPPFLRMTGY
FT                   TEGRILGFNCRFLQREGENEQARADIREALSKGQETQVVLRNYRFSGERFDNLLFLHPV
FT                   GGSIGHPDYFLGSQFELGRSGSSEQEAAAGHAGALTRELARIGAVAARLEMDSRRQLAD
FT                   AAAALVRAWQRRT"
FT   gene            541656..545168
FT                   /locus_tag="RSKD131_0547"
FT   CDS_pept        541656..545168
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0547"
FT                   /product="Chemotaxis multidomain(CheB methylesterase/CheR,
FT                   Methylase)"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00407"
FT                   /db_xref="GOA:B9KPB4"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000673"
FT                   /db_xref="InterPro:IPR000780"
FT                   /db_xref="InterPro:IPR011102"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR022641"
FT                   /db_xref="InterPro:IPR022642"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR035909"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B9KPB4"
FT                   /protein_id="ACM00407.1"
FT                   /translation="MTEMPSAAESAADRDLVLLGIGASAGGLEAFQSLLGALRPTDRFA
FT                   LILVQHLDPEHESLLPELLSKRTRLPVQSIEDGMEIEGGNVYLIPPAFGLDIRGRVLKL
FT                   VPFEAPRGLRRPIDSFFQALAREHGSNAAGVILSGTGSDGSNGVRAIKEAGGLVFAQDP
FT                   KDARYDGMPRSAIGTGAVDLVLPAAEMIGVLRDFHDRASGIAPTIESDAEFIEKVVRNV
FT                   RYRTGHDFSGYKSGTLLRRITLRMSVLGLTEPGDYLRELVQNRGEADRLFRDLLINVTS
FT                   FFRDPAAFDALARVAIPGILEEKGRGDELRVWVPGCSTGQEAYTVAMILADAMTRLDVR
FT                   ARLCVFGTDIDEDALAIARRAQYPNSIASEVPPQFLERYFTPTRHGFEVRGELRDLVRF
FT                   SSQSLVKDPPFSRLDLITCRNLLIYFNHELQELAQRVFHYALRPGGFLMLGPSETAKAE
FT                   GDPFVNVVPEHRIYRRNDALARSLDLPRGFRGISLASEPTHDALPEQIFGLPYAAAEAL
FT                   VVRHVPPFLLIGPQDEVTRVGAGAERFVRLNPGTASLGIRALILPELEQPLKRLLTGSG
FT                   LAGGSFRQTRVEFSRDGEAQEVMIGCETLSNGLRLVTFGTIASPSSGSAADPDTRIVLD
FT                   EAYVSQIEDELEEARLMVRTTVEELETSNEELKSSNEEMMSMNEELQSANEELSTTNEE
FT                   LQTKLAELAEANADLANFMSSTQIATVFLDRELRLRSFTPEAATWFRFVEQDRGREITD
FT                   IRARLDIGTIADVCRRVMAEGPAEEVAMVSTDGESEVIVRFAPYRSGSGDRGGVVFSIF
FT                   DVTAVTRYARAAEEASAEARASAEEIEELYLGSPGAMGLVDRDFRYLRANPKMADFSGL
FT                   PNESLIGRSISEVHPDVAGRMVASIRRVFDSGEPVLRQVVRGTTPADPDVPRVWEIDWY
FT                   PVHRSDGVRAVGFNVTDVTRLLELQADLRRIMRELQHRVKNMLSNVIALVNRARREQGD
FT                   PQEILETLAQRIRALANTHNLLTSENWASTSLSDIFALELLNVYGEERVTLRGPEMRLN
FT                   ARATLSLGMVIHELATNASKYGAFSRPEGRVSVRWSRVDEGEGEEFRLVWQESGGPTVN
FT                   PPSREGFGTQLMRSMVEGSFYGSIESNWEPAGLRLVVALPWNAATEVDYDSDLDPLRHA
FT                   DPLP"
FT   gene            545149..545502
FT                   /locus_tag="RSKD131_0548"
FT   CDS_pept        545149..545502
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0548"
FT                   /product="Response regulator receiver and SARP domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0548"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00408"
FT                   /db_xref="GOA:B9KPB5"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:B9KPB5"
FT                   /protein_id="ACM00408.1"
FT                   /translation="MRILYLEDEAIIAMETVETLRDMGFEQIDMAYSLPAAEKFVAEAL
FT                   PDIALLDVNLSHGRTSFELGSRLLGEGVPVVFATGYASSSLPADPRATVIEKPVTPAAL
FT                   ERALNSAACASEG"
FT   gene            545580..545729
FT                   /locus_tag="RSKD131_0549"
FT   CDS_pept        545580..545729
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0549"
FT                   /product="Hypothetical Protein"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00409"
FT                   /db_xref="GOA:B9KPB6"
FT                   /db_xref="UniProtKB/TrEMBL:B9KPB6"
FT                   /protein_id="ACM00409.1"
FT                   /translation="MKPMSSETLSLSLTLVVAATIVVTVIAMARREKRLVPVTVPARVR
FT                   QRGR"
FT   gene            545729..545983
FT                   /locus_tag="RSKD131_0550"
FT   CDS_pept        545729..545983
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0550"
FT                   /product="Hypothetical Protein"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00410"
FT                   /db_xref="UniProtKB/TrEMBL:B9KPB7"
FT                   /protein_id="ACM00410.1"
FT                   /translation="MDRLSILLTLMTGAVITGVLVILFFSMGWYGWTPIAIGAGAGILL
FT                   SWPAGYLISRRIKRTDPQWDETRVERVPTTIPKPDAPEV"
FT   gene            complement(546374..547831)
FT                   /locus_tag="RSKD131_0551"
FT   CDS_pept        complement(546374..547831)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0551"
FT                   /product="Phage SPO1 DNA polymerase-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00411"
FT                   /db_xref="InterPro:IPR005122"
FT                   /db_xref="InterPro:IPR005273"
FT                   /db_xref="InterPro:IPR023875"
FT                   /db_xref="InterPro:IPR025404"
FT                   /db_xref="InterPro:IPR036895"
FT                   /db_xref="UniProtKB/TrEMBL:B9KPB8"
FT                   /protein_id="ACM00411.1"
FT                   /translation="MPEVVLPRLGTVAAWRAEARRLAQAGVPAENVVWRVGAGEADLFA
FT                   DLPALPAGPARQIRLSREAVGSLETALCHADPERFGRAYGLLLRLADGSLRWGDRSDPA
FT                   LRKLLAQEKMVRREIHKMHAFVRFRELPSEGSRRAFAAWFEPDHPVEEAAAPFFARRFG
FT                   DMDWAIVTPEVTARFVAGQLDFALTEERTAPPADGTEELWRTYYANIFNPARLMVKAMQ
FT                   SEMPKRYWKNLPEAELIPGLIRGAAERAAEMQAAALTEPPARTAAVARQRAAAAGGPVA
FT                   AGDGSAPGSLAEAKTAAEGCRRCGLWANATQVVFGEGPATARMMIVGEQPGDREDLAGR
FT                   PFVGPAGQLFDEEAAAAGLDRQAVYVTNAVKHFKFAPRGKRRIHQKPDAGEVTACRWWL
FT                   DLERDLVRPRLIVAMGATALASLTGSGAGILKRRGSVERLDDGTPLFVTVHPSYILRLP
FT                   DEAARAEERRRFRADLEAARQLLERLN"
FT   gene            complement(547831..549051)
FT                   /locus_tag="RSKD131_0552"
FT   CDS_pept        complement(547831..549051)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0552"
FT                   /product="Radical SAM domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00412"
FT                   /db_xref="GOA:B9KPB9"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR023874"
FT                   /db_xref="UniProtKB/TrEMBL:B9KPB9"
FT                   /protein_id="ACM00412.1"
FT                   /translation="MKKDLARKLAILSDAAKYDASCASSGGTRRDSKDGKGLGSSGGSG
FT                   ICHAYAPDGRCISLLKILMTNFCIFNCAYCVNRVSSRVERARFSVEEVVTLTVEFYRRN
FT                   YIEGLFLSSGIIRSPDDTMADMVRIAKTLREREHFRGYIHLKTIPDAAPELIEQAGLYA
FT                   DRLSINVELPTEAGLDRFAPEKSATGIRKAMAEVRLKREASREPSFSGRRPSRFAPAGQ
FT                   STQMIVGADGADDAAILGNASTLYANYGLSRVYYSAFSPIPDASKALPLVRPPLLREHR
FT                   LYQADWLLRFYGFEVGEIADKGMLDLEVDPKLAWALAHREAFPVDVNRAPREMLLRVPG
FT                   FGTKTVGRILAARAHGAVRYEHLVAMGAVVKQARPFIVAPGWRPQGLDDASLRARFVPP
FT                   PEQLSLF"
FT   gene            complement(549134..550147)
FT                   /locus_tag="RSKD131_0553"
FT   CDS_pept        complement(549134..550147)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0553"
FT                   /product="Beta-lactamase"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00413"
FT                   /db_xref="InterPro:IPR001466"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:B9KPC0"
FT                   /protein_id="ACM00413.1"
FT                   /translation="MILSRRLLLAAGAALALPRALRAQAPRRPPLAATLEAARGLDQLH
FT                   AIVVAQGGEMLVAEALRGPAPDRAVNVKSVSKTLVAALLGAALDRGAVPALGATLGEVA
FT                   PGLIPAEADPRVRDLTLEDLVTMRAGLERTSGGNYGAWVSSRNWLAYALSRPMVAEPGG
FT                   RMLYSTGSFHILGAALSEATHRSLLALMRDWLGRPLGIEIPPWTQDPQGFYLGGNEMAL
FT                   SPLALLRFGEMVRQGGQWDGAQVLSADWVRRSLEPRTRSPFSGLGYGYGWFVGRAGTEG
FT                   IALARGYGGQLVCLLPDLEVTVVVTSNPTRPARSEGYFGDLMRLIGEVAAPELRRA"
FT   gene            550276..550743
FT                   /locus_tag="RSKD131_0554"
FT   CDS_pept        550276..550743
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0554"
FT                   /product="Transcriptional regulator, MarR family"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00414"
FT                   /db_xref="GOA:B9KPC1"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B9KPC1"
FT                   /protein_id="ACM00414.1"
FT                   /translation="MEKDTDRLGLLLHDATRAVRKRFEQRTSHLGLSTAQWRLLAQLSR
FT                   EPRATQARLADLLDIEPISVSRLIDRMEQGGWVRREADPCDRRARLVAPTDKTKAAYAT
FT                   IKTIADEVYDEALEGIPADRRRELVAMLRTIVTNLNDAEAEPRVPCIKANG"
FT   gene            550740..551846
FT                   /locus_tag="RSKD131_0555"
FT   CDS_pept        550740..551846
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0555"
FT                   /product="Secretion protein HlyD family protein"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00415"
FT                   /db_xref="GOA:B9KPC2"
FT                   /db_xref="InterPro:IPR039562"
FT                   /db_xref="UniProtKB/TrEMBL:B9KPC2"
FT                   /protein_id="ACM00415.1"
FT                   /translation="MNAQTSPEKARSTPVVAEPKPRKTRRILLMAALPAALLGGAGVWW
FT                   VTGGRYETTDNAYLHQAVVGVASELSGRVTRVSVSDNRPVSKGEVLFEIDPEPHRIALA
FT                   KAEAAVASARLEVEQLRVAYAQAQAQEKLAADDAAYLANELERQRALSQKGVASTTSLD
FT                   DARHESLRAKELLLVARQTTASALAALGGVADGPVDEHPKVRTALAARDDAAYQLARTE
FT                   VRAPADGIVYQAASFKPGQMVTAGQSLFSLVETGDVWIDANFKETQLAGIAPGQKAEVT
FT                   FDLHPDRPYEATVEAVGAGTGSEFSLLPAQNATGNWVKVTQRVPVRLRFEEGADIAGLA
FT                   SGLSAEVSVDTGRVRHIPGLASFAATAD"
FT   gene            551884..553383
FT                   /locus_tag="RSKD131_0556"
FT   CDS_pept        551884..553383
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0556"
FT                   /product="Drug resistance transporter, EmrB/QacA subfamily"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00416"
FT                   /db_xref="GOA:B9KPC3"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR004638"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B9KPC3"
FT                   /protein_id="ACM00416.1"
FT                   /translation="MEHRGLITLVIMLATIMQVLDTTIANVALPSMTGDLDASADTINW
FT                   VLTSYIVAAAIMTPVTGWLADRIGKRELFLVSIVGFTLASMACGLSWSLPSMVGFRLLQ
FT                   GVFGAAIVPLSQTFLLDINPREKAGQAMALWGAGIMVGPIIGPTLGGWLTESWDWRWVF
FT                   FINLPVGIVAFLGCAAWLPRAERVVRRFDFFGFAMLAIALGSLQLMLDRGADVEWFAAL
FT                   EIWIYLFLMLTGFWVFVIHILGAEKPFLEPAMFADRNFATGLVFIFVVGIILLASLALL
FT                   PPMLSHIFGYPVITTGLVMAPRGVGTMISMLIAGRMLRFVDARLMVTAGLSLTALSLHM
FT                   MTGFSPQMDSTPIVLSGVVQGLGLGLVFVPLSTVAFATIAPRFRADATSLFSLVRNIGS
FT                   SVGISMVTVMLTHNSQINHAELGANVTPYNPQLWQLSPDAAQGGLQSLAVIDRLVTQQA
FT                   TMIGYIDDFRLMMLITLAALPLALLLRKPRAGGAPVTVHAD"
FT   gene            complement(553626..553805)
FT                   /locus_tag="RSKD131_0557"
FT   CDS_pept        complement(553626..553805)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0557"
FT                   /product="Hypothetical Protein"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0557"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00417"
FT                   /db_xref="GOA:B9KPC4"
FT                   /db_xref="UniProtKB/TrEMBL:B9KPC4"
FT                   /protein_id="ACM00417.1"
FT                   /translation="MHEESDREGPASKSPSFRRHNPPDASDFRSRLAIGAHALLISLAA
FT                   GAVTALLSGALRAF"
FT   gene            554172..554957
FT                   /locus_tag="RSKD131_0558"
FT   CDS_pept        554172..554957
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0558"
FT                   /product="RNA methyltransferase, TrmH family, group 3"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00418"
FT                   /db_xref="GOA:B9KPC5"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR004441"
FT                   /db_xref="InterPro:IPR013123"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="UniProtKB/TrEMBL:B9KPC5"
FT                   /protein_id="ACM00418.1"
FT                   /translation="MPKPVKPAWVIEKERSRRAAAQETVWLFGIHAVRDALANPLRQKL
FT                   RLVLTKNAADRLGEAIAESGLEPEIVDPRKFSVPIDEGSVHQGAALEVKPLDWGSLEDL
FT                   AASGAGQPLLVLLDRVTDPHNVGAVLRSAEVFGARAVIAPHRHSAPETGALAKTASGAL
FT                   ERQPYLRVGNLGETMEKLKAMGYILVGLEGEAAMTLAEGLQGTAGRPVALVLGAEGPGL
FT                   REKTRETCDRLVRIPAAGGFGSLNVSNAAAVALYAAASR"
FT   gene            555146..555592
FT                   /locus_tag="RSKD131_0559"
FT   CDS_pept        555146..555592
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0559"
FT                   /product="CoA-binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00419"
FT                   /db_xref="GOA:B9KPC6"
FT                   /db_xref="InterPro:IPR003781"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B9KPC6"
FT                   /protein_id="ACM00419.1"
FT                   /translation="MTDDAARDMPLTDEEVRRILASTRTIAVVGWSPNPDRPSHQVAAF
FT                   LKARGYRVIPVNPGQAGQEALGETIRPDLAALAGEGVDMVDIFRRSDHVHEVVEAALAH
FT                   LPDLRTVWMQLGVRNPEAAQEARARGIDVVENRCPAIEIPRLGL"
FT   gene            complement(555794..556105)
FT                   /locus_tag="RSKD131_0560"
FT   CDS_pept        complement(555794..556105)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0560"
FT                   /product="Phosphoribosyl-ATP pyrophosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00420"
FT                   /db_xref="GOA:B9KPC7"
FT                   /db_xref="InterPro:IPR008179"
FT                   /db_xref="InterPro:IPR021130"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9KPC7"
FT                   /protein_id="ACM00420.1"
FT                   /translation="MTVLERLAATVEARKGVDPDSSWTAKLLARGPEKCAEKFGEEAVE
FT                   AIIEAVRGDRDRLASEAADVLYHLIVMLAARDVTLAEVMAVLEAREGTSGIAEKAGRG"
FT   gene            complement(556102..556863)
FT                   /locus_tag="RSKD131_0561"
FT   CDS_pept        complement(556102..556863)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0561"
FT                   /product="Imidazole glycerol phosphate synthase subunit
FT                   hisF"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00421"
FT                   /db_xref="GOA:B9KPC8"
FT                   /db_xref="InterPro:IPR004651"
FT                   /db_xref="InterPro:IPR006062"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9KPC8"
FT                   /protein_id="ACM00421.1"
FT                   /translation="MLKTRIIPCLDVADGRVVKGVNFVDLRDAGDPVEAARAYDAAGAD
FT                   ELCFLDIHATHENRGTMYDLVTRTAEQCFMPLTVGGGVRTHQDVRALLLAGADKVSFNS
FT                   AAVADPTVVAEAADRFGSQCIVVAIDAKTVAPGRWEIFTHGGRRATGIDAVEFACDVAS
FT                   RGAGEILLTSMDRDGTRAGFNLPLTRAISEAVPIPVIASGGVGTLDHLVEGVTEGGASA
FT                   VLAASIFHFGEFTIGEAKAHMATAGIPVRLA"
FT   gene            complement(556998..557717)
FT                   /locus_tag="RSKD131_0562"
FT   CDS_pept        complement(556998..557717)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0562"
FT                   /product="Phosphoribosylformimino-5-aminoimidazole
FT                   carboxamide ribotide isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00422"
FT                   /db_xref="GOA:B9KPC9"
FT                   /db_xref="InterPro:IPR006062"
FT                   /db_xref="InterPro:IPR006063"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR023016"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9KPC9"
FT                   /protein_id="ACM00422.1"
FT                   /translation="MILYPAIDLKDGQCVRLLRGEMEAATVFGDDPAAQAAAFEAAGCE
FT                   WVHLVDLNGAFAGRPVNAAAVEAILARIAVPAQLGGGIRDMATIALWLEKGLARVILGT
FT                   VAVENPGLVREAARAFPGRVAVGIDARKGRVATKGWATETDVMATDLARSFEDAGVAAI
FT                   IYTDIDRDGAMAGPNIEATDALARAVSIPVIASGGVSSLADLLALRDTGSIAGAISGRA
FT                   LYDGALDLTQALQALRT"
FT   gene            557857..558237
FT                   /locus_tag="RSKD131_0563"
FT   CDS_pept        557857..558237
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0563"
FT                   /product="Hypothetical Protein"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0563"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00423"
FT                   /db_xref="InterPro:IPR019223"
FT                   /db_xref="UniProtKB/TrEMBL:B9KPD0"
FT                   /protein_id="ACM00423.1"
FT                   /translation="MRLGILAACLALAAGAALADPVEGVWQTEPDEGAFAHVTMAPCGP
FT                   KICGTIGRTFRAGAEYVSPNRGKTIVWDMVAAGGGRYGEGRIWQPSTGKIYRSKMALEG
FT                   DRLKVSGCIGPFCRGQTWVRVK"
FT   gene            complement(558462..559103)
FT                   /locus_tag="RSKD131_0564"
FT   CDS_pept        complement(558462..559103)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0564"
FT                   /product="Imidazole glycerol phosphate synthase subunit
FT                   hisH"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00424"
FT                   /db_xref="GOA:B9KPD1"
FT                   /db_xref="InterPro:IPR010139"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:B9KPD1"
FT                   /protein_id="ACM00424.1"
FT                   /translation="MMLTVLVDYDSGNLHSAEKAFQRMATETGAGQVLVSDKPEDVARA
FT                   DRIVLPGDGAFPACRRALGSYGGLSEAIEEAVTRRARPFLGICIGMQMMATRGLEHEQT
FT                   PGFGWIAGEVVRIAPADPHLKVPHMGWNDLTVDHPHPVLAGIETGDHAYFVHSYHFQVA
FT                   HDAERLAHADYGAAITAIVGRDTMVGTQFHPEKSQKTGLRLIANFLTWKP"
FT   gene            complement(559100..559687)
FT                   /locus_tag="RSKD131_0565"
FT   CDS_pept        complement(559100..559687)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0565"
FT                   /product="Imidazoleglycerol-phosphate dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0565"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00425"
FT                   /db_xref="GOA:B9KPD2"
FT                   /db_xref="InterPro:IPR000807"
FT                   /db_xref="InterPro:IPR020565"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR038494"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9KPD2"
FT                   /protein_id="ACM00425.1"
FT                   /translation="MRKAEISRKTAETDISVTVDLDGTGRYDIRTGVGFFDHMMDQLAR
FT                   HALIDITLRCEGDLHIDDHHTVEDCGIALGQALTRALGDKRGIRRYGSFHLAMDDALVR
FT                   AALDLSGRPFLVWNLPFPTEKIGSFDTELVREFFQALATHGGITLHVDLIHGVNSHHIA
FT                   EAAFKAVARSLREAVEPDPRRADAIPSTKGML"
FT   gene            559909..561933
FT                   /locus_tag="RSKD131_0566"
FT   CDS_pept        559909..561933
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0566"
FT                   /product="Small GTP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0566"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00426"
FT                   /db_xref="GOA:B9KPD3"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR005517"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009022"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035649"
FT                   /db_xref="InterPro:IPR041095"
FT                   /db_xref="UniProtKB/TrEMBL:B9KPD3"
FT                   /protein_id="ACM00426.1"
FT                   /translation="MGERSMSHQPSGPRCAALVGSYTCGKTTLFEDLLFAAGAIDRRGA
FT                   VKDGNTVGDAAPEARARTMSTELSVANFDYLGEPWALIDCPGSVELTYEAQCAMMVADL
FT                   VVVVAEPLPERAVTLSPILRFLDDRNIPHLIYVNKMDLPEATVRGTFEALQAISGRPLV
FT                   LREIPIRDGAGKVTGMVDLVSERAWRWNPHKPSDLVALPDTLADATGEARTGMLEALAD
FT                   FDDALMAELLEDAVPSTDEIYANLTRDLQEDLIVPVFFGSAENENGIRRLLKALRHEAP
FT                   GAEVTADRLGIATAGTMAQVFKTVYAGQSGKISLARIWSGEVKDGIGLGQDRVGSVLSL
FT                   MGRKTAPRGVARAGEVVALGRMAGAATGDLLTESGVVEADWPAPPAPLHALAIRAEKQS
FT                   DDVKLQAALARLAEEDPSLAAAHQAETSELVLSGQGEMQLQIALARMKNEYGLAVTAGK
FT                   PAIPYRETITKAATIHARHKKQSGGHGEFADVHLEIRPQPRGAGFAFDERITGGVVPKS
FT                   YIPAVEKGVQSYLGKGPLGHRVVDVAVTLTDGSYHTVDSSEMAFQKAAQKGMAEAMPGC
FT                   GPVLLEPVLTVAISVPSEFTPKVQRIVTGRRGQLLGFDAKDGWPGWDEVQALIPQGEMD
FT                   GLIVEIRSQSLGVGTYSCRFDHLQELSGREAEKILAEQA"
FT   gene            complement(562053..563273)
FT                   /locus_tag="RSKD131_0567"
FT   CDS_pept        complement(562053..563273)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0567"
FT                   /product="Major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0567"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00427"
FT                   /db_xref="GOA:B9KPD4"
FT                   /db_xref="InterPro:IPR001958"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B9KPD4"
FT                   /protein_id="ACM00427.1"
FT                   /translation="MPQPRLALAFILITVALDAIGIGLIFPVMPDLILEITGQPLSEAA
FT                   VWGGLLSASFAVMQFLFGPTIGSLSDRFGRRPILLGSLVLMSATYLAMALAPTMAILLA
FT                   ARIVAGIVSATYATASAFIADVTPPEDRGKRFALVGAGFGIGFVLGPALGGLLAGLDTR
FT                   APFYAAALMALLNLALGSLILPETVTDATRRAFTLSRANPLGALRAVARLPGLSRPLAV
FT                   FLILGIAMNVYPAVWAFYGQAQFGWGAGMVGASLALYGISFAVGQVALVGPAIRHLGEH
FT                   RTALVGIWVDIVTLAALGVLASGTGALFVIPVTALGGVVVPALQSILSRATPADAQGEL
FT                   QGVLASLNAIAMIASPLVMTATFRAFTAPGAPLHLPGAPFLLASLLMVSALALHVRGAG
FT                   QPERDAA"
FT   gene            complement(563304..564032)
FT                   /locus_tag="RSKD131_0568"
FT   CDS_pept        complement(563304..564032)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0568"
FT                   /product="Hypothetical Protein"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0568"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00428"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B9KPD5"
FT                   /protein_id="ACM00428.1"
FT                   /translation="MSDILLVHGSGYGGWCWDATIRALAAHGARARALDLPGRIFTPGL
FT                   SLADHAAAILQEIRAPVTLVGHSAGGFSIAAAAEAAPPGLIERLVFLCAYAPRDGASVA
FT                   SMRRAQARQPLRPAIRLAPDRLSYSFHPDLAGEALFHDCPPEVRAAALARMGPEPVGPQ
FT                   EERIRLSTRYHALPKHYIRCLEDRAIPPETQEAMTADWPAGSVSTLPAGHSPFLSCPEA
FT                   LAKRLISVAANPLSCRPTPG"
FT   gene            complement(564025..564813)
FT                   /locus_tag="RSKD131_0569"
FT   CDS_pept        complement(564025..564813)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0569"
FT                   /product="3-oxoadipate enol-lactonase"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0569"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00429"
FT                   /db_xref="GOA:B9KPD6"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR026968"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B9KPD6"
FT                   /protein_id="ACM00429.1"
FT                   /translation="MPHIEIGDLRLNYLDEGRATGAPVVFAHALGSDLRIWDNLIPLLP
FT                   QDLRLVRYDLRGHGRSTTPEPPYAMGALIRDAERLMEALSIREAVFVGCSIGGMIAQGL
FT                   AVKRLDLVRGLVLCDTAAKIGTPEIWQDRIDQVRSYGLESLADPTMKRWFAPAFRQGPE
FT                   GQLWRERFIEGDPDGYAGGAAAIAGTDFYTTTARLTLPTLALVGSEDGSTPPDLVRETA
FT                   ELIRGSRFEIVRGAGHVPSVDKPAEVAALLTEFLRSIGHV"
FT   gene            complement(565041..566018)
FT                   /locus_tag="RSKD131_0570"
FT   CDS_pept        complement(565041..566018)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0570"
FT                   /product="Pyridoxal-5'-phosphate-dependent enzyme, beta
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0570"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00430"
FT                   /db_xref="GOA:B9KPD7"
FT                   /db_xref="InterPro:IPR000634"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:B9KPD7"
FT                   /protein_id="ACM00430.1"
FT                   /translation="MSDIAMIKAAAARLAGHARRTPLLSSPFLDEIAGRRVLVKAECLQ
FT                   HTGSFKFRGGWSALSALEPARRAQGVIAYSSGNHAQGVALAAARHGAPAVIVMPADAPQ
FT                   LKIENTRALGAEVVLYDRATEDRDAIGARLAEERGLTLIRPFDEPLVIAGQGTTGLEIA
FT                   EQAAEEGVTSADVLTCCGGGGLTAGIALALEARAPGLRVRPVEPVGFDDTARSLAAGEI
FT                   RSNAALSGSICDAIVTPQPGRITFPILARLCGPGLAVTDAEALRAMALAFLRLKIVLEP
FT                   GGAVALAAALFRPDALEGDAVICTASGGNVDPPLFARALAEAAD"
FT   gene            complement(566015..566839)
FT                   /locus_tag="RSKD131_0571"
FT   CDS_pept        complement(566015..566839)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0571"
FT                   /product="Alpha/beta hydrolase fold protein"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0571"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00431"
FT                   /db_xref="GOA:B9KPD8"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B9KPD8"
FT                   /protein_id="ACM00431.1"
FT                   /translation="MTQFFTASDGARLAFTDEGEGLPLLCLSGLTRTGADFDYLAPHLS
FT                   GVRLIRPDYRGRGRSDFTGAATYTVPREARDAVELLDHLGLASAAILGTSRGGLVGMFL
FT                   AATAKDRMRGLCLNDVGPEIERSGLEKIFAYVGRNPSPATHAELAAALPKLMTGFSDVP
FT                   AERWLAEAQLHYTETPQGLRITYDPTLREAFLAAFEGEPADLWPLFDACEGLPLALIRG
FT                   ANSDLLSPATAAEMRRRRPDMIFAEVPGRAHIPFLDESESLSAIRAFLEQVA"
FT   gene            567307..569094
FT                   /locus_tag="RSKD131_0572"
FT   CDS_pept        567307..569094
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0572"
FT                   /product="Lipid A ABC exporter family, fused ATPase and
FT                   inner membrane subunits"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0572"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00432"
FT                   /db_xref="GOA:B9KPD9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR011918"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="UniProtKB/TrEMBL:B9KPD9"
FT                   /protein_id="ACM00432.1"
FT                   /translation="MARRPTTQLEDRPKSRRMSALRGLVPFLAPYRKLTFGALGALVLT
FT                   AIISLILPVTVRRVVDGFMENNAALLDQYFAAALFIAAALAAGTGLRYYLVTRLGERVV
FT                   ADMRRALFDRMMGMSPAFFERIMTGEVLSRLTTDTTLLLSVIGSSISVALRNFLILIGG
FT                   LVLLLFTSTKLTGLVMLLVPLVVVPIVILGRKLRRLSRENQDWIAQSSGNASEALLSVQ
FT                   TVQAFTHERQSRAFFGDVTEKSFLSAKDRIGTRALMTVIVIFLVFTGIVGVLWVGARDV
FT                   RAGTMTPGEMVQFLIYAVMVAGSVGALSEIWSELQRAAGATERLNELLTAEDPVQDPAT
FT                   PVALPRPVKGEISFEGVRFRYPARPEVSALDGIDLVVRPGETVALVGPSGAGKTTILQL
FT                   LLRFYDPQQGAVRIDGVDLRDMTRDDFRRAIALVPQDPVIFATSARENIRFGRPEATDA
FT                   EVEAAARAAAAHDFLSLLPQGYDTYVGERGVMLSGGQKQRVALARAILRDAKILLLDEA
FT                   TSALDAESERAVQTAVEALAQNRTTLVVAHRLATVKRADRIVVFDKGRIVATGTHDALV
FT                   AEGGLYARLARLQFTDGSV"
FT   gene            569200..571089
FT                   /locus_tag="RSKD131_0573"
FT   CDS_pept        569200..571089
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0573"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0573"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00433"
FT                   /db_xref="GOA:B9KPE0"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:B9KPE0"
FT                   /protein_id="ACM00433.1"
FT                   /translation="MGSFACAADLRAIEAEGAWADLGTPRTMHRFLGRAAAEHGDRPAV
FT                   SFQLLSAPKSRAETLSWSQLHRRVTQAANLFRSLGVGERDVVAFVLPNCTETAVTLLGG
FT                   AVAGIVNPVNPLLEADQIAAILRETKARVVVTLRAFPKTDVAQKVAEAVRHAPEVRTVL
FT                   EVDLLRYLGPPKSLIVPLIRPKLKPAHHARVLSFNAELDRQPATLAFPDPETDRVAAYF
FT                   HTGGTTGMPKVAQHKVSGMIYNGWCGQRLLFQPTDTVMCPLPLFHVFAAYPILMSMIAS
FT                   GAHVVFPTPAGYRGEGVFDNLWKLIERWRCTYLVTVPTALAALMQRPIDADVSSLRGAF
FT                   SGSAPLPVELFNRFEKATGVQIVEGYGLTECTCLVSVNPPEGAKKIGSVGLPFPHTHVR
FT                   ILHSNGNGHVLKECGVDEVGEICVANPGVYEGSTYTELDKNHGLFAEDRFLRTGDLGRL
FT                   DAEGYLFITGRAKDLIIRGGHNIDPAGIEAALMSHPAVSFVGAIGQPDAFAGELPCAYV
FT                   ELVQGAEVETAALFDHARAHIHERAAVPKHIEILPELPKTAVGKVFKPDLRRLAIARVY
FT                   DAALASAGLPVRVAEVVEDRKRGLVARLERAGEVDEERLAHVLGEYTRPWEWA"
FT   gene            complement(571458..571895)
FT                   /locus_tag="RSKD131_0574"
FT   CDS_pept        complement(571458..571895)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0574"
FT                   /product="D-tyrosyl-tRNA(Tyr) deacylase"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0574"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00434"
FT                   /db_xref="GOA:B9KPE1"
FT                   /db_xref="InterPro:IPR003732"
FT                   /db_xref="InterPro:IPR023509"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9KPE1"
FT                   /protein_id="ACM00434.1"
FT                   /translation="MRALIQRVSEASVTVEGECLGEIGPGLLILVCAMQGDGEAQASAL
FT                   AARIAKLRIFKDEAGKMNRSVRDTGGAALVVSQFTLAADTSRGNRPGFSAAAPPADGER
FT                   LYRQFAAEIAACGIPTATGRFGADMKVRLLNDGPVTIWMES"
FT   gene            complement(571895..572815)
FT                   /locus_tag="RSKD131_0575"
FT   CDS_pept        complement(571895..572815)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0575"
FT                   /product="PfkB domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0575"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00435"
FT                   /db_xref="GOA:B9KPE2"
FT                   /db_xref="InterPro:IPR002139"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:B9KPE2"
FT                   /protein_id="ACM00435.1"
FT                   /translation="MILCCGEALIDMLPRETAGGEAAFAPYAGGAVFNTAIALGRLGAP
FT                   AGFFSGLSTDLFGVQLTETLAASQVETDLCARSDRPTTLAFVRLTNGQASYAFYDENTA
FT                   GRLLAKADLPTLPDRVSTLFFGGISLVNEPAAATYEALMAREAPRRVTMLDPNIRPGFI
FT                   ADAAAYRARIGRMIALADILKLSDEDLHWLDGPGEILPLARGLLGRGPKLVLVTEGAAG
FT                   ARAITATEDRFCETTPVQVADTVGAGDTFNAGVLAALHEAGGLSKSAVAGLSPETLDAA
FT                   LALGTRAAAVTVSRPGANPPWADEL"
FT   gene            complement(572829..573788)
FT                   /locus_tag="RSKD131_0576"
FT   CDS_pept        complement(572829..573788)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0576"
FT                   /product="Phosphoribosylaminoimidazole-succinocarboxamide
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0576"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00436"
FT                   /db_xref="GOA:B9KPE3"
FT                   /db_xref="InterPro:IPR018236"
FT                   /db_xref="InterPro:IPR028923"
FT                   /db_xref="UniProtKB/TrEMBL:B9KPE3"
FT                   /protein_id="ACM00436.1"
FT                   /translation="MPDLSRVLPEAHIPELPDPYYGKVRDCYDLPDGRRLLISSDRISA
FT                   FDRILAAIPFKGQVLTQTARFWFDATADICPNHVISYPDPNVVLARRVTILPVEVVVRG
FT                   YLAGTTGTSVLTLYKQGVREMYGHRLPDGLRDNEVLPAPLITPTSKAFDGGHDEPLTEA
FT                   EIVSQGLLTRAQWDEVSAKALALFARGQAMAAERGLILVDTKYEFGLDGEGRILIADEI
FT                   HTPDSSRYWIASGYEEAFRTGQRPPSFDKDVIRAWVAARCDPYRDPIPEIPDEMIRRTS
FT                   EVYIEAFETITGRPFEPDLSGATPLERIRANLAPYFTR"
FT   gene            complement(573855..574292)
FT                   /locus_tag="RSKD131_0577"
FT   CDS_pept        complement(573855..574292)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0577"
FT                   /product="Transmembrane protein precursor"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0577"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00437"
FT                   /db_xref="GOA:B9KPE4"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="UniProtKB/TrEMBL:B9KPE4"
FT                   /protein_id="ACM00437.1"
FT                   /translation="MDGLSAVLLLALSAFASATLLPGSSEALLLALLAAGEPAAPLVAV
FT                   ATAANLAGSLVNWALGRFLIRFRDRRWFPVSAAALARAERGYRRWGLWSLLFAWVPVVG
FT                   DPLTVAAGLLKVGFWPFLLLVGLGKAARYTLLAAGFSAVAG"
FT   gene            complement(574297..575394)
FT                   /locus_tag="RSKD131_0578"
FT   CDS_pept        complement(574297..575394)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0578"
FT                   /product="Hypothetical Protein"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0578"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00438"
FT                   /db_xref="GOA:B9KPE5"
FT                   /db_xref="UniProtKB/TrEMBL:B9KPE5"
FT                   /protein_id="ACM00438.1"
FT                   /translation="MQDVRHWPCESCGADLRFAPGQTRLVCDHCGHVQEIPETAPADRR
FT                   GMGELDLHAALADRLPATASEQVRTTPCPSCGALVEFEGATHATQCPFCATPVVAGTGE
FT                   TRLLKPQAVIPFRLTEREARQAMTDWLGRLWFAPNGLVQYARKGRALSGLYVPYWTFDA
FT                   ATRSRYTGQRGDAYYTTRTVTVEVNGRPQRRTERVRQIRWTPVSGRVAREFDDVLVLAS
FT                   QSLPRHYTEALEPWDLSALEPYRADWLAGFTAEGYTVGLPEGWSRAQEIMARTIRGDVA
FT                   RDIGGDEQRVGQVETAYDRETFKHVLLPVWMAAYRYGGKSYRFVVNGQTGRVQGERPWS
FT                   AWKIAFAVLLGLIAAGIAAYIAQAR"
FT   gene            complement(575396..576505)
FT                   /locus_tag="RSKD131_0579"
FT   CDS_pept        complement(575396..576505)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0579"
FT                   /product="Antifreeze protein, type I"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0579"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00439"
FT                   /db_xref="InterPro:IPR025640"
FT                   /db_xref="InterPro:IPR033880"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:B9KPE6"
FT                   /protein_id="ACM00439.1"
FT                   /translation="MALFDFLGGEFIDVIHWVDDTRDTMVWRFERQGHAIKYGAKLTVR
FT                   EGQAAVFIHEGQLADVFTPGLYMLETNNLPILTTLQHWDHGFRSPFKSEIYFVNTTRFN
FT                   DQKWGTKNPIICRDPEFGPVRLRAFGTYSMRVTDPGRFMTEIVGTDGEFTADEISFQIR
FT                   NVIVQEMGRALAASSIPVLDMAANTADLGKLVAEAIAPTIAAYGLSIPELYIENISLPQ
FT                   EVEKALDKRTSMGIVGDLGKFTQYSAAEAMSAPNSAAGAAVASGMGAAMGLGMAQRMGP
FT                   WGAAPAAAEPAAPPPPPPPTEPVWHVAANGQSEGPLAQADLARRVAAGQVTRATLVWTP
FT                   GQEGWIPAGEVAALAPLFARIPPPLPPGA"
FT   gene            576527..576661
FT                   /locus_tag="RSKD131_0580"
FT   CDS_pept        576527..576661
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0580"
FT                   /product="Hypothetical Protein"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0580"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00440"
FT                   /db_xref="UniProtKB/TrEMBL:B9KPE7"
FT                   /protein_id="ACM00440.1"
FT                   /translation="MDQSPRAGTTMAETAFGGFGTAASAGFRGARANQPRSGRGRLGW"
FT   gene            complement(576686..577324)
FT                   /locus_tag="RSKD131_0581"
FT   CDS_pept        complement(576686..577324)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0581"
FT                   /product="Hypothetical Protein"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0581"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00441"
FT                   /db_xref="GOA:B9KPE8"
FT                   /db_xref="UniProtKB/TrEMBL:B9KPE8"
FT                   /protein_id="ACM00441.1"
FT                   /translation="MNSLITPDNFEFFARYLLAGLIVISVRSRFVVGERPKLTEQLVEA
FT                   VALSLINQLAFLFLASLWSLVPAAPVLPARGVFFLEVLVLPATLGALFGWNLSLGWNRS
FT                   LLRRLSMPVQNPARRAYDFAFGKHRGPSFVIVTFTDGTVVHGLFGEESLAASDGNRGDI
FT                   YLERLYHVADDGQWAEVVPPRAMLLSLEGMRSIEFLELEGEREMTDDGG"
FT   gene            complement(577340..578305)
FT                   /locus_tag="RSKD131_0582"
FT   CDS_pept        complement(577340..578305)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0582"
FT                   /product="Hypothetical Protein"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0582"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00442"
FT                   /db_xref="InterPro:IPR021323"
FT                   /db_xref="UniProtKB/TrEMBL:B9KPE9"
FT                   /protein_id="ACM00442.1"
FT                   /translation="MHRGVRLSTLLHGGLSLAACAILSACTPPAPREPAHGLGPRARPA
FT                   DLQGPVKESAESQAIRAYFAKVQTDLLAQGLLRTDGGGRDTPYTDRMLAENFIRIALYD
FT                   EYERQGGGFAQREVESRLRRWEAPVRVGLRFGASVPEERRATDRARIASYLARLAKITG
FT                   HPIALADSGINFWLQVVSEDERRALGPQVAEALPTLSAAEIAGITQLPTTTYCLVYALS
FT                   DDATSVYNRAFAVIRSEHPDLLRLACLHEEIAQGLGLANDSPNARPSIFNDDEEFALLT
FT                   TQDELMLKILYDRRLKPGMTVEEARPIVQTIAYELLGGES"
FT   gene            complement(578318..579508)
FT                   /locus_tag="RSKD131_0583"
FT   CDS_pept        complement(578318..579508)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0583"
FT                   /product="Tellurite resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0583"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00443"
FT                   /db_xref="InterPro:IPR008863"
FT                   /db_xref="UniProtKB/TrEMBL:B9KPF0"
FT                   /protein_id="ACM00443.1"
FT                   /translation="MTDSSRREAAEALPRLAEVTAPDLPEPAPAVTPLASAPPEKAQEI
FT                   RRRMAELNVSDSQSIIGFGSKAQAELQTISQQMLADVKNKDVGPAGDSLREVVSTIRGF
FT                   SVSELDVRRKASWWERLLGRTAPFARFVARYEDVQQQIDRITQSLLTHEHRLLKDIKGL
FT                   DILYARTLDFHDELALYIAAGDEVLADLDGRVIPAKEAEVAATPEGDRMIKAQELRDLR
FT                   AARDDLERRVHDLKLTRQVTMQSLPSIRLVQENDKALVTRINSTLVNTVPLWETQLAQA
FT                   VTIQRSREAAEAVRGASDLTNELLTANAENLQQANKIVRKEMERGVFDIEAVKKANATL
FT                   IATINESLAIADEGRARRATAETELQRMEAELRDTLASARARRTGTGDTAGTSVRP"
FT   gene            complement(579657..580535)
FT                   /locus_tag="RSKD131_0584"
FT   CDS_pept        complement(579657..580535)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0584"
FT                   /product="Hypothetical Protein"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0584"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00444"
FT                   /db_xref="GOA:B9KPF1"
FT                   /db_xref="InterPro:IPR018770"
FT                   /db_xref="UniProtKB/TrEMBL:B9KPF1"
FT                   /protein_id="ACM00444.1"
FT                   /translation="MAERYGGRFSPANARREGPPGPPVSRWDRKRRSRAGGRSNILFFL
FT                   PFLFLWDAFLGPAQDFVPAFAAFAALFLAAWLTRQGILAEEAYDARPVAKRPAIPRKIL
FT                   ASVLTGAGLFAGGLAGDAGLLVAAAWGGIGGLLHLAAFGPDPLKDKIPDGVDGFQSDRV
FT                   SRAVAEAESHLTAMREAVARLRDPSLDRRLETFATTARGLFRSVEADPGDLTAARRYLG
FT                   VYLMGARDATLKFADLYGRERDPQVRADYERLLEDLGTSFADRTRRLLQNDRAGLDLEI
FT                   EVLRDRLGRET"
FT   gene            complement(580719..582194)
FT                   /locus_tag="RSKD131_0585"
FT   CDS_pept        complement(580719..582194)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0585"
FT                   /product="Pseudouridine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0585"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00445"
FT                   /db_xref="GOA:B9KPF2"
FT                   /db_xref="InterPro:IPR000748"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR018496"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="InterPro:IPR042092"
FT                   /db_xref="UniProtKB/TrEMBL:B9KPF2"
FT                   /protein_id="ACM00445.1"
FT                   /translation="MTDSKDGERIAKVLSRAGIASRRDAERMIELGRIAVNGRTIDSPA
FT                   LNVGPKDRITVDGQPLAPPEPARLWLYYKPEGLVTSASDEKGRETVFDHLPEGMPRVMS
FT                   VGRLDLNSEGLLLLTNDGELKRRLELPSTGWLRKYRVRVKGNPTDADLEPLRKGITVEG
FT                   ESFQPMTVSLDRVQGANAWLTVGLREGKNREIRRAMSALGLTVNRLIRVSYGPFRLNEL
FT                   EPGMVEEVRPKILRDQLGLDPHADGEARPAKGRKPEGAARPARSESAARRARAEGGARS
FT                   EKPARSPRGAAAEGPTRPARGAGSEGSAGATRGRSPQGAAPKAGAPKDGARFAGKGPAE
FT                   GARPARASRPGGAEASGRTRPADGKSAAAGRSGKTEAADAPRAFRSRSAEAPAKGPRGP
FT                   AKAAGPARSRREALPDTPIDARAPRGRAAAGPKAKGGGAAKAAPTPRAKGPDETAGGRG
FT                   PRTGAPSAQGDRKPQPTGPRPPSRGPKGRPGGR"
FT   gene            582270..582476
FT                   /locus_tag="RSKD131_0586"
FT   CDS_pept        582270..582476
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0586"
FT                   /product="Hypothetical Protein"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0586"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00446"
FT                   /db_xref="UniProtKB/TrEMBL:B9KPF3"
FT                   /protein_id="ACM00446.1"
FT                   /translation="MDQSERARRGGDQPRGSPRVRRRRVHVSREVKGRFGACGAREGGS
FT                   SRKGRPGPAPQAGARRPMSGLPI"
FT   gene            582546..582980
FT                   /locus_tag="RSKD131_0587"
FT   CDS_pept        582546..582980
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0587"
FT                   /product="CMP/dCMP deaminase, zinc-binding"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0587"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00447"
FT                   /db_xref="GOA:B9KPF4"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR028883"
FT                   /db_xref="UniProtKB/TrEMBL:B9KPF4"
FT                   /protein_id="ACM00447.1"
FT                   /translation="MQAALAEARAAGGRGEVPVGAVVVAPGGQVVARAGNRCRELSDPT
FT                   AHAEMLAIRAACATLGERLTGCDLYVTLEPCPMCAAAISAARIARLYYGAADPKSGGVA
FT                   QGARVFAHPQCHHVPEVYDGIGEAEAAALLRGFFAARRPG"
FT   gene            complement(582991..583683)
FT                   /locus_tag="RSKD131_0588"
FT   CDS_pept        complement(582991..583683)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0588"
FT                   /product="Beta-lactamase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0588"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00448"
FT                   /db_xref="GOA:B9KPF5"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR022877"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9KPF5"
FT                   /protein_id="ACM00448.1"
FT                   /translation="MKITWLGHSGFRIAIEQAVLLVDPWLTGNPLFPADRREEALAGAT
FT                   HILITHGHGDHTGDTVAIAKERGLPVVGIYDLVTWLQEKEGIDGIGFNKGGTVTLGGAR
FT                   VTMVQATHSSSMSGEAGPIYTGTESGYMIAGEGHVIYLSGDTDIMADMGWMGEYHRPDV
FT                   GILSAGGHFTMDMKRAAFAARKYFDFRTVIPCHYRTFPLLEQSAEALKEGLPGVEVIEP
FT                   QVLVPIEI"
FT   gene            583746..584402
FT                   /locus_tag="RSKD131_0589"
FT   CDS_pept        583746..584402
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0589"
FT                   /product="Hypothetical Protein"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0589"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00449"
FT                   /db_xref="GOA:B9KPF6"
FT                   /db_xref="UniProtKB/TrEMBL:B9KPF6"
FT                   /protein_id="ACM00449.1"
FT                   /translation="MDWFAAVDGYCERGGPGLWAEPLNAATNAAFLIAAALLWPRVRGL
FT                   ARGRALCLALAAIGLGSGLFHTAANRLTGLLDVLPILAFILLYLHAAARDLLGMGRGAA
FT                   LLATAAFLPYAALTVPLFARLPGLGSSAGYAPVPVLILGVAAWLAPRAPATARGLAGGG
FT                   ALLLLSLAFRTLDGPLCPAFPIGTHFLWHLLNALLLGWMIEVWRRHRLAAAGRPR"
FT   gene            584434..584721
FT                   /locus_tag="RSKD131_0590"
FT   CDS_pept        584434..584721
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0590"
FT                   /product="Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
FT                   subunit C"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0590"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00450"
FT                   /db_xref="GOA:B9KPF7"
FT                   /db_xref="InterPro:IPR003837"
FT                   /db_xref="InterPro:IPR036113"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9KPF7"
FT                   /protein_id="ACM00450.1"
FT                   /translation="MSIDIETARRVAHLARIRVDEADLPALAGELSGILTFMEQLNEVD
FT                   VEGIEPMTSVTPMRLKRRQDVVTDGDMQDKVLSNAPDAREGFFAVPKVVE"
FT   gene            584718..586193
FT                   /locus_tag="RSKD131_0591"
FT   CDS_pept        584718..586193
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0591"
FT                   /product="Glutamyl-tRNA(Gln) amidotransferase subunit A"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0591"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00451"
FT                   /db_xref="GOA:B9KPF8"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR004412"
FT                   /db_xref="InterPro:IPR020556"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9KPF8"
FT                   /protein_id="ACM00451.1"
FT                   /translation="MNANELTIAEARDALAKGELSAVDLTMACLTAIDAGTPLNAFVHA
FT                   TPEIALDQARAADARRGAEAGALNGIPLGIKDLFCTRGVASQAASNILRGFKPEYESTV
FT                   TSKLFEAGAVMLGKLNMDEFAMGSSNETSCYGDAVNPWKVDDRRLTPGGSSGGSAAAVA
FT                   ADLCLAATGTDTGGSIRQPAAFTGIVGIKPTYGRVSRWGIVAFASSLDQAGPMTKSVRD
FT                   AAILLGAMAGHDPKDSTSADIPVPDFEAALTGDIRGRKIGIPREYRMEGMPAEIEALWA
FT                   RGREMLADAGAEIVDISLPHTKYALPAYYVIAPAEASSNLARYDGVRYGHRARLGQGDG
FT                   IVDMYEKTRAEGFGKEVQRRVMIGTYVLSAGFYDAYYNRARKVRALIKRDFDEAFAAGV
FT                   DAILTPATPSSAFGLGEMADADPVAMYLNDVFTVTVNLAGLPGISVPVGLDAKGLPLGL
FT                   QLIGRPWDEAGLLNHAHVLERAAGFVEKPRKWW"
FT   gene            586229..587029
FT                   /locus_tag="RSKD131_0592"
FT   CDS_pept        586229..587029
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0592"
FT                   /product="Hypothetical Protein"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0592"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00452"
FT                   /db_xref="UniProtKB/TrEMBL:B9KPF9"
FT                   /protein_id="ACM00452.1"
FT                   /translation="MRASAALLLAVATAACQPAPPQSGAGFEDYSSYLHRREAELMGQG
FT                   RSTTMPLPDGPAGAAAQPGFSTEAIGSAIDAADGGAGYGGQGSTVPGQAAPGALIGGTT
FT                   SYTTGEAGLPANRPRGNAPVGIREESGEMAGVGSHTGISDENDFSAVSERRSREDDAQL
FT                   MAQNRANYTVIAPQPVPQRTQSDGPNIVQFALSTNHAPGTQMYKRSSLRLTDPGAACAK
FT                   FASPDLAQQAFLASGGPERDRKGLDPDGDGFACGWDPRPFRAVR"
FT   gene            587033..587704
FT                   /locus_tag="RSKD131_0593"
FT   CDS_pept        587033..587704
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0593"
FT                   /product="N-acetylmuramoyl-L-alanine amidase, family 2"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0593"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00453"
FT                   /db_xref="GOA:B9KPG0"
FT                   /db_xref="InterPro:IPR002502"
FT                   /db_xref="InterPro:IPR036505"
FT                   /db_xref="UniProtKB/TrEMBL:B9KPG0"
FT                   /protein_id="ACM00453.1"
FT                   /translation="MSLSPNCGPRREGARPDLVVIHYTAMASAEAARARLCDPAAEVSA
FT                   HWLVPERGDPLALVPEELRAWHAGAGSWGGVTDVNSRSIGIELANPGDRPFPEPQMAAL
FT                   ERLLAGILARWQIPPARVIAHSDMAPERKCDPGPRFDWRRLARGGLSVWPSDGCPPAEA
FT                   ETFAASARAFGYPAVEAALLLAAVRLRFRPWARGPLTGEDAGMMADLAARYPVDGRTPQ
FT                   A"
FT   gene            complement(588192..589406)
FT                   /locus_tag="RSKD131_0594"
FT   CDS_pept        complement(588192..589406)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0594"
FT                   /product="Coenzyme F390 synthetase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0594"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00454"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:B9KPG1"
FT                   /protein_id="ACM00454.1"
FT                   /translation="MTHYDDLETRSADARAADLARSLPRLIAHAKTTPALGQSLAGVDP
FT                   TSVTSIEALASLPVIRKSDLVAAQKTHPPLGGFLPEGGAFEHIFQSPGPIYEIGRTTPD
FT                   WWRMGRFLHACGVGPADIVQNCFGYHLTPAGMIFESGARAVGARVLPAGTGQTDLQVRA
FT                   AADVGSTAYAGTPDYLKVILDRAEEMGERLGIVRAAVGGGALFPSLRKDYADRGILCLQ
FT                   CYATADLGNIAYESEAMEGMIIDEGVLVEIVRPGTGDPVPEGEVGEVVVTTLNRDYPLV
FT                   RFATGDLSALMPGQSPCGRTNRRIRGWMGRADQTTKIKGMFVRPEQVADLVARHSEVSR
FT                   ARVIATREGEMDAMTVQIESRATNPAVYEASVLAALKLRGRIEIVTPGTLPNDGKVIED
FT                   RRTYG"
FT   gene            complement(589421..590251)
FT                   /locus_tag="RSKD131_0595"
FT   CDS_pept        complement(589421..590251)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0595"
FT                   /product="ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0595"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00455"
FT                   /db_xref="GOA:B9KPG2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B9KPG2"
FT                   /protein_id="ACM00455.1"
FT                   /translation="MFDDRPSPRTDTLLEVNNIEVIYNHVILVLKGVSLQVPKGGVTAL
FT                   LGGNGAGKTTTLKAISNLLRSERGEVTKGAILYRGERVQDLDPATLVRRGVIQVMEGRH
FT                   CFEHLTVEENLLTGAYTRKDGRAAVMEDLEMVYTYFPRLRERRKSQAGYTSGGEQQMVA
FT                   MGRALMSRPEMILLDEPSMGLAPQLVEQIFEIVRAVNEGEGVTFLLAEQNTNVALRYAH
FT                   TGYILESGRVVMEGTAQELRENPDVKEFYLGMSDKGRKSFRDVRSYRRRKRWLA"
FT   gene            complement(590338..591627)
FT                   /locus_tag="RSKD131_0596"
FT   CDS_pept        complement(590338..591627)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0596"
FT                   /product="ABC branched amino acid transporter family,
FT                   periplasmic substrate-binding subunit precursor"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0596"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00456"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:B9KPG3"
FT                   /protein_id="ACM00456.1"
FT                   /translation="MRKSFTLLAATALAAATAGAAQADLVVPNLSYRTGPFAAGGIPYA
FT                   DGFQDYFTLLNERDGGIGGEIVKTPECETAYNTEKGVECYEATKGQGALVYNPLSTGIT
FT                   YQLIPKMQADGITLYTPGYGRTSAANGRVFEWVFNYPANYWDGASVAVKYLLDQNGGSL
FT                   EGKKIALLYHNSAYGKEPIRTLEELSKKHGFTLSTLPIDSPGQEQKSQWLQVRREKPDY
FT                   VLFWGWGVMNSVAIQEAANIRFPMENFIGIWWSGSENDVAPAGAGANGYKSLTMHGVGS
FT                   DYPVYADLKQYVVDAGKAAGDGSNVGTVIYSRGMYAAMVIAEAIRKAQELAGTPAVNAA
FT                   QVRDGFEALEITEARMKELGLPDFGQPFKATCADHGGPGMARIQQWDASAKRWTLVTDW
FT                   IAPDDAVLDPLVAEDSAAYAKEAGLSERCN"
FT   gene            complement(591688..592764)
FT                   /locus_tag="RSKD131_0597"
FT   CDS_pept        complement(591688..592764)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0597"
FT                   /product="Inner-membrane translocator"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0597"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00457"
FT                   /db_xref="GOA:B9KPG4"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:B9KPG4"
FT                   /protein_id="ACM00457.1"
FT                   /translation="MLYREAGEFKTSYAQDSQTFPIWWDRLWYQVALVVGFAILPFVIN
FT                   DYWANAVVVPFLIYAIAAIGLNILTGYCGQVSLGTGGFMAVGAYAVYKLMTAFPDVPIL
FT                   IHVILAGAITAGVGVLFGLPSLRIKGFYLAVATLAAQFFLVWLFNKVPWFYNYSASGQI
FT                   TAPERTMFGIAVTGANTPAWAKYLFCAAFLFALAWIARNLTRGTIGRKWMAIRDMDIAA
FT                   EIIGVNPLTTKLSAFAVSSFFIGIAGALFFAVYLGAAEVGEAFGIQKSFLILFMIIIGG
FT                   LGSIFGSFAGAAFLVLLPVFLKNVLVGGLGWPSDLAAHIELMIVGALIIGFLILEPHGL
FT                   AQLWRVLKEKLRLWPFPH"
FT   gene            complement(592768..593757)
FT                   /locus_tag="RSKD131_0598"
FT   CDS_pept        complement(592768..593757)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0598"
FT                   /product="Inner-membrane translocator"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0598"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00458"
FT                   /db_xref="GOA:B9KPG5"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:B9KPG5"
FT                   /protein_id="ACM00458.1"
FT                   /translation="MLPDQLVFAMEVTLNGLMAGVMYALVALGFVLIFKASGIFNYAQG
FT                   VLALFAALTLVGLQNGQIPFAHLINAAFGTNLHSFGWTLPAALAIALTALVMVGLAWAI
FT                   ERLILKHLVNQEPIILFMATIGLAYFLEGLGDVMWGADIKMLDVGLPQGISEGIEAVTA
FT                   EWFGYGFFIDRLDIVATLVAAALVAALTLFSQYTKYGRALRAVADDHQAALSVGISLRF
FT                   VWVLVWSIAGFVALIAGIMWGAKSGVQFSLSLIALKALPVLMLGGFTSIPGAIVGGLII
FT                   GMGEKLFEFFAGPLIGGATENWFAYVLALLFLVFRPQGLFGERIIERV"
FT   gene            complement(593901..594725)
FT                   /locus_tag="RSKD131_0599"
FT   CDS_pept        complement(593901..594725)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0599"
FT                   /product="ABC branched amino acid transporter family,
FT                   ATPase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0599"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00459"
FT                   /db_xref="GOA:B9KPG6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032823"
FT                   /db_xref="UniProtKB/TrEMBL:B9KPG6"
FT                   /protein_id="ACM00459.1"
FT                   /translation="MNALDVTMDETGADERRIGGVLMEMKNITLRFGGVKAITDISFDI
FT                   REGEIRAIIGPNGAGKSSMLNVISGFYVPQEGEVWFRGKRRPQMKPYEVAQQGIARTFQ
FT                   NIALFEGMSVLDNIMTGRLTLMKTGLWSQALWWGRAQAEEVEHRARVERIIDFLEIQHI
FT                   RKTPVGRLPYGLKKRVELARALATEPKLLLLDEPMAGMNVEEKEDMCRFILDTNDEFGT
FT                   TIALIEHDMGVVMDLSDRVVVMDYGKKIGDGTPDEIRSNKAVIDAYLGVQHD"
FT   gene            complement(594722..596683)
FT                   /locus_tag="RSKD131_0600"
FT   CDS_pept        complement(594722..596683)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0600"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0600"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00460"
FT                   /db_xref="GOA:B9KPG7"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:B9KPG7"
FT                   /protein_id="ACM00460.1"
FT                   /translation="MAETGDLVSIPALLHRNAAAFPRQPAYREKEFGIWQVWSWAEAAS
FT                   EIRAIALGFLALGLQRGDHVAVVGRNRPALYWSMVAAQMCGAVPVPLYQDAVAEEMVYV
FT                   LDHCGARFVICGDQEQVDKVIEVQDRIHHIEQVVYVDKRGMRKYDHSRMNWLEDVVAEG
FT                   RAAHRRFDEELDRRIAELDYDSTCVMLYTSGTTGKPKGVVLSNRNIIETSKNSVAFDGL
FT                   RPGDEVLAYLPMAWVGDFIFSVGQAMWTGFCVNCPESATTMMNDLREIGPTYFFAPPRV
FT                   FEGQLTNVMIRMEDAGRIKKALFRHYMEVARRVGPAILDGRSVSTADRIAYWIGDKLIY
FT                   GPLKNTLGFSRVRVGYTAGEAIGPEIFDFYRSLGINLKQLYGQTEASVFITQQPDGQVR
FT                   SDTVGVPSPGVEVRIAETGEVFYRSPGTFVAYYKNPESTASTKDAEGWVATGDAGFFEE
FT                   ATGHLRIIDRAKDVGKMADGRLFAPKYVENKLKFYPSILEAVVFGNGRERCTAFLNIDL
FT                   AAVGNWAERNNIAYSSYQELAGHPKVYDMMKGHVEEVNRSIAEDPMLSGCQIHRFLILH
FT                   KELDADDGEMTRTRKVRRKVIEEKYHDLIAALYDGRTSIYTETEVTYEDGRKGAIRATL
FT                   RIEDAATHGASAQRMAAE"
FT   gene            596789..597289
FT                   /locus_tag="RSKD131_0601"
FT   CDS_pept        596789..597289
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0601"
FT                   /product="Hypothetical Protein"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0601"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00461"
FT                   /db_xref="UniProtKB/TrEMBL:B9KPG8"
FT                   /protein_id="ACM00461.1"
FT                   /translation="MRDFFAILANCNRPRGPRRPRSRRLAAPPPCGPPPPAGQAASRRL
FT                   RLFRRLPGHELSASQLIRFRDIARAPSDGRDRPPGSVRGSAGCGGSMPPQPAPPSSPSS
FT                   PSSPSSPSSPSSPSSPSSPSSPSSPSSPSSPSSPSSPSNPLHSPPVSPSANRSRRGPAP
FT                   GAE"
FT   gene            597366..599288
FT                   /locus_tag="RSKD131_0602"
FT   CDS_pept        597366..599288
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0602"
FT                   /product="Sensor protein"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0602"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00462"
FT                   /db_xref="GOA:B9KPG9"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B9KPG9"
FT                   /protein_id="ACM00462.1"
FT                   /translation="MPERDEPLEPLTRAGLNLIQQALSIYDSDLKLAVWNRRFREMFDL
FT                   PERLASSGADFTETIRYLVERGEYGPVEDAEEAVRIRVAAARTFQPHYMERERPSGRWI
FT                   SVEGAPLPQGGWVTVYTDITEIKLQESLLRARSEVLSGEVLAHAERLAQANRALAATNA
FT                   ALEEAQRELTEMEARTRLTTEMMPAHIAHVGRDLRYTYSNRRLSQVIPGRPSDILGLSG
FT                   REALGEGLFARIRPCLLRALDGEASVLEFSDEDSGSRIRAAFTPDRTGCGPINGVYILS
FT                   MDVTAETQAREALIQTRKRELTAQLTSGLAHDFANLLTVILGLQGRLERMDLPEEGRQL
FT                   VAATVAAARRGGGLLDQIASISGKRALKPTVTELARFLADLRLMAGPTLPEGVALEIVM
FT                   PEPIPPVMLDAGGLQDAALNLILNARDAIGPAGGTIRLTARPVRDAWIEILVEDDGPGF
FT                   TEAALERALDPFFTTKGGMGSGLGLSMVYDQIKLAGGTVRLGNRPGGGAAVQLRLPLRR
FT                   ADEAVPPMLVLLVEDDPDIRETVRGMLCAGGHSVIEAASADEALTLLDLPGVGLVLSDV
FT                   NLPGRLSGLDLAEALAGRGGAARLVLMTSLPAGDARRARAETLAPVLAKPFDAADLAAC
FT                   LGASA"
FT   gene            599285..599992
FT                   /locus_tag="RSKD131_0603"
FT   CDS_pept        599285..599992
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0603"
FT                   /product="Two component transcriptional regulator, winged
FT                   helix family"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0603"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00463"
FT                   /db_xref="GOA:B9KPH0"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:B9KPH0"
FT                   /protein_id="ACM00463.1"
FT                   /translation="MSRAPLVAILDDEPEIRRMLALALEEAGFQTTAFGRATEFEAALK
FT                   RRAPDVCLVDLGLPDRDGLAVVHRLALESGAAIIIVSGRAQVQDRVTGLELGADDYIIK
FT                   PFDPAEVVARVRARLRKGRAESLPATQTAHFSGWTAHFDRYLLVACDGAEVAFSHAEGE
FT                   VLRLFLESPRRLISRAQMQESLGGAAGESFDRAMDVRISRLRTKLGEDPRNPTLIKTIY
FT                   GAGYIFLGEVEWR"
FT   gene            complement(600003..601181)
FT                   /locus_tag="RSKD131_0604"
FT   CDS_pept        complement(600003..601181)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0604"
FT                   /product="Chromate transporter, chromate ion transporter
FT                   (CHR) family"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0604"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00464"
FT                   /db_xref="GOA:B9KPH1"
FT                   /db_xref="InterPro:IPR003370"
FT                   /db_xref="InterPro:IPR014047"
FT                   /db_xref="UniProtKB/TrEMBL:B9KPH1"
FT                   /protein_id="ACM00464.1"
FT                   /translation="MHSDNGGRAAEVFLAFLRLGLTSFGGPVAHLGYFRAELVERRRWM
FT                   DDRAYADLVALCQFLPGPASSQVGFAMGLHRAGPGGALAAWAGFTLPSALLMAGFGLAA
FT                   GQIAHPAALGALAGLKVVAVAIVAQAVWGMAASLCPDRERASLAAAAAALAVLVPGASG
FT                   QIGAILLGALAGLWIARDTAPAATDGGAGPPLLSRRAGIACLAACAALLVVLPLLSGLS
FT                   PLLALADGMARAGALVFGGGHVVLPLLEAETVRAGLVTPDAFLAGYGAAQAMPGPLFTF
FT                   AAHLGAVAAGPFGAAVALVAIFAPGLLLLCGALPFWDRLRRMPRAQRAMRGANAAVVGL
FT                   LGAALWDPVFTAGVTGPLPFALALAGFVLLTQWRTPPLWIVLAGAGLGAAFL"
FT   gene            601209..601544
FT                   /locus_tag="RSKD131_0605"
FT   CDS_pept        601209..601544
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0605"
FT                   /product="Hypothetical Protein"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0605"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00465"
FT                   /db_xref="UniProtKB/TrEMBL:B9KPH2"
FT                   /protein_id="ACM00465.1"
FT                   /translation="MGASCLEGKGKGKGKGKGKGKGKGKGKGKGKGKGKGKGKGKGKGK
FT                   GKGKGKGKGKGKGKGKGKGKGTEPHGERWRGRGAGAVDTRSGACISAHPRAIGPGFSLV
FT                   LVAPARG"
FT   gene            601602..602222
FT                   /locus_tag="RSKD131_0606"
FT   CDS_pept        601602..602222
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0606"
FT                   /product="30S ribosomal protein S4"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0606"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00466"
FT                   /db_xref="GOA:B9KPH3"
FT                   /db_xref="InterPro:IPR001912"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR005709"
FT                   /db_xref="InterPro:IPR018079"
FT                   /db_xref="InterPro:IPR022801"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9KPH3"
FT                   /protein_id="ACM00466.1"
FT                   /translation="MTKRTSAKYKIDRRMGENIWGRPKSPVNKREYGPGQHGQRRKNKL
FT                   SDFGTQLRAKQKLKGYYGDLTEKQFRKIFAEAERVKGDTGEMLVGLLERRLDAIVYRAK
FT                   FVPTIFAARQFVNHGHVTVNGQRVNIGSYRCKEGDVIQVREKSRQLALVLEATQLAERD
FT                   VPDYIEVDYSKMTATFVRTPGLGDVPYPVQMEPNLVVEFYAKN"
FT   gene            602467..603552
FT                   /locus_tag="RSKD131_0607"
FT   CDS_pept        602467..603552
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0607"
FT                   /product="Histidinol-phosphate aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0607"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00467"
FT                   /db_xref="GOA:B9KPH4"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR005861"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9KPH4"
FT                   /protein_id="ACM00467.1"
FT                   /translation="MSDAIRPQPGILDIALYEGGKSHVAGIQNALKLSSNENPFGPSPK
FT                   AKEAFLRSVHTLHRYPSTDHAGLRHAIAEVHGLDPARVICGVGSDEIITFLCQAYAGPH
FT                   TDVVFTEHGFLMYRISALAVGANPVEVPERERTTDVDAILAACTPHTRLVFLANPNNPT
FT                   GTMIGQADLARLAAGLPAQAILVLDGAYAEYVPGYDAGLALIEERGNVVMTRTFSKIYG
FT                   LGGLRVGWGYGPKSIIDVLNRIRGPFNLSTTQLETAEAAVRDQDHVARCRADNARWRIW
FT                   LAEALAEIGVPSDTSMANFILARFSDTEEAEACDLHLQTQGLIVRRVAGYKLPHCLRIT
FT                   IGDEASCRRVAHAIGQFKRMR"
FT   gene            603552..604487
FT                   /locus_tag="RSKD131_0608"
FT   CDS_pept        603552..604487
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0608"
FT                   /product="Prephenate dehydrogenase precursor"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0608"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00468"
FT                   /db_xref="GOA:B9KPH5"
FT                   /db_xref="InterPro:IPR003099"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B9KPH5"
FT                   /protein_id="ACM00468.1"
FT                   /translation="MALYERVALIGLGLIASSMAHAIRAAGLATEITGHARSAETRAAA
FT                   VEIGLCDRVFETAAEAVAGADLVVLAVPVGAMGAIAAEIAPHLAPGATVTDVGSVKQAV
FT                   ITAVAPHVPEGVHFVPGHPLAGTEHSGPRSGFATLFRNRWWLLTPPEGADPEAVARLRA
FT                   LCEGMGANVEEMDAAHHDLVLAVTSHTPHLIAYTMVGVADHLRRVTQSEIIRYSAAGFR
FT                   DFTRIAASDPTMWRDVFLTNKEATLDILGRFTEELFALQRAIRLGDGDHLFEYFTRTRA
FT                   IRRGIIEAGQDTAAPDFGRAAEAGKGTEKG"
FT   gene            604493..605356
FT                   /locus_tag="RSKD131_0609"
FT   CDS_pept        604493..605356
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0609"
FT                   /product="Extensin family protein precursor"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0609"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00469"
FT                   /db_xref="InterPro:IPR009683"
FT                   /db_xref="UniProtKB/TrEMBL:B9KPH6"
FT                   /protein_id="ACM00469.1"
FT                   /translation="MQAFGALVLVTGLMAGTAFADAPQTSPRPAPRTVAVVLVAAAPDS
FT                   AAPAEALRPRARPAVKLAAVAAAEPAMSFLAPARPEPARKGFLGSLFRPKARPPETVVK
FT                   AAAVRTLPGSAMVQTRRGSVCGDPTIRGATLAPISGKLRGCGIAEPVQVTSIDGVALSM
FT                   AATMDCGTARALKSWINRGLRPNVPAEVVKLQIAGAYTCRSRNNQRGAPVSEHGRGKAV
FT                   DVSGFTLANGKSVSIARDYHREKMIRASHKAACGIFGTTLGPGSDGFHEDHLHFDTVAR
FT                   RTPYCR"
FT   gene            complement(605359..606354)
FT                   /locus_tag="RSKD131_0610"
FT   CDS_pept        complement(605359..606354)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0610"
FT                   /product="Hypothetical Protein"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0610"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00470"
FT                   /db_xref="InterPro:IPR018666"
FT                   /db_xref="UniProtKB/TrEMBL:B9KPH7"
FT                   /protein_id="ACM00470.1"
FT                   /translation="MRKLLGLVLVLALLWGGWWVAGSALVRQAAEAFFAQQRAAGRLAE
FT                   HEGLSVRGFPNRFDLTVEKIRLADPATGLAWRAPFVQLFAMSWKPWHLIAALPPEQEID
FT                   LDGQTVTLNASALRASLIVSPSATLPLDRTASAGQALVLRSSAGWSVRLDEAQLATRRM
FT                   GDDATRHEIGLDLTGVAPEGAFAAAAERAGLPPRLSQLRLLAEAGFSAPIDRELGTSRP
FT                   QLRSLTLRESQLDWGSLQLTGSGELTFDASGMPEGRIDLALGNWRQAIRAAAELGYLEA
FT                   ESVPAWERGLGIFAARSGGEKLQVPLNFSKGWMSLGPLPLGPAPRLGPAG"
FT   gene            606415..606963
FT                   /locus_tag="RSKD131_0611"
FT   CDS_pept        606415..606963
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0611"
FT                   /product="ChaC family protein"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0611"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00471"
FT                   /db_xref="GOA:B9KPH8"
FT                   /db_xref="InterPro:IPR006840"
FT                   /db_xref="InterPro:IPR013024"
FT                   /db_xref="InterPro:IPR036568"
FT                   /db_xref="UniProtKB/TrEMBL:B9KPH8"
FT                   /protein_id="ACM00471.1"
FT                   /translation="MEPPLWVFGYGSLIWDPGFPVARSVIARLDGWHRSFCMHSIHYRG
FT                   TATDPGLVLALDAAPGRACLGVGFQVTPGAEAETLAALRKRELISNAYLERWLPVTLAT
FT                   GETVEAVSYVIDPDHGQYCGGLDLEAQAQIIARAAGERGPNRDYLLHTVAHLHSLGISD
FT                   PDLCWLATRVRALGNDPVS"
FT   gene            607037..608212
FT                   /locus_tag="RSKD131_0612"
FT   CDS_pept        607037..608212
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0612"
FT                   /product="Hypothetical Protein"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0612"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00472"
FT                   /db_xref="GOA:B9KPH9"
FT                   /db_xref="UniProtKB/TrEMBL:B9KPH9"
FT                   /protein_id="ACM00472.1"
FT                   /translation="MPRTAVEAEPHFTQPVRQIVMMLVVVALVGVGAIVAFATLQKIYE
FT                   SNPYLNALIGFVFLLGVTTCFLQMVQLMQSVSWIENFVKDRPGFDYVLAPRLLAPLAAL
FT                   LRTRGKRMQISSTSSRSILDSVGTRLDEARDITHYLASLLIFLGLLGTFYGLATTVPGL
FT                   VQTIRALAPQEGQSGLELFGQLMEGFEGQLGGMGTAFSSSLLGLAGSLVVGLLELFASH
FT                   GQNRFYRQLEEWLSSFTRLTPAGAEGEGGDISLVAGVLEQMVQQMDRLQELQAQADLSR
FT                   SMVDARMADLAGAVQTLAERIEAQSDGNAQLFERVAAGQERLVTALTGAEASAFADAEA
FT                   RMRLRSIDVQLLRILEEIAAGRQESTSDLRSDLAALTGAVRQLSRTAAARS"
FT   gene            608216..609793
FT                   /locus_tag="RSKD131_0613"
FT   CDS_pept        608216..609793
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0613"
FT                   /product="OmpA/MotB domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0613"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00473"
FT                   /db_xref="GOA:B9KPI0"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="UniProtKB/TrEMBL:B9KPI0"
FT                   /protein_id="ACM00473.1"
FT                   /translation="MGLVRRGGRREVNIWPGFVDAMTALLLVLMFVLTIFLAIQSLLRE
FT                   TITTQDSELDSLTGQLADLADALGLERQKSADLTAAVDAARAEGERQAATIATLTATLS
FT                   AREGELAAAQGRIASFEEQVATLLADRDRARGETARLTASVEELEAARKTLLSEQEAAQ
FT                   LALAQARSEIDAQTEAARLAAARREALDALVAELRGKVSETEKKLSDEEAARLADATAA
FT                   EALRERLKNSDTELTAMTLALEEQRRKAEETLTLLAAAKTDAARAVSEADQRAAALTAA
FT                   REALNAREGEGAEAARRVALLNEQVAALRAQLGSLQGLLEAAEAQDAANKVQLQSLGTQ
FT                   LNSALAQVASEQKRRAELEEAERLRLEAENKDLARFRSEFFGQLRQVLAGREGVRVVGD
FT                   RFVFSSEVLFEPGSAELAPEGRAQISGVVQTLNEIRTQIPEGIDWIIRVDGHTDNVPLS
FT                   GFGAFRDNWELSSARALSVVRFMQQSLGFPPSRLAATGFGEYRPVTPGDSADARAQNRR
FT                   IELKLTER"
FT   gene            complement(610374..612689)
FT                   /locus_tag="RSKD131_0614"
FT   CDS_pept        complement(610374..612689)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0614"
FT                   /product="ATP-dependent Clp protease, ATP-binding subunit
FT                   clpA"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0614"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00474"
FT                   /db_xref="GOA:B9KPI1"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004176"
FT                   /db_xref="InterPro:IPR013461"
FT                   /db_xref="InterPro:IPR018368"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028299"
FT                   /db_xref="InterPro:IPR036628"
FT                   /db_xref="InterPro:IPR041546"
FT                   /db_xref="UniProtKB/TrEMBL:B9KPI1"
FT                   /protein_id="ACM00474.1"
FT                   /translation="MPSFSTTLEQAIHGALALANARRHELATLEHLLLALIDEPDASRV
FT                   MKACSVDLDELRKTLVDFIDDDLSTLVTSVEGSEAVPTAAFQRVIQRAAIHVQSSGRTE
FT                   VTGANVLVAIFAERESNAAYFLQEQDMTRYDAVNFIAHGVAKDPSYGEPRPVTGAEEHH
FT                   ETPKAEAGEAKESALSKYCVDLNVKARKGDVDPLIGREHEVERCIQVLCRRRKNNPLLV
FT                   GDPGVGKTAIAEGLARKIVNGETPDILARATIFSLDMGALLAGTRYRGDFEERLKAVVK
FT                   EMEDHPDAILFIDEIHTVIGAGATSGGAMDASNLLKPALQGGKLRCMGSTTYKEYRQHF
FT                   EKDRALSRRFQKIDVNEPSVEDTVKILMGLKPYFEEHHDLRYTQDAIRTAVELSARYIH
FT                   DRKLPDKAIDVIDEAGAAQHLLADSKRRKTIGPREIEAVVAKIARIPPKSVSKDDAEVL
FT                   RDLEKTLKRVVFGQDRAIEALSSAIKLARAGLREPEKPIGNYLFAGPTGVGKTEVAKQL
FT                   ASILGVELLRFDMSEYMEKHAVSRLIGAPPGYVGFDQGGMLTDGVDQHPHCVLLLDEIE
FT                   KAHPDVYNILLQVMDHGKLTDHNGRSVDFRNVILIMTSNAGAAELAKSAIGFGRDRREG
FT                   EDTAAIERTFTPEFRNRLDAVISFAPLGKEIILQVVEKFVLQLEAQLMDRGVHIELSPE
FT                   AAAWLGDKGYDDKMGARPLGRVIQENIKKPLAEELLFGRLVKGGLVKVGVKDDTIDLQI
FT                   EEPKPRLTGSKPPLLTAD"
FT   gene            complement(612856..613623)
FT                   /locus_tag="RSKD131_0615"
FT   CDS_pept        complement(612856..613623)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0615"
FT                   /product="Hydroxyacylglutathione hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0615"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00475"
FT                   /db_xref="GOA:B9KPI2"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR017782"
FT                   /db_xref="InterPro:IPR032282"
FT                   /db_xref="InterPro:IPR035680"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:B9KPI2"
FT                   /protein_id="ACM00475.1"
FT                   /translation="MPLELVTVPCLSDNYAFLVHDAGTGETSVVDVPEAGPILKALEER
FT                   GWHLSQILLTHHHSDHVAGVEELRAATGARVAGAAADAHRLPPLDLELAEGDLVRVGAS
FT                   EGRVIEVPGHTVGHIAFHFPDSSLAFTGDSLMAMGCGRLFEGTAEAMWQSLRKLSALPP
FT                   ETMICSGHEYAASNARFAATLEPDSPMLIFRVGSIAAARKEGRPTVPSHLSDEIATNPF
FT                   LRAGEASLKAAVGMVDAEDAEVFAEIRRRKDKF"
FT   gene            613685..614473
FT                   /locus_tag="RSKD131_0616"
FT   CDS_pept        613685..614473
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0616"
FT                   /product="Hypothetical Protein"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0616"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00476"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B9KPI3"
FT                   /protein_id="ACM00476.1"
FT                   /translation="MHLDVLDLHNFYYRTPLGRVAQRAVRDQVQKLWPDAQGQTVAGFG
FT                   FSVPLLRPYLEQARRLIALMPGPQGVMPWPVGMGNVSVLCEEGAWPLSTGMVDKLVMLH
FT                   GLETSEHPSEVLSEAWRVLGPGGRALFIVPSRSGLWARRDGTPFGFGRPYSLNQLEAQL
FT                   KRHDFTPERALAALFAPPLHQRFWLKTADFWETGGRRFAPWLVGGVLIVEASKQVYAPT
FT                   RTGLKAAVSKPLRVLEGIPQPLPAPAGRTSDGSCGCPGGC"
FT   gene            complement(614635..614757)
FT                   /locus_tag="RSKD131_0617"
FT   CDS_pept        complement(614635..614757)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0617"
FT                   /product="Hypothetical Protein"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0617"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00477"
FT                   /db_xref="UniProtKB/TrEMBL:B9KPI4"
FT                   /protein_id="ACM00477.1"
FT                   /translation="MASGAEGGPAGQRHCMARGNLPARLKFRGGCSRGLAASQP"
FT   gene            614776..615336
FT                   /locus_tag="RSKD131_0618"
FT   CDS_pept        614776..615336
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0618"
FT                   /product="ATP synthase F1, delta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0618"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00478"
FT                   /db_xref="GOA:B9KPI5"
FT                   /db_xref="InterPro:IPR000711"
FT                   /db_xref="InterPro:IPR020781"
FT                   /db_xref="InterPro:IPR026015"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9KPI5"
FT                   /protein_id="ACM00478.1"
FT                   /translation="MSEPASISSGIAARYAAAVFELAKDEGALPALEKDMDALGAAWSE
FT                   SADLRDLATSPVYAREEQQKAIAAVAAKMGLSTVTANTLALMGSKRRLFVLPQMVADVQ
FT                   NRIATEKGEITAEVTAAAPLSPEQAARLAATLKARAGKDVKLKTTVDESLIGGLVVKLG
FT                   SSMIDTSVKARLAALQNAMKEVG"
FT   gene            615337..616875
FT                   /locus_tag="RSKD131_0619"
FT   CDS_pept        615337..616875
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0619"
FT                   /product="ATP synthase subunit alpha"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0619"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00479"
FT                   /db_xref="GOA:B9KPI6"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR000793"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005294"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR023366"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033732"
FT                   /db_xref="InterPro:IPR036121"
FT                   /db_xref="InterPro:IPR038376"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9KPI6"
FT                   /protein_id="ACM00479.1"
FT                   /translation="MGIQAAEISAILKEQIKNFGQQAEVAEVGRVLSVGDGIARVHGLD
FT                   NVQAGEMVEFPGGIRGMALNLEVDNVGVVIFGDDRSIKEGDTVKRTKSIVDVPAGDALL
FT                   GRVVDGLGNPIDGKGPIAATERRVADVKAPGIIPRKGVHEPMATGLKSVDAMIPIGRGQ
FT                   RELIIGDRQTGKTAIALDTILNQKSYNEAAGDDESKKLYCIYVAIGQKRSTVAQLVKKL
FT                   EETGAIDYTLVVAATASDPAPMQFLAPYAATAMAEYFRDNGRHALIIYDDLSKQAVAYR
FT                   QMSLLLRRPPGREAYPGDVFYLHSRLLERSAKLNKDHGAGSLTALPIIETQGGDVSAFI
FT                   PTNVISITDGQIFLETELFYQGIRPAVNTGLSVSRVGSSAQTDAMKSVAGPVKLELAQY
FT                   REMAAFAQFGSDLDAATQQLLNRGARLTELMKQPQYAPLTNAEIVCVIFAGTKGYLDKV
FT                   PVKDVGRWEQGLLKHLRTNAKDLLADITNNDRKVKGELEDKIRAALDTYAKDFA"
FT   gene            616898..617767
FT                   /locus_tag="RSKD131_0620"
FT   CDS_pept        616898..617767
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0620"
FT                   /product="ATP synthase gamma chain"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0620"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00480"
FT                   /db_xref="GOA:B9KPI7"
FT                   /db_xref="InterPro:IPR000131"
FT                   /db_xref="InterPro:IPR023632"
FT                   /db_xref="InterPro:IPR035968"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9KPI7"
FT                   /protein_id="ACM00480.1"
FT                   /translation="MPSLKDLKNRIGSVKNTRKITKAMQMVAAAKLRRAQEAAEAARPF
FT                   AERMTAVMTGLAGSVGSSESAPRLLAGTGSDKVHLLVVMTAERGLCGGFNSSIVRLARA
FT                   HAAKLLTQGKTVKILTVGKKGREQLRRDLGQHFIGHVDLSEVKRMGYPVAQGIARDLLD
FT                   RFDKGEFDVATIFFARFQSVISQVPTAQQVIPAVFEGEGEVSSLYDYEPSEEGVLADLL
FT                   PRGVATQIFTALLENGASEQGARMSAMDNATRNAGDMINRLTIEYNRSRQAAITKELIE
FT                   IISGAEAL"
FT   gene            617785..619212
FT                   /locus_tag="RSKD131_0621"
FT   CDS_pept        617785..619212
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0621"
FT                   /product="ATP synthase subunit beta"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0621"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00481"
FT                   /db_xref="GOA:B9KPI8"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005722"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR024034"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036121"
FT                   /db_xref="UniProtKB/TrEMBL:B9KPI8"
FT                   /protein_id="ACM00481.1"
FT                   /translation="MATASQGKVTQVIGAVVDVQFDGGLPPILNALETENNGKRLVLEV
FT                   AQHLGESTVRTIAMDATEGLVRGARVTDTGSPISVPVGDATLGRILNVIGEPIDEKGDL
FT                   GEASTRAIHQPAPTFAEQSTTSEILVTGIKVIDLLAPYSKGGKIGLFGGAGVGKTVLIM
FT                   ELINNIAKVHSGYSVFAGVGERTREGNDLYHEMIESGVIKIDNLSESKVALVYGQMNEP
FT                   PGARARVALTGLTLAEQFRDQSGTDVLFFVDNIFRFTQAGSEVSALLGRIPSAVGYQPT
FT                   LATDMGALQERITSTKAGSITSVQAIYVPADDLTDPAPATSFAHLDATTVLSRAISELG
FT                   IYPAVDPLDSTSRILDPQIVGEEHYNVARAVQGILQRYKSLQDIIAILGMDELSEEDKL
FT                   SVARARKIQRFLSQPFDVAKVFTGSDGVQVPLEKTIASFKAVVNGEYDHLPEAAFYMVG
FT                   DIEDVIAKAQRLAAQAA"
FT   gene            619222..619620
FT                   /locus_tag="RSKD131_0622"
FT   CDS_pept        619222..619620
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0622"
FT                   /product="ATP synthase epsilon chain 1"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0622"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00482"
FT                   /db_xref="GOA:B9KPI9"
FT                   /db_xref="InterPro:IPR001469"
FT                   /db_xref="InterPro:IPR020546"
FT                   /db_xref="InterPro:IPR036771"
FT                   /db_xref="UniProtKB/TrEMBL:B9KPI9"
FT                   /protein_id="ACM00482.1"
FT                   /translation="MAGTLQFDLVSPERRLASFAATEVQVPGTDGDMTAMEGHAPTITT
FT                   LRPGILRAHGPSGVQAYAVTGGFAEINATSISVLAEKAVAVEELTGTVLDEFIAEAREL
FT                   ASVALPEDRDMAERTLNDMLALKASSGH"
FT   gene            complement(620094..621104)
FT                   /locus_tag="RSKD131_0623"
FT   CDS_pept        complement(620094..621104)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0623"
FT                   /product="Ribose-phosphate pyrophosphokinase"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0623"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00483"
FT                   /db_xref="GOA:B9KPJ0"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR000842"
FT                   /db_xref="InterPro:IPR005946"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR029099"
FT                   /db_xref="InterPro:IPR037515"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9KPJ0"
FT                   /protein_id="ACM00483.1"
FT                   /translation="MNEPKLISGNANLTLAKSIARRMSVHRGMAVSLVDARVERFNDQE
FT                   IFVEVYENVRGEDMYVIQPTSNPANDNLMELLIIADALRRSSADRITAVIPYFGYARQD
FT                   RRAKARTPISAKLVANLIVEAGIDRVLTLDLHAAQIQGFFDIPVDNLYSAPVFALDIEH
FT                   HFKGQLQDLMVVSPDVGGVARAREIAKRINAPLAIVDKRREKPGEIAEMTVIGNVAGKK
FT                   CIIVDDICDTAGTLCKAAEVLIENGAVEVHSYITHGVLSGPAVERVTKSVMKSLVITDS
FT                   IEPSAAVRGAPNIRIVPTAPMFAQAILNIWSGTSVSSLFETDTLVPIYEGMYQRG"
FT   gene            complement(621245..622270)
FT                   /locus_tag="RSKD131_0624"
FT   CDS_pept        complement(621245..622270)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0624"
FT                   /product="L-threonine aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0624"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00484"
FT                   /db_xref="GOA:B9KPJ1"
FT                   /db_xref="InterPro:IPR001597"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR026273"
FT                   /db_xref="UniProtKB/TrEMBL:B9KPJ1"
FT                   /protein_id="ACM00484.1"
FT                   /translation="MFFASDNGSGVAPEVMAALAADRGYARAYGADEATEEVTALVRTE
FT                   FEAPEAEVVLVASGTAANALALSTICPPWGVVYCREEAHVAADECNAAEFFSGGAKLET
FT                   LPGSDGKLRPETLAAALSRYAPGDLHMARPAALSLTNLTEMGSLYRPAEIAALTEVARA
FT                   RGLGCHLDGARFANALVAAGAAPAEMSWQAGIDILSLGGTKNGLMGVEAVVIFDPASAE
FT                   ELRIRRKRAGHLLSKHRYLALQMRTYLRDGLWLRLAAQANAAGKRLAEGVAALPEARLL
FT                   GPVEANLLFAELPEPLVRRAREAGAVFYEMGRTGDRVTVRLVASWSTTETEVEAFLATF
FT                   G"
FT   gene            complement(622270..622674)
FT                   /locus_tag="RSKD131_0625"
FT   CDS_pept        complement(622270..622674)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0625"
FT                   /product="Hypothetical Protein"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0625"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00485"
FT                   /db_xref="InterPro:IPR005358"
FT                   /db_xref="InterPro:IPR008228"
FT                   /db_xref="UniProtKB/TrEMBL:B9KPJ2"
FT                   /protein_id="ACM00485.1"
FT                   /translation="MTPSEWEALCDGCGKCCLNKIEFEDTGEVAFTRIACRLLDGDSCR
FT                   CSNYEIRRQFVPDCVQLSPATLPKIAYWMPRTCAYRLLHEGKPLHGWHYLLTGDRNSVH
FT                   DAGASVQGWTVPEFEVAEEDWEDHIIEETP"
FT   gene            complement(622771..623691)
FT                   /locus_tag="RSKD131_0626"
FT   CDS_pept        complement(622771..623691)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0626"
FT                   /product="Riboflavin kinase / FMN adenylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0626"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00486"
FT                   /db_xref="GOA:B9KPJ3"
FT                   /db_xref="InterPro:IPR002606"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015864"
FT                   /db_xref="InterPro:IPR015865"
FT                   /db_xref="InterPro:IPR023465"
FT                   /db_xref="InterPro:IPR023468"
FT                   /db_xref="UniProtKB/TrEMBL:B9KPJ3"
FT                   /protein_id="ACM00486.1"
FT                   /translation="MRIYNHWQGLEASDRGASIAMGNFDGVHLGHQHVIDLARGRGPLG
FT                   VVTFEPHPREVFAPNGEPFRLMNAEARANRLAKLGVERLYELPFTRDLAALTPEDFARE
FT                   VLAEGLGVTHVVVGADFCFGRGRAGTAEDLERLGRTHGFEVTVADILTMEGTGISSTAI
FT                   RAALTEGRPRDAAAMLGHWHRIEGEVLHGDKRGRNLGYPTANMSVSGLHLPRLGVYAVK
FT                   VDVLTGPLAGSYSGAASLGVRPMFGENRPNLESFLFDFSGDLYGQHLSVAFVEYLRPEM
FT                   VFDGLPALIAQMDRDCARAREILGS"
FT   gene            complement(623719..624162)
FT                   /locus_tag="RSKD131_0627"
FT   CDS_pept        complement(623719..624162)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0627"
FT                   /product="MaoC domain protein dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0627"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00487"
FT                   /db_xref="InterPro:IPR002539"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:B9KPJ4"
FT                   /protein_id="ACM00487.1"
FT                   /translation="MLDNMPRGTICIEDLEIGMSRHLRKEVTDRDIELFAEVSTDRNPV
FT                   HLDEDYARDTIFEGRIAHGMLTAGLISAVIGEQLPGHGTVYLGQSLKFLAPVRPGDTVL
FT                   AEVTVTAIDHAKRRVTLETRCLVGNTTVLKGEALVLAPSRKFD"
FT   gene            complement(624387..625280)
FT                   /locus_tag="RSKD131_0628"
FT   CDS_pept        complement(624387..625280)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0628"
FT                   /product="HAD-superfamily hydrolase, subfamily IIA"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0628"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00488"
FT                   /db_xref="GOA:B9KPJ5"
FT                   /db_xref="InterPro:IPR006356"
FT                   /db_xref="InterPro:IPR006357"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:B9KPJ5"
FT                   /protein_id="ACM00488.1"
FT                   /translation="MTRIIASLSEVSAGYSALFCDLWGCLHDGKRPFGEAVEALRAFRA
FT                   KGGTVLLMTNAPRPKPSVVRQLESIGVPPDCYDEVTSSGDAAQYALVTGAVGRRVYHLG
FT                   PEKDETFFTELSPDLQKVAATEAPIVRVPLEEAEGIVCTGLFDDLTETPEDYRATLLYA
FT                   KTQGLKLLCANPDIVVDFGDKRIYCAGAIAEAYDAMGGQSLYFGKPHPPIYDLARRRLE
FT                   ALRPGVPADEILCVGDGIATDIRGAVAEGLDSLFITGGLAASVFGENGETLDQDRLEHW
FT                   LAEAELSPTLTIARLR"
FT   gene            complement(625443..626360)
FT                   /locus_tag="RSKD131_0629"
FT   CDS_pept        complement(625443..626360)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0629"
FT                   /product="Inorganic diphosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0629"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00489"
FT                   /db_xref="GOA:B9KPJ6"
FT                   /db_xref="InterPro:IPR001667"
FT                   /db_xref="InterPro:IPR004097"
FT                   /db_xref="InterPro:IPR038222"
FT                   /db_xref="InterPro:IPR038763"
FT                   /db_xref="UniProtKB/TrEMBL:B9KPJ6"
FT                   /protein_id="ACM00489.1"
FT                   /translation="MIKVFGHKSPDTDSTGSPIIWAWYLTEVKGTPAKAVLLGEPNTEA
FT                   AFVLKHWDLEKPEIISDVTADDSCVIVDTNNPAELPPSINEAKVVGIIDHHLLVGGIKT
FT                   KSPIEITVRPLACTATIMHDLMGEDLARAPRGIKGAMLSCILSDTLEFRSPTTTAHDRA
FT                   VAEKLAADLGVDIPAFAAELFAAKSDVSAFSDAELLRMDSKEYEIEGKQFRISVLETTA
FT                   PQVLLDRKASLMASMPGVAQEDGADQVVLFIVDILREEATLLVPNDLVKTLAEKSFGAT
FT                   VTGDTVVLPGVMSRKKQIIPVLKL"
FT   gene            626544..626732
FT                   /locus_tag="RSKD131_0630"
FT   CDS_pept        626544..626732
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0630"
FT                   /product="Hypothetical Protein"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0630"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00490"
FT                   /db_xref="UniProtKB/TrEMBL:B9KPJ7"
FT                   /protein_id="ACM00490.1"
FT                   /translation="MRLPMDGQAARQPAAPAAPIREEDPMRDPRARMPYELVLAELSRS
FT                   LKPASVVASLLGAPERG"
FT   gene            complement(626750..627736)
FT                   /locus_tag="RSKD131_0631"
FT   CDS_pept        complement(626750..627736)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0631"
FT                   /product="GumN family protein precursor"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0631"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00491"
FT                   /db_xref="InterPro:IPR002816"
FT                   /db_xref="UniProtKB/TrEMBL:B9KPJ8"
FT                   /protein_id="ACM00491.1"
FT                   /translation="MTRLTSIICAFFLASAPLAHAACTGTDLIAALPQPDRAELEAVAA
FT                   GQPFSEGNFWQATREGREVTVAGTYHLGDPRQAALLDRLRPRIEQASALLVEAGPEEEA
FT                   RLKEAMAKDPSMLLSDGPTLPEVLSEEEWHTLSDALRARGIPPVLASKFEPWYVSMTLA
FT                   LPPCAVEATQNPNGLDKLAMRAAEAAGVPVRSLEPWNTVFQLFAELTPEEQLAMVRTAL
FT                   PLEDRVEDLAVTLADRYFAGQSRTVWEYMRLQAHGMPDYTPEKADAEFAKMEETLISRR
FT                   NRDWLPVIEAAAAEGPVVVAVGALHLPGREGVLALLRDAGYAVTPLD"
FT   gene            627922..628209
FT                   /locus_tag="RSKD131_0632"
FT   CDS_pept        627922..628209
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0632"
FT                   /product="10 kDa chaperonin 1"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0632"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00492"
FT                   /db_xref="GOA:B9KPJ9"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR018369"
FT                   /db_xref="InterPro:IPR020818"
FT                   /db_xref="InterPro:IPR037124"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9KPJ9"
FT                   /protein_id="ACM00492.1"
FT                   /translation="MAFKPLHDRVLVRRVQSDEKTKGGLIIPDTAKEKPAEGEVVSCGE
FT                   GARKDSGELIAMSVKAGDRVLFGKWSGTEVTIDGAELLIMKESDILGILS"
FT   gene            628305..629948
FT                   /locus_tag="RSKD131_0633"
FT   CDS_pept        628305..629948
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0633"
FT                   /product="60 kDa chaperonin 1"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0633"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00493"
FT                   /db_xref="GOA:B9KPK0"
FT                   /db_xref="InterPro:IPR001844"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR018370"
FT                   /db_xref="InterPro:IPR027409"
FT                   /db_xref="InterPro:IPR027410"
FT                   /db_xref="InterPro:IPR027413"
FT                   /db_xref="UniProtKB/TrEMBL:B9KPK0"
FT                   /protein_id="ACM00493.1"
FT                   /translation="MAAKDVKFDTDARDRMLRGVNILADAVKVTLGPKGRNVVIDKSFG
FT                   APRITKDGVSVAKEIELSDKFENMGAQMVKEVASRTNDEAGDGTTTATVLAQAIIKEGL
FT                   KAVAAGMNPMDLKRGIDLATSKVVEAIKAAARPVNDSHEVAQVGTISANGEAQIGRFIA
FT                   DAMQKVGNEGVITVEENKGLETEVEVVEGMQFDRGYLSPYFVTNADKMTAELDDVYILL
FT                   HEKKLSSLQPMVPLLEAVIQSQKPLLIIAEDVEGEALATLVVNKLRGGLKIAAVKAPGF
FT                   GDRRKAMLQDIAILTGGQVISEDLGMKLENVTIDMLGRAKKISINKDNTTIVDGNGDKA
FT                   EIDARVAQIRNQIEETSSDYDREKLQERVAKLAGGVAVIRVGGMTEVEVKERKDRVDDA
FT                   LNATRAAVQEGIVVGGGVALIQGGKALDGLTGENPDQNAGITIVRRALEAPLRQIAQNA
FT                   GVDGSVVAGKVRESNEKSFGFNAQTEEYGDMFKFGVIDPAKVVRTALEDAASVASLLIT
FT                   TEAMIADKPEPKSPAGGPGMGGMGGMDGMM"
FT   gene            complement(630217..630792)
FT                   /locus_tag="RSKD131_0634"
FT   CDS_pept        complement(630217..630792)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0634"
FT                   /product="Hypothetical Protein"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0634"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00494"
FT                   /db_xref="InterPro:IPR010466"
FT                   /db_xref="UniProtKB/TrEMBL:B9KPK1"
FT                   /protein_id="ACM00494.1"
FT                   /translation="MGRRITTLAAALALALSVGAAGQARAQDAEEPADDLAAIAAEAAP
FT                   APDPGVGQVTNLPLPRYVSLKTSEGNARRGPGLTHRIDWVFTRAGMPLRVTAEYEHWRR
FT                   VEDFEGAGGWVHYALLSGARTAMVVAEMADLHEDPASGSTVTVHAQRGVVVRLLECMRD
FT                   WCRVSADGNRGWVIKTALWGVDPDEILQ"
FT   gene            630974..631912
FT                   /locus_tag="RSKD131_0635"
FT   CDS_pept        630974..631912
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0635"
FT                   /product="Glyoxylate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0635"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00495"
FT                   /db_xref="GOA:B9KPK2"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR029752"
FT                   /db_xref="InterPro:IPR029753"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B9KPK2"
FT                   /protein_id="ACM00495.1"
FT                   /translation="MVEARMKELFQVELRDPDTQMSREDLIEAMGRADVLVPCLTDDID
FT                   ANMLAQAGPKLKLIANYGAGVDHIDVASARQRGILVSNTPDVVTEDTADMALALILAVT
FT                   RRIPEGLAEMQSGDWPGWSPMAHLGGRLRGRRLGILGMGRIGQAVARRAHAFGMQIHYH
FT                   NRKRLRPEIEAEVGATFWESLDQMVTRMDIISVNCPHTPSTFHLLNARRLKLLKPTAVI
FT                   VNTSRGEVIDENALTRGLRAGEIAGAGLDVFEHGHEINPRLRELPNVVLLPHMGSATLE
FT                   GRIEMGEKVILNIKTFADGHRPPDQVLPSML"
FT   gene            632226..633044
FT                   /locus_tag="RSKD131_0636"
FT   CDS_pept        632226..633044
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0636"
FT                   /product="2,5-didehydrogluconate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0636"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00496"
FT                   /db_xref="GOA:B9KPK3"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:B9KPK3"
FT                   /protein_id="ACM00496.1"
FT                   /translation="MTATLEFHDGSRIPQLGFGLWQVPEERTAEVVREALELGYRLADG
FT                   AAIYGNEEGLGEGLRTSGLPCDEVFVTTKVWNDAQGFESALRAVEESLKRLGLDRLDLC
FT                   LIHWPAPKRNLYVETWRALIRLRDEGRITSIGVSNFDLDQIDRLTAETGVTPVLNQIEL
FT                   HPMLQQADLRAGHAERGIVTQSWSPLGRGMAFETPAIREIAERTGRSPAQVVLRWHIEL
FT                   GCSVIPRSTRRAGLAENLALFDFELTEADHAAISALDAGTRTGPDPQSFG"
FT   gene            633134..633439
FT                   /locus_tag="RSKD131_0637"
FT   CDS_pept        633134..633439
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0637"
FT                   /product="Hypothetical Protein"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0637"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00497"
FT                   /db_xref="UniProtKB/TrEMBL:B9KPK4"
FT                   /protein_id="ACM00497.1"
FT                   /translation="MPHPLRSAAFLTCLILPEGAFAHDWYPFTCCSDRDCHPIAETEVT
FT                   AGPKGWVIRRTGEIIGYDDEQLQQTPKQAGNSFHLCTTDGKPDGKTICLFVPQFGS"
FT   gene            complement(633637..634878)
FT                   /locus_tag="RSKD131_0638"
FT   CDS_pept        complement(633637..634878)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0638"
FT                   /product="D-amino-acid dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0638"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00498"
FT                   /db_xref="GOA:B9KPK5"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B9KPK5"
FT                   /protein_id="ACM00498.1"
FT                   /translation="MIQHLSSDTVVIGGGVVGLTIALTVARRHRSVILLDPEEPGSGAS
FT                   YGNAGTIADYAVLPVGTPDVLRQLPSLMFDRNSPLAIRHMALPSLAPWLARFLRQSLPA
FT                   PARRNAQAIAALLGSATRSWEDLAVEVEGTALLNRRGCLYAYETPQAARAAETDMAFRR
FT                   TLGVTVELLSAAEFAAMEPTLPPMAGAAYFPKAIFLSDPGRMVALIAEAARKAGVQIVK
FT                   ARATGLERRVDGVIVSGRGLQIHGRRAVIAAGAHSRALALCAGDRVPLDTERGYHVEWD
FT                   MAQPPLTRPTCPTARGFYLCPMAGRLRVAGTVELGGLTARPSPHRIARLVAGARAIFPH
FT                   LPEPTRSWMGFRPSMPDSLPVIGPSAAGPEILHAYGHGHIGLTLAPITARIVADLLDAK
FT                   TPELDIAPYLPTRF"
FT   gene            complement(634925..636070)
FT                   /locus_tag="RSKD131_0639"
FT   CDS_pept        complement(634925..636070)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0639"
FT                   /product="Iron-containing alcohol dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0639"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00499"
FT                   /db_xref="GOA:B9KPK6"
FT                   /db_xref="InterPro:IPR001670"
FT                   /db_xref="InterPro:IPR018211"
FT                   /db_xref="InterPro:IPR039697"
FT                   /db_xref="UniProtKB/TrEMBL:B9KPK6"
FT                   /protein_id="ACM00499.1"
FT                   /translation="MTLRANWSYPTAVKFGAGRIAELAEQCKAVGLKKPLLVTDKALAA
FT                   LPITASALDRLEAAGLGRACFSDVDPNPNEKNMEAGIAVYRAGGHDGVICFGGGSALDL
FT                   GKMIALMHDQTVSVWDLEDIGDWWTRADAAKIAPILAVPTTAGTGSEVGRAGVLTNSET
FT                   HKKKIIFHPKLLPAVTICDPELTVGMPKFITAGTGMDALAHCLEAYCSPFYHPMSQGIA
FT                   LEGMRLVFENLPKVYATPGDLEARAHMMSAAAMGAVAFQKGLGAIHSLSHPVGAVYNTH
FT                   HGTTNAVVMPMVLDFNRPAIEEKIERAAAYLGIEGGFDGFRAKIMALRAELAIPETLSA
FT                   MGVEASRLDELTEMALEDPSCGGNPVEMTRENTRALFEACL"
FT   gene            complement(636067..637455)
FT                   /locus_tag="RSKD131_0640"
FT   CDS_pept        complement(636067..637455)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0640"
FT                   /product="Aldehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0640"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00500"
FT                   /db_xref="GOA:B9KPK7"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:B9KPK7"
FT                   /protein_id="ACM00500.1"
FT                   /translation="MTKPIQLISPVDGRVYAERMPLSMADAKAMARRARAAQPAWAARP
FT                   LDERIALVKAGVAKLNEMKDSVVEELAWQMGRPTRFGGEFGGVNDRTAYMAEIAAETLA
FT                   PTVIEASDRFERRIVREAVGVVLIVAPWNYPYLTTINTLVPALIAGNSVVLKHASQTLL
FT                   VGERLAEAFQAAGVPEEVFQNVVLDHGTTEALIGARAFNFVNFTGSVSGGYAIERAAAG
FT                   TFTATGLELGGKDPGYVRADADLDAAVDSLMDGAMFNAGQCCCGIERIYVHESLYDAFV
FT                   EKAAAWVKALKLGNPFEPETTLGPMANVRFARVVREQVAEAVAAGARPLIDPALFPADD
FT                   GGAYLAPQILVNVTHDMRVMKEESFGPVVGIMKVSGDEEAIGLMNDSPYGLTCSLWTED
FT                   AEAAAEIGARLETGTVYMNRCDYLDPALCWTGCKDTGRGAALSALGYMSVTRPKSYHLK
FT                   KVTK"
FT   gene            complement(637468..638847)
FT                   /locus_tag="RSKD131_0641"
FT   CDS_pept        complement(637468..638847)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0641"
FT                   /product="L-glutamine synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0641"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00501"
FT                   /db_xref="GOA:B9KPK8"
FT                   /db_xref="InterPro:IPR008146"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR036651"
FT                   /db_xref="UniProtKB/TrEMBL:B9KPK8"
FT                   /protein_id="ACM00501.1"
FT                   /translation="MPGNMTFDELKEAVESGGIDTVLVACVDMQGRLMGKRFHAQYFID
FT                   GGHHETHCCDYLLAIDMEMTTVPGYKNSGWEKGYGDYVMKPDMATLRALPWMPGTALVL
FT                   CDLLDHHHNDVPQSPRAILKRQIARAEAMGFKAMMATELEFFLFETSFDAVRNSMQASG
FT                   QIRDLKPISAYNEDYHIFQTSKEEEVMRALRNGLYGAGIPVECSKGEADAGQEEINVKY
FT                   SDALDTADNHAITKTAVKDIAHAAGKSVTFMAKYDHRRAGSSSHVHQSLWTLDGKPAFF
FT                   DPEAPHGMSELMRQFLAGQLAHAEEITAFLAPYVNSYKRFCVGMFAPTKAVWSRDNRTA
FT                   GFRVCGEGTKAIRVECRIGGADLNPYLACAALLAAGLDGIEKKMDLEAEMRGDMYSTAG
FT                   VREIPKTLRAAAERLKGSTMLREAMGDEVVEHYHHAAEWEISEQDRVVTDFELARLFER
FT                   A"
FT   gene            complement(638919..639956)
FT                   /locus_tag="RSKD131_0642"
FT   CDS_pept        complement(638919..639956)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0642"
FT                   /product="TRAP dicarboxylate transporter-DctP subunit
FT                   precursor"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0642"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00502"
FT                   /db_xref="GOA:B9KPK9"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR018389"
FT                   /db_xref="InterPro:IPR038404"
FT                   /db_xref="UniProtKB/TrEMBL:B9KPK9"
FT                   /protein_id="ACM00502.1"
FT                   /translation="MTTRRKFITTGALAGAAGLAAPAVTRAQAPIKWRMQTYAGAALGE
FT                   HVVKPAVEAFNTIAQGQMEIELYYSDQLVPTAELFQAMQRGTIDCVQSDDDSMASPTEV
FT                   TVFGGYFPLALRYSLDVPALFNKYGLGAIWAEEYAKVGVKHISAGSWDPCNFSTKKPIN
FT                   SLSDLQGLRIFTFPTAGRFLTRFGVVPVTLPWEDVEVALQTGELDGLAWSGITEVYTVG
FT                   WANVTDYFLTNNISGAWIGHFFANMDRWNEVPPHLQELLRVCFEQSHYYRQHWYWAGEA
FT                   YLRVNETKLKLTTIPDAEWKQVEDAAVEFWDEIAQESEVKAKVVSIIKDYNETMKKAGP
FT                   PYRFS"
FT   gene            complement(640013..641338)
FT                   /locus_tag="RSKD131_0643"
FT   CDS_pept        complement(640013..641338)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0643"
FT                   /product="TRAP C4-dicarboxylate transport system permease
FT                   DctM subunit precursor"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0643"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00503"
FT                   /db_xref="GOA:B9KPL0"
FT                   /db_xref="InterPro:IPR004681"
FT                   /db_xref="InterPro:IPR010656"
FT                   /db_xref="UniProtKB/TrEMBL:B9KPL0"
FT                   /protein_id="ACM00503.1"
FT                   /translation="MSYEMIAILMFSAMLLMMLTGQRVFGVIGFVAVVASLALWGTGGQ
FT                   SMGFSAAMKLMKWYPLLTLPMFIFMGYVMSESRLADDLYRMFHVWFGPVPGGLAIGTIL
FT                   LMVLISAMNGLSVAGMAIGSTIALPELLRRRYDKLMVTGVIQAGSSLGILIPPSVVLVL
FT                   YAMIARQPVGQLWLAGVVPGLMMAGMFVAYIWLRCRLNPALGPVLPPEELAAVPRSEKM
FT                   RLLAAGLLPLGIFAAMMVPFVNGWTSLVESSVIGALVTVLAAVVKGRFTREVFETSTRA
FT                   TLAISCMFMWIILAALAFGAVFDGLGAVRAIQGFFVDRLELSPWTILIMMQLSYLIMGM
FT                   FLDDTAMLVIVAPLYVPLVGALGFDLIWYGVLYTITCQVAYLTPPFGYNLFLMRAMAPP
FT                   EISIGDIYRSIVPFVGVMVLALVLVMAFPEIALWLPETLYAK"
FT   gene            complement(641338..641844)
FT                   /locus_tag="RSKD131_0644"
FT   CDS_pept        complement(641338..641844)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0644"
FT                   /product="Tripartite ATP-independent periplasmic
FT                   transporter, DctQ component precursor"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0644"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00504"
FT                   /db_xref="GOA:B9KPL1"
FT                   /db_xref="InterPro:IPR007387"
FT                   /db_xref="UniProtKB/TrEMBL:B9KPL1"
FT                   /protein_id="ACM00504.1"
FT                   /translation="MPRALVAFVRLVDRLNYGIGRFAMYLLFVLMGVLLWSSVSKVFFN
FT                   PSLWTLEMAQFVMVAYFILGGPYSLQMGSHVRMDLLYADWPLRKKSWWDAITIFAVILY
FT                   LGVMLWGAVDSTLYSLQYNERSPTAWRPYLWPIKIVMCVGFVLMILQCLAILVRDIATL
FT                   RGKTI"
FT   gene            complement(641849..642628)
FT                   /locus_tag="RSKD131_0645"
FT   CDS_pept        complement(641849..642628)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0645"
FT                   /product="N-formylglutamate amidohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0645"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00505"
FT                   /db_xref="GOA:B9KPL2"
FT                   /db_xref="InterPro:IPR007709"
FT                   /db_xref="InterPro:IPR011227"
FT                   /db_xref="UniProtKB/TrEMBL:B9KPL2"
FT                   /protein_id="ACM00505.1"
FT                   /translation="MTFADMAPDRYPAILENASARSRFLLVCEHASHAIPGRWGDLGLP
FT                   EELRQAHIAWDPGALGLSRGLARRLDAGLVHAPVSRLVYDCNRAPDQPGAMAERSEMHE
FT                   IPGNRRLSPEERAARTAAIYAPFHADLRAEIVRRLAQGVPPVLVTIHSFTPVWHGKPRA
FT                   VEFGIIHDHDPALALAVLEESRDSGLVCGLNEPYSAADDVTHTLRLQALPYGLANVMLE
FT                   IRNDLIATPEAEEAMADRLAPILARALGSLAAPAMAG"
FT   gene            642788..643654
FT                   /locus_tag="RSKD131_0646"
FT   CDS_pept        642788..643654
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0646"
FT                   /product="Transcriptional regulator, RpiR family"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0646"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00506"
FT                   /db_xref="GOA:B9KPL3"
FT                   /db_xref="InterPro:IPR000281"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR035472"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:B9KPL3"
FT                   /protein_id="ACM00506.1"
FT                   /translation="MGLSSIEELMRSALPDMTRAERQLATHILRQYPVAALGSITALAK
FT                   AADVSTPTVVRLVQKLGFKGYPDFQSGLRGEVEAMLLSPLAKHDRWAGGVPDTHILNRF
FT                   ADAVVANLQATLSQIDHAEFDAAARLLADPERRIFVLGGRITHALADYFATLMKVTRPE
FT                   VTLMSDMSSTWPPALLDMGRGDILLLFDIRRYENMVLQVAEMAVEQGVEVVLMTDRWIS
FT                   PAAVHARHTFSCQIEVPSAWDSTVAMLVLVESLISAVQSLTWEQTEERMKRLEDLYARN
FT                   RVFRRHR"
FT   gene            complement(643825..644964)
FT                   /locus_tag="RSKD131_0647"
FT   CDS_pept        complement(643825..644964)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0647"
FT                   /product="Rod shape-determining protein RodA"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0647"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00507"
FT                   /db_xref="GOA:B9KPL4"
FT                   /db_xref="InterPro:IPR001182"
FT                   /db_xref="InterPro:IPR011923"
FT                   /db_xref="InterPro:IPR018365"
FT                   /db_xref="UniProtKB/TrEMBL:B9KPL4"
FT                   /protein_id="ACM00507.1"
FT                   /translation="MSFLEYRVKTAPTGLAKVLHINWALVLLVTATASVGWLMLTSVAG
FT                   GDIDTWAGPQMKRFAVGLVLMFSVAFVPIWFWRNMAGLAYIVSLALLVVVEFFGTVGMG
FT                   AQRWIALGPVVLQPSEMAKVTLVMMLAAYYDWLDPKKVSRPLWVLLPVLIILVPTALVV
FT                   IQPNLGTALLLLMVGAAVMFLAGVSLWYFGVVAAMGVGAVFSVFSLRGTPWQFLHDYQY
FT                   RRIDTFFDPTADPLGAGYNIIQAKIALGSGGWAGKGFMQGTQSRLNFLPEKHTDFIFNT
FT                   LAEEFGFVGAASLLVLYALVIAFCVASAMQNRDRFSSLLILGIAANFFFYLAVNLSMVM
FT                   GMAPVVGVPLPLVSYGGSAMLVLMVAFGLVQSAHVHRLR"
FT   gene            complement(644972..646918)
FT                   /locus_tag="RSKD131_0648"
FT   CDS_pept        complement(644972..646918)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0648"
FT                   /product="Pbp2 protein"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0648"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00508"
FT                   /db_xref="GOA:B9KPL5"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR005311"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR017790"
FT                   /db_xref="InterPro:IPR036138"
FT                   /db_xref="UniProtKB/TrEMBL:B9KPL5"
FT                   /protein_id="ACM00508.1"
FT                   /translation="MRRSARDSEDSARKVNRRALFLGGAMTAMFAVLGARMRYLQVDQA
FT                   DEFKLLAEENRINIRLIPPTRGQIFDRNGRLIAGNEQNYRVVITREDAGDVEAVLRRLA
FT                   DVIPLTEPDIERVMTEARRHSPFVPIIVADRMAWDDLSKVAINAPSLPGVTPEVGLSRA
FT                   YPLDTDFAHVVGYVGPVSENDLAKIEDPDPLLKIPEFQIGKIGVETWMEGTLRGKAGTK
FT                   RIEVNAYGRMMREIDRVEGDAGDDIRLTIDAEIQDFVQARLGAESAAAVAIDVITGDIL
FT                   AICSSPSFDPNLFVRGISFKDYAALTENDHRPLANKAVQGAYPPGSTFKMVTALAALEA
FT                   GVITPETSVYCPGHYETGGRRFHCWKRGGHGMVSLSRSLAESCDVYYYDIAQRVGIDKI
FT                   AEMGRRLGLGMRHDLPMSAITEGIMPDKAWKRQRYEQDWRIGDTINASIGQGYVLASPL
FT                   QLAVMTARVASGRAVQPRLVRSVGDSELPVPEAPPLGVDGSLLRSVRQGMYAVINERRG
FT                   TGHTNRIVDPALVMAGKSGTSQVRNISAAERARGVISNDQLPWNRRDHALFVGFAPFDA
FT                   PRVAVAVVVEHGGGGSSVAGPIVRDVILRCLTPGPLPPLSAYPESQRARMETLLTSLPL
FT                   RKIEPEVTARSRA"
FT   gene            complement(646915..647454)
FT                   /locus_tag="RSKD131_0649"
FT   CDS_pept        complement(646915..647454)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0649"
FT                   /product="MreD protein"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0649"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00509"
FT                   /db_xref="GOA:B9KPL6"
FT                   /db_xref="UniProtKB/TrEMBL:B9KPL6"
FT                   /protein_id="ACM00509.1"
FT                   /translation="MAEGVRRRVWLYPTAFVAIAAFLVMLRLLPLGLRAGAWPGPDLLL
FT                   CLILAWVIRRPDYLPAPLLAVVLLLEDLLLMRPPGLWAALVLVATEFLRSRAALTRELS
FT                   FPVEWLLVSGVMLALRFAERTIAALALLPQPALGEHLLQTAMTILCYPLIVGCCWLLLD
FT                   LRKPATGELDAFGRRM"
FT   gene            complement(647447..648349)
FT                   /locus_tag="RSKD131_0650"
FT   CDS_pept        complement(647447..648349)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0650"
FT                   /product="Rod shape-determining protein MreC"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0650"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00510"
FT                   /db_xref="GOA:B9KPL7"
FT                   /db_xref="InterPro:IPR007221"
FT                   /db_xref="InterPro:IPR042175"
FT                   /db_xref="InterPro:IPR042177"
FT                   /db_xref="UniProtKB/TrEMBL:B9KPL7"
FT                   /protein_id="ACM00510.1"
FT                   /translation="MARDRTRPEDFTRPLRRILVGGLVLLLLGIFLIWRIDSPRVEQFR
FT                   AALIDRVVPSFEWLMTPMTKVAGMVENFQSYTRIYEQNQELRRELQQMKAWKEAALQLE
FT                   QKNARLLDLNQVRLDPKLTHVTGVVLADSGSPFRQSVLLNVGARDGIRDGWATMDGIGL
FT                   VGRISGVGRTTSRVILLTDTSSRIPVTVQPSGQRALLTGDNSPSPPLEFLDKPDLVRPG
FT                   DRVVTSGDGGVFPADLLVGQVAQGPDRRLRVRLAADYGRLEFLRVLRSHELEPISDPGK
FT                   LVAEPPAPPTPAAVEGADG"
FT   gene            complement(648383..649420)
FT                   /locus_tag="RSKD131_0651"
FT   CDS_pept        complement(648383..649420)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0651"
FT                   /product="Rod shape-determining protein MreB"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0651"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00511"
FT                   /db_xref="GOA:B9KPL8"
FT                   /db_xref="InterPro:IPR004753"
FT                   /db_xref="UniProtKB/TrEMBL:B9KPL8"
FT                   /protein_id="ACM00511.1"
FT                   /translation="MSFLTGLFSSDMAIDLGTANTLIYVRGKGIVLSEPSVVAYHVKDG
FT                   KKQVLAVGEDAKLMLGRTPGSIEAIRPMREGVIADFDTAEEMIKHFIRKVHKRTTFSKP
FT                   KIIVCVPHGATPVEKRAIRQSVLSAGARRAGLIAEPIAAAIGAGMPITDPTGNMVVDVG
FT                   GGTTEVAVLSLGDIVYARSVRVGGDRMDEAIVAYLRRHQNLLIGDSTAERIKTSIGTAR
FT                   MPDDGRGQSMTIRGRDLLNGVPKETEINQAQVAEALAEPVQQICDAVMQALEATPPDLA
FT                   ADIVDRGVMLTGGGALLGDLDLALREQTGLSISVANESLNCVALGTGKALEYEKQLRHV
FT                   IDYES"
FT   gene            649769..650725
FT                   /locus_tag="RSKD131_0652"
FT   CDS_pept        649769..650725
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0652"
FT                   /product="Serine/alanine racemase VanTc3"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0652"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00512"
FT                   /db_xref="GOA:B9KPL9"
FT                   /db_xref="InterPro:IPR002656"
FT                   /db_xref="UniProtKB/TrEMBL:B9KPL9"
FT                   /protein_id="ACM00512.1"
FT                   /translation="MSPSAAPSPPLRNLSLDALKIVMAVMVVGLHAGFLRDLHPMASDF
FT                   FTNCLFRIAVPTFLVINGYYLERQLDRGLWRWARRVALLYGIWMALYAPLWLPGALKVP
FT                   AFGREVLFFGYYHLWYLLALLLAGLLVAALRPLGERVLAGTALLAFACGVGIQYAGNFH
FT                   LFEPPVDDLLNRVQTYRNFLFMGFPFLVAGVLIARHEERLARFGTPAVLAAASALLLAE
FT                   WGANMVWNREDPVFEIFASLALVCPALFLTVKGRRLMGRSRDFGQFATALYLVHIAVLH
FT                   FTYDVEMGDTLRTLIGLCLASLLAVPVVLAARRLPIL"
FT   gene            complement(650893..652482)
FT                   /locus_tag="RSKD131_0653"
FT   CDS_pept        complement(650893..652482)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0653"
FT                   /product="2-isopropylmalate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0653"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00513"
FT                   /db_xref="GOA:B9KPM0"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR002034"
FT                   /db_xref="InterPro:IPR005671"
FT                   /db_xref="InterPro:IPR013709"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR036230"
FT                   /db_xref="UniProtKB/TrEMBL:B9KPM0"
FT                   /protein_id="ACM00513.1"
FT                   /translation="MTDTTKTASEQDRVLIFDTTLRDGEQSPGATMTHDEKLEIAALLD
FT                   EMGVDIIEAGFPIASEGDFEAVSAIARQSKNATICGLARANYKDIDRCWEAVRHAKSPR
FT                   IHTFIGTSPLHRAIPNLDMDQMAERIHDTVSHARNLCDNVQWSPMDATRTEHDYLCRVV
FT                   EIAIKAGATTINIPDTVGYTAPRESADLIRMLVERVPGADTIVFATHCHNDLGMATANA
FT                   LAAVEAGARQIECTINGLGERAGNTALEEVVMALKVRNDIMPFRTGIDTTKIMNISRKV
FT                   ATVSGFPVQFNKAIVGKNAFAHESGIHQDGMLKNAQTFEIMRPADVGLADTSLVMGKHS
FT                   GRAALRAKLKDLGYDLADNQLNDVFVRFKALADRKKEVYDDDIVALIQDQVTSAEHDTL
FT                   QLKRLRVVCGTDGPQEAEMTLSVEGVDHAIDATGDGPVDAAFNAVKMIYPHHAKLHLYQ
FT                   VHAVTEGTDAQATVSVRLEEDGKIATGQAADTDTVVASVKAYVNALNRLIHRRQKSAPG
FT                   ADMKDVHYSSHA"
FT   gene            652483..652839
FT                   /locus_tag="RSKD131_0654"
FT   CDS_pept        652483..652839
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0654"
FT                   /product="Hypothetical Protein"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0654"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00514"
FT                   /db_xref="UniProtKB/TrEMBL:B9KPM1"
FT                   /protein_id="ACM00514.1"
FT                   /translation="MNSLVVLSFGPGRWSPPSGRAQGHAQRQLRRRSARAATARRGVAE
FT                   LIAMVRSRVMARILRSRAQKESAKVTVRRFSLRVGPALSIAGLQADGAMGGSHCIAAGD
FT                   PLPASACEARPPRR"
FT   gene            653213..653671
FT                   /locus_tag="RSKD131_0655"
FT   CDS_pept        653213..653671
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0655"
FT                   /product="Pseudoazurin precursor"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0655"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00515"
FT                   /db_xref="GOA:B9KPM2"
FT                   /db_xref="InterPro:IPR000923"
FT                   /db_xref="InterPro:IPR001235"
FT                   /db_xref="InterPro:IPR002386"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR012745"
FT                   /db_xref="UniProtKB/TrEMBL:B9KPM2"
FT                   /protein_id="ACM00515.1"
FT                   /translation="MFANLPMIGLAAGLAAALALPAGAANYEIAMVHNGSTGAKAFEPA
FT                   FIQAKVGDTVTFLPIDKGFNAEIIPGMLPLGARGFRGEMNRPVTITLTQEGIWGVKSMP
FT                   YYGMGMVALIQVGAPLNLEEAMSVPQPARAEARLEPLFAQVLQNYEAN"
FT   gene            complement(653907..654641)
FT                   /locus_tag="RSKD131_0656"
FT   CDS_pept        complement(653907..654641)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0656"
FT                   /product="NirV"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0656"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00516"
FT                   /db_xref="InterPro:IPR005532"
FT                   /db_xref="InterPro:IPR016187"
FT                   /db_xref="InterPro:IPR042095"
FT                   /db_xref="UniProtKB/TrEMBL:B9KPM3"
FT                   /protein_id="ACM00516.1"
FT                   /translation="MGPSVPAIKMPETVTFPAGTFLHRTSAEVRIGTRRIDPPVERLTL
FT                   GSFAIMTHQVTQEDYARCVADRDCLPAPTEPGTLLPQTGLNWSDGAAYAAWLSEETGQD
FT                   WRLPTDAEWLRAAAERGFDGALGAEATDPSERWLASYRAEVSRRGEADLVPHPQGHFGQ
FT                   NSLGLWDMAGNVWEWTESCDEKRASSLEGRLIASERFCGVRVAQGKHRAFLVDFVRDAR
FT                   SGGCAAGIPPDFLGLRLVHDLP"
FT   gene            complement(654755..655822)
FT                   /locus_tag="RSKD131_0657"
FT   CDS_pept        complement(654755..655822)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0657"
FT                   /product="Copper-containing nitrite reductase precursor"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0657"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00517"
FT                   /db_xref="GOA:B9KPM4"
FT                   /db_xref="InterPro:IPR001117"
FT                   /db_xref="InterPro:IPR001287"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR011707"
FT                   /db_xref="UniProtKB/TrEMBL:B9KPM4"
FT                   /protein_id="ACM00517.1"
FT                   /translation="MIRAAGAEEAPAQAAAAAPADLSSLPRVKHKLVVPPFAHAHEQVA
FT                   TGGPVINEFEMRIVEKEVQLDEDAWMQAMTFDGSIPGPLMIVHEGDYVELTLVNPPENT
FT                   MPHNIDFHAATGALGGGGLTLVNPGEKVVLRFKATRAGTFVYHCAPGGPMIPWHVVSGM
FT                   AGCIMVLPREGLTDAQGKPVRYDRLYYIGESDHYVPKDADGTYRRYADPSEGYEDMVAV
FT                   MDTLTPSHIVFNGAVGALTGDKAMKANVGERVLFIHSQPNRDSRPHLIGGHGDLVWETG
FT                   KFHNPPQRDLETWFIRGGSAGAALYEFLQPGVYAYVNHNLIEAVHKGATAHVLVEGAWN
FT                   NDLMEQLVAPTGVTG"
FT   gene            complement(656177..657703)
FT                   /locus_tag="RSKD131_0658"
FT   CDS_pept        complement(656177..657703)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0658"
FT                   /product="MORN repeat-containing protein precursor"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0658"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00518"
FT                   /db_xref="InterPro:IPR003409"
FT                   /db_xref="UniProtKB/TrEMBL:B9KPM5"
FT                   /protein_id="ACM00518.1"
FT                   /translation="MRKTKERIGRARRHGLAAVALGAALGAPAVLAQDPGAVTTKQYDD
FT                   GSVYEGTFRNGLQHGTGTYRLPNGYEYSGDWTDGEIRGEGRARFPNGSVYEGAFVAGKP
FT                   EGRGKITFSDGGTYEGDWAGGQMTGEGVARYANGSVYTGQFRNAVHHGRGVLENPGGYR
FT                   YEGDWVEGVKEGRGKITYPDGAIYEGDLVKGQRQGQGTLTMPDGLVYVGAWDNGQINGT
FT                   GRLTQPNGDIYEGPLKDGQREGRGKVTHKNGDVYEGEFHADRRHGQGTFRGTDGYVYEG
FT                   AWVEGRIEGQGRVTYPDGSVYVGRFHEDQPEGRGKITYPDGSTYEGDWKDGVIEGRGTA
FT                   TYANGLVYEGQFHAAKNHGQGVMTYPDGYRYEGDWVEGQRHGRGTATYADGTVYTGQFV
FT                   RGQREGEGEIVMADGFRYKGGWKAGEIDGEGIATYANGDVYEGTFKAGKRQGQGVMRYA
FT                   TGQESAGEWKDGILAEPAAEAPAGEAPAPAEDATPPAEDAAPPAEASTAD"
FT   gene            657855..659549
FT                   /locus_tag="RSKD131_0659"
FT   CDS_pept        657855..659549
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0659"
FT                   /product="NH(3)-dependent NAD(+) synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0659"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00519"
FT                   /db_xref="GOA:B9KPM6"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR003694"
FT                   /db_xref="InterPro:IPR014445"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR022310"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:B9KPM6"
FT                   /protein_id="ACM00519.1"
FT                   /translation="MSRDPDGSETMTERFRLTLAQLNPTVGDLAGNAALARRAWDEARA
FT                   AGSDMLALTEMFVTGYQTQDLVMRRAFVEEAMVTIERLAADCAEGPAIGIGGPCLEDGR
FT                   LMNAYWVLEGGRVSARVFKHHLPNAEVFDEKRVFSSGEVHGPCRVGPLRIGIPICEDSW
FT                   HADVCETLAETGAEILLVPNGSPYHREKLDVRVNLMVTRVVETGLPLVYLNMVGGQDDQ
FT                   VFDGASFVLNPHGRLMAQLPAFEEALVHVDFEATDEGWRALPAPIVAQPDLWEADYHAM
FT                   VLSLRDYLRKSGFSRVLLGLSGGIDSALVAAIAADALGPEAVRCVMLPSRFTSRPSLED
FT                   AAAVARALGCRLDEVGIGGPQEAVGAALGPLFEGTEPGITEENIQSRLRGLLLMALSNK
FT                   FGEMLLTTGNKSEVAVGYCTIYGDMNGGYNPIKDLYKTRVFQMCRWRNGHHRPWMKGPP
FT                   GEVIPPRVIDKPPSAELREDQKDEDSLPPYATLDAILEGLVDREESVAELVARGFERET
FT                   VARIERLILGSEWKRFQSAPGTRLTRRAFWLDRRYPMVNRWRDAGGA"
FT   gene            complement(659655..660581)
FT                   /locus_tag="RSKD131_0660"
FT   CDS_pept        complement(659655..660581)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0660"
FT                   /product="6-phosphofructokinase"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0660"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00520"
FT                   /db_xref="GOA:B9KPM7"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR017583"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:B9KPM7"
FT                   /protein_id="ACM00520.1"
FT                   /translation="MTLNPAIDLAADVPQVLPGIKLRCTEPRVDPGGGGLNVSRAIRIL
FT                   GGRSTAFVALGGNIGGRLAALVAAAGIEIVAFSGPGETRESLTVTETATGRQFRFMLPG
FT                   AVWDTPRVEAALARIDSAVPEGGMVVLSGSLPPGVPADFPAMVSRVLGKRARLLVDTSG
FT                   APLAHLAAGGVPDLDILRMDDGEAAGLAGRPLACASETADFASSLVARGVAECVIVARG
FT                   ADGSVLADARGRWHARSEPVEVVSAVGAGDTFVGAFVLALARGAPPEEALAHGVAGAAA
FT                   AVLTEATELCHPEDVARLLPSAAATAL"
FT   gene            660744..661337
FT                   /locus_tag="RSKD131_0661"
FT   CDS_pept        660744..661337
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0661"
FT                   /product="Flavodoxin/nitric oxide synthase"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0661"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00521"
FT                   /db_xref="GOA:B9KPM8"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:B9KPM8"
FT                   /protein_id="ACM00521.1"
FT                   /translation="MPVKLAILFYTTYGTNHRMAEIADEAARATGAEVRLRKIAETAPA
FT                   SVVNGQEAWKAQVERMADIAEARPEDLDWADAYLFSAPTRFGAGPSQLRAFIDTLGPFW
FT                   SQGKLADKAVSAMSSAQNVHGGQEATILGLYTTFLHWGSIIVAPGYTDPVLFKAGGNPY
FT                   GYSHTQGAEFDEAARGAIAHQVRRLVKMAEKLTA"
FT   gene            complement(661362..661601)
FT                   /locus_tag="RSKD131_0662"
FT   CDS_pept        complement(661362..661601)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0662"
FT                   /product="Hypothetical Protein"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0662"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00522"
FT                   /db_xref="UniProtKB/TrEMBL:B9KPM9"
FT                   /protein_id="ACM00522.1"
FT                   /translation="MFTIEHDFDATVITLIDEGGPHLQEDATISAFEDVVTLEQVDPRR
FT                   DEVIRITLSMAQIRDLAAALNLPEGSYRLARPGE"
FT   gene            661790..662464
FT                   /locus_tag="RSKD131_0663"
FT   CDS_pept        661790..662464
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0663"
FT                   /product="Peptidase M48, Ste24p precursor"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0663"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00523"
FT                   /db_xref="GOA:B9KQ16"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="UniProtKB/TrEMBL:B9KQ16"
FT                   /protein_id="ACM00523.1"
FT                   /translation="MGPEALGPGSYQAAPDPGPFLTPADAQRAFPAVVARVEPVAEAIC
FT                   RERTRGVPCDFQIAVDARPGLDPNAFQTLDDYGRPVIGLTLSLISDARNVDELAFVVGH
FT                   ETAHHILGHIPRQRETALTGAVLAGVLAQMGGADAQTIRSVQEFGANVGARSYSKNFEL
FT                   EADGLGTEIAIRAGYDPVHGAQFFTRLPDPGDTFLGSHPPNAQRIAAVRRAAESIGYVS
FT                   AW"
FT   gene            662539..662790
FT                   /locus_tag="RSKD131_0664"
FT   CDS_pept        662539..662790
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0664"
FT                   /product="Hypothetical Protein"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0664"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00524"
FT                   /db_xref="UniProtKB/TrEMBL:B9KQ17"
FT                   /protein_id="ACM00524.1"
FT                   /translation="MIGYVEAPRAWSLTRGMARVAGVNLPDAVLEGWLSRAELAEMVDR
FT                   CQTCTASDACTGWLSHSGRSTVLPAFCRNKTEIEALAS"
FT   gene            662909..663238
FT                   /locus_tag="RSKD131_0665"
FT   CDS_pept        662909..663238
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0665"
FT                   /product="PRC-barrel domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0665"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00525"
FT                   /db_xref="InterPro:IPR011033"
FT                   /db_xref="InterPro:IPR027275"
FT                   /db_xref="UniProtKB/TrEMBL:B9KQ18"
FT                   /protein_id="ACM00525.1"
FT                   /translation="MVSSADVNGTAVYSPKGEHLGHIDHLMIDKESGVIAYAVMAFGGF
FT                   LGLAEDHHPIPWKKLSYDQTLGGFVTDITRAQLEGAPPRGENWREDRTWGAATYNYYGV
FT                   PPYWI"
FT   gene            complement(663476..664843)
FT                   /locus_tag="RSKD131_0666"
FT   CDS_pept        complement(663476..664843)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0666"
FT                   /product="MiaB-like tRNA modifying enzyme YliG"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0666"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00526"
FT                   /db_xref="GOA:B9KQ19"
FT                   /db_xref="InterPro:IPR002792"
FT                   /db_xref="InterPro:IPR005839"
FT                   /db_xref="InterPro:IPR005840"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013848"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR038135"
FT                   /db_xref="InterPro:IPR041582"
FT                   /db_xref="UniProtKB/TrEMBL:B9KQ19"
FT                   /protein_id="ACM00526.1"
FT                   /translation="MGAMAQNPPNLRPDLAPRLVIDSPRREGQPTIGMVSLGCPKALVD
FT                   SERILTRLRAEGYAISPDYAGADAVIVNTCGFLDSAKAESLEAIGEALRENGRVIVTGC
FT                   LGAEPDYITGAHPKVLAVTGPHQYEQVLDAVHGAVPPAPDPFVDLLPATGVRLTPRHFS
FT                   YLKISEGCNHTCRFCIIPDMRGRLASRPERAVLREAEKLVEAGVRELLVISQDTSAYGT
FT                   DWKGPEKFPILPLARELGRLGAWVRLHYVYPYPHVRELIPLMAEGLVLPYLDIPFQHAH
FT                   PEVLKRMARPAAAARTLDEIAAWRRDCPEIALRSTFIVGYPGETEAEFQTLLDWLDEAQ
FT                   LDRVGCFQYENVAGARSNALPDHVAPEVKQERWDRFMEKAQAISEAKLAAKVGRRMEVI
FT                   VDEVDEDGATCRTKADAPEIDGNLFIDEGFKGLAPGDILTVEVEEAGEYDLWGRPV"
FT   gene            complement(664947..666125)
FT                   /locus_tag="RSKD131_0667"
FT   CDS_pept        complement(664947..666125)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0667"
FT                   /product="Aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0667"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00527"
FT                   /db_xref="GOA:B9KQ20"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:B9KQ20"
FT                   /protein_id="ACM00527.1"
FT                   /translation="MTLPLNPAMAATFPPPVMEARRWIQGLSFPADRPLLNLSQAAPVE
FT                   PPPAELRAALAEAALHDPQAHLYGPVLGLPALRAEIAAQWSAAYGGRIEPPQVAITQGC
FT                   NQAFCAIMATLAGTGDEVILPTPWYFNHKMWLDMQGVTAVPLPTGPGLLPDAEEAAALV
FT                   GPRTRAIVLVSPNNPGGVEYPAATLEAFRDLARARGLALIVDETYRDFDSRTGAPHALF
FT                   ADPDWDGVLVHLYSFSKAYRLTGHRVGAVVASAARLAQIEKFLDTVAICPSQLGQIGAL
FT                   WGMRNLAQWVAGERAEILARRTAMVGGFSALEGWTLLGCGAYFAYVEHPFDAPSNRLAP
FT                   RLVQEAGVLMLPGTMFQPERSEAGARQFRMAFANVDQAGIAELFSRLAQVTD"
FT   gene            complement(666154..666657)
FT                   /locus_tag="RSKD131_0668"
FT   CDS_pept        complement(666154..666657)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0668"
FT                   /product="Xanthine phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0668"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00528"
FT                   /db_xref="GOA:B9KQ21"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR023747"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:B9KQ21"
FT                   /protein_id="ACM00528.1"
FT                   /translation="MKERLPHEKGFHVSWDQIHRDSRALAWRLDGQGPDNGSWRAVVGI
FT                   TRGGLVPAMIVSRELDIRTVDTISVKSYNWQEQQAPTVIKAPQAELMGDGHGILIVDDL
FT                   VDSGKTLELVRTLYPRAHFATVYAKPSGRPMVDTYITEVSQDTWIFFPWDMALQYVEPY
FT                   RGRD"
FT   gene            complement(666667..667281)
FT                   /locus_tag="RSKD131_0669"
FT   CDS_pept        complement(666667..667281)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0669"
FT                   /product="Lysine exporter protein (LYSE/YGGA) precursor"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0669"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00529"
FT                   /db_xref="GOA:B9KQ22"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:B9KQ22"
FT                   /protein_id="ACM00529.1"
FT                   /translation="MSLAAFAAAWLLHLMAAISPGPAVLMSARTGMSEGLRTGAILALG
FT                   LAAGALVWASAALFGLALLFKVAPSLLWGMKIAGAIYLMRMAFVMWREADRPFDTGQAG
FT                   RPPRSAASAFRLGLFTQLSNPKPAVFFSAIFIGTVPQDAAPWAVGLLLLAVFLNEFLWN
FT                   TFVARVFSFERARSGYISLKSVIDRSFGGLLALLGVKLAAF"
FT   gene            complement(667283..668107)
FT                   /locus_tag="RSKD131_0670"
FT   CDS_pept        complement(667283..668107)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0670"
FT                   /product="enoyl-(acyl carrier protein) reductase"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0670"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00530"
FT                   /db_xref="GOA:B9KQ23"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR014358"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B9KQ23"
FT                   /protein_id="ACM00530.1"
FT                   /translation="MANGLLAGKRGLIMGLANDKSIAWGIAKCCADQGAELAFSYQGDA
FT                   LKKRVEPLAASIGATEMVECDVSDEASLDRLFAHLKEVWGTLDFVVHAIGFSDKSELRG
FT                   RYVDTTPANFRMTMDISVYSFTAVCQRACAMMPAGGSLLTLTYYGAEKVMPHYNVMGIA
FT                   KAALETSVQYIAEDLGKDGIRVNAISAGPIKTLAASGIGDFRYIMKWNELNSPLRRNVT
FT                   QEEVGKAALYLLSDLGSGTTGEVLHVDAGYHVVGMKAVDAPDIDAVTGRKDH"
FT   gene            668250..668852
FT                   /locus_tag="RSKD131_0671"
FT   CDS_pept        668250..668852
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0671"
FT                   /product="Pyridoxamine 5'-phosphate oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0671"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00531"
FT                   /db_xref="GOA:B9KQ24"
FT                   /db_xref="InterPro:IPR000659"
FT                   /db_xref="InterPro:IPR011576"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="InterPro:IPR019576"
FT                   /db_xref="InterPro:IPR019740"
FT                   /db_xref="UniProtKB/TrEMBL:B9KQ24"
FT                   /protein_id="ACM00531.1"
FT                   /translation="MDRTGIFAGDDPFAIAAGWLAEAEPQEPNDPNAIALATVDAAGLP
FT                   NVRMVLLKEIEAEAFVFYTNYGSQKAVEIETSGKAAFVLHWKSLRRQIRVRGLVEREEG
FT                   AQADAYYASRSLKSRLGAWASEQSRPLASRTSLLAEVARVTARFGTNPPRPAFWGGFRI
FT                   RPLEIEFWADGAFRLHDRFRWRRNSLSDGWSIERLNP"
FT   gene            668969..669511
FT                   /locus_tag="RSKD131_0672"
FT   CDS_pept        668969..669511
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0672"
FT                   /product="Cold-shock DNA-binding protein family precursor"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0672"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00532"
FT                   /db_xref="GOA:B9KQ25"
FT                   /db_xref="InterPro:IPR002059"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:B9KQ25"
FT                   /protein_id="ACM00532.1"
FT                   /translation="MVEDEKALQLVHGRVKWFDPAKGFGFIVTEENGADILLHANVLRN
FT                   YGQSSVADGAGITVKVQSTQRGVQAVEVIEIEPPEGTTFHLSEDSEATTPEEIAARPLE
FT                   PGRVKWFDKGKGFGFANVFGRPEDVFIHVEVLRMSGFADLAAGEAVALRIIEGRRGRMA
FT                   VQVVSWEVAARQHQQPA"
FT   gene            669526..669987
FT                   /locus_tag="RSKD131_0673"
FT   CDS_pept        669526..669987
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0673"
FT                   /product="Hypothetical Protein"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0673"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00533"
FT                   /db_xref="InterPro:IPR003795"
FT                   /db_xref="InterPro:IPR038695"
FT                   /db_xref="UniProtKB/TrEMBL:B9KQ26"
FT                   /protein_id="ACM00533.1"
FT                   /translation="MLALLPGASRADCRPDAVELRTEAGSTMRFSVEIADTPAERSRGL
FT                   MHRESLPRSSGMLFLFDAPHRASFWMRNTLIPLDMIFAGPDGTVKVVHSNAVPEDLTPI
FT                   SGGEGIQSVLEINGGLARALGIGPGTVLRHPGLDQSLATWPCDEAPAKP"
FT   gene            670376..670452
FT                   /locus_tag="RSKD131_trnaPro1"
FT   tRNA            670376..670452
FT                   /locus_tag="RSKD131_trnaPro1"
FT                   /product="tRNA-Pro"
FT   gene            670666..671448
FT                   /locus_tag="RSKD131_0674"
FT   CDS_pept        670666..671448
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0674"
FT                   /product="Transcriptional regulator, GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0674"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00534"
FT                   /db_xref="GOA:B9KQ27"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR011663"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B9KQ27"
FT                   /protein_id="ACM00534.1"
FT                   /translation="MEDGDSAEAFRAFAAGVALQREDPSPLWVQLKNRIEHAILDGTLP
FT                   ENARLPSEQAMCSMFDLSRPVIRNALQALAGEGRVIKQPRKGMFVAPRAPELAFMTSAL
FT                   GVFDDLSAKGYKVTVRTYEFGLHPANEDERRVFKLPEGFQVIRALRVYHANETPLTHTL
FT                   ISLPAHRLPGFEKLDMEGRSIFGTIRELYGLTVARADRWLKGAIVPSEVAARMGVPPGG
FT                   AMIAIESVAYDHDGNALEYYRAYYNSEVAPIHVATDAH"
FT   gene            671642..672406
FT                   /locus_tag="RSKD131_0675"
FT   CDS_pept        671642..672406
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0675"
FT                   /product="Short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0675"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00535"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B9KQ28"
FT                   /protein_id="ACM00535.1"
FT                   /translation="MDYRTVFRLDGACAAVTGAGSGIGLEICRAFAASGARLILIDREG
FT                   AALDRAAEELGAAVASRIVADVTDAEAMTAAAAEAEAVAPVSILVNSAGIARLHDALET
FT                   DDATWRQVMAVNVDGMFWASRAFGRAMVERGAGAIVNLGSMSGTIVNRPQFASSYMASK
FT                   GAVHQLTRALAAEWAGRGVRVNALAPGYVATEMTLKMRERPELFDTWLDMTPMGRCGEP
FT                   SEIAAAALFLASPAASYVTGAILAVDGGYTVW"
FT   gene            672411..673067
FT                   /locus_tag="RSKD131_0676"
FT   CDS_pept        672411..673067
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0676"
FT                   /product="L-fuculose-phosphate aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0676"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00536"
FT                   /db_xref="InterPro:IPR001303"
FT                   /db_xref="InterPro:IPR036409"
FT                   /db_xref="UniProtKB/TrEMBL:B9KQ29"
FT                   /protein_id="ACM00536.1"
FT                   /translation="MNEMSDLSDLAKREEIIRQCLEMNRSGLNQGTSGNISVRHGEGML
FT                   ITPTSLPYDTLVPEDIVFVSMEGEVRGRHKPSSEWRFHRDILRERADVNAVVHAHPTYC
FT                   TTLAIMNREIPSIHYMLAVVGGPNIRCAPYAIYGSEELSRNAVEALRDRKACLLEHHGM
FT                   IAVGKSLAQAMWLAVEVETLARQYHGCLQIGEPRLLSERQIQDVIDKIAGYGHQG"
FT   gene            673133..674095
FT                   /locus_tag="RSKD131_0677"
FT   CDS_pept        673133..674095
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0677"
FT                   /product="Periplasmic binding protein/LacI transcriptional
FT                   regulator precursor"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0677"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00537"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:B9KQ30"
FT                   /protein_id="ACM00537.1"
FT                   /translation="MTTKTAKGLTTALLLLATLSPALAEELTLEGKTIGITAIGTDHDW
FT                   DLKAYQAQIAEIERLGGTAIALDAGRNDQTQVSQIQTLIAQKPDAIIEQLGNLDVLNPW
FT                   LQKINDAGIPLFTVDTATPHAINNTTSNNYSIGAELALQMVADLGGKGNVLVFNGFYSV
FT                   PVCKIRYDQMKYVLEAFPDVKIIEPELRDVIPNTIQSAYSNVTDMLTKYPNEGDIGAIW
FT                   ACWDVPMIGATQALQAAGRTDIRTYGVDGSPEFVEMVADPESPAGAVAAQQPSEIGKLA
FT                   VQNVARHLAGQEVKPFTFAPAVLITKENAAETAADFLPK"
FT   gene            674280..675788
FT                   /locus_tag="RSKD131_0678"
FT   CDS_pept        674280..675788
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0678"
FT                   /product="Ribose import ATP-binding protein rbsA"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0678"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00538"
FT                   /db_xref="GOA:B9KQ31"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR015861"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B9KQ31"
FT                   /protein_id="ACM00538.1"
FT                   /translation="MSGLAIDMTGISKAFGPVKALVDADLRVARGTIHGLVGQNGAGKS
FT                   TIIKVLAGILKPDSGRITINGTRVESLTPASVERLGVHFIHQERLLVPTATVAEAVFLN
FT                   YELRFGPFLRPGAMKRRAEELIRTHFGLELPGDTLVRDLTTAQQKIVQITRALAQEAQV
FT                   LVLDEPTAALVKREVDSLFAVLRNLRAQGIAVIFISHYMQEIEDLCDEVTVMRNGTDVG
FT                   VVRPGETSIDEIVSMMIARDVGEMFPRRSHALGAPVLRVEGLSQAGHFRNVSFEVRAGE
FT                   VLGITGLLGSGVKELVECLFGLEQPDAGSVTIDGEVRRFANPGRAVQGRMALVPEDRRA
FT                   HGVATDMSVRDNITIASLDRYMTRGFVSRARENEAVDGFIRELSIKTPHRDQLVRNLSG
FT                   GNQQKVALAKWLSCQSRVYVLDEPTVAVDVGAKVEIYTLLNRLAAEGAAILFLSSDLLE
FT                   IAGFCDRALVVYRGTLNGQFAGETLDSDLLLAAASGARAQRKEA"
FT   gene            675789..676799
FT                   /locus_tag="RSKD131_0679"
FT   CDS_pept        675789..676799
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0679"
FT                   /product="Inner-membrane translocator precursor"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0679"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00539"
FT                   /db_xref="GOA:B9KQ32"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:B9KQ32"
FT                   /protein_id="ACM00539.1"
FT                   /translation="MTMALSPSSPESPAGASRGKALAAAAIRLGALATFAAIMAYFALT
FT                   ARGFATPFNIVNVIEQSAILGILAFGMSVVIIGGGSEVQTGGIDLSLAANAGLCAAVFA
FT                   TATNAGLPAPMAIAATLGTGMLVGAVNGFAVVGLGILPLLATLASMNIVAGIELTLTEN
FT                   TVLSTSSPMLSVLSSGRFLGISALAWVLIAASVIVGLVIHRTPVGLRLYAVGGHPEAAR
FT                   AAGLNVGLHVWGTYVFAGLCAGLAAILIVSRLSASTPGTGELLLSILAAALLGTVFSRR
FT                   FVPTVGGTVLSVIFIGFLANGFQLLHLSSYWVSGVQGALILLVVAVTSYARPQEH"
FT   gene            676803..677780
FT                   /locus_tag="RSKD131_0680"
FT   CDS_pept        676803..677780
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0680"
FT                   /product="Inner-membrane translocator precursor"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0680"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00540"
FT                   /db_xref="GOA:B9KQ33"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:B9KQ33"
FT                   /protein_id="ACM00540.1"
FT                   /translation="MSLSLSRHLPKDRESFSTLAVLVAFVGLFLVFATQADAFLTLGNL
FT                   RNVLVNNVVLLAIVALGVTFVVSSGGIDLSVGVSVDMASLVFVSALAAGVAAPLGLAAG
FT                   LGAALLVGLLNAILIARLKISPFLATLGVLFIGQSVQRLATGGGQPIYLVTKDYAEIFN
FT                   AISRSSLLGVPTPVWVLILCVLATWLALHRMGFGRQVQAIGARPGVAWYSGIRVPSRLT
FT                   QVYILAAVLAGITGILLSATVRSYVPMSGNAFLLDAIGATFIGTTISRERRPSILGTLL
FT                   GVALLAMVKNGLLLIGWNFYWQQVGIGVLVFAVLALSFGLQRRH"
FT   gene            677796..678746
FT                   /locus_tag="RSKD131_0681"
FT   CDS_pept        677796..678746
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0681"
FT                   /product="PfkB domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0681"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00541"
FT                   /db_xref="GOA:B9KQ34"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:B9KQ34"
FT                   /protein_id="ACM00541.1"
FT                   /translation="MPTYDVSSIGFYVCDILGRPVTRIPDGGRADYIQEIRMTVAGTAG
FT                   ATAADCAILGLKTLAVTTVGEDEMGDFMVAKLTRFGVDCAMVARDGSVQTSATILPVRP
FT                   NGERPALHVPGTAATFRIPEGRLDAALDARIVHVGGTGLLKSFDGAPTVEALRRAKELG
FT                   RITTFDLIQATPETFELVRPCLPYIDYFVPSIEEASEMAGTADPAEVARFFKGLGVKNA
FT                   ILTMGGEGVYVSPEAGEDFRLPAHAIEVVDTTGCGDSFTAGVIVGLARGWDLRDCCRFA
FT                   SAVAARVALGLGSDGKLVSFEDTIEAMNTLPLRAN"
FT   gene            678757..679503
FT                   /locus_tag="RSKD131_0682"
FT   CDS_pept        678757..679503
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0682"
FT                   /product="Short-chain dehydrogenase/reductase SDR
FT                   precursor"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0682"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00542"
FT                   /db_xref="GOA:B9KQ35"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B9KQ35"
FT                   /protein_id="ACM00542.1"
FT                   /translation="MTKTAVVTGAARGIGRALAVGLAEAGYDVAVTDLASQADGLAETR
FT                   ALIEAAGRRAFVETVDVSDRAAVFAAMARIEEAAGGIDVLVNNAGILKPARLEDLSEAD
FT                   WDAHMDVNVKGVLSCCQAVLPGMRARKAGRIVNIASIAGRQGVPTQGHYAATKAAVITL
FT                   TRVLAQEAGMDGITVNAICPGIILTEMGKNNLGSDEAIRHWEEVAALKRLGAPEDIVGP
FT                   VLFFAGEQSAFVTGQALNVCGGIYFH"
FT   gene            679757..681175
FT                   /locus_tag="RSKD131_0683"
FT   CDS_pept        679757..681175
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0683"
FT                   /product="Aldehyde dehydrogenase precursor"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0683"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00543"
FT                   /db_xref="GOA:B9KQ36"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniProtKB/TrEMBL:B9KQ36"
FT                   /protein_id="ACM00543.1"
FT                   /translation="MRNIDRFFIGGVWTAPLGTDRHRLVNPATEEEIAAIPMASAEDVE
FT                   RAVASARAAFEGWQASSKEERLALLRRLLDLYNEAYDELAELMTREMGTVARFSREAQA
FT                   WVGRAHLEAAIEALEAESFEEMRGSTLISKEPIGVCALITPWNWPMNQLVVKVAPALAA
FT                   GCTVVAKPSEFSPLSSIRFAELVEAAGFPPGVYNHITGAGPVAGEALARHPDVDMISIT
FT                   GSTRAGIAVARAAADTVKRVTQELGGKSANIILRDADLATAVRQGVLDCFGNAGQACKA
FT                   PARMLVPAERMEEAAALAGAAAEALTVGAPEGEVDLGPVVNESQWRRIQSLIEAGIAEG
FT                   ARLVTGGPGRPDHLPRGWYVRPTVFADVAHGSTIATEEIFGPVVALIPYRDEEEAIRIA
FT                   NDSIYGLAGYIQTGDPETARRIARKLRVGMVYINGAGWDARAPFGGYKQSGNGREHGAW
FT                   GLADYLETKATAGL"
FT   gene            681172..682341
FT                   /locus_tag="RSKD131_0684"
FT   CDS_pept        681172..682341
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0684"
FT                   /product="Major facilitator superfamily MFS_1 precursor"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0684"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00544"
FT                   /db_xref="GOA:B9KQ37"
FT                   /db_xref="InterPro:IPR010645"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B9KQ37"
FT                   /protein_id="ACM00544.1"
FT                   /translation="MTSAYRNALLLSLGPAAGIGLGRFAYALLLPAMQADLGWSYAAAG
FT                   WINAANAAGYLGGAMLAPALAQRVGAARAFAAGLAMLLPALAAVALTRDVAALAALRLL
FT                   AGASGGVVFVCGGLLAVGLSLRAGSGGLVLGTFYAGTGLGMILSALAVAPLLGIAGATH
FT                   WPQGWLILAGLSALCAALALLPLRDGLGASVRQAGSRGPTPLRFWRILAGYLLFGLGSI
FT                   GYMTFIYGHLAESAGGWRQAMLFWCALGLAAVAAPSIWRRLIGGASPERSFALLVATNA
FT                   LGSVLPFLMPGALGLWLSAFLFGSTFFSTVAATSAFASALPQAFDRGRAIRAFTIAFAL
FT                   GQFGGPVVLGWTADLTGRLDAPLMFASLVVLAGALLGVLERRPDAIDGA"
FT   gene            682338..682517
FT                   /locus_tag="RSKD131_0685"
FT   CDS_pept        682338..682517
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0685"
FT                   /product="Hypothetical Protein"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0685"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00545"
FT                   /db_xref="UniProtKB/TrEMBL:B9KQ38"
FT                   /protein_id="ACM00545.1"
FT                   /translation="MTRARTGEGAWQGRPPLLAPQAKRRKIRQQATGRRPQGFLPPIRL
FT                   LPCGEIAPGHTAII"
FT   gene            682571..683095
FT                   /locus_tag="RSKD131_0686"
FT   CDS_pept        682571..683095
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0686"
FT                   /product="Hypothetical Protein"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0686"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00546"
FT                   /db_xref="GOA:B9KQ39"
FT                   /db_xref="UniProtKB/TrEMBL:B9KQ39"
FT                   /protein_id="ACM00546.1"
FT                   /translation="MTRLLHFGTIAGLASLFGVLVPPHALDELMLPLIAVLPVVASVLV
FT                   LRAGTPMPSAGWERIDPVRRHRFTRRLVERTLAYRRAVFILSGSFLALAAMFAVGKGGV
FT                   LDGLLSQRQEQLVAAVVGGLIGLCGSCLPEILRRECAVADIQKRLLDELPVFRANRPGA
FT                   QVIRLVPRAGA"
FT   gene            683182..684627
FT                   /locus_tag="RSKD131_0687"
FT   CDS_pept        683182..684627
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0687"
FT                   /product="Hypothetical Protein"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0687"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00547"
FT                   /db_xref="GOA:B9KQ40"
FT                   /db_xref="InterPro:IPR003846"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9KQ40"
FT                   /protein_id="ACM00547.1"
FT                   /translation="MTFRFDNSYARDLEGFYVDWPAAPVPAPRLLRLNRPLAEELGLDP
FT                   DLLEREGAEIFSGRRLPEGAHPLAQAYAGHQFGGFSPQLGDGRALLIGEITDRAGRRRD
FT                   LQLKGSGRTPFSRGADGKAALGPVLREYLVGEAMHGLGIPTTRALAAVATGEPLLRQEG
FT                   ERPGAILTRVAASHIRVGTFQFFAARSDIDRVRRLADYAIARHYPELASAPEPYLAFYE
FT                   AVAEAQAQLVARWMLVGFIHGVMNTDNMTISGETIDYGPCAFMEGYDPGTVFSSIDLQG
FT                   RYAYGNQPYILAWNLARLGEALLPLLDADAERATDKANSVLETVGARYQGHWLAGMRAK
FT                   LGLAGAEEGDARLAEDLLEAMRNQRADWTLTFRRLAEAVTDEGTLRPLFRDPAALEAWL
FT                   PRWRARLAPDAAERMRATNPIYIARNHRVEEALAAAHAGDLAPFDRLLEALADPFTERA
FT                   DRELFALPAPEGFDDSYRTFCGT"
FT   gene            684672..685862
FT                   /locus_tag="RSKD131_0688"
FT   CDS_pept        684672..685862
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0688"
FT                   /product="2-amino-3-ketobutyrate coenzyme A ligase"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0688"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00548"
FT                   /db_xref="GOA:B9KQ41"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR011282"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:B9KQ41"
FT                   /protein_id="ACM00548.1"
FT                   /translation="MSGRDAFLAGMRELLEGIEAEGLTKRERPILSAQGTHVRVGDRDL
FT                   LNLCANNYLGLANHPALIEAARRGMDEHGYGMASVRFICGTQDIHRALEGRIARFLGME
FT                   DAILFAACFDANGGLFEPLLGPEDAVISDALNHASIIDGIRLCKARRYRYANSDMEDLR
FT                   RQLAAARAAGARHILLATDGVFSMDGYLARLPEIVALAEEFGALVMVDDCHATGFMGPK
FT                   GQGTPAHHGVTVDILTGTLGKALGGALGGYVAGPQPVIDLLRQRARPYLFSNALPPAVV
FT                   AAGLAALDLVEAADDLRAALFENTAYWRAGLTEAGFRLLPGAHPIVPVMLGEARLAQEM
FT                   AVALYDRGVYVSGFFFPVVPRGQARIRTQMNAALTRDDLDLALAAFREAGRAVGAI"
FT   gene            685862..686887
FT                   /locus_tag="RSKD131_0689"
FT   CDS_pept        685862..686887
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0689"
FT                   /product="L-threonine 3-dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0689"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00549"
FT                   /db_xref="GOA:B9KQ42"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B9KQ42"
FT                   /protein_id="ACM00549.1"
FT                   /translation="MRALVKAKAEPGLWMAERPVPEIGPDEVLIRVRKTGICGTDVHIW
FT                   NWDDWAAKTVPVPLVTGHEFAGEIVEVGRDVRDLSPGQRCSGEGHLIGHHSRQVRAGRF
FT                   HLDPETRGIGVNVPGAFADYLRLPAFNVVPLPDAIDDEVGAILDPLGNAVHTALSFDLV
FT                   GEDVLVTGAGPIGIMAAAVARHVGARHVVITDVNADRLRLSTEVADVVPVNVATEDLRS
FT                   VMGRLKIVQGFDVGMEMSGAPAGFDQMVEAMVMGGRIAMLGIPPGRSPVDWSRIVFKAL
FT                   TIKGVYGREIFETWYKMIAMLENGLDIRRVITHRFPVADFAEGFAAMRSGASGKVVLDW
FT                   G"
FT   gene            complement(687079..688341)
FT                   /locus_tag="RSKD131_0690"
FT   CDS_pept        complement(687079..688341)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0690"
FT                   /product="fatty acid beta hydroxylase"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0690"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00550"
FT                   /db_xref="GOA:B9KQ43"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR036396"
FT                   /db_xref="UniProtKB/TrEMBL:B9KQ43"
FT                   /protein_id="ACM00550.1"
FT                   /translation="MPRDPRIDASMALMSEGYRFVSNLCDRMDSDAVTTRLRLREVVCL
FT                   RGSAAARLLYGAEGLTRVGAMPSTVLHLLQDKGSVQQLEGPAHWHRKALFLSICMDPAR
FT                   VEALVSEMRLAWRERLPAWEAEGKIVLQQEAARLLTRAGCRWAGVAHQPEAQLADEIFD
FT                   MIDKAGSIGPRNWLAQMRRAGTEKRLRTLVEEVRAGEVVPEAATALHAIAFHREEDGTL
FT                   LDPSVAAVELLNLLRPIVAVGRYITFAALALHRETTWRELFRSGNLELAGDFAEEVRRA
FT                   SPFFPFTAAVTTRPITWEGYDVPEGQWLLLDLYGTTHDPRHFPEATRFRAERMLSWTGQ
FT                   DEAFIPQGAGDVARTHRCPGEMITVELMKEAIRLLCCEMDYEVPAQDLGVRLNRMPAQP
FT                   RSGMILSAIRRRSGTEPSGDG"
FT   gene            complement(688512..688712)
FT                   /locus_tag="RSKD131_0691"
FT   CDS_pept        complement(688512..688712)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0691"
FT                   /product="Hypothetical Protein"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0691"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00551"
FT                   /db_xref="UniProtKB/TrEMBL:B9KQ44"
FT                   /protein_id="ACM00551.1"
FT                   /translation="MLTSAVVLGAFGALAVRHLMSGRRSTHYPEVRQAGRDAMRDPPRD
FT                   WDRLDETLDESFPASDPPATY"
FT   gene            complement(688802..690934)
FT                   /locus_tag="RSKD131_0692"
FT   CDS_pept        complement(688802..690934)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0692"
FT                   /product="Catalase"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0692"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00552"
FT                   /db_xref="GOA:B9KQ45"
FT                   /db_xref="InterPro:IPR002226"
FT                   /db_xref="InterPro:IPR010582"
FT                   /db_xref="InterPro:IPR011614"
FT                   /db_xref="InterPro:IPR018028"
FT                   /db_xref="InterPro:IPR020835"
FT                   /db_xref="InterPro:IPR024708"
FT                   /db_xref="InterPro:IPR024712"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR037060"
FT                   /db_xref="InterPro:IPR041399"
FT                   /db_xref="UniProtKB/TrEMBL:B9KQ45"
FT                   /protein_id="ACM00552.1"
FT                   /translation="MAEDKPAARSGSFENLVSDYGAGGEFHQHASEGDERLTTAQGVTI
FT                   ADNQNSLRSGAPGPTALEDFILREKIFHFDHERIPERVVHARGFGAHGLFECTKAIPEI
FT                   TRAAPFQKEGKITETFVRFSTVAGSKGSVDLARDVRGFAVKFYTDEGNWDLVGNNIPVF
FT                   FIQDAIKFPDLIHSVKPEPDRGFPQAQSAHDNFWDFISLTPESMHMVMWQMSDRAIPRS
FT                   FRFMEGFGVHTFRFINAEGQSSFVKFHWKPKLGMQSVLWDEALKINGADPDRHRRDLWE
FT                   AIAAGDFPEWELGLQIFDEEFANRFDFDVLDPTKIVPEELVPLTIVGTLTLDRVVDNFF
FT                   AETEQVAFCTQNVVPGIDFTDDPLLQGRNFSYLDTQLKRLGSPNFTKLPINAPRGCPVH
FT                   NFQQDGHMQTSNRKGRVNYEPNGWGKGPRAHPLEGYVSYAVRNEGEKRRLRPESFADHY
FT                   SQARQFFLSQTPVEQGHIRDALVFELSKCQEIEIRARIVAHLLNIDGALAQAVADGLGL
FT                   TEMPEPAPAARPTRTDLPPSDALSMLKNPPPNFAGRTVGVLAGNGVEAELLTELRSILQ
FT                   AEGAMMKLVAPRVGGVTDSTGTLHPADEKLGGGPSVIFDAVAVLPGSDAAMLAANPAAK
FT                   DFLTDAHAHCKFIAHHGAGPLIEACALGAKLDEGWIEIGSSSDIDGFVAACRGMRHWPR
FT                   EATLGGNPPLARTFSP"
FT   gene            complement(691055..691582)
FT                   /locus_tag="RSKD131_0693"
FT   CDS_pept        complement(691055..691582)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0693"
FT                   /product="Hypothetical Protein"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0693"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00553"
FT                   /db_xref="UniProtKB/TrEMBL:B9KQ46"
FT                   /protein_id="ACM00553.1"
FT                   /translation="MERLSMRKIAFTASLLALAAAPGFAQSGADGMDPTRPVAPETGTG
FT                   SIKDISQQTWSDDVRDVFFEDAAMTSLRATDEMEKRWAALDPEAKERAVRDCQAYLMDA
FT                   GSMGGASSGGIGGALTPDADEAGTTGEDLGGADTPAPAPEDTTNASDAPASPGDASVWT
FT                   QACSFVTSFKPQ"
FT   gene            691701..692255
FT                   /locus_tag="RSKD131_0694"
FT   CDS_pept        691701..692255
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0694"
FT                   /product="3-methyladenine DNA glycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0694"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00554"
FT                   /db_xref="GOA:B9KQ47"
FT                   /db_xref="InterPro:IPR003180"
FT                   /db_xref="InterPro:IPR011034"
FT                   /db_xref="InterPro:IPR036995"
FT                   /db_xref="UniProtKB/TrEMBL:B9KQ47"
FT                   /protein_id="ACM00554.1"
FT                   /translation="MEGQAACFAREAPAVAVDLLGAHLQVRGVGGRIVETEAYTPDDPA
FT                   SHSFRGPTPRNAAMFGPPGCAYVYLSYGIHLCLNVVCAPGHAVLIRALEPTEGLAQMAA
FT                   RRGTDVARLLCSGPGRIGQALGLTLADDGTAFGTRGFALRRGAPVAAGEILSGPRIGIS
FT                   RAADMPWRFGLRGSLCLSRRF"
FT   gene            692328..692489
FT                   /locus_tag="RSKD131_0695"
FT   CDS_pept        692328..692489
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0695"
FT                   /product="Hypothetical Protein"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0695"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00555"
FT                   /db_xref="UniProtKB/TrEMBL:B9KQ48"
FT                   /protein_id="ACM00555.1"
FT                   /translation="MTNDLQLGPNDPPAPDPMPEPNPYPDPMPDPDPIPPGDPDMPNPG
FT                   EETPPIYS"
FT   gene            complement(692561..693670)
FT                   /locus_tag="RSKD131_0696"
FT   CDS_pept        complement(692561..693670)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0696"
FT                   /product="Hypothetical Protein"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0696"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00556"
FT                   /db_xref="InterPro:IPR022062"
FT                   /db_xref="UniProtKB/TrEMBL:B9KQ49"
FT                   /protein_id="ACM00556.1"
FT                   /translation="MNADKIEREVEENRARVESTLDALKERMSVNQVVDDLANFVRVED
FT                   LRGVMHSAGRQVRDNPVALGLIGVGLAWLAFGGSSSRSRHVSAYDREEYYRSDYGPAGR
FT                   SYEPYGGGASYRSDRGEGVVSRVKHAVSDAADSVSRAAHSATDKVAETFGDARDRAGSL
FT                   RDDVYDRAGRMREDAYDRAGHWRDDLGERSSHLRDRAGHLRDRASHGAHQMRDSMSHGM
FT                   EQQPLLVGAAAVALGAVIGAALPRTRTEDEWMGRTSDELWDEAKASSWELRERAMKAAR
FT                   GTYDATIAAARDEGLVPEKGETLASKVGRVADAAASEAKAQVEPVLHGKDEDKSSTGMS
FT                   SAGAGSTGSTDSTTKGPGTSGPKVAGSGF"
FT   gene            complement(693670..694050)
FT                   /locus_tag="RSKD131_0697"
FT   CDS_pept        complement(693670..694050)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0697"
FT                   /product="Hypothetical Protein"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0697"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00557"
FT                   /db_xref="GOA:B9KQ50"
FT                   /db_xref="InterPro:IPR009937"
FT                   /db_xref="UniProtKB/TrEMBL:B9KQ50"
FT                   /protein_id="ACM00557.1"
FT                   /translation="MPEDRSLGDLLSDLVRDVTGLVRSESRLIRAEVAEAGRSMAVGAE
FT                   MIAAGGILLLVALLVLVQALVVLLAHWVGPAWAALIVGAVLAVIGGLLIARGRKDMSAA
FT                   NLVPERTIEQTSRDVRLAREQI"
FT   gene            complement(694058..694969)
FT                   /locus_tag="RSKD131_0698"
FT   CDS_pept        complement(694058..694969)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0698"
FT                   /product="Hypothetical Protein"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0698"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00558"
FT                   /db_xref="UniProtKB/TrEMBL:B9KQ51"
FT                   /protein_id="ACM00558.1"
FT                   /translation="MAGGACFWATQAGTGRRARLRPQKCEEIRMQTDKNMTGSGTASDP
FT                   SGRPGFTDTAREAARREMDDARERLHGAAGRAREEANRARSSVSRLVLDEMDRRKEDLC
FT                   DSIHGIAQSMRKGAEEAEKRDDAPAPPQMIHRAIHTLDDMADRMRHRSAEDMTRSVARF
FT                   GRENPALFVGGALFAGLAIGRFLVSSSNRPRGRDWDEGDAMRADRWRGAAPGSSAHERA
FT                   SHEPLGAKPHDVGGQNRPSMAGQPGAAPFSAPGGAAMPGTEPPRPGSANEATARSTGMA
FT                   PTAASVKPHGSGPTSGGKDGGS"
FT   gene            695085..695582
FT                   /locus_tag="RSKD131_0699"
FT   CDS_pept        695085..695582
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0699"
FT                   /product="Hypothetical Protein"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0699"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00559"
FT                   /db_xref="GOA:B9KQ52"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="InterPro:IPR038725"
FT                   /db_xref="UniProtKB/TrEMBL:B9KQ52"
FT                   /protein_id="ACM00559.1"
FT                   /translation="MADTKLAQTDPKAALWKQLGKLRAGMLGVEGSGQHMQPMSHHCDE
FT                   AAAKLWFLTKRSTDLFRAIGPSSTAHFCIIAHDEDFHACLSGHIAEETDRAKLDEMWNP
FT                   VVAAWFEGKDDPDLVMVSVNLRSAAIWASTSSTARFAYEIAKANVTDSDPEVGVHNVVT
FT                   FA"
FT   gene            complement(695662..696168)
FT                   /locus_tag="RSKD131_0700"
FT   CDS_pept        complement(695662..696168)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0700"
FT                   /product="Hypothetical Protein"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0700"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00560"
FT                   /db_xref="UniProtKB/TrEMBL:B9KQ53"
FT                   /protein_id="ACM00560.1"
FT                   /translation="MTAGAVIGRAALPSSPSRASRSQNDRSAASGGRLRSALSGHGAYA
FT                   RANVPGCGPGTGPSDLFRRPSGRRAGLGLTGFRGRVRLHDPLRAGRLSGGSLIPVGRRG
FT                   GRLIPMRRRRCAVRGLRVARPGGRGVKAARLTLRGHEAEPADRQHGQENDDSEHICHLN
FT                   LPLAR"
FT   gene            696379..696810
FT                   /locus_tag="RSKD131_0701"
FT   CDS_pept        696379..696810
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0701"
FT                   /product="Phosphate-starvation-inducible E"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0701"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00561"
FT                   /db_xref="GOA:B9KQ54"
FT                   /db_xref="InterPro:IPR009315"
FT                   /db_xref="InterPro:IPR020948"
FT                   /db_xref="UniProtKB/TrEMBL:B9KQ54"
FT                   /protein_id="ACM00561.1"
FT                   /translation="MKSSGDVPVTEDENDGAVDAGRTEKLVMVAALGVIERGLLILVAL
FT                   MTLAATSVEILSIVERRSVNLGDILLMFLYTEVIAMVAVFYTGKGLPFVYPIFIAITAL
FT                   ARLIVLQGKDMDPQNIVLEASAILLLAIAAVVLLRFARR"
FT   gene            complement(696813..697907)
FT                   /locus_tag="RSKD131_0702"
FT   CDS_pept        complement(696813..697907)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0702"
FT                   /product="Translation initiation factor 2B subunit I
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0702"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00562"
FT                   /db_xref="GOA:B9KQ55"
FT                   /db_xref="InterPro:IPR000649"
FT                   /db_xref="InterPro:IPR005251"
FT                   /db_xref="InterPro:IPR011559"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9KQ55"
FT                   /protein_id="ACM00562.1"
FT                   /translation="MKINGTPFRSIWCEAGEVRIIDQRWLPHELRIVPLRTRAEFAAAI
FT                   RDMWVRGAPLIGATAAWGMAVQMAEDPSDASLAETWQVLHETRPTAINLRWALNEMRRL
FT                   LAPLPPSERAAAAARRAAEICDEDVEINRRIGAHGLTLIREIAERKRGRVNILTHCNAG
FT                   WLATVDWGTATSPIYHALEAGIDVHVFVDETRPRNQGALLTAWEMNSHGVSHDLIVDNA
FT                   GGHLMQHGEVDLVIVGTDRTTAQGDVCNKIGTYLKALAAKANGVPFYVALPSPTIDWTV
FT                   RDGVAEIPIEERSSAEVTHVQGKAPDGSVISVQISPDGTGARNPAFDVTPASLVTGLIT
FT                   ERGICAAEAGAMEALFPEAARSAA"
FT   gene            complement(698019..698453)
FT                   /locus_tag="RSKD131_0703"
FT   CDS_pept        complement(698019..698453)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0703"
FT                   /product="Hypothetical Protein"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0703"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00563"
FT                   /db_xref="InterPro:IPR009562"
FT                   /db_xref="UniProtKB/TrEMBL:B9KQ56"
FT                   /protein_id="ACM00563.1"
FT                   /translation="MIRYSLRCPEDHGFESWFQSSDAFDDLLAAGRVACPVCGSSSVEK
FT                   VLMAPAVRPARKAAAAPPPKPLSAPASQMEEAFRALRRQVEENSEYVGMNFATEARKIH
FT                   EGDAPERAIYGEAKPEEARRLIEDGVPVAPLPFLPQRKVN"
FT   gene            complement(698525..699025)
FT                   /locus_tag="RSKD131_0704"
FT   CDS_pept        complement(698525..699025)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0704"
FT                   /product="NUDIX hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_0704"
FT                   /db_xref="EnsemblGenomes-Tr:ACM00564"
FT                   /db_xref="GOA:B9KQ57"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="UniProtKB/TrEMBL:B9KQ57"
FT                   /protein_id="ACM00564.1"
FT                   /translation="MGEGRHIGLTSNGSGEVRPQCGAICWRLEGGELQVLLITSRDTGR
FT                   WVIPKGGRIEGLDDADSAAQEAWEEAGIQGEIAPQPLGRFTYQKIARNAASIACEVVVF
FT                   PLAVEDMSDVFPERGQRKRKWFTRDKAARKVAEPGLREILVRFDPAPEPDPERDDGLPL
FT                   GDY"
FT   gene            699292..699840
FT                   /locus_tag="RSKD131_0705"
FT   CDS_pept        699292..699840
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RSKD131_0705"
FT                   /product="Glutathione peroxidase precursor"
FT                   /db_xref="EnsemblGenomes-Gn:RSKD131_