(data stored in SCRATCH zone)

EMBL: CP001163

ID   CP001163; SV 1; circular; genomic DNA; STD; PRO; 94644 BP.
XX
AC   CP001163; ABHN01000000-ABHN01000063;
XX
PR   Project:PRJNA27739;
XX
DT   10-OCT-2008 (Rel. 97, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 6)
XX
DE   Escherichia coli O157:H7 str. EC4115 plasmid pO157, complete sequence.
XX
KW   .
XX
OS   Escherichia coli O157:H7 str. EC4115
OC   Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales;
OC   Enterobacteriaceae; Escherichia.
OG   Plasmid pO157
XX
RN   [1]
RP   1-94644
RX   PUBMED; 22135463.
RA   Eppinger M., Mammel M.K., Leclerc J.E., Ravel J., Cebula T.A.;
RT   "Genomic anatomy of Escherichia coli O157:H7 outbreaks";
RL   Proc. Natl. Acad. Sci. U.S.A. 108(50):20142-20147(2011).
XX
RN   [2]
RP   1-94644
RA   Eppinger M., Sebastian Y., Ravel J.;
RT   ;
RL   Submitted (25-SEP-2008) to the INSDC.
RL   J. Craig Venter Institute, 9704 Medical Center Drive, Rockville, MD 20850,
RL   USA
XX
DR   MD5; d6d169f677840bbe7cfa3cd7454ce90c.
DR   BioSample; SAMN02603441.
DR   EnsemblGenomes-Gn; EBG00001001176.
DR   EnsemblGenomes-Gn; EBG00001001177.
DR   EnsemblGenomes-Gn; ECH74115_B0088.
DR   EnsemblGenomes-Tr; EBT00001527248.
DR   EnsemblGenomes-Tr; EBT00001527249.
DR   EnsemblGenomes-Tr; ECH74115_B0088-1.
DR   EuropePMC; PMC2945939; 20831800.
DR   RFAM; RF00042; CopA.
DR   RFAM; RF01497; ALIL.
DR   RFAM; RF01794; sok.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..94644
FT                   /organism="Escherichia coli O157:H7 str. EC4115"
FT                   /plasmid="pO157"
FT                   /strain="EC4115"
FT                   /mol_type="genomic DNA"
FT                   /serovar="O157:H7"
FT                   /db_xref="taxon:444450"
FT   gene            196..711
FT                   /locus_tag="ECH74115_B0017"
FT   CDS_pept        196..711
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH74115_B0017"
FT                   /product="hemolysin-activating lysine-acyltransferase HlyC"
FT                   /note="identified by match to protein family HMM PF02794"
FT                   /db_xref="EnsemblGenomes-Gn:ECH74115_B0017"
FT                   /db_xref="EnsemblGenomes-Tr:ACI34481"
FT                   /protein_id="ACI34481.1"
FT                   /translation="MKSNAFDVMGKVAWLWACSPLHKKWPLSVFAINVIPAIQTNQFAL
FT                   LIKDELPVAFCSWASLDLECEVKYINDVTSLYAKDWMSGERKWFIDWIAPFGHNMELYK
FT                   YMRKKYPYELFRAIRLDESSKTGKIAEFHGGGIDKKLASKIFRQYHHELMSEVKNRQDF
FT                   NFNIEKEN"
FT   gene            713..3709
FT                   /locus_tag="ECH74115_B0018"
FT   CDS_pept        713..3709
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH74115_B0018"
FT                   /product="RTX C-domain protein"
FT                   /note="identified by match to protein family HMM PF00353;
FT                   match to protein family HMM PF02382; match to protein
FT                   family HMM PF08339"
FT                   /db_xref="EnsemblGenomes-Gn:ECH74115_B0018"
FT                   /db_xref="EnsemblGenomes-Tr:ACI34487"
FT                   /protein_id="ACI34487.1"
FT                   /translation="MTVNKIKNIFNNATLTTKSAFNTASSSVRSAGKKLILLIPDNYEA
FT                   QGVGINELVKAADELGIEIHRTERDDTAIANQFFGAAEKVVGLTERGVAIFAPQLDKLL
FT                   QKYQKVGSKIGGTAENVGNNLGKAGTVLSALQNFTGIALSGMALDELLRKQRAGEDISQ
FT                   NDIAKSSIELINQLVDTVSSINSTVDSFSEQLNQLGSFLSSKPRLSSVGGKLQNLPDLG
FT                   PLGDGLDVVSGILSAVSASFILGNSDAHTGTKAAAGIELTTQVLGNVGKAVSQYILAQR
FT                   MAQGLSTTAASAGLITSAVMLAISPLSFLAAADKFERAKQLESYSERFKKLNYEGDALL
FT                   AAFHKETGAIDAALTTINTVLSSVSAGVSAASSASLIGAPISMLVSALTGTISGILEAS
FT                   KQAMFEHVAEKFAARINEWEKEHGKNYFENGYDARHAAFLEDSLSLLADFSRQHAVERA
FT                   VAITQQHWDEKIGELAGITRNADRSQSGKAYINYLENGGLLEAQPKEFTQQVFDPQKGT
FT                   IDLSTGNVSSVLTFITPTFTPGEEVRERKQSGKYEYMTSLIVNGKDTWSVKGIKNHKGV
FT                   YDYSKLIQFVEKNNKHYQARIISELGDKDDVVYSGAGSSEVFAGEGYDTVSYNKTDVGK
FT                   LTIDATGASKPGEYIVSKNMYGDVKVLQEVVKEQEVSVGKRTEKIQYRDFEFRTGGIPY
FT                   DVIDNLHSVEELIGGKHDDEFKGGKFNDIFHGADGNDYIEGNYGNDRLYGDDGDDYISG
FT                   GQGDDQLFGGSGNDKLSGGDGNNYLTGGSGNDELQAHGAYNILSGGTGDDKLYGGGGID
FT                   LLDGGEGNDYLNGGFGNDIYVYGQNYGHHTIADEGGKGDRLHLSDISFDDIAFKRVGND
FT                   LIMNKAINGVLSFNESNDVNGITFKNWFAKDASGADNHLVEVITDKDGREIKVDKIPHN
FT                   NNERSGYIKASNIASEKNMVNITSVANDINKIISSVSGFDSGDERLASLYNLSLHQNNT
FT                   HSTTLTTTV"
FT   gene            3759..5879
FT                   /locus_tag="ECH74115_B0019"
FT   CDS_pept        3759..5879
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH74115_B0019"
FT                   /product="type I secretion system ATPase family protein"
FT                   /note="identified by match to protein family HMM PF00005;
FT                   match to protein family HMM PF00664; match to protein
FT                   family HMM PF03412; match to protein family HMM TIGR01846"
FT                   /db_xref="EnsemblGenomes-Gn:ECH74115_B0019"
FT                   /db_xref="EnsemblGenomes-Tr:ACI34454"
FT                   /protein_id="ACI34454.1"
FT                   /translation="MMSKCSSHNSLYALILLAQYHNITVNAETIRHQYNTHTQDFGVTE
FT                   WLLAAKSIGLKAKYVEKHFSRLSIISLPALIWRDDGKHYILSRITKDSSRYLVYDPEQH
FT                   QSLTFSRDEFEKLYQGKVILVTSRATVVGELAKFDFSWFIPSVVKYRRILLEVLTVSAF
FT                   IQFLALITPLFFQVVMDKVLVHRGFSTLNIITIAFIIVILFEVILTGARTYIFSHTTSR
FT                   IDVELGAKLFRHLLALPVSYFENRRVGETVARVRELEQIRNFLTGQALTSVLDLFFSVI
FT                   FFCVMWYYSPQLTLVILLSLPCYVIWSLFISPLLRRRLDDKFLRNAENQAFLVETVTAI
FT                   NTIKSMAVSPQMIATWDKQLAGYVASSFRVNLVAMTGQQGIQLIQKSVMVISLWMGAHL
FT                   VISGEISIGQLIAFNMLAGQVIAPVIRLAHLWQDFQQVGISVERLGDVLNTPVEKKSGR
FT                   NILPEIQGDIEFKNVRFRYSSDGNVILNNINLYISKGDVIGIVGRSGSGKSTLTKLLQR
FT                   FYIPETGQILIDGHDLSLADPEWLRRQIGVVLQENILLNRSIIDNITLASPAVSMEQAI
FT                   EAARLAGAHDFIRELKEGYNTIVGEQGVGLSGGQRQRIAIARALVTNPRILIFDEATSA
FT                   LDYESENIIMKNMSRICKNRTVIIIAHRLSTVKNANRIIVMDNGFISEDGTHKELISKK
FT                   DSLYAYLYQLQA"
FT   gene            5883..7322
FT                   /locus_tag="ECH74115_B0020"
FT   CDS_pept        5883..7322
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH74115_B0020"
FT                   /product="leukotoxin secretion protein D"
FT                   /note="identified by match to protein family HMM PF00529;
FT                   match to protein family HMM TIGR01843"
FT                   /db_xref="EnsemblGenomes-Gn:ECH74115_B0020"
FT                   /db_xref="EnsemblGenomes-Tr:ACI34482"
FT                   /protein_id="ACI34482.1"
FT                   /translation="MRFYMKGLWDLVCRYKTVFSDVWKIRHTLDAPVREKDEYAFLPAH
FT                   LELIETPVSRRSHFVVWSILLFVIISLLLSVLGKVEVVSVANGKFTHSGRSKEIKPIEN
FT                   AIVEKIMVKDGSFVKKNDPLVELTVPGVESDILKSEASLLYEKTEQYRYAILSESIQRN
FT                   ELPEIRITDFPGGEDNAGGEHFQRVSSLIKEQFMTWQNRKNQKQITLNKKIVERDAALA
FT                   RVSLYEHQVSQEGRKLNDFKYLLNKKAVSQHSVMEQENSYIQAKNEHAVWLAQVSQLEK
FT                   EIELVREELALETNIFRSEIIEKHRKSTDNIVLLEHELEKNRQRKASSFIKAPVSGTVQ
FT                   ELNIHTEGGVVTTAETLMIIVPDNDILEVTASVLNKDIGFIQPGQEVVIKVDAYPYTRH
FT                   GYLTGKVKNITADSVSVPDTGLVFNVIISVDRNDIQGERKKIPVTAGMTVMAEIKTGVR
FT                   SVISYLLSPLKETINESLRER"
FT   gene            7389..7583
FT                   /pseudo
FT                   /locus_tag="ECH74115_B0021"
FT                   /note="transcriptional regulator; this gene contains a
FT                   frame shift which may be the result of sequencing error"
FT   gene            7625..7897
FT                   /pseudo
FT                   /locus_tag="ECH74115_B0022"
FT                   /note="PapX; this gene contains a frame shift which may be
FT                   the result of sequencing error; identified by match to
FT                   protein family HMM PF01047"
FT   gene            complement(7898..8095)
FT                   /locus_tag="ECH74115_B0023"
FT   CDS_pept        complement(7898..8095)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH74115_B0023"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:ECH74115_B0023"
FT                   /db_xref="EnsemblGenomes-Tr:ACI34459"
FT                   /protein_id="ACI34459.1"
FT                   /translation="MHLKYVQNPHSVTLIFLTRKKRGNNQYLSPLHNCRIINYKNKNSG
FT                   FIYMITCNITEKYFEIKPFC"
FT   gene            8417..9157
FT                   /locus_tag="ECH74115_B0024"
FT   CDS_pept        8417..9157
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH74115_B0024"
FT                   /product="site-specific recombinase"
FT                   /note="identified by match to protein family HMM PF00589"
FT                   /db_xref="EnsemblGenomes-Gn:ECH74115_B0024"
FT                   /db_xref="EnsemblGenomes-Tr:ACI34436"
FT                   /protein_id="ACI34436.1"
FT                   /translation="MNNVIPLQNSPERVFLLPIAPGVDFATALSLRRMATSTGATPAYL
FT                   LAPEVSALLFYMPDQRHHMLFATLWNTGMRIGEARMLTPESFDLDGARPFVRILSEKVR
FT                   ARRGRPPKDEVRLVPLTDISYVRQMESWMITTRPRRREPLWAVTDETMRNWLKQAVRRA
FT                   EADGVHFSIPVTPHTFRHSYIMHMLYHRQPRKVIQALAGHRDPRSMEVYTRVFALDMAA
FT                   TLAVPFTGDGRDAAEILRTLPPLR"
FT   gene            9247..9366
FT                   /locus_tag="ECH74115_B0025"
FT   CDS_pept        9247..9366
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH74115_B0025"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECH74115_B0025"
FT                   /db_xref="EnsemblGenomes-Tr:ACI34456"
FT                   /protein_id="ACI34456.1"
FT                   /translation="MFYEGSNASASGYGVTHVRDRQMTAQLQAALQETEYKLQ"
FT   gene            complement(9442..10419)
FT                   /locus_tag="ECH74115_B0026"
FT   CDS_pept        complement(9442..10419)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH74115_B0026"
FT                   /product="initiator RepB protein"
FT                   /note="identified by match to protein family HMM PF01051"
FT                   /db_xref="EnsemblGenomes-Gn:ECH74115_B0026"
FT                   /db_xref="EnsemblGenomes-Tr:ACI34471"
FT                   /protein_id="ACI34471.1"
FT                   /translation="MDKSSGELVTLTPNNNNTVQPVALMRLGVFVPTLKSLKNSKKNTL
FT                   SRTDATEELTRLSLARAEGFDKVEITGPRLDMDNDFKTWVGIIHSFARHNVIGDKVELP
FT                   FVEFAKLCGIPSSQSSRRLRERISPSLKRIAGTVISFSRTDEKHTREYITHLVQSAYYD
FT                   TERDIVQLQADPRLFELYQFDRKVLLQLKAINALKRRESAQALYTFIESLPRDPAPVSL
FT                   ARLRARLNLKSPVFSQNQTVRRAMEQLREIGYLDYTEIQRGRTKLFCIHYRRPRLKAPN
FT                   DESKENPLPPSPAEKVSPEMAEKLALLEKLGITLDDLEKLFKSR"
FT   gene            complement(10412..10582)
FT                   /locus_tag="ECH74115_B0027"
FT   CDS_pept        complement(10412..10582)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH74115_B0027"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:ECH74115_B0027"
FT                   /db_xref="EnsemblGenomes-Tr:ACI34444"
FT                   /protein_id="ACI34444.1"
FT                   /translation="MVSTPDSAVKYRLQVFLQSVSGALTHDLLFILLLSTGRRLSGKRK
FT                   FRHQKTVRRGG"
FT   gene            10719..10832
FT                   /locus_tag="ECH74115_B0029"
FT   CDS_pept        10719..10832
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH74115_B0029"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECH74115_B0029"
FT                   /db_xref="EnsemblGenomes-Tr:ACI34446"
FT                   /protein_id="ACI34446.1"
FT                   /translation="MGIFNGSFVDHSWICLLDRASGYVDKSFQGNSIHNRL"
FT   gene            complement(10827..11027)
FT                   /locus_tag="ECH74115_B0028"
FT   CDS_pept        complement(10827..11027)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH74115_B0028"
FT                   /product="w0044"
FT                   /db_xref="EnsemblGenomes-Gn:ECH74115_B0028"
FT                   /db_xref="EnsemblGenomes-Tr:ACI34503"
FT                   /protein_id="ACI34503.1"
FT                   /translation="MKIYHYTDLNGLKGIIESGSLWATHFSFLNDSNELTHGMNCLENA
FT                   LQYLRDDFNPKTLKFIEQAPL"
FT   gene            complement(11024..11644)
FT                   /locus_tag="ECH74115_B0030"
FT   CDS_pept        complement(11024..11644)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH74115_B0030"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECH74115_B0030"
FT                   /db_xref="EnsemblGenomes-Tr:ACI34430"
FT                   /protein_id="ACI34430.1"
FT                   /translation="MRQERVLRIKAFRRALELGGGERADGCRHFPRWKTELRNFPHSSC
FT                   DLASNTLAYYLKERERCHPCIIFMEGNAGFHEAENSTVHGHVIVLLDGEYIDLTLDQFD
FT                   EYPDYIPYEPVESDGQIGKLLRNIMKHEDPVKTRQIDLDGGEELYAWLRDTADEVLAAD
FT                   PEWQARERSIEEAREAAITVFPFLSDVQKTECEQGPDSQEAAR"
FT   gene            complement(11641..12099)
FT                   /locus_tag="ECH74115_B0031"
FT   CDS_pept        complement(11641..12099)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH74115_B0031"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECH74115_B0031"
FT                   /db_xref="EnsemblGenomes-Tr:ACI34424"
FT                   /protein_id="ACI34424.1"
FT                   /translation="MRAFRARQREQATPLPPELAQLLTGQLGLLWQAAVKQAEAGALAA
FT                   REQADDDIARADKERDEALANVAALESELAVLREVVAERDRLLQEVRELRAEALPLREQ
FT                   VARLTATGEHLAAQLQDTKAELKEAREDGRQLQTELLALARQDGKVKK"
FT   gene            12112..12606
FT                   /locus_tag="ECH74115_B0032"
FT   CDS_pept        12112..12606
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH74115_B0032"
FT                   /product="w0046"
FT                   /db_xref="EnsemblGenomes-Gn:ECH74115_B0032"
FT                   /db_xref="EnsemblGenomes-Tr:ACI34457"
FT                   /protein_id="ACI34457.1"
FT                   /translation="MGQGAAAEVLTDLLVGRVRGAGGDQGGGGVFNAADGVRGEGCHGL
FT                   APVSQGMAPSYARYEKYTIHTIQFIHTVQNLHTLFLFSWSDPVSGGYGSSSPSAQRYIP
FT                   SAQHAVPHSVAHGTICCVVSLDCDAPRRGGKQRYDDFLRWYTSGKSFIQIKSDPYETGM
FT                   R"
FT   gene            12783..13001
FT                   /gene="ccdA2"
FT                   /locus_tag="ECH74115_B0034"
FT   CDS_pept        12783..13001
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ccdA2"
FT                   /locus_tag="ECH74115_B0034"
FT                   /product="post-segregation antitoxin CcdA"
FT                   /note="identified by match to protein family HMM PF07362"
FT                   /db_xref="EnsemblGenomes-Gn:ECH74115_B0034"
FT                   /db_xref="EnsemblGenomes-Tr:ACI34523"
FT                   /protein_id="ACI34523.1"
FT                   /translation="MKQRITVTVDSDSYQLLKAYDVNISGLVSTTMQNEARRLRAERWK
FT                   AENQEGMAEVARFIEMNGSFADENRDW"
FT   gene            complement(12955..13089)
FT                   /pseudo
FT                   /locus_tag="ECH74115_B0033"
FT                   /note="putative IS orf, fragment; this gene contains a
FT                   frame shift which may be the result of sequencing error"
FT   gene            complement(13055..13942)
FT                   /locus_tag="ECH74115_B0035"
FT   CDS_pept        complement(13055..13942)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH74115_B0035"
FT                   /product="IS629, transposase orfB"
FT                   /note="overlaps another CDS with the same product name;
FT                   identified by match to protein family HMM PF00665"
FT                   /db_xref="EnsemblGenomes-Gn:ECH74115_B0035"
FT                   /db_xref="EnsemblGenomes-Tr:ACI34490"
FT                   /protein_id="ACI34490.1"
FT                   /translation="MPLLDKLREQYGVGPVCSELHIAPSTYYHCQQQRHHPDKRSARAQ
FT                   RDDWLKREIQRVYDENHQVYGVRKVWRQLLREGIRVARCTVARLMAVMGLAGVLRGKKV
FT                   RTTVSRKAVSAGDRVNRQFVAERPDQLWVADFTYVSTWQGFVYVAFIIDVFSGCIVGWR
FT                   VSSSMETTFVLDALEQALWARRPSGTVHHSDKGSQYVSLAYTERLKEAKLLASTGSTGD
FT                   SYDNAMAESINGLYKAEVIHRKSWKNRAEVELATLTWVDWYNNRRLLGRLGHIPPAEAE
FT                   KAYYASIRNDDLAA"
FT   gene            complement(13942..14268)
FT                   /locus_tag="ECH74115_B0036"
FT   CDS_pept        complement(13942..14268)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH74115_B0036"
FT                   /product="IS629, transposase orfA"
FT                   /note="overlaps another CDS with the same product name;
FT                   identified by match to protein family HMM PF01527"
FT                   /db_xref="EnsemblGenomes-Gn:ECH74115_B0036"
FT                   /db_xref="EnsemblGenomes-Tr:ACI34472"
FT                   /protein_id="ACI34472.1"
FT                   /translation="MTKNTRFSPEVRQRAVRMVLESQGEYDSQWAAICSIAPKIGCTPE
FT                   TLRVWVRQHERDTGGGDGGLTTAERQRLKELERENRELRRSNDILRQASAYFAKAEFDR
FT                   LWKK"
FT   gene            14367..14621
FT                   /locus_tag="ECH74115_B0037"
FT   CDS_pept        14367..14621
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH74115_B0037"
FT                   /product="cytotoxic protein CcdB"
FT                   /note="identified by match to protein family HMM PF01845"
FT                   /db_xref="EnsemblGenomes-Gn:ECH74115_B0037"
FT                   /db_xref="EnsemblGenomes-Tr:ACI34440"
FT                   /protein_id="ACI34440.1"
FT                   /translation="MDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHIGDESWR
FT                   MMTTDMASVPVSVIGEEVADLSHRENDIKNAINLMFWGI"
FT   gene            14622..15428
FT                   /locus_tag="ECH74115_B0038"
FT   CDS_pept        14622..15428
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH74115_B0038"
FT                   /product="resolvase"
FT                   /note="identified by match to protein family HMM PF00589"
FT                   /db_xref="EnsemblGenomes-Gn:ECH74115_B0038"
FT                   /db_xref="EnsemblGenomes-Tr:ACI34500"
FT                   /protein_id="ACI34500.1"
FT                   /translation="MSGSVIHSQSAVMVPAVYSAGQPASLPVAIDYPAALALRQMSMVH
FT                   DELPKYLLAPEVSALLHYVPNLHRKMLLATLWNTGARINEALALTRGDFSLAPPYPFVQ
FT                   LATLKQRTEKAARTAGRMPAGQQTHRLVPLSDSWYVSQLQTMVATLKIPMERRNRRTGR
FT                   TEKARIWEVTDRTVRTWIGEAVAAAAADGVTFSVPVTPHTFRHSYAMHMLYAGIPLKVL
FT                   QSLMGHKSISSKEVYTKVFALDVAARHRVQFAMPESDAVAMLKQLS"
FT   gene            15440..15562
FT                   /locus_tag="ECH74115_B0039"
FT   CDS_pept        15440..15562
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH74115_B0039"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:ECH74115_B0039"
FT                   /db_xref="EnsemblGenomes-Tr:ACI34478"
FT                   /protein_id="ACI34478.1"
FT                   /translation="MAFIWKCGTEWICCFCLLNREAGCYPLRSERDSRENLPLS"
FT   gene            15622..15741
FT                   /locus_tag="ECH74115_B0040"
FT   CDS_pept        15622..15741
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH74115_B0040"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:ECH74115_B0040"
FT                   /db_xref="EnsemblGenomes-Tr:ACI34489"
FT                   /protein_id="ACI34489.1"
FT                   /translation="MMPASGNENDLNMPSGTIEIFVRCYVEVERIMSAMDRTT"
FT   gene            complement(16151..17038)
FT                   /locus_tag="ECH74115_B0041"
FT   CDS_pept        complement(16151..17038)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH74115_B0041"
FT                   /product="IS629, transposase orfB"
FT                   /note="overlaps another CDS with the same product name;
FT                   identified by match to protein family HMM PF00665"
FT                   /db_xref="EnsemblGenomes-Gn:ECH74115_B0041"
FT                   /db_xref="EnsemblGenomes-Tr:ACI34480"
FT                   /protein_id="ACI34480.1"
FT                   /translation="MPLLDKLREQYGVGPVCSELHIAPSTYYHCQQQRHHPDKRSARAQ
FT                   HDDWLKREIQRVYDENHQVYGVRKVWRQLLREGIRVARCTVARLMAVMGLAGVLRGKKV
FT                   RTTISRKAVAAGDRVNRQFVAERPDQLWVADFTYVSTWQGFVYVAFIIDVFAGYIVGGR
FT                   VSSSMETTFVLDALEQALWARRPSGTIHHSDKGSQYVSLAYTERLKEAGLLASTGSTGD
FT                   SYDNAMAESINGLYKAEVIHRKSWKNRAEVELATLTWVDWYNNRRLLGRLGHTPPAEAE
FT                   KAYYASIGNDDLAA"
FT   gene            complement(17038..17364)
FT                   /locus_tag="ECH74115_B0042"
FT   CDS_pept        complement(17038..17364)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH74115_B0042"
FT                   /product="IS629, transposase orfA"
FT                   /note="overlaps another CDS with the same product name;
FT                   identified by match to protein family HMM PF01527"
FT                   /db_xref="EnsemblGenomes-Gn:ECH74115_B0042"
FT                   /db_xref="EnsemblGenomes-Tr:ACI34513"
FT                   /protein_id="ACI34513.1"
FT                   /translation="MTKNTRFSPEVRQRAIRMVLESQDEYDSQWAAICSIAPKIGCTPE
FT                   TLRVWVRQHERDTGGGDGGLTSAERQRLKELERENRELRRSNDILRQASAYFAKAEFDR
FT                   LWKK"
FT   gene            17440..18195
FT                   /pseudo
FT                   /locus_tag="ECH74115_B0043"
FT                   /note="replication initiation protein (Protein rep)
FT                   (Protein E) (Protein F4); this gene contains a frame shift
FT                   which may be the result of sequencing error; identified by
FT                   match to protein family HMM PF01051"
FT   gene            complement(18675..18827)
FT                   /locus_tag="ECH74115_B0044"
FT   CDS_pept        complement(18675..18827)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH74115_B0044"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:ECH74115_B0044"
FT                   /db_xref="EnsemblGenomes-Tr:ACI34427"
FT                   /protein_id="ACI34427.1"
FT                   /translation="MTSVYALVKCFHEFHSEHPLIIALHFFIKSCNLLQSNNKIAKSSK
FT                   NRKVV"
FT   gene            18792..19949
FT                   /gene="sopA"
FT                   /locus_tag="ECH74115_B0045"
FT   CDS_pept        18792..19949
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sopA"
FT                   /locus_tag="ECH74115_B0045"
FT                   /product="plasmid partition protein A"
FT                   /note="identified by match to protein family HMM PF00376;
FT                   match to protein family HMM PF01656"
FT                   /db_xref="EnsemblGenomes-Gn:ECH74115_B0045"
FT                   /db_xref="EnsemblGenomes-Tr:ACI34522"
FT                   /protein_id="ACI34522.1"
FT                   /translation="METLNQCINAGHEMTKAIAIAQFNDDSPEARKITRRWRIGEAADL
FT                   VGVSSQAIRDAEKAGRLPHPDMEIRGRVEQRVGYTIEQINHMRDVFGTRLRRAEDVFPP
FT                   VIGVAAHKGGVYKTSVSVHLAQDLALKGLRVLLVEGNDPQGTASMYHGWVPDLHIHAED
FT                   TLLPFYLGEKDDVTYAIKPTCWPGLDIIPSCLALHRIETELMGKFDEGKLPTDPHLMLR
FT                   LAIETVAHDYDVIVIDSAPNLGIGTINVVCAADVLIVPTPAELFDYTSALQFFDMLRDL
FT                   LKNVDLKGFEPDVRILLTKYSNSNGSQSPWMEEQIRDAWGSMVLKNVVRETDEVGKGQI
FT                   RMRTVFEQAIDQRSSTGAWRNALSIWEPVCNEIFDRLIKPRWEIR"
FT   gene            19949..20920
FT                   /gene="sopB"
FT                   /locus_tag="ECH74115_B0046"
FT   CDS_pept        19949..20920
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sopB"
FT                   /locus_tag="ECH74115_B0046"
FT                   /product="plasmid partition protein B"
FT                   /note="identified by match to protein family HMM PF02195;
FT                   match to protein family HMM TIGR00180"
FT                   /db_xref="EnsemblGenomes-Gn:ECH74115_B0046"
FT                   /db_xref="EnsemblGenomes-Tr:ACI34524"
FT                   /protein_id="ACI34524.1"
FT                   /translation="MKRAPVIPKHTLNTQPVEDTSLSTPAAPMVDSLIARVGVMARGNA
FT                   ITLPVCGRDVKFTLEVLRGDSVEKTSRVWSGNERDQELLTEDALDDLIPSFLLTGQQTP
FT                   AFGRRVSGVIEIADGSRRRKAAALTESDYRVLVGELDDEQMAALSRLGNDYRPTSAYER
FT                   GQRYASRLQNEFAGNISALADAENISRKIITRCINTAKLPKSVVALFSHPGELSARSGD
FT                   ALQKAFTDKEELLKQQASNLHEQKKAGVIFEAEEVITLLTSVLKTSSASRTSLSSRHQF
FT                   APGATVLYKGDKMVLNLDRSRVPTECIEKIEAILKELEKPAP"
FT   gene            21615..22517
FT                   /locus_tag="ECH74115_B0048"
FT   CDS_pept        21615..22517
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH74115_B0048"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF06924"
FT                   /db_xref="EnsemblGenomes-Gn:ECH74115_B0048"
FT                   /db_xref="EnsemblGenomes-Tr:ACI34423"
FT                   /protein_id="ACI34423.1"
FT                   /translation="MYFSGEPAQIAEIKRLASGAVTPLYRRATNEGIQLFLAGSAGLLQ
FT                   TTEDVRFEPCPGLTAAGRGVVSPENIAFTRWLTHLQDGVLLDEQNCLMLHELWLQSGTG
FT                   RRRWEELPDDARESITALFTPKRGDWCDIWSNEDVSVWWNRLCDNVLPEKTMPFDLLTV
FT                   LSTRLDVEVNGFNGGVLNGVPSAYHWYTEQYGVKWPCGYEVNISSQGDNFIQVDFDTPW
FT                   CQPESDVIAVLSRRFSCMLEHWYAGQGCNFCGWQRYERGELVDVLWGELEWSSPTDDDE
FT                   LPEVTAPEWIVDKVAHYGG"
FT   gene            complement(22468..22689)
FT                   /locus_tag="ECH74115_B0047"
FT   CDS_pept        complement(22468..22689)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH74115_B0047"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECH74115_B0047"
FT                   /db_xref="EnsemblGenomes-Tr:ACI34429"
FT                   /protein_id="ACI34429.1"
FT                   /translation="MPAGSGKSARPVPGRTRDTDHRQRSCRAASAGAVKRGARRHPLPE
FT                   KKRAVARPSPSYFIHRNAPPCRLSTPAR"
FT   gene            complement(22670..22795)
FT                   /locus_tag="ECH74115_B0049"
FT   CDS_pept        complement(22670..22795)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH74115_B0049"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECH74115_B0049"
FT                   /db_xref="EnsemblGenomes-Tr:ACI34428"
FT                   /protein_id="ACI34428.1"
FT                   /translation="MEYRSRRLFDGENMPRKRLEGRSSEKGDGLAYTVTDASRER"
FT   gene            22903..23586
FT                   /locus_tag="ECH74115_B0050"
FT   CDS_pept        22903..23586
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH74115_B0050"
FT                   /product="DNA methylase family protein"
FT                   /note="identified by match to protein family HMM PF01555"
FT                   /db_xref="EnsemblGenomes-Gn:ECH74115_B0050"
FT                   /db_xref="EnsemblGenomes-Tr:ACI34453"
FT                   /protein_id="ACI34453.1"
FT                   /translation="MSRFIQGDCVRVMATIPGNGVDFILTDPPYLVGFRDRQGRTIAGD
FT                   KTDEWLQPACNEMYRVLKKDALMVSFYGWNRVDRFMAAWKNAGFSVVGHLVFTKTYTSK
FT                   AAYVGYRHECAYILAKGRPALPQKPLPDVLGWKYSGNRHHPTEKPVTSLQPLIESFTHP
FT                   NAIVLDPFAGSGSTCVAALQSGRRYIGIELLEQYHRAGQQRLAAVQRAMQQGAANDDWF
FT                   MPEAA"
FT   gene            23587..23808
FT                   /locus_tag="ECH74115_B0051"
FT   CDS_pept        23587..23808
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH74115_B0051"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECH74115_B0051"
FT                   /db_xref="EnsemblGenomes-Tr:ACI34514"
FT                   /protein_id="ACI34514.1"
FT                   /translation="MNYAGHEKLRADVAEVANTMCDLRARLNDMEHRCRFDSDVLVERL
FT                   ARQTLYRANRLFMEAYTEILELDACFKD"
FT   gene            23822..24256
FT                   /locus_tag="ECH74115_B0052"
FT   CDS_pept        23822..24256
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH74115_B0052"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF07128"
FT                   /db_xref="EnsemblGenomes-Gn:ECH74115_B0052"
FT                   /db_xref="EnsemblGenomes-Tr:ACI34443"
FT                   /protein_id="ACI34443.1"
FT                   /translation="MYGTCETLCRELAAKYPGYTPLMLVIWSPEEIQALADGMDISLSD
FT                   PEIRTVLARLEDIPEDQRIESGISSAAAMEIISNVSENRQVTVPAELLASLIQTAEQAL
FT                   WKREWAARDYGLAVPECVTRRQAVVNQARILLKNNTHENG"
FT   gene            24302..25078
FT                   /locus_tag="ECH74115_B0053"
FT   CDS_pept        24302..25078
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH74115_B0053"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECH74115_B0053"
FT                   /db_xref="EnsemblGenomes-Tr:ACI34525"
FT                   /protein_id="ACI34525.1"
FT                   /translation="MNENTTLNALICRHARNLLLAQGWPEETDVDQRNPKYPGWISIYV
FT                   LLDAPRLATLLVNRHGGVLPPHLASAIQKLTGTGAELVLSGSQWQSLPVLPADGTQVSF
FT                   PYAGEWLTEDEIRAVLAAVRDAVRSVSCRVAEDTRRIRAALTTTGQTLLTRQTRRFRLV
FT                   VKESDHPCWLDEDDENLPVVLDAILNRGARFSAVEMYLVSDCIEHILSSGLACDVLRIP
FT                   DEPPRRWFDRGVLREVVREARNEIRSMADALAKIRK"
FT   gene            complement(25208..25501)
FT                   /locus_tag="ECH74115_B0054"
FT   CDS_pept        complement(25208..25501)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH74115_B0054"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECH74115_B0054"
FT                   /db_xref="EnsemblGenomes-Tr:ACI34431"
FT                   /protein_id="ACI34431.1"
FT                   /translation="MHDVFLRCSHIPRHRAVPCLQKSRAIRRGCTGRKGSRSLTHTADG
FT                   SCRVRPRNLSGRTTGKSRQTGRRDRVTAAAKRTLASTPARLRWRHGTARTRR"
FT   gene            25496..25921
FT                   /locus_tag="ECH74115_B0055"
FT   CDS_pept        25496..25921
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH74115_B0055"
FT                   /product="antirestriction protein"
FT                   /note="identified by match to protein family HMM PF03230"
FT                   /db_xref="EnsemblGenomes-Gn:ECH74115_B0055"
FT                   /db_xref="EnsemblGenomes-Tr:ACI34515"
FT                   /protein_id="ACI34515.1"
FT                   /translation="MQYAKPVTLNVEECDRLSFLPYLFGNDFLYAEAYVYALAQKMMPE
FT                   YQGGFWHFIRLPDGGGYMMPDGDRFHMVNGANWFDRTVSADACGIILTSLVINRQLWLY
FT                   HDSGDAGLTQLYRMRDAQLWRHIEFHPECNAIYAALD"
FT   gene            25968..26390
FT                   /locus_tag="ECH74115_B0056"
FT   CDS_pept        25968..26390
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH74115_B0056"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECH74115_B0056"
FT                   /db_xref="EnsemblGenomes-Tr:ACI34486"
FT                   /protein_id="ACI34486.1"
FT                   /translation="MYCTVKEIIRDVLDTDVPDSECVFAVVLTRGDVRHIAQDWNLSDD
FT                   ELETVMQRLDDAFEYGADVSIVHDVVRELMEEKRASRQVTVPAVMLEKVMALAGSEMKR
FT                   LYAVGSENGGDGDAFVREEREAMDVVLQALDGEHMS"
FT   gene            26387..26578
FT                   /locus_tag="ECH74115_B0058"
FT   CDS_pept        26387..26578
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH74115_B0058"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECH74115_B0058"
FT                   /db_xref="EnsemblGenomes-Tr:ACI34448"
FT                   /protein_id="ACI34448.1"
FT                   /translation="MNISTETREILRNYKAVINARRREMGQKPLTTAQIVDEICDFVAN
FT                   QQAVFLGGHYILQGSRNR"
FT   gene            complement(26548..27159)
FT                   /pseudo
FT                   /locus_tag="ECH74115_B0057"
FT                   /note="w0059; this gene contains a frame shift which may be
FT                   the result of sequencing error"
FT   gene            27212..27340
FT                   /locus_tag="ECH74115_B0059"
FT   CDS_pept        27212..27340
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH74115_B0059"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:ECH74115_B0059"
FT                   /db_xref="EnsemblGenomes-Tr:ACI34519"
FT                   /protein_id="ACI34519.1"
FT                   /translation="MSGRGSDAPCGEGSQTGEVHTTGNTAAGSRETSKPRLPKLNG"
FT   gene            complement(27403..27552)
FT                   /locus_tag="ECH74115_B0060"
FT   CDS_pept        complement(27403..27552)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH74115_B0060"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:ECH74115_B0060"
FT                   /db_xref="EnsemblGenomes-Tr:ACI34422"
FT                   /protein_id="ACI34422.1"
FT                   /translation="MVNNAVKIGRTILTAWIKQVPDLLFSYLHLTLSGVFLLLFLRSHY
FT                   LSAG"
FT   gene            27574..27804
FT                   /locus_tag="ECH74115_B0061"
FT   CDS_pept        27574..27804
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH74115_B0061"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECH74115_B0061"
FT                   /db_xref="EnsemblGenomes-Tr:ACI34518"
FT                   /protein_id="ACI34518.1"
FT                   /translation="MTVSIVSPSAAAVKPRRHPRFRREDIPAPEIDPVLKAFGRHIARS
FT                   FHRGRGVHIPAMKNTAFGQVLRTLELKRAFN"
FT   gene            27856..29217
FT                   /locus_tag="ECH74115_B0062"
FT   CDS_pept        27856..29217
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH74115_B0062"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:ECH74115_B0062"
FT                   /db_xref="EnsemblGenomes-Tr:ACI34504"
FT                   /protein_id="ACI34504.1"
FT                   /translation="MTSAAITMTAPEAASPVQMYRATYSPDDNKLRLYAVSRLDPETYK
FT                   KVHDAGFRWAPKQALFVAPAWTPGREDVLLSLAGEIEDEDSTLAERQEARAERFTGYSG
FT                   KRASESAQALDEVERLAAMIPPGQPILVGHHSERRARRDAQRIENGMKRAVMLFERAEY
FT                   WEERGRSALLHAKYKERPDVRWRRIKKIEADLRKAEKTIAQSQKYLTMWRAESLDLNMA
FT                   KLISSHDHISACFPLDTYPRPAEKSQYEGSRSLWSALDDDIITTEQAREIAIRCHERQI
FT                   QHQQRWVNHYQNRLNYERAMLDESGGVVTRTQDFEPGGQVFSRGEWLTIIRVNKSNGAV
FT                   SSVTTPNYSFLGYSGTMKVTPDRITDYKAPSAEEAAVASQAAKRPPVVNYPGEGFREMT
FT                   KAQWAALPRDCKAVRSVAEAEDHGAYRYRRTMDNNFRLVNVYITDMKITEIPQK"
FT   gene            29264..29827
FT                   /locus_tag="ECH74115_B0063"
FT   CDS_pept        29264..29827
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH74115_B0063"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:ECH74115_B0063"
FT                   /db_xref="EnsemblGenomes-Tr:ACI34484"
FT                   /protein_id="ACI34484.1"
FT                   /translation="MHSQLKERIRLMRARLDNAAPVAEIRAESQLFVTPAPVCDRLVTL
FT                   AEISNRDHILEPSAGTGAILRAIRDTAPEAMCDAVEINSGLVRYLRENFNGVRVQCGDF
FT                   MEWQPVQYYSRVIINPPFSHGQDIRHILRAFSLLRPGGVLVAVCLNGPRQQEKLLPFSD
FT                   VREELPRGTFAYTDVPTMIIRLRA"
FT   gene            complement(29913..30380)
FT                   /pseudo
FT                   /locus_tag="ECH74115_B0064"
FT                   /note="w0062; this gene contains a frame shift which may be
FT                   the result of sequencing error"
FT   gene            30495..30656
FT                   /locus_tag="ECH74115_B0065"
FT   CDS_pept        30495..30656
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH74115_B0065"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:ECH74115_B0065"
FT                   /db_xref="EnsemblGenomes-Tr:ACI34442"
FT                   /protein_id="ACI34442.1"
FT                   /translation="MRSAPGQSFPAVAVMPLAAKVLKKVMVNTGGNKRQVPAKRQNRGS
FT                   RNSKDDGG"
FT   gene            30682..31134
FT                   /locus_tag="ECH74115_B0066"
FT   CDS_pept        30682..31134
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH74115_B0066"
FT                   /product="single-strand binding protein"
FT                   /note="identified by match to protein family HMM PF00436;
FT                   match to protein family HMM TIGR00621"
FT                   /db_xref="EnsemblGenomes-Gn:ECH74115_B0066"
FT                   /db_xref="EnsemblGenomes-Tr:ACI34516"
FT                   /protein_id="ACI34516.1"
FT                   /translation="MAVRGINKVILVGRLGKDPEVRYIPNGGAVANLQVATSESWRDKQ
FT                   TGEMREQTEWHRVVLFGKLAEVAGEYLRKGAQVYIEGQLRTRSWEDNGITRYVTEILVK
FT                   TTGTMQMLVRAAGAQTQPEEGQQFSGQPQPQPPEGDDYGFSDDIPF"
FT   gene            31191..31424
FT                   /locus_tag="ECH74115_B0067"
FT   CDS_pept        31191..31424
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH74115_B0067"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF06006"
FT                   /db_xref="EnsemblGenomes-Gn:ECH74115_B0067"
FT                   /db_xref="EnsemblGenomes-Tr:ACI34521"
FT                   /protein_id="ACI34521.1"
FT                   /translation="MSEYFRILQGLPDGPFTRKHAEAVAAQYRNVFIENDHGEQFRLVV
FT                   RNNGAMVWRTWNFEDGAGYWMNHVIRDFGIIK"
FT   gene            31490..33448
FT                   /locus_tag="ECH74115_B0068"
FT   CDS_pept        31490..33448
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH74115_B0068"
FT                   /product="plasmid partition protein B"
FT                   /note="identified by match to protein family HMM PF02195;
FT                   match to protein family HMM TIGR00180"
FT                   /db_xref="EnsemblGenomes-Gn:ECH74115_B0068"
FT                   /db_xref="EnsemblGenomes-Tr:ACI34501"
FT                   /protein_id="ACI34501.1"
FT                   /translation="MSVTESKAKTERKSSRKPAKTQETVLSALLAQTEEVSVPLASLIK
FT                   SPLNVRTVPYSAESVSELADSIKGVGLLQNLVVHALPGDRYGVAAGGRRLAALNMLAER
FT                   DIIPADWPVRVKVIPQELATAASMTENGHRRDMHPAEQIAGFRAMAQEGKTPAQIGDLL
FT                   GYSPRHVQRMLKLADLAPVILDALAEDRITTEHCQALALENDTARQVQVFEAACQSGWG
FT                   GKPEVQTIRRLVTESEVAVAGNSKFRFVGADTFSPDELRTDLFSDDEGGYVDCVALDAA
FT                   LLEKLQAVAEHLREAEGWEWCAGRMEPVGFCREDAGTYRSLPEPEAVLTEAEEERLNEL
FT                   MARYDALENQCEESDLLEAEMKLMRCMAKVRAWTPEMRAGSGVVVSWRYGNVCVQRGVQ
FT                   LRSEDDVADNDYRTEQVQEKASVEEISLPLLTKMSSERTLAVQAALMQQSDKSLALLAW
FT                   TLCLNVFGSGAYSNPARIRLECEHYSLTSDAPSGKEGAAFMAMMAEKARLAALLPDGWA
FT                   RDMTTFLSLSQEVLLSLLSFCTACSIHGVQTREYGHTSRSPLDTLESAIGFHMRDWWQP
FT                   TKANFFGHLKKPQIIAALNEAGLSGAARDAEKMKKGDAAEHAEHHMKDNRWVPGWMCAP
FT                   RPQTDATERTDNLADAA"
FT   gene            33503..33937
FT                   /locus_tag="ECH74115_B0069"
FT   CDS_pept        33503..33937
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH74115_B0069"
FT                   /product="plasmid SOS inhibition protein"
FT                   /note="identified by match to protein family HMM PF06290"
FT                   /db_xref="EnsemblGenomes-Gn:ECH74115_B0069"
FT                   /db_xref="EnsemblGenomes-Tr:ACI34509"
FT                   /protein_id="ACI34509.1"
FT                   /translation="MKTELTLNVLHTMNAQEYEDIRAAGSDARRELTHAVMRELDAPDN
FT                   WTMNGEYGSEFGGFFPVQVRFTPAHERFHLALCSPGDVSQVWVLVLVNAGGEPFAVVQV
FT                   QRRFAPEAVSHSLALAASLDTQGYSVNDIIHILMAEGGQV"
FT   gene            33934..34695
FT                   /locus_tag="ECH74115_B0070"
FT   CDS_pept        33934..34695
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH74115_B0070"
FT                   /product="putative PsiA protein"
FT                   /note="identified by match to protein family HMM PF06952"
FT                   /db_xref="EnsemblGenomes-Gn:ECH74115_B0070"
FT                   /db_xref="EnsemblGenomes-Tr:ACI34438"
FT                   /protein_id="ACI34438.1"
FT                   /translation="MSARSQALVPLSTEQQAAWRAVAETEKRRNQGNTLAEYPYAGAFF
FT                   RCLNGSRRISLSDLRFFMPSLTAEELHGNRLQWLYAIDVLIETQGEVCLLPLPGDAAER
FT                   LFPSVRFCVRERSRHKSALVMQKYSRQQAREAEQKARAYQALVAQAEIELAFHSPETVG
FT                   SWYARWSDRVAEHDLETLFWQWGERFPSLAGMERWQWQDMPFWQVIAEASLAAKEAGHA
FT                   VREMERWMVPNKLREVRDAATITRIARKQPE"
FT   gene            34927..35085
FT                   /gene="hok"
FT                   /locus_tag="ECH74115_B0071"
FT   CDS_pept        34927..35085
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hok"
FT                   /locus_tag="ECH74115_B0071"
FT                   /product="stable plasmid inheritance protein Hok"
FT                   /note="identified by match to protein family HMM PF01848"
FT                   /db_xref="EnsemblGenomes-Gn:ECH74115_B0071"
FT                   /db_xref="EnsemblGenomes-Tr:ACI34495"
FT                   /protein_id="ACI34495.1"
FT                   /translation="MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGYREVAAF
FT                   MAYESGK"
FT   gene            35267..37240
FT                   /locus_tag="ECH74115_B0072"
FT   CDS_pept        35267..37240
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH74115_B0072"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:ECH74115_B0072"
FT                   /db_xref="EnsemblGenomes-Tr:ACI34437"
FT                   /protein_id="ACI34437.1"
FT                   /translation="MSIAGLREEPAQDWLSLHKRLASDGLYITMQEGELVVKDGWDRAR
FT                   EGVALSSFGPLWTAEKLGRKLGEYQPVPTDIFSQVGTPGRYDPEAINVDIRPEKVAETE
FT                   SLKQYACRHFAERLPEMARNGELESCLDVHRTLATAGLWMGIQHGHLVLHDGFDKQQTP
FT                   VRADSVWPLMTLDYMQDLDGGWQPVPKDIFTQVIPGERFRGRNLGTQAVSDYEWYRMRM
FT                   GTGPQGAIKRELFSDKESLWGYTTVQCESLIEDMIAGGNFSWQACHEMFARKGLMLQKQ
FT                   HHGLVIVDAFNHELTPVKASSIHPDLTLSRAEPQAGPFEIAGADIFERVKPECRYNPEL
FT                   AASDEVEPGFRRDPVLRRERREARAAAREDLRARYLAWKEHWRKPDLRYGERLREIHAA
FT                   CRRRKAYIRVQFRDPQLRKLHYHIAEVQRMQALIRLKESVKEERLSLIEEGKWYPLSYR
FT                   QWVEQQAVQGDRAALSQLRGWDYRDRRKDKRRTTNADRCVILCEPGGTPLYEDTGVLEA
FT                   RLQKDGSVRFRDRRNGELVCVDYGDRVVFYHHQDRNELVDKLNLIAPVLFDREPGMGFE
FT                   PEGSYQQFNDVFAEMVAWHNAAGITGNGHFVISRPDVDLHRQRSEQYYHEYIRQQKSIS
FT                   GGHGASYAPVQDNEWTPPSPGM"
FT   gene            37308..37739
FT                   /pseudo
FT                   /locus_tag="ECH74115_B0073"
FT                   /note="conserved hypothetical protein; this gene contains a
FT                   frame shift which may be the result of sequencing error"
FT   gene            complement(38313..38711)
FT                   /pseudo
FT                   /locus_tag="ECH74115_B0074"
FT                   /note="transposase InsF for insertion sequence
FT                   IS3A/B/C/D/E/fA; this region contains one or more premature
FT                   stops and/or frameshifts"
FT   gene            38854..39264
FT                   /locus_tag="ECH74115_B0075"
FT   CDS_pept        38854..39264
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH74115_B0075"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:ECH74115_B0075"
FT                   /db_xref="EnsemblGenomes-Tr:ACI34492"
FT                   /protein_id="ACI34492.1"
FT                   /translation="MLSREDFYMIKQMRQQGAYIVDIATQIGCSERTVRRYLKYPEPPA
FT                   RKTRHKMAEMDYIDMRLAENVWNGEVILAEIKAMGYTGGRSMLLRQFRKTPEQRFTQEH
FT                   SLFFRLLNRRYEKASIVLTSNKGFADWGRDVR"
FT   gene            39533..49042
FT                   /locus_tag="ECH74115_B0076"
FT   CDS_pept        39533..49042
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH74115_B0076"
FT                   /product="glycosyltransferase sugar-binding region
FT                   containing DXD motif family protein"
FT                   /note="identified by match to protein family HMM PF04488;
FT                   match to protein family HMM TIGR01586"
FT                   /db_xref="EnsemblGenomes-Gn:ECH74115_B0076"
FT                   /db_xref="EnsemblGenomes-Tr:ACI34469"
FT                   /protein_id="ACI34469.1"
FT                   /translation="MIHPGSSLDKAINNTRVKNVSTDVKHGQIQERKRNFIYKKNDDIS
FT                   SRFKLYSSLVKQKNATEDVVLIGKMILDEVRSYRTIHNDRNIVSNSGNWKTSFLCNLAR
FT                   LLYSIFNGSNYFCSREGENNSSPSSTLLTIHQPEKQELLQQKSIKHLPTSNNIDGYIKI
FT                   RKTRGAEDQTTTITQSLIINELLNGVDRNTIPFQKISELNDIIHSYENMQIKNSRKGIE
FT                   ILVKQGELLSSLINDNKGNKQLSDNASKIINLLGIEYQSHKVDIEPFIHAVWVAGAPPD
FT                   NTFSYITAFLNTYKDYTYLLWIDPNAFGAAKFSGILKNIAMNYAIMRLRRTNPHLAEEM
FT                   NEVILKIQNIQNETIEFKETRERLKELENRYKSLTSETKEKFNVFFLESMIGMQDNYFT
FT                   YCISNGISNTDDISRLDFLTNVLKLSPEVQNDFKSTVEKNKRDIDLLKNTISQKFGDRF
FT                   QLRDINTLESFKKPQDYFFYQQEMLLRWNYAAASDQVRINILKEYGGIYTDTDILPAYS
FT                   DKVSQIINEKSDDKRFFEDLKLRRIISESILSLIKGEKYSIKHDGLDETTLNQLNNILS
FT                   EIEKLTIDDYFKPVETKVVRDTFKIFKRYQKWTENTWNIRGNNNFMLTHKGSKCIDFIL
FT                   SGQKKQYLELQRIRDNISYNNLFYTTEDLKSLNNVAIGGIPAKKYLEHGLFSEYRQDGT
FT                   IPYVVSTLNISGPDMIMRQMKKYYKSLGRIGEVHIKDNKLSDVNFLGVYASSNKDNKSF
FT                   NWLNPVSVGINDITPDDESSWAVRNNDINKILFEKINCHVPEKLPTSLYYEIDSRSFFQ
FT                   GWDNKSIKHVTEINKDLIKDINLLLTSSNIDVKLLIKLDRELYAISSKIDNPLALRSIR
FT                   TLQLQLANYVTSNTFEPENTINFIYDFYRKKQDDLLSAIKLFSRNDADTKIIVWYNSVM
FT                   EKNVFLREVISCVLRSKKVDSYINENKKNLSKEDAGALRDYAKLKMKELFSMLDDDGYK
FT                   KIITTNAYIKERDKLSGIIYNIENSIISGHESFDIIRSNQHEWGDLSTVEQFKKFEFYV
FT                   KSELSSAKSIFDDIKNKYITDPETKRNVLYHQLDSDIKERIAFLDISHYAYPGSLLEKL
FT                   QLSGYVFSDINIIAEYLLASYGVSGHYSHGVVYPAPSDKLLELLRRHTKSNSEWIEKIT
FT                   PYVYDILSDNVSNVLRPPLSEEQKKILNDIKLEISKSVSEQYFMKLTEQKSSVIGIKYS
FT                   VDFDRYNENLFLSLPINQNLTLPFMYRYFEMLYDIHIGIIENKANREFIYSKFSSLNLD
FT                   FLINDERVLNLEGLIKKYKYLSLSEIHRTLTNSTSFADISIPLLQTICPSITTIIKKTE
FT                   YYGHQLTNAMTVASVVKPYDFSNLGAINSIDKSVSDVPALHTIVEQAKYNLLSWNDFYN
FT                   THASIWDTIARQHKSTNIEFHPQSLLFDRDSKGKCLGLSLLYLDTGGYGGGYQKLRHNI
FT                   DTASTLYQTKYNDNLKLSNRDDFFLRKTQRIITMSNELGNNRLKNAQLEVLELKDPILT
FT                   EGILYQRRISSLLITTEYHSLALQQISSFWRVTDPNFGHCDFHSLAQALTFIKNITSNR
FT                   NFSSLYGSGIVKIYFSESLNNWKYIKLPLVQTGSLLRDIYLTTPEKLSTSGGSLNIMGH
FT                   LVPVSFIYDIGGVINGNRISESTDVKNKIRSLKINGDILQHYINTHYLSEEQTQKIKDI
FT                   VDFLGIQDNTIKVKLESDIKPISEIQQPLHSILSRQKEHVKNLLSGLLDEFSNKLRKQG
FT                   LSLKTNVLSVNNFKESKINSDTVEVTVTDLQGRLYRVDIDTRVIGLTFKEGINSLSEAL
FT                   EHMNIDAIMSVIGLVQYARMIKMNDNISAIDHAGAVSDIKNIVDKFLGGILTLTNNRVY
FT                   NPGGVSGASLEGFISSGLEVCASRMGGTAGRYLSNVAKVIKLPLLDIGINIWSLYDSSL
FT                   NHAKATTQIEYISTAIDVSFSSINTALSIGAIAYPPLAIAIVPITIFSHEVKNYAVYVN
FT                   QINERHKLWLEAEKYLDNGSAKVLSINKATGIIDLSNNQVLGNIYLDMRENPPILHGEK
FT                   SYNSGKNIGSHPDMTDREIMESRAYNFACTKLSDAGEPDIFGWGDKEICNSMELSESQL
FT                   ANGYSNRQWPSQIPVIPEGIYNTVYLGYGETLRANTEVTLSSTGYFYEIARAYTDDELS
FT                   EPLLTVCNQHSHVIGGKEPLTIIIPAIEHGMLGSNLHMIERFKNYNFSISGGKGGIKLM
FT                   VGGIGDYNIECTPGVRNIISFEQLSRDFNLDLDLSDGRKQNFNFHHPSGFYSGKVMSIT
FT                   QKGINAVVGTKLGYDKIRGNNLDNTFSLGSGGGVIYSGGGSNTYFVPATLQDNLHIYIS
FT                   EKSNGNHIILGDMHSRLSIECHFSNNEREFIKMGYYNGCDVILESDTIQKIKSFAKNIT
FT                   IQTADGVMANWDDKLNTLSVYSIDMIAWRDKNKTAKEPLPVDVIQLTNWRMHNTCSLFY
FT                   DKYQVDIEANKLTYTVLFPDTELPVQLNYTSIIYGNHGAKYTFLNSGSKTIDIHILDKN
FT                   SDYDTFDFRNIIFEHYTNEIFISFDNQGGFVISILNNATSEAANINVFRKNMTSLDSSG
FT                   SLIYLPSGDIYHISDIYKMSRGRKSFKLNVEKKPDIDDIINVAILETSYLQIKKIPNND
FT                   DSDYILCLDNPNLSSYTLNFNDLSGYISSLWDNIRGSFTPFHKNTVNIAPNEKKYISLI
FT                   GLDKLSFNIDVFRQALEVKNKNSYKISKFTWETYGDIVVSPEDRISHLELDGFNYFSQP
FT                   ELDTPISDSFSYLYDNFQIVDSDVHIKLLHLNRETKQITPHRIILKRYFIDSFAKTSIT
FT                   DREKNIYPVICDSPDHFTSDIYRHPFRIVLGNKTLYPSEELVKFISTSKEYLSNMDVIN
FT                   NVIVPQKTTKKNKLSIVSLNSNIKNDIVLSGVMTGTSKIFHLNNSGDLLLTTSKTHGGG
FT                   VVVIFKDFINNWWKYNLTLITVPIDNKLSDNRINITPMGIKIQETVSGNDRLFFYPTPL
FT                   KNGCFILHNPLYSNSFPSLYSHELFDLIEAYRNPTYSYLQNNIINRYIHTVSEYAGKDG
FT                   IANMSLSIYAYSTCRFWSKESVAVGDTIKLSNYEHIEFSFNSFSKDYFREQNSDIYKIF
FT                   FKIASSSNSVVVDKNTLTQKNFLENNTFFSITGIDESLYEKHIIFITLKVIVPSKK"
FT   gene            complement(49333..49836)
FT                   /locus_tag="ECH74115_B0077"
FT   CDS_pept        complement(49333..49836)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH74115_B0077"
FT                   /product="putative transposase family protein"
FT                   /note="identified by match to protein family HMM PF01527;
FT                   match to protein family HMM PF01695"
FT                   /db_xref="EnsemblGenomes-Gn:ECH74115_B0077"
FT                   /db_xref="EnsemblGenomes-Tr:ACI34526"
FT                   /protein_id="ACI34526.1"
FT                   /translation="MTKNTRFSPEVRQRAVRMVLESQGEYDSQWAAICSIAPKIGCTPE
FT                   TLRVWVRQHERDTGSGDGGLTTAERQRLKELERENRELRVQFFRLLNRRYEKASIILTS
FT                   NKGFADWGEMFGEHVLATAILDRLLHHSTTLNIKGESYRFNIPDRLVVHLSLHARPELR
FT                   AHNT"
FT   gene            49798..49929
FT                   /pseudo
FT                   /locus_tag="ECH74115_B0078"
FT                   /note="conserved hypothetical protein; this gene contains a
FT                   frame shift which may be the result of sequencing error"
FT   gene            49983..51281
FT                   /locus_tag="ECH74115_B0079"
FT   CDS_pept        49983..51281
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH74115_B0079"
FT                   /product="protein TraI"
FT                   /note="identified by match to protein family HMM PF07057"
FT                   /db_xref="EnsemblGenomes-Gn:ECH74115_B0079"
FT                   /db_xref="EnsemblGenomes-Tr:ACI34506"
FT                   /protein_id="ACI34506.1"
FT                   /translation="MAEGVTLYPPDTIRVGTGDRMRFTKSDRGRGYVANSVWTVTAVSG
FT                   DSVTLSGGQQTRVIRPAQERAEQHIDLAYAITAHGAQGASETFAIALEGTEGSRKLMAG
FT                   FESAYVALSRMKQHVQVYTDNRQGWTDAINNAVQKGTAHDVFEPKPDREVMNAERLFST
FT                   ARELRDVAAGRAVLRQAGLAGGDSPARFIAPGRKYPQPYVALPAFDRNGKSAGIWLNPL
FT                   TTDDGNGLRGFSGEGRVKGSGDAQFVALQGSRNGESLLADNMQDGVRIARDNPDSGVVV
FT                   RIAGEGRPWNPGAITGGRVWGDIPDNSVQPGAGNGEPVTAEVLAQRQAEEAIRRETERR
FT                   ADEIVRKMAENKPDLPDGRTEQAVREIAGQERERAVTSEREAALPESVLREPQREREAV
FT                   REVVRENLLQERLQQMERDMVRDLQKEKTLGGD"
FT   gene            51301..52047
FT                   /gene="traX"
FT                   /locus_tag="ECH74115_B0080"
FT   CDS_pept        51301..52047
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="traX"
FT                   /locus_tag="ECH74115_B0080"
FT                   /product="type-F conjugative transfer system pilin
FT                   acetylase TraX"
FT                   /note="identified by match to protein family HMM PF05857;
FT                   match to protein family HMM TIGR02755"
FT                   /db_xref="EnsemblGenomes-Gn:ECH74115_B0080"
FT                   /db_xref="EnsemblGenomes-Tr:ACI34462"
FT                   /protein_id="ACI34462.1"
FT                   /translation="MTTDNTNTTRNDSLAARTDTWLQSLLVWSPGQRDIIKTVALVLMV
FT                   LDHANRILHLDQTWMFLAGRGAFPLFALVWGLNLSRHAHIRQSAINRLWGWGIIAQFAY
FT                   YLAGFPWYEGNILFAFAVAAQVLTWCETRSGWRTAAAILLMALWGPLSGTSYGIAGLLM
FT                   LAVSHRLYRAEDRTERLVLVACLLAVIPALNLASSDAAAVAGLVMTVLTVGLVSCAGKS
FT                   LPRFWPGDFFPTFYGCHLAVLGILAL"
FT   gene            52106..52966
FT                   /locus_tag="ECH74115_B0081"
FT   CDS_pept        52106..52966
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH74115_B0081"
FT                   /product="hydrolase, alpha/beta fold family"
FT                   /note="identified by match to protein family HMM PF00561"
FT                   /db_xref="EnsemblGenomes-Gn:ECH74115_B0081"
FT                   /db_xref="EnsemblGenomes-Tr:ACI34467"
FT                   /protein_id="ACI34467.1"
FT                   /translation="MKITDHKLSEGIALTFRVPEGNIKHPLIILCHGFCGIRNVLLPCF
FT                   ANAFTEAGFATITFDYRGFGESDGERGRLVPAMQTEDIISVINWAEKQECIDNQRIGLW
FT                   GTSLGGGHVFSAAAQDQRVKCIVSQLAFADGDVLVTGEMNESERASFLSTLNKMAEKKK
FT                   NTGKEMFVGVTRVLSDDESKVFFEKIKARHPEMDIKIPFLTVMETLQYKPAESAASVQC
FT                   PVLVVIAGQDSVNPPEQGRALYDAVASGTKELYEEADACHYDIYEGAFFERVVAVQTQW
FT                   FKQYL"
FT   gene            52994..53629
FT                   /gene="finO"
FT                   /locus_tag="ECH74115_B0082"
FT   CDS_pept        52994..53629
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="finO"
FT                   /locus_tag="ECH74115_B0082"
FT                   /product="fertility inhibition protein"
FT                   /note="identified by match to protein family HMM PF05286"
FT                   /db_xref="EnsemblGenomes-Gn:ECH74115_B0082"
FT                   /db_xref="EnsemblGenomes-Tr:ACI34452"
FT                   /protein_id="ACI34452.1"
FT                   /translation="MKLTSCYDEPFQRPAGHIFTKVRVSMAEQKRPVLTLKRKTEGETP
FT                   VRSRKTIINVTTPPKWKVKKQKLAEKAAREAELAAKKAQARQALSIYLNLPTQDEAVNT
FT                   LKPWWPGLFDGDTPRLLACGIRDVLLEDVAQRNIPLSHKKLRRALKAITRSESYLCAMK
FT                   AGACRYDTEGYVTEHISQEEEAYAAARLDKIRRQNRIKAELQAVLDEK"
FT   gene            53762..53974
FT                   /locus_tag="ECH74115_B0083"
FT   CDS_pept        53762..53974
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH74115_B0083"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECH74115_B0083"
FT                   /db_xref="EnsemblGenomes-Tr:ACI34447"
FT                   /protein_id="ACI34447.1"
FT                   /translation="MNGFRNSSRNGQVWRYQRAGSRAVILEVSGRWMEAAEAWRRAAGV
FT                   APRTDWQQFARKRAEHCHRRCRGRG"
FT   gene            54219..54680
FT                   /locus_tag="ECH74115_B0084"
FT   CDS_pept        54219..54680
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH74115_B0084"
FT                   /product="nuclease homolog"
FT                   /note="identified by match to protein family HMM PF00565"
FT                   /db_xref="EnsemblGenomes-Gn:ECH74115_B0084"
FT                   /db_xref="EnsemblGenomes-Tr:ACI34505"
FT                   /protein_id="ACI34505.1"
FT                   /translation="MRKYIPLVLFIFSWPVLCADIHGRVVRVLDGDTIEVMDSRKVVRI
FT                   RLVNIDAPEKKQDYGRWSTDMMKSLVAGKTVTVTYFQRDRYGRMLGQVYAPDGMNVNQF
FT                   MVRAGAAWVYEQYNTDPVLPVLQNEARQQKRGLWSDADPVPPWIWRHRK"
FT   gene            54726..54935
FT                   /locus_tag="ECH74115_B0085"
FT   CDS_pept        54726..54935
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH74115_B0085"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF05321"
FT                   /db_xref="EnsemblGenomes-Gn:ECH74115_B0085"
FT                   /db_xref="EnsemblGenomes-Tr:ACI34499"
FT                   /protein_id="ACI34499.1"
FT                   /translation="MEKTKQEWLYQLRRCSSVNTLEKIIHKNRDSLSTSERESFNSAAD
FT                   HRLAELITGKLYDRIPKEIWKYVR"
FT   gene            54973..55311
FT                   /locus_tag="ECH74115_B0086"
FT   CDS_pept        54973..55311
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH74115_B0086"
FT                   /product="w0003"
FT                   /db_xref="EnsemblGenomes-Gn:ECH74115_B0086"
FT                   /db_xref="EnsemblGenomes-Tr:ACI34476"
FT                   /protein_id="ACI34476.1"
FT                   /translation="MKLIIFILIVLIIAALLIRIILRSVNQHSPLLMQLHAAGIRTGDA
FT                   ERILSGGEYDASHLRPERRRRDILLEEVLRQAGIPLLRSHDARKLLQMTGEWLNTTGAA
FT                   QQSPEHRS"
FT   gene            55551..55805
FT                   /locus_tag="ECH74115_B0087"
FT   CDS_pept        55551..55805
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH74115_B0087"
FT                   /product="replication regulatory protein repA2"
FT                   /db_xref="EnsemblGenomes-Gn:ECH74115_B0087"
FT                   /db_xref="EnsemblGenomes-Tr:ACI34463"
FT                   /protein_id="ACI34463.1"
FT                   /translation="MSQTENAVTSSSGAKRAYRKGNPLSDAEKQRLSVARKRASFKEVK
FT                   VFLEPKYKAMLMQMCHEDGLTQAEVLTALIKSEAQKRCV"
FT   gene            complement(55935..56023)
FT                   /locus_tag="ECH74115_B0088"
FT   ncRNA           complement(55935..56023)
FT                   /locus_tag="ECH74115_B0088"
FT                   /product="CopA-like RNA"
FT                   /ncRNA_class="antisense_RNA"
FT   gene            56108..56965
FT                   /gene="repA"
FT                   /locus_tag="ECH74115_B0089"
FT   CDS_pept        56108..56965
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="repA"
FT                   /locus_tag="ECH74115_B0089"
FT                   /product="replication initiation protein"
FT                   /note="identified by match to protein family HMM PF02387;
FT                   match to protein family HMM TIGR03474"
FT                   /db_xref="EnsemblGenomes-Gn:ECH74115_B0089"
FT                   /db_xref="EnsemblGenomes-Tr:ACI34421"
FT                   /protein_id="ACI34421.1"
FT                   /translation="MTDLQQTYYRQVKNPNPVFTPREGAGTLKFCEKLMEKAVGFTSRF
FT                   DFAIHVAHARSKGLRRRMPPVLRRRAIDALLQGLCFHYDPLANRVQCSITTLAIECGLA
FT                   TESAAGKLSITRATRALTFLSELGLITYQTEYDPLIGCYIPTDITFTPALFAALDVSED
FT                   AVAAARRSRVEWENRLRKKQGLDTLGMDELIAKAWRFVRERFRSYQTELKSRGIKRARA
FT                   RRDAGRERQDIVTLVKRQLTREISEGRFTANREAVKREVERRVKERMILSRNRNYSRLA
FT                   TASP"
FT   gene            complement(57040..57159)
FT                   /locus_tag="ECH74115_B0090"
FT   CDS_pept        complement(57040..57159)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH74115_B0090"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:ECH74115_B0090"
FT                   /db_xref="EnsemblGenomes-Tr:ACI34485"
FT                   /protein_id="ACI34485.1"
FT                   /translation="MQFNVDKQNCPSVRRVLYQNRGDRMHQKVDDEVVFGMWC"
FT   gene            complement(57282..57434)
FT                   /locus_tag="ECH74115_B0091"
FT   CDS_pept        complement(57282..57434)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH74115_B0091"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:ECH74115_B0091"
FT                   /db_xref="EnsemblGenomes-Tr:ACI34441"
FT                   /protein_id="ACI34441.1"
FT                   /translation="MWFQFCAGPGFFWRLFLCVVTKVAPVGARRLRWEVHICLSTGQAV
FT                   NKSFF"
FT   gene            57878..58162
FT                   /locus_tag="ECH74115_B0092"
FT   CDS_pept        57878..58162
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH74115_B0092"
FT                   /product="CopG family protein"
FT                   /note="identified by match to protein family HMM PF01402"
FT                   /db_xref="EnsemblGenomes-Gn:ECH74115_B0092"
FT                   /db_xref="EnsemblGenomes-Tr:ACI34433"
FT                   /protein_id="ACI34433.1"
FT                   /translation="MQMKNNTAQATKVITAHVPLPMADKVDQMAARLERSRGWVIKQAL
FT                   SAWLAQEEERNRLTLEALDDVTSGQVIDHQAVQAWADSLSTDNPLPVPR"
FT   gene            58162..58437
FT                   /locus_tag="ECH74115_B0093"
FT   CDS_pept        58162..58437
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH74115_B0093"
FT                   /product="plasmid stabilization system protein, RelE/ParE
FT                   family"
FT                   /note="identified by match to protein family HMM PF05016"
FT                   /db_xref="EnsemblGenomes-Gn:ECH74115_B0093"
FT                   /db_xref="EnsemblGenomes-Tr:ACI34508"
FT                   /protein_id="ACI34508.1"
FT                   /translation="MELKWSSKALSDLARLYDFLVLASKPAAARTVQSLTQAPVILLTH
FT                   PRMGEQLFQFEPREVRRIFAGEYEIRYELNGQTIYVLRLWHTRENR"
FT   gene            58532..58738
FT                   /locus_tag="ECH74115_B0094"
FT   CDS_pept        58532..58738
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH74115_B0094"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECH74115_B0094"
FT                   /db_xref="EnsemblGenomes-Tr:ACI34520"
FT                   /protein_id="ACI34520.1"
FT                   /translation="MNYDEITKITAERISDYMTEAVNTDSIAVAEMFHNAAWGVRTLWF
FT                   ELVTKIDIDIHKKNRYASYDLDR"
FT   gene            complement(58823..59044)
FT                   /locus_tag="ECH74115_B0095"
FT   CDS_pept        complement(58823..59044)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH74115_B0095"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECH74115_B0095"
FT                   /db_xref="EnsemblGenomes-Tr:ACI34449"
FT                   /protein_id="ACI34449.1"
FT                   /translation="MIPDALAAEGSSKRDWNRFLDSHYRRGWNVNVSRVMDNATHVAVY
FT                   FGSYLKKPPVPMSRLEHYAGQDEIDPFN"
FT   gene            complement(59097..59831)
FT                   /locus_tag="ECH74115_B0096"
FT   CDS_pept        complement(59097..59831)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH74115_B0096"
FT                   /product="ISSd1, transposase OrfB"
FT                   /note="overlaps another CDS with the same product name;
FT                   identified by match to protein family HMM PF00665"
FT                   /db_xref="EnsemblGenomes-Gn:ECH74115_B0096"
FT                   /db_xref="EnsemblGenomes-Tr:ACI34451"
FT                   /protein_id="ACI34451.1"
FT                   /translation="MDTVSAESGSRLSVAAYCVHTSLPVLVPGVPQPVVTGRDEPHCCG
FT                   CDTGNLPPGRCATTNSNHNLPVAPNLLNQTFAPAAPNQVWVADLTYVATQEGWLYLAGI
FT                   KDVYTCEIVGYAMGERMTKELTGKALFMALRSQRPPAGLIHHSDRGSQYCAYDYRVIQE
FT                   QFGLKTSMSRKGNCYDNAPMESFWGTLKNESLSHYRFNNRDEAISVIREYIEIFYNRQR
FT                   RHSRLGNISPAAFREKYHQMAA"
FT   gene            complement(59615..60124)
FT                   /locus_tag="ECH74115_B0097"
FT   CDS_pept        complement(59615..60124)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH74115_B0097"
FT                   /product="transposase"
FT                   /note="overlaps another CDS with the same product name"
FT                   /db_xref="EnsemblGenomes-Gn:ECH74115_B0097"
FT                   /db_xref="EnsemblGenomes-Tr:ACI34419"
FT                   /protein_id="ACI34419.1"
FT                   /translation="MWHGSLAGRSSPALLMLPRFADIFQQGNRWLNWLEKQPEGSVRPV
FT                   VIESVTKIMACGTTLMGYTQWCCSSPDCSHIKKVCFRCKSRSCPHCGVKAGAQWIQYLL
FT                   SLVPDCPWQHIVFTLPCQYWSLVFHNRWLLAEMSRIAADVIQEICRQADVRLRTRTTIC
FT                   QLRQIC"
FT   gene            complement(60079..60264)
FT                   /locus_tag="ECH74115_B0098"
FT   CDS_pept        complement(60079..60264)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH74115_B0098"
FT                   /product="IS91, Orf2"
FT                   /db_xref="EnsemblGenomes-Gn:ECH74115_B0098"
FT                   /db_xref="EnsemblGenomes-Tr:ACI34494"
FT                   /protein_id="ACI34494.1"
FT                   /translation="MDVRNKKLVFWFVRVDDEGYPEIARCTEREFATILAGISAGGMYC
FT                   PECGTVHWPDGVPPPF"
FT   gene            60441..62651
FT                   /gene="katG"
FT                   /locus_tag="ECH74115_B0099"
FT   CDS_pept        60441..62651
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="katG"
FT                   /locus_tag="ECH74115_B0099"
FT                   /product="catalase/peroxidase HPI"
FT                   /note="identified by match to protein family HMM PF00141;
FT                   match to protein family HMM TIGR00198"
FT                   /db_xref="EnsemblGenomes-Gn:ECH74115_B0099"
FT                   /db_xref="EnsemblGenomes-Tr:ACI34426"
FT                   /protein_id="ACI34426.1"
FT                   /translation="MIKKTLPVLILLALSGSFSTAVAADKKETQNFYYPETLDLTPLRL
FT                   HSPESNPWGADFDYATRFQQLDMEALKKDIKDLLTTSQDWWPADYGHYGPFFIRMAWHG
FT                   AGTYRTYDGRGGASGGQQRFEPLNSWPDNVNLDKARRLLWPVKKKYGSSISWGDLMVLT
FT                   GNVALESMGFKTLGFAGGREDDWESDLVYWGPDNKPLADNRDKNGKLQKPLAATQMGLI
FT                   YVNPEGPGGKPDPLASAKDIREAFSRMAMDDEETVALIAGGHTFGKAHGAASPEKCIGA
FT                   GPDGAPVEEQGLGWKNKCGTGNGKYTITSGLEGAWSTSPTQFTMQYLKNLYKYEWELHK
FT                   SPAGAYQWKPKKAANIVQDAHDPSVLHPLMMFTTDIALKVDPEYKKITTRFLNDPKAFE
FT                   QAFARAWFKLTHRDMGPAARYLGNEVPAESFIWQDPLPAADYTMIDGKDIKSLKEQVMD
FT                   LGIPASELIKTAWASASTFRVTDYRGGNNGARIRLQPEINWEVNEPEKLKKVLASLTSL
FT                   QREFNKKQSDGKKVSLADLIVLSGNAAIEDAARKAGVELEIPFTPGRTDASQEQTDVAS
FT                   FSVLEPTADGFRNYYSKSRSHISPVESLIDKASQLDLTVPEMTALLGGLRVMDINTNNS
FT                   SLGVFTDTPGVLDNKFFVNLLDMSTRWSKADKEDTYNGFDRKTGALKWKASSVDLIFSS
FT                   NPELRAVAEVYASDDARNKFIHDFVKSWNKVMNSDRFDLNNK"
FT   gene            62695..63084
FT                   /locus_tag="ECH74115_B0100"
FT   CDS_pept        62695..63084
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH74115_B0100"
FT                   /product="cytochrome b562 family protein"
FT                   /note="identified by match to protein family HMM PF07361"
FT                   /db_xref="EnsemblGenomes-Gn:ECH74115_B0100"
FT                   /db_xref="EnsemblGenomes-Tr:ACI34493"
FT                   /protein_id="ACI34493.1"
FT                   /translation="MQKSNKVIISCGMALYFLCGGITVAEELDESMQVLARNMSVLQSS
FT                   MDKKELLEALDRMDDAVDESMKRLPESISPADEEGKNDYIKELQKLEKEIMLAKQKVLS
FT                   GQLSDIPDSVNKMNKIRVEGHDKFR"
FT   gene            63090..63242
FT                   /locus_tag="ECH74115_B0101"
FT   CDS_pept        63090..63242
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH74115_B0101"
FT                   /product="transposase OrfA"
FT                   /note="overlaps another CDS with the same product name"
FT                   /db_xref="EnsemblGenomes-Gn:ECH74115_B0101"
FT                   /db_xref="EnsemblGenomes-Tr:ACI34491"
FT                   /protein_id="ACI34491.1"
FT                   /translation="MVDSCGTNTYVRNITLWLERENRELRRSNDILRQASAYFAKAEFD
FT                   RLWKK"
FT   gene            63242..64129
FT                   /locus_tag="ECH74115_B0102"
FT   CDS_pept        63242..64129
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH74115_B0102"
FT                   /product="IS629, transposase orfB"
FT                   /note="overlaps another CDS with the same product name;
FT                   identified by match to protein family HMM PF00665"
FT                   /db_xref="EnsemblGenomes-Gn:ECH74115_B0102"
FT                   /db_xref="EnsemblGenomes-Tr:ACI34450"
FT                   /protein_id="ACI34450.1"
FT                   /translation="MPLLDKLREQYGVGPVCSELHIAPSTYYHCQQQRHHPDKRSARAQ
FT                   RDDWLKREIQRVYDENHQVYGVRKVWRQLLREGIRVARCTVARLMAVMGLAGVLRGKKI
FT                   RTTVSRKAVSAGDRVNRQFVAERPDQLWVADFTYVSTWQGFVYVAFIIDVFAGCIVGWR
FT                   VSSSMETTFVLDALEQALWARRPSGTVHHSDKGSQYVSLAYTERLKEAKLLASTGSTGD
FT                   SYDNAMAESINGLYKAEVIHRKSWKNRAEVELATLTWVDWYNNRRLLGRLGHIPPAEAE
FT                   KAYYASIRNDDLAA"
FT   gene            complement(64132..64272)
FT                   /locus_tag="ECH74115_B0103"
FT   CDS_pept        complement(64132..64272)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH74115_B0103"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:ECH74115_B0103"
FT                   /db_xref="EnsemblGenomes-Tr:ACI34496"
FT                   /protein_id="ACI34496.1"
FT                   /translation="MYQRCVSDSREHCNHRPDKCLLLYVFVIIRITNTEPPRFSWRVFY
FT                   L"
FT   gene            64310..68212
FT                   /locus_tag="ECH74115_B0104"
FT   CDS_pept        64310..68212
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH74115_B0104"
FT                   /product="immunoglobulin A1 protease domain protein"
FT                   /note="identified by match to protein family HMM PF02395;
FT                   match to protein family HMM PF03797; match to protein
FT                   family HMM TIGR01414"
FT                   /db_xref="EnsemblGenomes-Gn:ECH74115_B0104"
FT                   /db_xref="EnsemblGenomes-Tr:ACI34461"
FT                   /protein_id="ACI34461.1"
FT                   /translation="MNKIYSLKYSHITGGLIAVSELSGRVSSRATGKKKHKRILALCFL
FT                   GLLQSSYSFASQMDISNFYIRDYMDFAQNKGIFQAGATNIEIVKKDGSTLKLPEVPFPD
FT                   FSPVANKGSTTSIGGAYSITATHNTKNHHSVATQNWGNSTYKQTDWNTSHPDFAVSRLD
FT                   KFVVETRGATEGADISLSKQQALERYGVNYKGEKKLIAFRAGSGVVSVKKNGRITPFNE
FT                   VSYKPEMLNGSFVHIDDWSGWLILTNNQFDEFNNIASQGDSGSALFVYDNQKKKWVVAG
FT                   TVWGIYNYANGKNHAAYSKWNQTTIDNLKNKYSYNVDMSGAQVATIENGKLTGTGSDTT
FT                   DIKNKDLIFTGGGDILLKSSFDNGAGGLVFNDKKTYRVNGDDFTFKGAGVDTRNGSTVE
FT                   WNIRYDNKDNLHKIGDGTLDVRKTQNTNLKTGEGLVILGAEKTFNNIYITSGDGTVRLN
FT                   AENALSGGEYNGIFFAKNGGTLDLNGYNQSFNKIAATDSGAVITNTSTKKSILSLNNTA
FT                   DYIYHGNINGNLDVLQHHETKKENRRLILDGGVDTTNDISLRNTQLSMQGHATEHAIYR
FT                   DGAFSCSLPAPMRFLCGSDYVAGMQNTEADAVKQNGNAYKTNNAVSDLSQPDWETGTFR
FT                   FGTLHLENSDFSVGRNANVIGDIQASKSNITIGDTTAYIDLHAGKNITGDGFGFRQNIV
FT                   RGNSQGETLFTGGITAEDSTIVIKDKAKALFSNYVYLLNTKATIENGADVTTQSGMFST
FT                   SDISISGNLSMTGNPDKDNKFEPSIYLNDASYLLTDDSARLVAKNKASVVGDIHSTKSA
FT                   SIMFGHDESDLSQLSDRTSKGLALGLLGGFDVSYRGSVNAPSASATMNNTWWQLTGDSA
FT                   LKTLKSTNSMVYFTDSANNKKFHTLTVDELATSNSAYAMRTNLSESDKLEVKKHLSGEN
FT                   NILLVDFLQKPTPEKQLNIELVSAPKDTNENVFKASKQTIGFSDVTPVITTRETDDKIT
FT                   WSLTGYNTVANKEATRNAAALFSVDYKAFLNEVNNLNKRMGDLRDINGEAGAWARIMSG
FT                   TGSASGGFSDNYTHVQVGVDKKHELDGLDLFTGFTVTHTDSSASADVFSGKTKSVGAGL
FT                   YASAMFDSGAYIDLIGKYVHHDNEYTATFAGLGTRDYSTHSWYAGAEAGYRYHVTEDAW
FT                   IEPQAELVYGSVSGKQFAWKDQGMHLSMKDKDYNPLIGRTGVDVGKSFSGKDWKVTARA
FT                   GLGYQFDLLANGETVLRDASGEKRIKGEKDSRMLMSVGLNAEIRDNVRFGLEFEKSAFG
FT                   KYNVDNAVNANFRYSF"
FT   gene            complement(68375..68515)
FT                   /locus_tag="ECH74115_B0105"
FT   CDS_pept        complement(68375..68515)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH74115_B0105"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECH74115_B0105"
FT                   /db_xref="EnsemblGenomes-Tr:ACI34468"
FT                   /protein_id="ACI34468.1"
FT                   /translation="MLALLAPFTIGMLTSDKCNLRYLTENVPFAGTGGQSCMQDLYHSS
FT                   G"
FT   gene            complement(68677..68841)
FT                   /locus_tag="ECH74115_B0106"
FT   CDS_pept        complement(68677..68841)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH74115_B0106"
FT                   /product="IS1 transposase orfA"
FT                   /note="identified by match to protein family HMM PF03811"
FT                   /db_xref="EnsemblGenomes-Gn:ECH74115_B0106"
FT                   /db_xref="EnsemblGenomes-Tr:ACI34466"
FT                   /protein_id="ACI34466.1"
FT                   /translation="MFQLTYRYEARKPGVQDQITEMPFNGAGVRDTARTLKIGINTVIR
FT                   TLKNARHEE"
FT   gene            69249..69371
FT                   /locus_tag="ECH74115_B0107"
FT   CDS_pept        69249..69371
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH74115_B0107"
FT                   /product="TnpA"
FT                   /db_xref="EnsemblGenomes-Gn:ECH74115_B0107"
FT                   /db_xref="EnsemblGenomes-Tr:ACI34483"
FT                   /protein_id="ACI34483.1"
FT                   /translation="MPLKDWCMAMSRFIIEFGDRLDGHFGEKAFTQHPKQVQHR"
FT   gene            complement(69544..69678)
FT                   /locus_tag="ECH74115_B0108"
FT   CDS_pept        complement(69544..69678)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH74115_B0108"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:ECH74115_B0108"
FT                   /db_xref="EnsemblGenomes-Tr:ACI34439"
FT                   /protein_id="ACI34439.1"
FT                   /translation="MITFRVWHFEDSTVQLMNLTRVQIFLLSITCPYLLKVDISLKSC"
FT   gene            69634..69789
FT                   /pseudo
FT                   /locus_tag="ECH74115_B0109"
FT                   /note="conserved domain protein; this gene contains a frame
FT                   shift which may be the result of sequencing error"
FT   gene            complement(70032..70205)
FT                   /locus_tag="ECH74115_B0110"
FT   CDS_pept        complement(70032..70205)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH74115_B0110"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:ECH74115_B0110"
FT                   /db_xref="EnsemblGenomes-Tr:ACI34425"
FT                   /protein_id="ACI34425.1"
FT                   /translation="MLFLIRFSVFQKKQNTAISVNTARDIRLSKKSEDYHPDLLHKTSR
FT                   VAEFSASGYHSP"
FT   gene            70391..71212
FT                   /locus_tag="ECH74115_B0111"
FT   CDS_pept        70391..71212
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH74115_B0111"
FT                   /product="polysaccharide deacetylase family protein"
FT                   /note="identified by match to protein family HMM PF01522"
FT                   /db_xref="EnsemblGenomes-Gn:ECH74115_B0111"
FT                   /db_xref="EnsemblGenomes-Tr:ACI34498"
FT                   /protein_id="ACI34498.1"
FT                   /translation="MLNARHLPVLMYHHVSRCPGLVTLSPETFCEQMKWLADNNWRTVT
FT                   SAELEYFYQGGTLPRKSVMLTFDDGYLDNWLRAWPVLKEYNLHAHIFLITGLIGKGNVR
FT                   SRQEQEYSHRDCERLIADNRSDEVMLRWSEVREMRDSGLVEFHVHTHSHKRWDRLSVSR
FT                   AEQCRLMKEDILVGKQCLTEKLGFCSSHLCWPEGYYNRDYINLAGKLGFSYLYTTERRM
FT                   NCPENGSLRIGRISTKEREHSGWLKRRLFYYTTPLFSSVLALHKGPRLPDN"
FT   gene            71215..72318
FT                   /locus_tag="ECH74115_B0112"
FT   CDS_pept        71215..72318
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH74115_B0112"
FT                   /product="UDP-sugar hydrolase"
FT                   /note="identified by match to protein family HMM PF00534"
FT                   /db_xref="EnsemblGenomes-Gn:ECH74115_B0112"
FT                   /db_xref="EnsemblGenomes-Tr:ACI34474"
FT                   /protein_id="ACI34474.1"
FT                   /translation="MKILFTESSSDIGGQELQALAQMTALQKQGHSVLLACREKSKIAP
FT                   EARKRGHDVTFIPFRNSLHLPSILRLRRIIGEFKPDLVICHSGHDSNIAGLSRLICCHR
FT                   FSIVRQKTYITRKTRTFSLNYLCDFIVVPSSAMMAHLMAEGVRTPVTVIPPGFDWPALH
FT                   NEAMRPLPLHIHAWAASADNVPLIVQVGMLRPEKGHEFMLRVLYQLKMEGKSFRWLVVG
FT                   AGREEYEARLRQQTEHLGMSGDVLMAGALFPALPVYRIASVVVMPSENEAFGMVLAEAS
FT                   VSGVPVIASETGGIPDVIQKNVTGTLLPVGDVSAWTGALRDFLSRPERFRMMAASARED
FT                   IEYRFDINRTAQIIVSLASQAKGKCNR"
FT   gene            72408..74129
FT                   /locus_tag="ECH74115_B0113"
FT   CDS_pept        72408..74129
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH74115_B0113"
FT                   /product="sulfatase domain protein"
FT                   /note="identified by match to protein family HMM PF00884"
FT                   /db_xref="EnsemblGenomes-Gn:ECH74115_B0113"
FT                   /db_xref="EnsemblGenomes-Tr:ACI34507"
FT                   /protein_id="ACI34507.1"
FT                   /translation="MHLNTGQNRPTFSWSALGWAIFYFGFFSTLLQVIIFSSGYSGTNG
FT                   IRDSLLFSCLWLIPVFLYPDRIKIIAAVVGFILWGTSLAALCYYFLYGHEFSQSVLFVM
FT                   FETNAREAGEYFSQYFSLKLLLISLVYTAVSVFLWTRLRPVYIPLPWRRIVSFLLLYAL
FT                   LLHPVVLKSLIRQEPLNDTLGKLASRMEPAAPWQFVSSYYQYHQQLNALTTFLNENSAL
FT                   PPLGNLRDESGERPRTLVLVIGESTQRERMSLYGYLRETTPELDALRKTDPGLTVFNNV
FT                   VASRPYTIEALQQALTFANEKNPDLYLTQPSLMNMMKQAGYKTFWITNQQTITARNTML
FT                   TVFSRQTDRQYYMNQQRTQSAREYDTNVLKPFREVLNDPAPKKLIIVHLLGTHIKYKYR
FT                   YPEGQGRFDGITGHIPTGLNAKELEVYNDYDNANLFNDHVVASLIKDFRATAPDGFLLY
FT                   FSDHGEEVYDTPPYKTQGRNEDNPTRPMYTVPFLLWTSEKWHAAHPRDFSQYVDRKYSL
FT                   AELIHTWSDLAGLTYDGYDPTRSLVNPQFRETTRWIGNPYKKNGLTDFDTLPYGEP"
FT   gene            74170..75201
FT                   /gene="msbB"
FT                   /locus_tag="ECH74115_B0114"
FT   CDS_pept        74170..75201
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msbB"
FT                   /locus_tag="ECH74115_B0114"
FT                   /product="lipid A biosynthesis (KDO)2-(lauroyl)-lipid IVA
FT                   acyltransferase"
FT                   /note="identified by match to protein family HMM PF03279;
FT                   match to protein family HMM TIGR02208"
FT                   /db_xref="EnsemblGenomes-Gn:ECH74115_B0114"
FT                   /db_xref="EnsemblGenomes-Tr:ACI34445"
FT                   /protein_id="ACI34445.1"
FT                   /translation="MFSSAVRWPPGMVPPSAVLCYHNEISRQIPVNMKNIRTEFIPRFN
FT                   LTLCFPRYWMTWTGIGIICVFAMVPPALRDPLLGKLGMLVGRLGKSARQRALINLSLCF
FT                   PEYSDKEKENIVDAMFATASMAVVLMAELALSGPDKISHRIRWNGLEIVEKMAQNNEKV
FT                   IFLVPHAWGVDIPAMLMAASGRKMAAMFHNQRNPVVDYVWNSVRRRFGGKLHARNDGIA
FT                   SFVRSVRQGYWGYYLPDQDHGPEFSEFADFFATYKATLPVIGRLSRISGARIIPLFPVY
FT                   DGKTHHLTIHVSPPLAIRQKSDAHIARQINEVVENFVRPHPEQYTWILKLLKTRKEGEE
FT                   DPY"
FT   gene            complement(75250..75375)
FT                   /locus_tag="ECH74115_B0115"
FT   CDS_pept        complement(75250..75375)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH74115_B0115"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:ECH74115_B0115"
FT                   /db_xref="EnsemblGenomes-Tr:ACI34465"
FT                   /protein_id="ACI34465.1"
FT                   /translation="MRSASFRASLRNSGECYLRGFLLVGTVFLSYEPPLTESLLT"
FT   gene            75548..75949
FT                   /locus_tag="ECH74115_B0116"
FT   CDS_pept        75548..75949
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH74115_B0116"
FT                   /product="IS66 family element, orf1"
FT                   /note="identified by match to protein family HMM PF01527"
FT                   /db_xref="EnsemblGenomes-Gn:ECH74115_B0116"
FT                   /db_xref="EnsemblGenomes-Tr:ACI34511"
FT                   /protein_id="ACI34511.1"
FT                   /translation="MGTKVSDMQKNVTPGRRKGCPNYPPEFKQQLVAASCEPGISISKL
FT                   ALENGINANLLFKWRQQWREGKLLLPSSESPQLLPVTLDAAAEQPESLAEDPEPLSISC
FT                   EVTFRHGTLRFNGNVSEKLLTLLIQELKR"
FT   gene            75946..76293
FT                   /locus_tag="ECH74115_B0117"
FT   CDS_pept        75946..76293
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH74115_B0117"
FT                   /product="IS66 family element, orf2"
FT                   /note="identified by match to protein family HMM PF05717"
FT                   /db_xref="EnsemblGenomes-Gn:ECH74115_B0117"
FT                   /db_xref="EnsemblGenomes-Tr:ACI34420"
FT                   /protein_id="ACI34420.1"
FT                   /translation="MIPLPSGTKIWLVAGITDMRNGFNGLAAKVQTALKDDPMSGHVFI
FT                   FRGRSGSQVKLLWSTGDGLCLLTKRLERGRFAWPSARDGKVFLTQAQLAMLLEGIDWRQ
FT                   PKRLLTSLTML"
FT   gene            76343..77881
FT                   /locus_tag="ECH74115_B0118"
FT   CDS_pept        76343..77881
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH74115_B0118"
FT                   /product="IS66 family element, transposase"
FT                   /note="identified by match to protein family HMM PF03050"
FT                   /db_xref="EnsemblGenomes-Gn:ECH74115_B0118"
FT                   /db_xref="EnsemblGenomes-Tr:ACI34460"
FT                   /protein_id="ACI34460.1"
FT                   /translation="MNDISSDDIFLLKQRLAEQEALIHALQEKLSNREREIDHLQAQLD
FT                   KLRRMNFGSRSEKVSRRIAQMEADLNRLQKESDTLTGRVYDPAVQRPLRQTRTRKPFPE
FT                   SLPRDEKRLLPAAPCCPNCGGSLSYLGEDTAEQLELMRSAFRVIRTVREKHACTQCDAI
FT                   VQAPAPSRPIERGIAGPGLLARVLTSKYAEHTPLYRQSEIYGRQGVELRRSLLSGWVDA
FT                   CCRLLSPLEEALHGYVMTDGKLHADDTPVQVLLPGNKKTKTGRLWAYVRDDRNAGSALA
FT                   PAVWFAYSPDRKGIHPQTHLACFSGVLQADAYAGFNELYRNGGITEAACWAHARRKIHD
FT                   VHVRIPSALTEEALEQIGQLYAIEADIRGMPAEQRLAERQRKTKPLLKSLESWLREKMK
FT                   TLLRHSELAKAFAYALNQWPALTYYANDGWVEIDNNIAENALRAVSLGRKNFLFFGSDH
FT                   GGERGALLYSLIGTCKLNDVDPESYLRHVLGVIADWPVNRVSELLPWRIALPAE"
FT   gene            complement(77972..78088)
FT                   /locus_tag="ECH74115_B0119"
FT   CDS_pept        complement(77972..78088)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH74115_B0119"
FT                   /product="transposase IS3/family protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECH74115_B0119"
FT                   /db_xref="EnsemblGenomes-Tr:ACI34473"
FT                   /protein_id="ACI34473.1"
FT                   /translation="MPMSGKRYPEDFKIEAVKQVVDRGHSASSVATLRHAEA"
FT   gene            78157..78369
FT                   /locus_tag="ECH74115_B0120"
FT   CDS_pept        78157..78369
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH74115_B0120"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:ECH74115_B0120"
FT                   /db_xref="EnsemblGenomes-Tr:ACI34458"
FT                   /protein_id="ACI34458.1"
FT                   /translation="MAKNTFIFFFFFFFFFFFLVFVFLLSFVLYVKYLLLIHYHTKECI
FT                   IMQLFDVLNVINILIVVFCACLSKG"
FT   gene            78551..81247
FT                   /locus_tag="ECH74115_B0001"
FT   CDS_pept        78551..81247
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH74115_B0001"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECH74115_B0001"
FT                   /db_xref="EnsemblGenomes-Tr:ACI34517"
FT                   /protein_id="ACI34517.1"
FT                   /translation="MNTKMNERWRTPMKLKYLSCTILAPLAIGVFSATAADNNSAIYFN
FT                   TSQPINDLQGSLAAEVKFAQSQILPAHPKEGDSQPHLTSLRKSLLLVRPVKADDKTPVQ
FT                   VEARDDNNKILGTLTLYPPSSLPDTIYHLDGVPEGGIDFTPHNGTKKIINTVAEVNKLS
FT                   DASGSSIHSHLTNNALVEIHTANGRWVRDIYLPQGPDLEGKMVRFVSSAGYSSTVFYGD
FT                   RKVTLSVGNTLLFKYVNGQWFRSGELENNRITYAQHIWSAELPAHWIVPGLNLVIKQGN
FT                   LSGRLNDIKIGAPGELLLHTIDIGMLTTPRDRFDFAKDKEAHREYFQTIPVSRMIVNNY
FT                   APLHLKEVMLPTGELLTDMDPGNGGWHSGTMRQRIGKELVSHGIDNANYGLNSTAGLGE
FT                   NSHPYVVAQLAAHNSRGNYANGIQVHGGSGGGGIVTLDSTLGNEFSHEVGHNYGLGHYV
FT                   DGFKGSVHRSAENNNSTWGWDGDKKRFIPNFYPSQTNEKSCLNNQCQEPFDGHKFGFDA
FT                   MAGGSPFSAANRFTMYTPNSSAIIQRFFENKAVFDSRSSTGFSKWNADTQEMEPYEHTI
FT                   DRAEQITASVNELSESKMAELMAEYAVVKVHMWNGNWTRNIYIPTASADNRGSILTINH
FT                   EAGYNSYLFINGDEKVVSQGYKKSFVSDGQFWKERDVVDTREARKPEQFGVPVTTLVGY
FT                   YDPEGTLSSYIYPAMYGAYGFTYSDDSQNLSDNDCQLQVDTKEGQLRFRLANHRANNTV
FT                   MNKFHINVPTESQPTQATLVCNNKILDTKSLTPAPEGLTYTVNGQALPAKENEGCIVSV
FT                   NSGKRYCLPVGQRSGYSLPDWIVGQEVYVDSGAKAKVLLSDWDNLSYNRIGEFVGNVNP
FT                   ADMKKVKAWNGQYLDFSKPRSMRVVYK"
FT   gene            81334..82209
FT                   /gene="gspC"
FT                   /locus_tag="ECH74115_B0002"
FT   CDS_pept        81334..82209
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gspC"
FT                   /locus_tag="ECH74115_B0002"
FT                   /product="general secretion pathway protein C"
FT                   /note="identified by match to protein family HMM TIGR01713"
FT                   /db_xref="EnsemblGenomes-Gn:ECH74115_B0002"
FT                   /db_xref="EnsemblGenomes-Tr:ACI34434"
FT                   /protein_id="ACI34434.1"
FT                   /translation="MLFFLSFRGDRGLFIKDIVLKMLTPNRLLCVILLIAGYQLVSVIH
FT                   HFWLTQAASVPGLSRVSAPETAVTGDQTEERFVFTLFGRASPLSSEGRAQETMPSLSDD
FT                   LLSGEDLDVRGILYSSVAEHSVAIFAHNNRQFSLSVGEKVPSYDATISAIFSDHIVINY
FT                   QGKTVSLPLRYDNTEKKNAYDNNNLTVGDVITQDNFRVESVFDIMSFSAVTVNNTLSGY
FT                   RLIPGKHSSLFYNAGLHDNDLAVSVNGSELRDTRQAQQIMKQLPELKEIKITVERDGQL
FT                   YDAFIAVGEN"
FT   gene            82210..84177
FT                   /gene="gspD"
FT                   /locus_tag="ECH74115_B0003"
FT   CDS_pept        82210..84177
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gspD"
FT                   /locus_tag="ECH74115_B0003"
FT                   /product="general secretion pathway protein D"
FT                   /note="identified by match to protein family HMM PF00263;
FT                   match to protein family HMM PF03958; match to protein
FT                   family HMM TIGR02517"
FT                   /db_xref="EnsemblGenomes-Gn:ECH74115_B0003"
FT                   /db_xref="EnsemblGenomes-Tr:ACI34510"
FT                   /protein_id="ACI34510.1"
FT                   /translation="MFRKWLNGRLPVLVFTTVILGAIPGWGAEFSANFKDTDIQEFINT
FT                   VSKNLHKTVIINPDVQGTITVRSYDMLNEEQYYQFFLSVLDVYGFAVVDMHNGILKVVR
FT                   SKDAKTSAVPVASDVSPGTGDEVVTRVVPVSNVAARDLAPLLRQLNDNAGAGSVVHYEP
FT                   SNVLLMTGRAAVMKRLMEIVERVDKVGNRSVATVPLTYASATDVARLVTELTKETDKTA
FT                   IPAWMTAKLVADERTNSVLVSGEPISQQRIISIIKQLDRQEDVQGNTKVIYLKYAKAKD
FT                   LVEVLTGISSSIENDSKKSPSTEALRKGVTIKSHEQTNALILTGAPDVIRDLENVISQL
FT                   DIRRPQVLVEAIIAEIQDADGLNLGIQWVNKHAGVAQFTSTGLPITTMVQTRQNEILDS
FT                   DQSNALSMFNGIAAGFYQGNWAMLLTALSTSSKNDILATPSIVTLDNMEATFNVGQEVP
FT                   VLSGSQTTSGDNIFNTVERKTVGIKLRVKPQINEGDSVLLEIEQEVSGVADTAVATTTD
FT                   LGATFNTRTVTNAMLVGNGETVVVGGLLDKSIRGSESKVPLLGDIPVLGHLFRAKSEQT
FT                   AKRNLMLFIRPTIIRERDGFRHASAEKYQSFNQEQVQSRGKETTALTLNEEQLRLSPDQ
FT                   DDTAFRKVKAAIAAFYAQEM"
FT   gene            84177..85682
FT                   /gene="gspE"
FT                   /locus_tag="ECH74115_B0004"
FT   CDS_pept        84177..85682
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gspE"
FT                   /locus_tag="ECH74115_B0004"
FT                   /product="general secretory pathway protein E"
FT                   /note="identified by match to protein family HMM PF00437;
FT                   match to protein family HMM TIGR02533"
FT                   /db_xref="EnsemblGenomes-Gn:ECH74115_B0004"
FT                   /db_xref="EnsemblGenomes-Tr:ACI34497"
FT                   /protein_id="ACI34497.1"
FT                   /translation="MSRVVQNVSESRPLLPFSFSRTQRILLLREQEGNRVFCMEDTPAS
FT                   ALLEVRRVAEGPLNVTTVSAEAFEKQLVSSYQRDSDEARQMMAEIGNEMDFYTVAGELP
FT                   DREDLLDANDDAPIIRLINAMLTEAIKEKASDIHIETYERHLQVRFRIDGVLREILRLH
FT                   RNLASLLISRIKVMARLDIAEKRVPQDGRMVLRIGGRAVDVRVSTLPSNHGERIVLRLL
FT                   DKNSVSLDLAALGMSQQNQRHIDALIRRPHGIILVTGPTGSGKSTTLYAALSLLNPRDR
FT                   NIMTVEDPVEYELDGISQTQVNPKVDMTFARSLRAILRQDPDVVLVGEIRDGETAQIAV
FT                   QASLTGHLVLSTLHTNSAAGALSRLQDMGIPPFLLSTSLLAVLAQRLVRTLCPRCRQPC
FT                   QVSTELAMDMDIPPETTIWQPAGCQHCSFTGYHGRTGIHELLLIDDRIRTAIYQGEGEL
FT                   GITRLAGSRYLTLRGDGRQKVLAGETSWEEVVRVTESRLQEEE"
FT   gene            85684..86907
FT                   /gene="gspF"
FT                   /locus_tag="ECH74115_B0005"
FT   CDS_pept        85684..86907
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gspF"
FT                   /locus_tag="ECH74115_B0005"
FT                   /product="general secretion pathway protein F"
FT                   /note="identified by match to protein family HMM PF00482;
FT                   match to protein family HMM TIGR02120"
FT                   /db_xref="EnsemblGenomes-Gn:ECH74115_B0005"
FT                   /db_xref="EnsemblGenomes-Tr:ACI34502"
FT                   /protein_id="ACI34502.1"
FT                   /translation="MALFHYQASDIHGRKRSGILEADSARHARQLLREQALIPVRLDEK
FT                   QVHHKHSLRSILRFRPRGGSSAELALLTRQLATLVAASLPLEEALDALLRQSEKPRQRN
FT                   LIAAVRTKVLEGHSLAAAMGMFPGTFERLYCAMVAAGETSGRLDVVLSRLADYTEQRQI
FT                   MRNRLLQALLYPCVLTLVAVGVIAILLTAVVPKVVEQFIHMKQTLPLSTRVLMGAAEVS
FT                   QTWGPWLLLAAALGGIAGRMILHQPSQRLAFHHLLLRLPVVGRISRGLNTARYARTLSI
FT                   LNASAVPLLQAMHISGDVLSNDWARHQLATAAELVREGVSLHQALEQTSLFPPMMRHMI
FT                   ASGENSGELDSMLERAADNQDREFSTQMQLALGLFEPLLVVGMAGVVLFIVLAILQPLL
FT                   QLNNMMNM"
FT   gene            86938..87372
FT                   /gene="gspG"
FT                   /locus_tag="ECH74115_B0006"
FT   CDS_pept        86938..87372
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gspG"
FT                   /locus_tag="ECH74115_B0006"
FT                   /product="general secretion pathway protein G"
FT                   /note="identified by match to protein family HMM PF07963;
FT                   match to protein family HMM PF08334; match to protein
FT                   family HMM TIGR01710; match to protein family HMM
FT                   TIGR02532"
FT                   /db_xref="EnsemblGenomes-Gn:ECH74115_B0006"
FT                   /db_xref="EnsemblGenomes-Tr:ACI34464"
FT                   /protein_id="ACI34464.1"
FT                   /translation="MRKQHQRGFTLLEIMVVIVILGVLASLVVPNLMGNKDKADRQKVM
FT                   SDLVALESTLDMYRLDNNRYPTTEQGLRALVSKPTVQPEPRNYRQDGYIRRLPQDPWGG
FT                   DYQLLNPGQYSDIDIFSPGPDGVPNTEDDIGNWTLGNAQP"
FT   gene            87369..87923
FT                   /gene="gspH"
FT                   /locus_tag="ECH74115_B0007"
FT   CDS_pept        87369..87923
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gspH"
FT                   /locus_tag="ECH74115_B0007"
FT                   /product="general secretion pathway protein H"
FT                   /note="identified by match to protein family HMM PF07963;
FT                   match to protein family HMM TIGR01708; match to protein
FT                   family HMM TIGR02532"
FT                   /db_xref="EnsemblGenomes-Gn:ECH74115_B0007"
FT                   /db_xref="EnsemblGenomes-Tr:ACI34475"
FT                   /protein_id="ACI34475.1"
FT                   /translation="MSQRGFTILEMMLILLLMGITAGLVLMSFPDSAQNHLQQQRERLQ
FT                   AQLDYALDRSQQDGLLMGIQVRFDGWKFKVLQRGTAESPPTLAEGGDIWQGYVWQTWQP
FT                   RRAAMGGKLPDDVRLELQYLRGLQWMSEHDDGAEPDILLLPGGEVTPFRLLFRQVGEEA
FT                   VVGLQVDENGLMTLFEGEVSL"
FT   gene            87920..88285
FT                   /gene="gspI"
FT                   /locus_tag="ECH74115_B0008"
FT   CDS_pept        87920..88285
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gspI"
FT                   /locus_tag="ECH74115_B0008"
FT                   /product="general secretion pathway protein I"
FT                   /note="identified by match to protein family HMM PF02501;
FT                   match to protein family HMM PF07963; match to protein
FT                   family HMM TIGR01707; match to protein family HMM
FT                   TIGR02532"
FT                   /db_xref="EnsemblGenomes-Gn:ECH74115_B0008"
FT                   /db_xref="EnsemblGenomes-Tr:ACI34488"
FT                   /protein_id="ACI34488.1"
FT                   /translation="MKGQEGMTLLEVIVALVVFALAGMALMQASTQQAAGIGRMEEKVL
FT                   AGWLADNQMVQLQLEKTWPENGWGEKTISFAGTEWYLRWGGPDSDVPQPRSLEVEVRRT
FT                   KEETSALVSLRSSVVRE"
FT   gene            88282..88881
FT                   /gene="gspJ"
FT                   /locus_tag="ECH74115_B0009"
FT   CDS_pept        88282..88881
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gspJ"
FT                   /locus_tag="ECH74115_B0009"
FT                   /product="general secretion pathway protein J"
FT                   /note="identified by match to protein family HMM PF07963;
FT                   match to protein family HMM TIGR01711; match to protein
FT                   family HMM TIGR02532"
FT                   /db_xref="EnsemblGenomes-Gn:ECH74115_B0009"
FT                   /db_xref="EnsemblGenomes-Tr:ACI34455"
FT                   /protein_id="ACI34455.1"
FT                   /translation="MSQQRVKGFTLLEMLLALAVFAALSISAFQVLQGGIRAHELSRDK
FT                   VQRLAELQRGISQMERDLTQMLPRHSRGNEGLLLAAPHLLKSDDWGISFTRNSWLNPAG
FT                   MLPRPELQWVGYRLRQQKLERLSYFHVDHPSGVSPDVRVMLDGVHAFRLRFFVNGDWQA
FT                   RWDSTGILPQAVEVTLVMDDFAELPRLFLVSKETAE"
FT   gene            88878..89855
FT                   /gene="gspK"
FT                   /locus_tag="ECH74115_B0010"
FT   CDS_pept        88878..89855
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gspK"
FT                   /locus_tag="ECH74115_B0010"
FT                   /product="general secretion pathway protein K"
FT                   /note="identified by match to protein family HMM PF03934"
FT                   /db_xref="EnsemblGenomes-Gn:ECH74115_B0010"
FT                   /db_xref="EnsemblGenomes-Tr:ACI34479"
FT                   /protein_id="ACI34479.1"
FT                   /translation="MKLREQGVALLVVLLILSLMVTIAAVIAERNGRTFLRTVAQLDQL
FT                   QAKWDGYTAETIAKQILQRSRQESPRKTHLAQNWAQSERQFETRGGDVRGQIVDAQACF
FT                   NLNAINYGVVDLTSIPYAARIFQQLLINLQVELLQARQVTAALRDWIDRDDKPVRGGAE
FT                   DEVYMGMEPPYLAANQPMQDVSELRLIRGIDARLYRKLLPYVCVLPTSDLSVNVNTLLD
FT                   SQAPLLAALFLTKPDSLPVTELLQRRPRTGWESVAAFLDAPPLKDIDTSAAMPVLAVSS
FT                   NYFLVRLHVRSGEHLFSQQTLMQWREERFRIIQRQYGLTMREVP"
FT   gene            89927..91066
FT                   /gene="gspL"
FT                   /locus_tag="ECH74115_B0011"
FT   CDS_pept        89927..91066
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gspL"
FT                   /locus_tag="ECH74115_B0011"
FT                   /product="general secretion pathway protein L"
FT                   /note="identified by match to protein family HMM PF05134;
FT                   match to protein family HMM TIGR01709"
FT                   /db_xref="EnsemblGenomes-Gn:ECH74115_B0011"
FT                   /db_xref="EnsemblGenomes-Tr:ACI34435"
FT                   /protein_id="ACI34435.1"
FT                   /translation="MWRLIAPEETGAGSVAVGETDPQLVGLLSRYPAWVLVPSGRIAFH
FT                   QVTLPHRTWRQRLQVLPFLLEEQLATDIEQLHFAILHQSGDRCDVAVVEKAVMHRWLAY
FT                   CGQLGVREVRLLPDVLMLPLATEGWSAVKLAGQWLFRRDRYAGMTVELSWLTHFLSLTA
FT                   PPVIESYSVPPVPCPGPKTTEWRNQPGRDLLQLVAEGDGYDGADLRQGEFARQGTWYAR
FT                   FRPWRYVAGALLACVFLAGSNAGLAHYRLWQQAQFWRYESVRVYQQLFPSEKAVKDPRR
FT                   QMLRHLQQSTGNNIPELGSVMRQLQQLLSETSTIRLQALAWDSSSQTLKIDLQAASFQA
FT                   LEHFQQIAGEKYLIQPGEIRQQPQGVESRLILRVNNERA"
FT   gene            91053..91565
FT                   /locus_tag="ECH74115_B0012"
FT   CDS_pept        91053..91565
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH74115_B0012"
FT                   /product="EtpM"
FT                   /note="identified by match to protein family HMM PF04612"
FT                   /db_xref="EnsemblGenomes-Gn:ECH74115_B0012"
FT                   /db_xref="EnsemblGenomes-Tr:ACI34512"
FT                   /protein_id="ACI34512.1"
FT                   /translation="MNELKKRLQYVSPRERRLLIGCVALLVVVFVYYVLWQPWLIREDK
FT                   WRTVVTREKNTVEWMKQQVPNIKRREASMPEQGEPLGLSAAVTRTSAAYGVSVTRLQPQ
FT                   GERLAVTLAPVEFNALMQWLTQLERRHRIRTMVFDVAAQGNPPGQVTVNRLVLSQDDVN
FT                   KDASLSR"
FT   gene            91632..92456
FT                   /locus_tag="ECH74115_B0013"
FT   CDS_pept        91632..92456
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH74115_B0013"
FT                   /product="bacterial Peptidase A24 N-domain protein"
FT                   /note="identified by match to protein family HMM PF01478;
FT                   match to protein family HMM PF06750"
FT                   /db_xref="EnsemblGenomes-Gn:ECH74115_B0013"
FT                   /db_xref="EnsemblGenomes-Tr:ACI34470"
FT                   /protein_id="ACI34470.1"
FT                   /translation="MPEFAVDYPLLWLICTGGLGGVTGSFLNVVIHRLPIMLERRWRRE
FT                   ALTLLAHSVPESGPAFNLMIPQSHCPCCFHPLGIRDNIPLLSYLFLKGKSRCCGERIPV
FT                   YYPLVEITNSVLFILAASRFPPGLTLAAAWLFISMLLVLAVIDCHTALLPDVLTLPLLW
FT                   LGLLFSLQRGVVTLEEAVVGAVSGYLCLWGLYWLFRFATGREGLGYGDFKLAAALGAWM
FT                   GWQALPSILLFASVSGLIVTVLLRIVTATDFTRPLPFGPWLALSGVCHFLLM"
FT   gene            92551..92949
FT                   /locus_tag="ECH74115_B0014"
FT   CDS_pept        92551..92949
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH74115_B0014"
FT                   /product="EptO"
FT                   /note="identified by match to protein family HMM PF09691;
FT                   match to protein family HMM TIGR01004"
FT                   /db_xref="EnsemblGenomes-Gn:ECH74115_B0014"
FT                   /db_xref="EnsemblGenomes-Tr:ACI34432"
FT                   /protein_id="ACI34432.1"
FT                   /translation="MGNILKKLNCIASLLVLVTISGCHQSPSIHKQATVPPSEQLEQMA
FT                   SIVSATRYLKMRCNRSDLPDEQSILNVANRIAIGKGWQSLTQEDIRKHSDDIYVRLTRD
FT                   STPEYIKCREFNRRLVPFIGELLARGRG"
FT   gene            93128..93433
FT                   /locus_tag="ECH74115_B0015"
FT   CDS_pept        93128..93433
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH74115_B0015"
FT                   /product="IS911, transposase orfA"
FT                   /note="identified by match to protein family HMM PF01527"
FT                   /db_xref="EnsemblGenomes-Gn:ECH74115_B0015"
FT                   /db_xref="EnsemblGenomes-Tr:ACI34477"
FT                   /protein_id="ACI34477.1"
FT                   /translation="MKKRNFSAEFKRESAQLVVDQNYTVADAAKAMDIGLSTMTRWVKQ
FT                   LRDERQGKTPKASPITPEQIEIRELRKKLQRIEMENEILKKATTALLMSDSLNSSR"
FT   gene            93460..94299
FT                   /pseudo
FT                   /locus_tag="ECH74115_B0016"
FT                   /note="IS911, transposase orfB; this gene contains a frame
FT                   shift which may be the result of sequencing error;
FT                   identified by match to protein family HMM PF00665"
XX
SQ   Sequence 94644 BP; 25199 A; 20947 C; 24375 G; 24123 T; 0 other;
     taatataact tagctgtgat atgtgtaaga atgtttaggc aatatattat tatcgctaat        60
     gttgttttgg ttgggagaga ttctccttgc ggtagctttc tgtttttaga tgcttcttgc       120
     ttaaaaggat ataatttctg ttcttttata tagggttctt tacatttact gagttttctt       180
     atttatttaa acattatgaa atctaatgct tttgacgtca tggggaaggt tgcatggcta       240
     tgggcctgtt ctcctctgca taaaaaatgg ccattatctg tttttgctat taatgtcata       300
     cctgctattc agacaaatca atttgctctc ttaataaagg atgagcttcc tgtagctttt       360
     tgtagctggg ccagtttaga tctggaatgt gaggtaaaat atataaatga tgtaacatct       420
     ttgtatgcaa aagactggat gtcgggagaa agaaagtggt ttattgactg gatagctcca       480
     tttggacaca acatggagtt atataaatac atgaggaaaa agtatcctta tgagttattc       540
     agagcaataa ggttagatga gagcagtaaa acaggaaaaa tagctgaatt tcatggaggg       600
     gggatagata aaaaactggc atcaaaaata ttcaggcaat accatcatga acttatgtct       660
     gaagtaaaaa acagacaaga ttttaatttt aatattgaga aagaaaacta atatgacagt       720
     aaataaaata aagaacattt tcaataatgc gacattgact acaaaatcag catttaatac       780
     agcatcatca agcgtacgtt ccgctggaaa aaaactcata ttattaatac ctgataatta       840
     tgaagctcag ggcgtgggta ttaatgagtt ggtcaaagct gctgatgagc ttggaataga       900
     aatacaccgt actgaacgag atgatacagc gattgcaaac cagttttttg gtgcagcaga       960
     aaaagttgta ggattaactg aacgtggtgt tgcaatattc gcaccacaac ttgacaaact      1020
     tctgcagaag tatcagaaag ttgggagtaa aataggagga accgctgaaa atgtaggtaa      1080
     taatctggga aaagccggaa cagttctctc agcactacag aattttacgg ggattgcttt      1140
     atcaggcatg gctcttgatg aattgctgag aaaacaacgg gcaggagagg atataagtca      1200
     gaatgatatt gccaaaagta gtattgaact tattaatcag cttgtagata cagtatcaag      1260
     tataaacagt accgttgatt cattttctga gcagcttaac cagcttggct catttttatc      1320
     cagtaaacct cgattaagtt ctgttggtgg gaaattacaa aatttaccag acctgggccc      1380
     cctgggggat gggctggatg ttgtctccgg aattctttct gctgtatcag caagctttat      1440
     tctgggaaac agtgacgcac atacaggaac aaaagctgca gcgggtatcg aactgacaac      1500
     tcaggttctt ggaaatgttg gtaaagctgt ttcgcaatat attctggctc agagaatggc      1560
     acaggggtta tcgacaacag ctgcaagtgc gggtctgatc acatcggctg ttatgctggc      1620
     tatcagtcct ctttctttcc tggctgctgc agataaattt gagcgagcta agcagcttga      1680
     atcatattct gaacgattta aaaaattgaa ttatgaaggg gatgctttac tcgcagcctt      1740
     tcataaagaa accggagcta tagatgcagc cctgacaaca ataaatactg tcctgagttc      1800
     tgtatctgcg ggagttagtg cagcctccag tgcatccctc ataggggccc cgataagcat      1860
     gctggtgagt gcattaaccg gtacgatatc tggcattctg gaagcatcaa aacaggctat      1920
     gtttgagcac gttgcagaga aattcgctgc tcggatcaat gaatgggaaa aggagcatgg      1980
     caaaaattat tttgagaatg gatatgacgc aagacatgct gcgtttttag aagactctct      2040
     gtctttgctt gctgattttt ctcgtcagca tgcagtagaa agagcagtcg caataaccca      2100
     gcaacattgg gatgagaaga tcggtgaact tgcaggcata acccgtaatg ctgatcgcag      2160
     tcagagtggt aaggcatata ttaattatct ggaaaatgga gggcttttag aggctcaacc      2220
     gaaggagttt acacaacaag tgtttgatcc tcaaaaaggg accatagacc tttcaacagg      2280
     taatgtatca agtgttttga catttataac accaacattt accccaggag aagaagttag      2340
     agaaagaaaa cagagtggta aatatgaata tatgacatct cttattgtaa atggtaagga      2400
     tacatggtct gtaaaaggca taaaaaatca taaaggtgta tatgattatt caaaattgat      2460
     tcagtttgtt gaaaagaata acaaacacta tcaggcgaga ataatttctg agctcggaga      2520
     taaagacgat gtggtttatt ctggagcagg ctcatcagaa gtatttgctg gtgaaggtta      2580
     tgataccgta tcttataata agacggatgt tggtaaacta acaattgatg caacaggagc      2640
     atcaaaacct ggtgagtata tagtttcaaa aaatatgtat ggtgacgtga aggtattgca      2700
     ggaagtcgtt aaggaacagg aggtgtcagt agggaagcga acagagaaaa tacaatatcg      2760
     tgattttgaa ttcagaaccg gtggaattcc ttatgatgta atagataatc ttcattctgt      2820
     tgaagagctc attggcggaa aacatgatga tgaattcaaa ggcggtaagt ttaatgatat      2880
     attccatggc gcagatggga acgattatat cgaaggtaat tatggtaatg atcgactata      2940
     cggcgatgat ggggatgatt atatatccgg aggacaggga gacgaccagt tatttggtgg      3000
     tagtggaaac gataaattga gtggagggga tggtaataat tatctgacag gaggaagcgg      3060
     taatgatgag cttcaggcac acggagctta taatattctg tcaggtggta ctggtgatga      3120
     taaactttat ggtggtggtg gtattgatct tctggatgga ggggaaggta atgactatct      3180
     gaatggtggt tttggtaatg atatttatgt ttatgggcaa aactatggtc atcatacaat      3240
     tgcagatgaa ggaggtaaag gagatcgttt gcacttatct gatattagct ttgatgatat      3300
     cgcatttaag agagttggaa atgatcttat catgaataaa gccattaatg gtgtactttc      3360
     atttaatgag tcaaatgatg tcaatgggat aacatttaaa aactggtttg cgaaagatgc      3420
     ctcaggagca gataatcatc ttgttgaggt tataacagat aaagatggtc gagagataaa      3480
     agttgataag atacctcata ataataatga acggtcaggt tatataaaag ccagtaatat      3540
     agcatctgaa aaaaacatgg ttaatatcac cagtgttgcc aatgatatta ataagattat      3600
     ttcttcagtt tcagggttcg attcaggtga tgaacgatta gcatctttat ataatttatc      3660
     cttacatcaa aacaacacac actcaacaac tttaacgaca actgtctgag actaaaagag      3720
     gaggtgatgg ccattccagg aggaatggtc atcgttatat gatgagtaaa tgtagttctc      3780
     ataatagtct gtatgcactg atattgcttg cacaatatca taatataact gtcaatgctg      3840
     aaactataag gcatcagtat aatacccaca cacaagattt tggggtgact gaatggttac      3900
     tggcagcgaa atctattggc ttaaaagcaa aatatgtaga aaaacatttt tccagattgt      3960
     caataatttc tttacctgcg ttgatatggc gggatgacgg taagcattat atattgtctc      4020
     gtattactaa agattcatca cgctatcttg tttatgatcc agaacaacat cagtcactaa      4080
     cttttagtcg ggatgagttt gaaaaactgt atcagggaaa agtcattctg gttacgtcaa      4140
     gagcaacagt agtcggagag ttagctaaat ttgatttttc ttggtttatc ccctctgttg      4200
     tgaaatacag gaggatttta cttgaggtgt taactgtttc tgcttttatt cagtttcttg      4260
     cgttaataac acctcttttt tttcaggttg taatggataa ggttttagtt caccgggggt      4320
     tttcaacgtt aaatattatc acaatagcat ttattatagt gatacttttt gaagtgatat      4380
     taaccggagc cagaacttat attttctctc atactacaag tcgtattgac gtcgaactgg      4440
     gtgctaagtt attcagacat ttgcttgcat tgcctgtttc atattttgaa aatcgcaggg      4500
     tcggagagac cgttgccaga gtaagggaac tggagcaaat tcgtaatttt ttaaccggac      4560
     aagcgttgac atcagttctt gatctatttt tttctgtaat atttttttgt gtcatgtggt      4620
     attacagccc tcaattaaca ctggttatat tattgtcact accttgttat gttatatggt      4680
     cattgtttat atcaccctta ttacgtcgac gtcttgatga taagtttctc aggaatgcag      4740
     aaaatcaagc ttttcttgtc gaaacggtaa cagcaataaa tacaatcaaa tccatggcag      4800
     tatcaccaca gatgattgct acatgggata aacaactggc cgggtatgtt gcttccagtt      4860
     tcagggtaaa tctggttgca atgacagggc agcaggggat acagctgata cagaaaagtg      4920
     taatggtaat tagtctatgg atgggagcac atcttgtcat atcgggagag ataagcatcg      4980
     ggcagttaat cgcgtttaat atgcttgcag gtcaggtcat tgctcctgtt atcagactgg      5040
     ctcatctttg gcaggatttt cagcaggttg gtatttctgt tgagcgcctt ggtgatgtat      5100
     taaatacacc ggtagagaaa aagtcaggca gaaatatact gccggaaatt cagggggata      5160
     tcgaatttaa aaatgtcaga tttcggtatt cttctgacgg taatgttatt ttgaataata      5220
     ttaatttata catatcaaag ggggatgtta tcggtatagt tggccgttct ggttcaggaa      5280
     aaagtacatt aacaaaactg cttcagcgct tttatatacc agagaccgga cagattttaa      5340
     ttgatgggca tgatttatca cttgcagatc cagaatggtt acgacgccag attggtgttg      5400
     tattgcagga aaatatacta ttaaatcgta gtattatcga taatattaca ttagcttctc      5460
     cggctgtatc tatggaacag gctattgagg cagccagact tgcaggtgcc catgatttta      5520
     ttagagaact aaaagaaggg tacaatacta ttgttggaga acagggcgtt ggtctttcag      5580
     gagggcagcg ccaacggatc gcaatagccc gggctcttgt tacaaatcct cgaattctta      5640
     tttttgatga agcaaccagt gctcttgatt atgagtcgga aaatataata atgaaaaata      5700
     tgtcaagaat atgtaagaac agaaccgtaa ttattattgc acacaggttg tcaactgtaa      5760
     aaaatgcaaa cagaataatt gttatggata atggctttat ttctgaagat ggcacacata      5820
     aagagcttat ctccaaaaaa gacagtttat atgcatattt atatcagttg caggcataac      5880
     gtatgcgctt ttacatgaaa ggtttatggg atttggtttg ccgttataag acggtttttt      5940
     ctgatgtctg gaaaattcgt cacacacttg atgctcctgt gagagaaaaa gatgagtatg      6000
     catttcttcc tgctcacctt gaactcattg aaacaccagt atccagacgt tctcattttg      6060
     ttgtatggag tattttatta tttgtaatta tatctcttct cttatctgtt cttgggaaag      6120
     ttgaagtggt ttcagtagca aatggtaagt ttactcatag tggaagaagc aaagaaataa      6180
     aaccgataga gaatgcgatt gtagaaaaaa taatggtaaa agatggctct tttgtaaaaa      6240
     aaaatgatcc attagttgaa ttgacggtgc ctggtgttga atctgatatt ttaaaatcag      6300
     aagcatcttt gttgtatgaa aaaacagaac aatatcgcta cgcaattctt tctgaatcaa      6360
     tacaacggaa tgagcttcct gaaataagga taacagattt tcctggcgga gaagataatg      6420
     cgggaggtga acattttcag agggttagct cattaataaa agagcaattc atgacatggc      6480
     agaacagaaa aaatcaaaag cagatcacat taaataaaaa aatagttgaa cgggatgcag      6540
     cgcttgctcg tgttagcctg tatgagcatc aggtatcaca ggaaggaaga aaactcaatg      6600
     attttaagta tttgttgaat aaaaaagctg tttctcaaca ttcagttatg gagcaggaaa      6660
     atagctatat tcaggcaaaa aatgaacatg cagtctggct tgcacaggtt tctcaacttg      6720
     aaaaagaaat agaacttgtg cgggaagaac tggcactgga gacgaatatc ttcagaagtg      6780
     aaattatcga gaagcacaga aaatcaacag ataacattgt gttgctggag catgagcttg      6840
     aaaaaaacag gcagagaaaa gcatcatctt ttattaaagc tcctgtgagt ggtactgttc      6900
     aggagttaaa tatacataca gaaggtggtg ttgtcacaac agcagaaacg ctgatgatta      6960
     ttgtccctga taatgatatt ctcgaagtaa cagcatctgt acttaacaag gatatcggtt      7020
     ttatacaacc tggacaggag gtcgttatta aagtagatgc atatccatat acacgtcatg      7080
     gttaccttac agggaaagta aaaaatataa ctgcagattc tgtttctgtt ccggatacag      7140
     ggcttgtatt taacgtgatt atatctgttg atcggaatga tatacaggga gaaagaaaaa      7200
     aaatccctgt tacagctgga atgactgtta tggcagaaat aaaaaccggg gtgcgtagtg      7260
     ttatcagcta tcttcttagt ccattaaagg aaactattaa tgaaagttta cgtgaacgtt      7320
     agtatataaa taacatattg gctttttata tgatatagat ttctgaaata atcttgtaaa      7380
     gattatctat gttatttaaa caaactatga tacagttttt atctttaaaa atagttaatg      7440
     gaatggatag tattaaatta cttgataaag ttattatcta tcaacaacag aatgagcaat      7500
     tatatccagc acaggaacat cttcttttac aactttgtat gcgagttacc aaaaaactta      7560
     ctgatatatt aatgcctccc tgaaggggga tggtataaac gatacaacgc ttatgcttct      7620
     agccttgtta tccagtactg ataatttctg cttatcttcg actgaactca gtgaaagatt      7680
     agatgtttcc agaacatata tcaccagagc ttgtgattct ctggaaaaat ttggttttat      7740
     taaacgtatg gaaagtaagg aagatcgacg tagtaagaat atttatctga cttcagacgg      7800
     taatttgtat ttacagcgga ccacaaggat atatggacgc tatttaaaaa aatatggagc      7860
     aaccttacag atgatgaaat caaaacattt aaaataatca gcaaaaaggt tttatctcaa      7920
     aatatttctc agtaatatta catgtaatca tgtatataaa tcctgagttc ttatttttat      7980
     aatttattat tctgcaattg tgtagggggg atagatactg gttattcccc ctcttttttc      8040
     tggtaaggaa aatcagagtt acgctatgtg gattttgaac gtatttcagg tgcataaatc      8100
     tgtcagaatc tacatagcgc atttttcagt tttcaattgt cacttacatc catccattga      8160
     tagatcatta gcgtcctggc attaccccaa ttctcccaaa aacggcaaac cagccctcag      8220
     cccgcgccac gactggctta atacgggatc cctgctgcaa aacgtacctt tacgtatttg      8280
     gttttacccg caataatgcg tgataagcaa acaaaaggat ccgcacgctg cgatttattg      8340
     tcgtggaagg atccgggcgt tcaggtcaga atacctgtat ccataaacag tgcgtgtgct      8400
     acgtgaaaaa taactcatga acaatgtcat tcccctgcag aattcaccag aacgcgtctt      8460
     cctgttaccc attgcgccgg gggtggattt tgcaacagcg ctctccctga gaagaatggc      8520
     cacttccaca ggggccacac cggcctacct gctggccccg gaagtgagtg cccttctttt      8580
     ctatatgccg gatcagcgtc accatatgct gttcgccacc ctctggaata ccggaatgcg      8640
     tattggcgaa gcccggatgc tgacgccgga atcatttgac ctggatggag caaggccgtt      8700
     tgtgcggatc ctgtccgaaa aagtgcgtgc gcgacgcgga cgcccgccaa aagatgaagt      8760
     ccgcctggtt ccgctgacgg atataagcta tgtcaggcag atggaaagct ggatgatcac      8820
     cacccggccc cgtcgtcgtg aaccattatg ggccgtgacc gacgaaacca tgcgcaactg      8880
     gctgaagcag gctgtcagac gggccgaagc tgacggagta cacttttcga ttccggtcac      8940
     accacacacc ttccggcaca gctatatcat gcatatgctc tatcaccgcc agccccggaa      9000
     agtcatccag gccctggcag gtcacaggga tccacgttcg atggaggttt ataccagagt      9060
     gtttgcgctg gatatggctg ccacgctggc agtgcctttc acaggtgacg ggcgggatgc      9120
     tgcggagatc ctgcgtacac tgcctcccct gaggtgacgg catacgcgct tccttatata      9180
     agctgtggtc agcagaacag acataacata agctggagca tgtatataag ctgtagtgag      9240
     taagtcatgt tttatgaagg gagcaatgcc tcagcatcag gttacggggt gactcacgta      9300
     agggaccggc agatgacagc tcagctacag gcagcactgc aggaaactga atataaactg      9360
     cagtgagcag accactcact gcacctgata atataagctg tagtcagtaa aggaacactc      9420
     ttcactgact acagtttatg ttcagcggga tttgaagagt ttttccaggt catccagcgt      9480
     gatgcccagt ttctcaagca gggcaagctt ctccgccatc tccggactga ctttttccgc      9540
     aggtgaaggt ggcaacggat tttccttact ctcatcattc ggtgctttta accggggacg      9600
     ccggtagtga atgcagaaga gttttgtccg cccccgctgg atctccgtgt aatcaagata      9660
     tccaatctcg cgcagctgct ccattgcccg tctgaccgtc tggttctggg aaaatacagg      9720
     agacttcaga ttgaggcgtg cacgcagccg cgccagcgat accggtgccg gatcccgggg      9780
     caggctctct ataaaggtgt agagtgcctg ggcggactcc cgtcgcttca gggcattaat      9840
     cgccttaagc tggagaagga cctttctgtc aaactggtac agttcaaaaa ggcggggatc      9900
     agcctgtaac tgaacaatat cccgttcagt atcgtagtag gctgactgta ccagatgggt      9960
     gatgtattcc cgggtgtgct tctcatcggt gcgggaaaag gagatcacgg taccggcaat     10020
     gcgtttcagg gaagggctga tgcgctcacg cagcctgcgt gatgactggc ttgaaggtat     10080
     accacacagt tttgcaaact cgacaaaagg cagttcaact ttgtcaccaa ttacgttatg     10140
     gcgggcaaag gaatgaatga tccccaccca ggtcttgaaa tcgttatcca tatccaggcg     10200
     ggggccggtg atctcaacct tatcgaatcc ctcagcacgg gccagggaaa gacgtgtcag     10260
     ctcttccgtg gcatcagtac gtgacagtgt atttttttta ctgttcttca gtgatttaag     10320
     ggtcggtaca aaaacgccca gacgcatcag cgccacaggt tgtacggtgt tgttattgtt     10380
     tggtgtcagt gtcaccagct caccggacga cttatccacc tcgccgaaca gttttttgat     10440
     gtctgaattt tcgttttcca gaaagcctcc tgcctgtgga cagtaaaaga ataaacagca     10500
     aatcgtgtgt cagagccccg ctaactgact gaagaaaaac ctgcagcctg tatttaacag     10560
     ctgagtctgg cgtactgacc atagtttatg tcattaactt acttcagtat atggattact     10620
     gaatacagct tatcattagc atgttacagt ttatcagtaa catgccactg cttatgtgat     10680
     cgtggtcccg gcccatgagt gacaaggttt gcagcggtat ggggatcttt aatggatcct     10740
     ttgttgatca ttcatggatc tgtttactgg atcgagcctc cggatatgtg gataaatcat     10800
     tccagggaaa cagcatacac aaccgcttat aagggtgcct gttcgatgaa cttaagggtt     10860
     ttcgggttaa agtcgtccct caggtactgc agggcattct caaggcagtt catgccgtga     10920
     gtcagctcat tactgtcatt gagaaaggaa aagtgcgtcg cccacagtga gcctgattcg     10980
     atgatgccct ttaggccgtt caggtcagtg taatgataaa tcttcatctg gcagcctcct     11040
     gactgtccgg gccctgttcg cactcagttt tttgcacgtc agacagaaac gggaacaccg     11100
     taatagcggc ttcccttgct tcttctatcg accgttcccg ggcctgccat tccggatctg     11160
     ctgccagcac ttcgtcggcg gtatcgcgta accaggcata cagctcttcg ccaccatcga     11220
     gatcaatctg gcgggttttt accgggtcct catgcttcat gatattacgc aacagcttac     11280
     caatctgccc gtcagattcg acaggttcgt aaggaatgta gtccggatat tcgtcgaatt     11340
     gatccagcgt caaatcgatg tactctccgt ccagcaatac gatgacatgc ccgtgaactg     11400
     ttgagttttc cgcttcatga aagccagcgt tcccttccat aaaaatgatg cacggatggc     11460
     atctctctcg ttctttgagg tagtacgcca gagtattgct ggctaaatcg cagctgctgt     11520
     gcgggaaatt cctcagttcc gttttccagc ggggaaaatg acgacacccg tcagcccgtt     11580
     caccgccacc aagctccagt gcccgtcgaa atgcctttat acgtaatact ctttcctgtc     11640
     tcatttcttc accttcccgt cctggcgggc cagagccagc agttcggtct gaagctggcg     11700
     gccgtcctcc cgggcttcct tcagctccgc cttcgtgtcc tgcagctgcg ccgccaggtg     11760
     ttcgccggtg gcggtcaggc gggccacctg ctcgcgcagc ggcagcgcct ccgcgcgtag     11820
     ctcgcgtacc tcctgcagca ggcggtcacg ttcggccacc acctcgcgca gcaccgccag     11880
     ctcgctttcc agcgcggcca cgttcgccag cgcctcatcc cgctccttgt cggcccgggc     11940
     aatgtcgtcg tcggcctgct cgcgcgccgc cagggccccg gcttcagcct gtttcacggc     12000
     cgcctgccac agcagcccca gctggccggt cagcagctgc gccagctccg gcggcagggg     12060
     cgtggcctgc tcgcgctggc gggcgcggaa cgcgcgcatc accggggaga tgtgggacag     12120
     ggagccgccg ccgaggtgct gacggacctg ctcgttggtc gggttcgggg tgccggcggc     12180
     gatcagggcg gcggcggcgt cttcaatgcg gcggacggtg tccggggaga gggatgtcat     12240
     ggtctggctc cggtttctca gggaatggcg ccatcgtatg cccggtatga aaaatacaca     12300
     atacatacaa tacaattcat acatacagta cagaacttac atacactctt tctcttttcc     12360
     tggtcagatc cggtttctgg tggttacgga tcttcctctc cctccgcaca gcgttacatc     12420
     ccgtcagcac agcatgcagt gcctcattca gttgcccatg gcactatatg ttgtgttgta     12480
     tctctggact gtgatgcgcc gcgcaggggc ggaaaacagc gatatgatga ttttctcagg     12540
     tggtacactt ccggaaagtc gtttattcaa ataaagtcgg atccatacga aacgggaatg     12600
     cggtaattac gctttgtttt tataaggcag attttaattt ttattggtta acataacgaa     12660
     aggtaaaata cataaggctt actaaaagcc agataatagt atgcgtattt gcgcgctgat     12720
     ttttgcggca taagaatata tactgatatg tatacccgaa gtatgtcaaa aagaggtgtg     12780
     ctatgaagca gcgtattaca gtgacagttg acagcgacag ctatcagttg ctcaaggcat     12840
     atgatgtcaa tatctccggt ctggtaagca caaccatgca gaatgaagcc cgtcgtctgc     12900
     gtgccgaacg ctggaaagcg gaaaatcagg aagggatggc tgaggtcgcc cggtttattg     12960
     aaatgaacgg ctcttttgct gacgagaaca gggactggtg aaatgcagtt tatgaaccgc     13020
     cccggttttc ctggagagtg ttttatctgt gaactcaggc tgccagatca tcgtttctga     13080
     tggaagcata ataagctttt tctgcttctg ccggagggat atgacccagc cttcccagca     13140
     atcgtcgatt gttataccag tccacccacg tgagtgtggc cagttccact tctgcacggt     13200
     ttttccagct cttacggtgt attacctccg ctttgtaaag accattgatg ctctccgcca     13260
     tcgcgttgtc atacgagtca cctgtactcc ctgttgatgc cagcagtttt gcttctttta     13320
     gtcgctccgt ataggccagt gatacatact gagaaccttt atcactgtga tggactgtgc     13380
     cggacggccg acgggcccac aacgcctgct ccagtgcatc cagcacgaat gtcgtttcca     13440
     tagacgatga gactcgccac cccacgatac atccggaaaa cacatcaatg atgaacgcca     13500
     catagacgaa gccctgccat gtgctgacgt aagtaaaatc agccacccac agctggtcag     13560
     gacgttctgc cacgaactga cggtttacgc ggtcgcctgc ggaaacggct ttccggctga     13620
     cggtagtacg gaccttttta ccccggagaa caccggcaag tcccataacc gccatgaggc     13680
     gcgccactgt acatctggcc accctgatac cttcgcgtaa caactggcgc cagactttac     13740
     gcacaccgta cacctgatga ttttcatcgt atacgcgctg tatctctctc ttcagccagt     13800
     catcgcgctg cgcacgggca ctgcgtttat ccggatgatg tcgctgttgc tgacagtggt     13860
     aatacgttga cggggcaata tgcagttcac tgcataccgg tccgaccccg tactgctcac     13920
     gcagcttatc cagcagcggc attatttttt ccagaggcgg tcgaactccg ccttcgcaaa     13980
     ataagcggaa gcctggcgaa ggatatcgtt actgcggcgc agttcacgat tttcacgttc     14040
     cagctctttc agacgctgac gttcagcggt ggtgagtcca ccatcaccgc ccccggtatc     14100
     ccgctcatgc tgacgaaccc acacacgcag agtctctggt gtacagccaa tctttggggc     14160
     aatggaacaa attgccgccc attgtgagtc atattcgccc tgactttcca gaaccatacg     14220
     gactgcccgt tgacggacct cgggggaaaa acgtgtattt ttagtcatcc tgtttacctc     14280
     tttctcaggg agtttagtct ccaggattcc cggggcggtt cattaaggtt tacacctata     14340
     aaagagagag ccgttatcgt ctgtttgtgg atgtacagag tgatattatt gacacgcccg     14400
     ggcgacggat ggtgatcccc ctggccagtg cacgtctgct gtcagataaa gtctcccgtg     14460
     aactttaccc ggtggtgcat atcggggatg aaagctggcg catgatgacc accgatatgg     14520
     ccagtgtgcc ggtctccgtt atcggggaag aagtggctga tctcagccac cgcgaaaatg     14580
     acatcaaaaa cgccattaac ctgatgttct ggggaatata aatgtcaggc tccgttatac     14640
     acagccagtc tgcagtcatg gtaccggcag tgtattctgc cggacagcct gcatcgctgc     14700
     ctgttgccat tgattatccg gcagctctgg cacttcgcca gatgtcgatg gtccatgatg     14760
     aactgccaaa atatctgctg gctccggaag tgagtgccct gctccattac gtcccgaatc     14820
     tgcaccgcaa gatgctgctg gccacactgt ggaacaccgg agcacgcatt aatgaagcac     14880
     tggcgctgac gcggggggat ttttcgcttg cgcctccgta tccgtttgtg cagcttgcga     14940
     ccctgaaaca acggaccgaa aaagctgcca ggacggcggg gagaatgccc gccggtcagc     15000
     agactcaccg gctggttccg ctctctgact cctggtacgt cagccagctg cagacgatgg     15060
     tggcaacact gaaaataccc atggagcggc gtaaccgtcg cacaggaagg acagagaaag     15120
     cgcggatctg ggaagtgacg gacagaacgg tcaggacctg gattggggag gcggttgccg     15180
     ccgctgctgc tgacggtgtg acgttctctg ttccggtcac accacatacg ttccgccatt     15240
     cctatgcgat gcacatgctg tatgctggta taccgctgaa agttctgcaa agcctgatgg     15300
     gacataagtc catcagttca aaggaagtct acacgaaggt ttttgcgctg gatgtggctg     15360
     cccggcaccg ggtgcagttt gcgatgccgg agtctgatgc ggttgcgatg ctgaaacaat     15420
     tatcctgaga ataaatgctt tggcctttat atggaaatgt ggaactgagt ggatatgctg     15480
     tttttgtctg ttaaacagag aagctggctg ttatccactg agaagcgaac gagacagtcg     15540
     ggaaaatctc ccattatcgt agagatccgc attattaatc tcaggagcct gtgtagcgtt     15600
     tataggaagt agtgttctgt catgatgcct gcaagcggta acgaaaacga tttgaatatg     15660
     ccttcaggaa caatagaaat cttcgtgcgg tgttacgttg aagtggagcg gattatgtca     15720
     gcaatggaca gaacaaccta atgaacacag aaccatgatg tttggtctgt ccttttacag     15780
     ccagtagtgc tcgccgcagt cgagcgacag ggcgaagccc tcgagtgagc gaggaagcac     15840
     cagggaacag cacttatata ttctgcttac acacgatgcc tgaaaaaact tcccttgggg     15900
     ttatccactt atccacgggg atatttttat aattattttt ttatagtttt tagatcttct     15960
     tttttagagc gccttgtagg cctttatcca tgctggttct agagaaggtg ttgtgacaaa     16020
     ttgccctcag aagaagctgt tttttcacaa agttatccct gcttattgac tcttttttat     16080
     ttagtgtgac aatctaaaaa attgtcactg aaccgccccg gttttcctgg agagtgtttt     16140
     atctgtgaac tcaggctgcc agatcatcgt ttccgatgga agcataataa gctttttctg     16200
     cttctgccgg aggagtatgg cccagccttc ccagcaatcg tcgattgtta taccagtcca     16260
     cccacgttag tgtggccagt tccacttctg cacggttttt ccagctctta cggtgtatta     16320
     cctccgcttt gtaaagacca ttgatgctct cagccatcgc gttgtcatac gagtcgcctg     16380
     tactccctgt tgatgccagt aatccggctt cttttagtcg ctccgtatag gccagtgaca     16440
     catactgaga gcctttatcg ctgtgatgga tggtgccaga cggacgacgg gcccacaacg     16500
     cctgctccag cgcatccagc acgaatgtcg tttccataga cgatgagacc cgccccccca     16560
     cgatgtatcc ggcaaacaca tcaatgataa acgccacata gacgaagccc tgccatgtgc     16620
     tgacgtaagt aaaatcagcc acccacagct ggtcaggtcg ttctgccacg aactgacggt     16680
     ttacgcggtc gcctgcggca acggctttcc ggctgatggt cgtacggacc tttttacccc     16740
     ggagaacacc ggcaagtccc ataaccgcca tgagacgtgc cactgtacat ctggccaccc     16800
     tgattccttc ccgtaacaac tgacgccaga ctttacgcac accgtacacc tgatgatttt     16860
     catcgtatac gcgctgtatc tctctcttca gccagtcgtc gtgctgcgca cgggcactgc     16920
     gtttatccgg atgatgtcgc tgttgctgac aatggtaata cgttgacggg gcaatatgca     16980
     gttcgctgca taccggtccg accccgtact gctcacgcag cttatccagc agtggcatca     17040
     ttttttccag aggcggtcga actccgcctt cgcaaaataa gcggaagcct ggcgaaggat     17100
     atcgttactg cggcgcagtt cacgattttc acgttccagc tctttcagac gctgacgttc     17160
     agcgctggtg agcccaccat caccgccccc ggtatcccgc tcatgctggc gaacccagac     17220
     acgcagagtc tccggcgtac agccaatctt tggggcaatg gaacaaattg ccgcccactg     17280
     tgagtcatat tcatcctgac tttccagaac catacgaatc gcccgctgac ggacttcggg     17340
     ggaaaaacga gtatttttag tcatcctgtt tacctctttc tcagggagtt tagtctccag     17400
     gatttccggg gcggttcaca cacttcacat ggatctgtca tggcggaaac agcggttatc     17460
     aatcacaaga aacgtaaaaa tagcccgcga atcgtccagt caaacgacct cactgaggcg     17520
     gcatatagtc tctcccggga tcaaaaacgt atgctgtatc tgttcgttga ccagatcaga     17580
     aaatctgatg gcaccctaca ggaacatgac ggtatctgcg agatccatgt tgttaaatat     17640
     gctgaaatat tcggattgac ctctgcggaa gctagtaagg atatacggca ggcattgaag     17700
     agttttgcgg ggaaggaagt ggttttttat cgccctgaag aggatgccgg cgatgaaaaa     17760
     ggctatgaat cttttccctg gtttatcaaa cgtgcgcaca gtccatccag agggctttac     17820
     agtgtacata tcaacccata tctcattccc ttctttatcg ggttacagaa ccggtttacg     17880
     cagtttcggc ttagtgaaac aaaagaaatc accaatccgt atgccatgcg tttatacgaa     17940
     tccctgtgtc agtaccgtaa gccggatggc tcaggcatcg tctctctgaa aattgactgg     18000
     atcatagagc gttaccagct gcctcaaagt taccagcgta tgcctgactt ccgccgccgc     18060
     ttcctgcagg tctgtgttaa tgagatcaac agcagaactc caatgcgcct ctcatacatt     18120
     gagaaaaaga aaggccgcca gacgactcat atcgtatttt ccttccgcga tatcacttcc     18180
     atgacgacag gatagtctga gggttatctg tcacagattt gagggtggtt cgtcacattt     18240
     gttctgacct actgagggta atttgtcaca gttttgctgt ttccttcagc ctgcatggat     18300
     tttctcatac tttttgaact gtaattttta aggaagccaa atttgagggc agtttgtcac     18360
     agttgatttc cttctctttc ccttcgtcat gtgacctgat atcgggggtt agttcgtcat     18420
     cattgatgag ggttgattat cacagtttat tactctgaat tggctatccg cgtgtgtacc     18480
     tctacctgga gtttttccca cggtggatat ttcttcttgc gctgagcgta agagctatct     18540
     gacagaacag ttcttctttg cttcctcgcc agttcgctcg ctatgctcgg ttacacggct     18600
     gcggcgagcg ctagtgataa taagtgactg aggtatgtgc tcttcttatc tccttttgta     18660
     gtgttgctct tattttaaac aactttgcgg ttttttgatg actttgcgat tttgttgttg     18720
     ctttgcagta aattgcaaga tttaataaaa aaatgcaaag caatgattaa aggatgttca     18780
     gaatgaaact catggaaaca cttaaccagt gcataaacgc tggtcatgaa atgacgaagg     18840
     ctatcgccat tgcacagttt aatgatgaca gcccggaagc gaggaaaata acccggcgct     18900
     ggagaatagg tgaagcagcg gatttagttg gggtttcttc tcaggctatc agagatgccg     18960
     agaaagcagg gcgactaccg cacccggata tggaaattcg aggacgggtt gagcaacgtg     19020
     ttggttatac aattgaacaa attaatcata tgcgtgatgt gtttggtacg cgattgcgac     19080
     gtgctgaaga cgtatttcca ccggtgatcg gggttgctgc ccataaaggt ggcgtttaca     19140
     aaacctcagt ttctgttcat cttgctcagg atctggctct gaaggggcta cgtgttttgc     19200
     tcgtggaagg taacgacccc cagggaacag cctcaatgta tcacggatgg gtaccagatc     19260
     ttcatattca tgcagaagac actctcctgc ctttctatct tggggaaaag gacgatgtca     19320
     cttatgcaat aaagcccact tgctggccgg ggcttgacat tattccttcc tgtctggctc     19380
     tgcaccgtat tgaaactgag ttaatgggca aatttgatga aggtaaactg cccaccgatc     19440
     cacacctgat gctccgactg gccattgaaa ctgttgctca tgactatgat gtcatagtta     19500
     ttgacagcgc gcctaacctg ggtatcggca cgattaatgt cgtatgtgct gctgatgtgc     19560
     tgattgttcc cactcctgct gagttgtttg actacacctc cgcactgcag tttttcgata     19620
     tgcttcgtga tctgctcaag aacgttgatc ttaaagggtt cgagcctgat gtacgtattt     19680
     tgcttaccaa atacagcaat agtaatggct ctcagtcccc gtggatggag gagcaaattc     19740
     gggatgcctg gggaagcatg gttctaaaaa atgttgtacg tgaaacggat gaagttggta     19800
     aaggtcagat ccggatgaga actgtttttg aacaggccat tgatcaacgc tcttcaactg     19860
     gtgcctggag aaatgctctt tctatttggg aacctgtctg caatgaaatt ttcgatcgtc     19920
     tgattaaacc acgctgggag attagataat gaagcgtgcg cctgttattc caaaacatac     19980
     gctcaatact caaccggttg aagatacttc gttatcgaca ccagctgccc cgatggtgga     20040
     ttcgttaatt gcgcgcgtag gagtaatggc tcgcggtaat gccattactt tgcctgtatg     20100
     tggtcgggat gtgaagttta ctcttgaagt gctccggggt gatagtgttg agaagacctc     20160
     tcgggtatgg tcaggtaatg aacgtgacca ggagctgctt actgaggacg cactggatga     20220
     tctcatccct tcttttctac tgactggtca acagacaccg gcgttcggtc gaagagtatc     20280
     tggtgtcata gaaattgccg atgggagtcg ccgtcgtaaa gctgctgcac ttaccgaaag     20340
     tgattatcgt gttctggttg gcgagctgga tgatgagcag atggctgcat tatccagatt     20400
     gggtaacgat tatcgcccaa caagtgctta tgaacgtggt cagcgttatg caagccgatt     20460
     gcagaatgaa tttgctggaa atatttctgc gctggctgat gcggaaaata tttcacgtaa     20520
     gattattacc cgctgtatca acacagccaa attgcctaaa tcagttgttg ctcttttttc     20580
     tcaccccggt gaactatctg cccggtcagg tgatgcactt caaaaagcct ttacagataa     20640
     agaggaatta cttaagcagc aggcatctaa ccttcatgag cagaaaaaag ctggggtgat     20700
     atttgaagct gaagaagtta tcactctttt aacttctgtg cttaaaacgt catctgcatc     20760
     aagaactagt ttaagctcac gacatcagtt tgctcctgga gcgacagtat tgtataaggg     20820
     cgataaaatg gtgcttaacc tggacaggtc tcgtgttcca actgagtgta tagagaaaat     20880
     tgaggccatt cttaaggaac ttgaaaagcc agcaccctga tgcgaccacg ttttagtcta     20940
     cgtttatctg tctttactta atgtcctttg ttacaggcca gaaagcataa ctggcctgaa     21000
     tattctctct gggcccactg ttccacttgt atcgtcggtc tgataatcag actgggacca     21060
     cggtcccact cgtatcgtcg gtctgattat tagtctggga ccacggtccc actcgtgttg     21120
     tcggtctgat tatcggtctg ggaccacggt cccactcgtg ttgtcggtct gattatcggt     21180
     ctgggaccac ggtcccactt gtattgtcga tcagactatc agcgtgagac tacgattcta     21240
     tcaatgcctg tcaagggcaa gtattgacat gtcgtcgtaa cctgtagaac ggagtaacct     21300
     cggtgtgcgg ttgtatgcct gctgtggatt gctgctgtgt cctgcttatc cacaacattt     21360
     tgcgcacggt tatgtggaca aaatacctgg ttacccaggc cgtgccggca cgttaaccgg     21420
     gctgcatccg atgcaagtgt gtcgctgtcg ccggcctcct cacccggtca cgtttcgtcg     21480
     ttcctcctcc acgcgctgcg gcttcggggc cgcacctgca ttcgtatgcg gtcgcccggt     21540
     tacaggtgcg gcacggcctg atggaggccg catgtgagag gagaattccc atgccaaact     21600
     ggtgctcgaa tcgtatgtat ttttctggtg aaccggcaca gatcgctgag attaaacgac     21660
     tggccagcgg tgcagtcaca ccgctttatc gccgcgccac aaatgaaggt attcagctgt     21720
     ttctggccgg aagtgccgga cttctgcaga ccactgaaga tgtgcggttt gaaccatgcc     21780
     ccggactgac ggctgccggg cgtggcgttg tatcgccgga gaatatcgcg ttcacccgct     21840
     ggctgacaca cctgcaggac ggtgtacttc tggatgagca aaactgcctg atgctgcatg     21900
     aactctggct gcagagcggt actggccggc gtcgctggga agaattaccg gatgatgcca     21960
     gggaaagcat taccgctctt ttcaccccaa aaagaggtga ctggtgcgac atctggagta     22020
     acgaggatgt atctgtgtgg tggaaccgtc tgtgtgacaa cgtcctgccg gaaaaaacca     22080
     tgccgtttga cctgctgacg gttctgtcca ctcgcctgga tgttgaagtg aatggcttta     22140
     acggtggtgt tctgaacggt gttccttctg catatcactg gtatacggaa cagtatggcg     22200
     tgaagtggcc ttgtgggtat gaggtgaata tcagcagtca gggagacaac ttcattcagg     22260
     ttgatttcga cacgccgtgg tgtcagccgg aaagcgacgt tattgcagta ttaagccgcc     22320
     gtttcagttg catgctggag cactggtacg ccgggcaggg ctgcaatttc tgtggctggc     22380
     agcgatatga gcgtggagag cttgttgatg tgctgtgggg ggaactggaa tggtcttccc     22440
     cgacagatga tgatgagctg ccggaagtca ccgcgccgga gtggatagtc gacaaggtgg     22500
     cgcattacgg tggatgaagt atgacggaga cgggcgggca accgcccgtt tcttttccgg     22560
     taaaggatgt cgccgggctc ctctttttac tgcgccggct gacgcggcgc ggcaggaacg     22620
     ctgcctgtgg tcagtgtccc gcgtccggcc gggcacggga cgggcgcttt taccgctccc     22680
     ggctggcatc ggtgacagtg tacgccagcc cgtcgccctt ttctgatgaa cgcccttcaa     22740
     gccgctttcg cggcatattc tcgccgtcaa aaagacgacg gctgcgatat tccacggtcg     22800
     gcctgacccg ttaccggacg cggtgaacag cccacaggcc gcggggaacg ggcgccacag     22860
     gggcgccctc ccggtgccct ctgtaagaga aggagtgctg ttatgtcccg ttttatccag     22920
     ggtgactgcg tgcgtgttat ggccacgatt ccgggcaatg gtgtcgattt catcctcacc     22980
     gacccgccat atctcgtcgg tttccgtgac cgtcaggggc gtaccatcgc cggcgataaa     23040
     accgatgaat ggctgcaacc ggcctgtaat gaaatgtacc gcgtgctgaa aaaagatgcg     23100
     ctgatggtga gcttctatgg ctggaaccgc gtcgatcgct ttatggccgc ctggaaaaat     23160
     gcgggattca gcgtggttgg ccacctggtt tttaccaaaa cctacacttc gaaggccgca     23220
     tatgtgggct atcgccacga atgcgcttac atcctggcaa aagggcgtcc ggcgctgcct     23280
     cagaagccat tgcccgacgt gctgggctgg aaatattcag gcaatcgtca tcacccgacg     23340
     gaaaagcctg ttaccagcct gcaaccactg attgagagct tcacacaccc gaacgcgatt     23400
     gtgctggacc cgtttgcagg cagcggctca acctgtgtgg ccgcccttca gtccggacgc     23460
     cggtatatcg gtatcgagct gcttgaacag tatcaccgtg ccggacagca acgtctggct     23520
     gccgtacagc gggccatgca gcagggggcc gcaaatgatg actggtttat gccggaggct     23580
     gcgtaaatga actatgccgg acatgaaaaa cttcgcgccg acgtggcgga ggtggccaac     23640
     accatgtgtg accttcgggc caggctgaac gatatggagc atcgctgtcg ctttgattcc     23700
     gatgtgcttg ttgaacgcct ggcacgccag acgctgtatc gcgccaatcg cctgttcatg     23760
     gaggcgtata ccgaaattct ggaactggat gcgtgcttta aagattgaga aggagacgag     23820
     aatgtacgga acatgcgaaa cgctatgccg ggagctggca gcaaagtatc cgggatatac     23880
     accgctgatg ctggttatct ggtccccgga agagattcag gccctcgctg acggaatgga     23940
     tatttccctg tccgatcctg aaatcaggac cgtcctggcg cgcctggagg acatcccgga     24000
     agaccagcga attgagtccg gtatttcttc tgccgcggcg atggagatta tcagcaacgt     24060
     gagcgaaaac cgccaggtga ccgtcccggc tgaactgctg gcgtccctga ttcagaccgc     24120
     cgaacaggca ctgtggaaac gtgaatgggc cgcccgtgat tacggtctcg ccgtcccgga     24180
     atgcgttacc cgccgtcagg cggtggttaa tcaggcccgc atcctgctga aaaacaacac     24240
     acacgaaaac ggctgatgtt atcgccgcct gcgggcggcg atacagggag aacgattaat     24300
     catgaacgaa aacacaacgc tgaacgcact gatttgtcgt cacgcccgta acctgctgct     24360
     ggcgcagggc tggccggaag agacggatgt cgaccagcgt aacccgaagt atccgggctg     24420
     gatcagcatt tatgttctgc tggatgcgcc ccggctggcg acgttactcg ttaaccgcca     24480
     cggcggcgta ctgccgccgc acctggcctc cgccattcag aaactgaccg gaaccggagc     24540
     ggaacttgtt ctgtccggca gtcagtggca gtcgctgccg gtgcttccgg cagacggaac     24600
     gcaggtgtct tttccgtatg ccggtgaatg gctgaccgaa gacgaaatca gggctgtact     24660
     tgcggcggtg cgcgatgcgg tacgcagtgt cagttgccgg gtggcagaag atacgcggcg     24720
     tatccgggcg gcgctgacca ccaccggtca gacgttactg acccgccaga cgcgccgctt     24780
     tcgcctggtc gtgaaggaaa gcgatcaccc ctgctggctc gatgaggacg acgaaaacct     24840
     gcccgtggtg ctcgatgcca tcctgaaccg gggcgcacgt ttttcggcgg tggaaatgta     24900
     tctggtcagc gattgtattg aacatatcct gtccagtggg ctggcctgcg atgtgctgcg     24960
     tataccggat gaaccgcccc gccggtggtt tgaccgtggt gttctgcggg aggtggtccg     25020
     ggaagcccgg aacgaaatcc gcagcatggc ggatgccctg gcaaaaatcc ggaaatgatg     25080
     acgttggcgg ggtaaatccc cgcctttttc ctgccggtcc ccggacagag cacaaaggaa     25140
     gtcgccgctg gctccgcttt acccggccat gcagggcatg gccttgtggt ttttcagtta     25200
     tgtggcctca gcgtcgtgtg cgggcggtgc cgtgcctcca tcttagccgg gctggcgttg     25260
     atgcaagggt acgcttcgcc gctgcggtca cccggtccct ccttcccgtc tgccgtgatt     25320
     ttccggtcgt tcgcccgctc aggtttcgcg gcctcaccct gcaactcccg tcagccgtgt     25380
     gcgtcaggct gcggcttccc ttgcgccctg tgcatccccg ccttatcgcc cggcttttct     25440
     ggaggcacgg caccgcccgg tgtcgcggaa tatgtgaaca acggaggaaa acatcatgca     25500
     atatgcgaaa cctgtcactc tgaatgttga agagtgcgac cgtctctcct ttctgcctta     25560
     cctgtttggc aacgattttc tgtatgccga ggcgtatgtg tacgcgctgg cgcaaaaaat     25620
     gatgccggaa tatcagggag gcttctggca cttcatccgc ctgccggacg gtggcggtta     25680
     catgatgccg gatggcgacc gtttccacat ggtgaacggt gcaaactggt ttgaccgtac     25740
     cgtgagtgct gatgcctgcg gcatcattct gacttccctt gtgattaacc gccagttgtg     25800
     gctgtaccac gacagcggtg atgcaggact gacccagctt taccggatgc gcgatgcgca     25860
     gttgtggcgt cacatcgaat ttcaccctga atgcaacgcg atttacgcgg cactggactg     25920
     attaacggac ggggcggcaa tgccgcccct gtaaaggaga cgagaacatg tactgtactg     25980
     ttaaagaaat catccgcgat gtactggata cagacgtgcc ggacagtgaa tgcgtttttg     26040
     ccgtggtgct gacccgtggg gatgtgcgcc acatagccca ggactggaac ctgtcagacg     26100
     atgagctgga aaccgtcatg cagcggctgg acgatgcctt tgaatatggt gcggatgtca     26160
     gcattgttca cgacgttgtt cgtgagttga tggaagaaaa gcgtgccagc cgtcaggtga     26220
     cagttccggc ggtgatgctg gaaaaagtga tggcgctggc aggcagtgaa atgaagcgcc     26280
     tgtatgccgt cgggagtgag aacgggggcg acggtgatgc gttcgtcagg gaggaacgcg     26340
     aagcaatgga cgttgtgtta caggcgctgg acggggagca catgtcatga atatcagcac     26400
     agaaacccgc gaaattctgc gcaattacaa agccgtgatt aatgcgcgac gtcgtgaaat     26460
     ggggcagaaa ccgctcacca ccgcgcagat tgttgatgaa atctgcgatt ttgtggcgaa     26520
     tcagcaggct gttttcctgg gcggtcacta catcttacag ggcagcagaa acaggtgata     26580
     cagggctggc ggtggaggcc gcctgtcagc ccgcgcgaaa acccctggca ggctgacgcc     26640
     tgccggaagg gaagcgggcc acgctgacgc gtcgtccgtt acccttcctg tttgtgatgt     26700
     gtccggaatg tttttttctg atgttatttt tctgtggtta ccgtgcctgt tactgttctt     26760
     cttctttttc ctcttcctct tcctcctctt ctttccgttc ctctcctgct tatggctttt     26820
     ccgggcgtcc ccctggcggg gcgggctgtc gtgaacggag ccagcgaagc tgtctccgcc     26880
     ctggcgggct tccatccctg acgcgaaacc ctggcttgca gcgaccgttc cggtcgcgca     26940
     gcctctgtcg cgccgtggcc tgcgctcccg gcatcccggc aaaaggccgc cgggatgtaa     27000
     ggggcaacgc cgtttcgcaa accgcgcttc acgtcgttgc ggcgggtccc tgctcattgc     27060
     ctgccgggtg ccacacaccc gtatgagtcc ctgtcgccgg gagctgatac agccacaacc     27120
     tgccgcactg actgtccagg gtaaatgaac agcccacaaa attttttacc cagaacccgg     27180
     taaaaaattt tgcgttctgc ccaggacagg tgtgtcaggc cgtggcagtg atgccccttg     27240
     cggcgaaggt tctcaaacgg gtgaagttca taccacaggg aatacagcag caggttcccg     27300
     cgaaacgtca aaaccgcggc tcccgaaact caacgggtga tgttctttaa aaatcaggat     27360
     ttatttcagg ctccggcaat acgcatttat gtgttctgtc agtcatccgg ctgacaggta     27420
     atgagaacgc aggaacagaa ggaggaaaac accggaaagc gtcagatgca gatatgaaaa     27480
     aagcaggtca gggacctgct taatccacgc cgtaagaatt gtgcgaccaa ttttgacggc     27540
     attgttaacc aatttgtcat aaggaatcca tttatgactg taagcattgt ttcaccttcc     27600
     gcagcggctg taaagccccg ccgtcatccc cgtttcagac gcgaagacat ccccgctccg     27660
     gaaattgacc ccgtgctgaa agccttcggg cgacacatag cccggagttt tcaccggggg     27720
     cgtggtgtac acatccccgc catgaaaaac acggctttcg ggcaggtgct ccgcacactc     27780
     gaactgaaac gcgcttttaa ctgatgaggt gagccgcccc gcgaggggcg gcaacagacg     27840
     gaaggagaac attttatgac atcagcagca atcaccatga ccgccccgga agccgccagc     27900
     cctgtgcaga tgtaccgcgc gacctactca ccggatgaca acaaactgcg cctgtatgcc     27960
     gtgtcacgtc ttgacccgga gacgtataaa aaagtgcatg atgccggttt tcgctgggca     28020
     ccaaaacagg cgctgtttgt cgcgccggcc tggacaccgg gccgggaaga cgtgctcctc     28080
     tcacttgccg gagagattga ggatgaagac agcacgctcg ctgaacgtca ggaagcacgg     28140
     gcggagcggt ttaccggata cagcggaaag cgggccagtg aatccgcaca ggcacttgat     28200
     gaagtggaaa gactggccgc gatgatcccg cccggtcagc ccattcttgt ggggcatcac     28260
     agcgaacgcc gcgcccgtcg tgatgcgcag cgtattgaaa acggcatgaa acgtgccgtg     28320
     atgctctttg aacgtgcgga atactgggaa gaacgggggc ggtcagcact gcttcacgcg     28380
     aagtataaag aacgtccgga cgttcgctgg cgtcgtatca aaaaaatcga agctgatttg     28440
     cgcaaggctg aaaagaccat cgcgcagtcg cagaaatatc tgacgatgtg gcgggctgaa     28500
     tcgctggatc tgaatatggc aaaactcatc agcagtcatg accatatcag cgcctgtttc     28560
     ccgctggata cgtatccgcg cccggcagaa aaaagccagt atgaagggag ccggtcgtta     28620
     tggtcggccc tggatgatga catcatcacc acggagcagg cccgcgaaat tgcgatccgc     28680
     tgtcatgaac ggcagattca gcatcagcaa cgctgggtta accactatca gaaccgcctg     28740
     aactatgagc gtgccatgct ggacgaaagc ggcggcgtgg ttacccggac acaggatttt     28800
     gagccgggcg gacaggtttt cagccggggc gagtggctga ccatcatccg cgtgaacaaa     28860
     agcaacgggg cggtgagttc agtcacaacg ccgaattaca gttttctcgg gtacagcggc     28920
     acgatgaaag tgacgcccga tcgcatcacg gactacaaag caccatcggc agaagaggct     28980
     gccgtcgcca gccaggccgc gaagcgtccg ccggtagtca actatccggg ggaaggtttc     29040
     cgggaaatga caaaggcaca gtgggccgcc ctgccccggg actgtaaggc cgtgcgcagt     29100
     gtggcagaag cagaagacca cggggcatac cgctaccgcc gcacaatgga caataatttc     29160
     cgtctggtga atgtgtatat caccgacatg aaaattacgg aaatcccaca gaaataaggt     29220
     atatcccccc gggaaatccc cgggggatga cggagataat gacatgcaca gtcagttaaa     29280
     agaacgtatc cggctgatgc gcgcaaggct ggataacgcc gcgccggttg ctgaaatccg     29340
     ggctgaatct cagctttttg tgactcctgc cccggtctgt gatcgcctgg tgacgctggc     29400
     ggagatcagc aaccgtgatc acattctgga accctctgcc ggcaccgggg ccatactgcg     29460
     ggcgattcgg gataccgcac cggaggccat gtgtgatgcg gtggaaatca acagcgggct     29520
     ggtccggtat ctgcgggaaa attttaacgg tgtcagggtt cagtgtggcg acttcatgga     29580
     atggcagccg gtgcagtatt acagccgggt tatcattaat ccgccgttca gccacgggca     29640
     ggatatccgg catatcctgc gggccttttc cctgttgcgt ccgggtggcg tgctggtcgc     29700
     cgtctgtctg aacgggccgc gccagcagga gaagctgtta ccgttttctg acgtccgcga     29760
     ggagctgcca cgcggcacgt ttgcttatac cgatgttccg acgatgatta ttcgtctgcg     29820
     tgcctgatga ctccgggcag gcgggaggat aaatgcccgt ctgcccgcgc cgggaaaaga     29880
     ccgcgcgccg gtggcgctga aaggggccgc gctcacgcgc cgccccttac attacgcgga     29940
     cattctgctg tgggcttctg tcttttcaga cctgtcattt gtctgttact gatgatgttg     30000
     ttgttcatgc tactgctact gctactgcta ctgctactgc tactgctact gctactgcta     30060
     ctgttcttct tttttctgct gctctgatta ctgtctgttt tgttgttctc ctgcttatgc     30120
     cttttccggg cgtccccctg gcggggcggg ctgtcgtgaa cggagccagc ggagctgtct     30180
     ccgccctggc gggcttccat ccctgacgcg aaacccgggc ttgcagcgac cgttccggtc     30240
     gcgccgcctc tgtcgcgccg tggcctgcgc tcccggcatc ccggcaaaag gccgccggga     30300
     tgtaaggggc aacgccgttt cgcaaaccgc gcttcacgtc gttgcggcgg gtgcctgccc     30360
     gttgttgtgt ccggtgccat tcacctgttt aagcccctgt cgccgggggc aaagacagcc     30420
     acaaccgtct ccgccagtcc aggggtgaaa tgcacatccc gcaaaacttt ttgcccaaaa     30480
     gcaggcaaaa agttttgcgg tctgcccccg gacagtcgtt tccggccgtg gcagtgatgc     30540
     cccttgcggc gaaggttctc aaaaaggtga tggtgaatac cggagggaac aaaaggcagg     30600
     tccccgcaaa acgtcaaaac cgcggctccc gaaactcaaa agatgatggg ggctgaaaac     30660
     atcaacagaa ggagacacat catggcagtt cgtggcatta acaaggtcat cctcgtagga     30720
     cgcctgggaa aagatccgga agtccgttac atccccaacg ggggcgcagt ggcaaacctg     30780
     caggtggcca cgtcagaaag ctggcgtgac aaacagacgg gggagatgcg ggagcagaca     30840
     gaatggcatc gcgtggtgct gttcggcaag ctcgcggaag tggcaggtga atatctgcgc     30900
     aagggcgcgc aggtctacat cgaaggtcag cttcgcaccc gtagctggga ggataacggt     30960
     atcacccgtt acgtcaccga aattcttgtt aagaccacgg gcaccatgca gatgctggta     31020
     cgtgccgcag gtgctcagac tcagccggaa gaggggcaac agttcagcgg tcagcctcag     31080
     ccgcaaccgc cggagggtga cgattacggg ttttcagacg atatcccgtt ctgaacgact     31140
     gactgtgaca accgccccgt cctgtgcggg gcatcaccgg agagatgagg atgagcgaat     31200
     atttcagaat acttcaggga ctgcctgacg gtccttttac ccgcaaacat gccgaagccg     31260
     ttgccgcaca gtaccggaac gtctttatcg agaatgacca cggcgaacag tttcgcctgg     31320
     ttgtccgtaa taacggtgca atggtctggc gtacctggaa ttttgaggac ggtgccgggt     31380
     actggatgaa ccatgtcatc cgtgatttcg ggattattaa gtaagagagg tgccggacgg     31440
     gaacgcgtcc ggcagacaat cattattacc gttttgggag gtactaacta tgtcagttac     31500
     agagtctaag gcaaaaacgg agcgtaaatc cagccgtaaa cctgcaaaaa cgcaggaaac     31560
     agtcctgtcg gccctgctgg cgcagacgga ggaagtgagc gtgccgctgg cctcgctgat     31620
     taagtcaccg ctgaatgtgc gcacggtgcc gtattctgcg gagtccgtca gcgaactggc     31680
     ggactccatt aaaggtgtcg gcctgttaca gaatctggtt gttcatgccc tgccaggtga     31740
     ccgttacggt gtcgccgcag gtggtcgccg actggcagca ctcaacatgc tggcagagcg     31800
     tgacatcatt ccggctgact ggcctgtccg tgtgaaggtc attccgcagg agctggcgac     31860
     tgccgcatcg atgaccgaga acggtcatcg tcgggatatg caccctgccg aacagattgc     31920
     cggattccgt gcaatggcgc aggaaggcaa aacacctgca caaatcggtg atttgctggg     31980
     ttattcgccc cgccacgttc agcgaatgct gaaactggca gaccttgcgc ctgtcatcct     32040
     cgatgcgctg gcagaagacc gcatcaccac cgagcactgt caggcgctgg cgctggagaa     32100
     cgacaccgcg cgtcaggtgc aggtgtttga agccgcctgt cagtcgggat ggggcggtaa     32160
     accggaagta cagaccattc gtcgtctggt gaccgaaagt gaagtggcgg tggcagggaa     32220
     cagtaaattc cgcttcgtgg gggctgatac cttctcgcca gatgaactgc gcaccgattt     32280
     gttcagtgac gacgagggtg gctatgtgga ctgcgtggcg ctcgatgccg ccctgctgga     32340
     aaaactccag gctgtcgccg aacaccttcg ggaagccgaa ggctgggaat ggtgcgccgg     32400
     acgtatggag cctgttggtt tctgccgtga ggatgccgga acataccgca gtctgccgga     32460
     gccggaagcg gtgctgacgg aggcagaaga agaacgcctg aacgaactga tggcacgtta     32520
     cgatgcgctg gaaaaccagt gtgaggaatc cgacctgctg gaagccgaaa tgaagctgat     32580
     gcgctgcatg gcgaaggtca gggcgtggac gccggagatg cgtgccggaa gtggcgtggt     32640
     ggtgtcctgg cgttatggca acgtgtgtgt ccagcgtggt gtgcagttgc gcagtgagga     32700
     tgatgtggct gataacgatt accgcacgga acaggtgcag gagaaagcct cagtggagga     32760
     aatcagtctg ccgctgctga cgaaaatgtc ctcagagcgc acgctggcag tccaggcggc     32820
     actgatgcag caatcagaca aatccctggc acttctggca tggacactct gtctgaatgt     32880
     atttggcagt ggagcgtaca gcaatcccgc cagaatccgc ctggaatgtg agcattattc     32940
     gctgaccagc gatgcgccgt cagggaagga aggtgccgca ttcatggcga tgatggcaga     33000
     aaaagcccgt cttgccgccc tgctgccgga tggatgggca cgggatatga cgacgttcct     33060
     gtcactcagt caggaggtgc tgttatcact gctcagtttc tgcaccgcgt gcagtatcca     33120
     cggtgtccag acccgtgagt atggtcacac gtcacgcagt ccgctggaca cgctggagag     33180
     cgccatcggc tttcacatgc gcgactggtg gcagccgacg aaagcaaact ttttcggaca     33240
     cctgaaaaag ccgcagatta tcgcagccct gaatgaggca ggactatccg gtgccgcacg     33300
     ggacgcggag aagatgaaga aaggcgatgc ggctgaacat gcagagcacc atatgaaaga     33360
     caaccgctgg gtgcctggct ggatgtgtgc accacgccca cagacggatg ccactgaacg     33420
     caccgataac ctggctgatg ccgcctgatg aacaaccaca ccgccccgcc ggagacgggg     33480
     cggcagcaag ggagataccg tgatgaaaac tgaactgact ctgaatgtat tacataccat     33540
     gaacgcacag gaatatgaag atatccgggc tgccggaagt gatgcacgcc gtgagctgac     33600
     acacgccgtg atgcgggagc tggatgcgcc ggacaactgg acgatgaacg gcgagtacgg     33660
     cagcgagttt ggcggctttt tccccgtcca ggtccgtttc acgcctgccc acgaacgttt     33720
     tcacctggcg ttatgttcac cgggcgatgt ctcccaggtc tgggtgctgg ttctggtgaa     33780
     tgccggtggt gagccgtttg cggtggttca ggtacagcgg cggtttgcac cggaagccgt     33840
     cagccattca ctggcactgg cggcgtcact ggatacgcag ggatacagcg ttaacgacat     33900
     catccatatc ctgatggcgg aaggaggtca ggtatgagcg cacgttcaca ggcactggtt     33960
     cccctcagca cagagcaaca ggccgcatgg cgggcagtgg cagagacgga aaaacgccgc     34020
     aatcagggaa acacgctggc ggaatatccg tatgcggggg cgtttttccg ctgtctgaac     34080
     ggaagccgca ggatatcgct gtctgacctg cgatttttca tgccgtccct gaccgcagaa     34140
     gaactgcacg gaaaccgtct tcagtggttg tatgccatcg atgtgctgat tgaaacacag     34200
     ggcgaggtct gcctccttcc ccttcccggt gatgcagcag aacgcttgtt cccgtcggtg     34260
     cggttttgtg tcagggaacg cagtcgccat aaatccgcgc tggtcatgca gaagtacagc     34320
     cgccagcagg cgagggaggc agagcagaaa gcccgtgcgt accaggcgct ggtcgcccag     34380
     gctgaaatcg aactggcgtt ccattcaccg gaaacagtcg gaagctggta tgcacgctgg     34440
     agtgatcggg tggcagagca tgacctggaa accctgttct ggcagtgggg cgagcgtttt     34500
     ccgtcactgg ccggaatgga acgctggcag tggcaggata tgccattctg gcaggttatc     34560
     gcggaagcca gtctggcagc aaaggaggcc ggtcatgctg tccgtgagat ggagcggtgg     34620
     atggtgccga acaaactccg ggaggtgcgt gatgcggcaa caatcacacg gattgcccgt     34680
     aaacagcctg aatgagcggg ttattttcag gaaaagtgaa tgtggtcagc gtgctggtat     34740
     atgggctatg atgtgcccgg cgcttgaggc tttctgcctc atgacgtgaa ggtggtttgt     34800
     taccgtgttg tgtggcagaa ggacaaaagc cccgtagtta atttttcatt aacccacgag     34860
     gcccctgcat gcttagacaa catcaggata gcctcttacc gcgctttgcg caaggagaag     34920
     aaggccatga aactaccacg cagctctctt gtctggtgtg tgttgatagt gtgtctcaca     34980
     ctgttgatat tcacttatct gacacgaaaa tcgctgtgcg agattcgtta cagagacgga     35040
     tacagggagg tggcggcttt catggcttac gaatccggta agtagcaacc tggaggcggg     35100
     cgcaggcccg ccttttcagg gctgatgctg gtctgactgc actgaagcgc ctttataaag     35160
     gggctgctgg ttcgccggtg gcccctttct ccttgctggc attgtacggg catgaacagc     35220
     ctggcgacgc gggaaaaagc agacgttcag ggaatatatt gctcagatgt cgattgccgg     35280
     gctgcgtgaa gagcccgcac aggactggtt atctttgcat aaacggctgg ccagtgatgg     35340
     tctgtatatc acgatgcagg aaggggaact ggtggtgaag gatggctggg acagagcgcg     35400
     ggaaggtgtt gcactcagtt cgttcggacc gttatggaca gctgaaaaac tggggcggaa     35460
     actgggggaa tatcagcctg taccgacaga tattttcagt caggtgggga cacccggtcg     35520
     ttatgatccg gaagccataa acgttgatat ccggccggaa aaagtggcag aaacggagag     35580
     tctgaaacag tacgcctgcc gtcattttgc cgaacgctta ccggaaatgg cgagaaatgg     35640
     tgagctggaa agttgcctgg atgtgcacag aactctggca acggctggat tatggatggg     35700
     gatccagcac gggcatctgg tactgcatga tggatttgat aaacaacaga caccagtacg     35760
     tgcagacagt gtgtggccgt taatgacgct ggattatatg caggatctgg atggtggatg     35820
     gcagcctgta ccgaaggata tttttactca ggttataccc ggagaacggt tccggggacg     35880
     taatcttggt actcaggctg tcagtgatta cgaatggtat cgtatgcgga tggggacagg     35940
     tccacaggga gcaataaagc gcgaactgtt ttctgataag gaaagtctgt gggggtacac     36000
     aactgttcag tgtgagtcgt tgattgaaga tatgatcgcg ggcgggaatt tcagctggca     36060
     ggcgtgccat gagatgtttg cgcgtaaagg gcttatgttg cagaaacagc atcatggtct     36120
     tgtgattgtg gatgcgttta atcatgagct cacaccagtg aaggccagca gtatccaccc     36180
     ggatttgacg ttatccaggg ctgagccgca ggcagggcca tttgagattg caggtgcaga     36240
     tatatttgaa cgggtgaagc ctgaatgtcg ctacaatccg gaacttgctg ccagcgatga     36300
     agtggagccc ggcttccggc gcgatcctgt actgcgtcgt gaacgccgtg aagcccgtgc     36360
     agctgcgcgg gaagatttgc gcgcgcgtta tcttgcatgg aaggagcact ggcgtaaacc     36420
     cgacttacgt tacggagaac ggttacggga aattcatgct gcctgccgtc ggcgcaaggc     36480
     gtatatccgt gtgcagttcc gggatccaca attgcgtaag ctgcattacc atattgcgga     36540
     agtgcagcgt atgcaggcgc tgatcaggct gaaggagagt gtgaaggaag agcggttgtc     36600
     actgattgag gagggtaagt ggtatccttt gtcctaccgg cagtgggtgg agcaacaggc     36660
     ggtacaggga gacagagctg cattatcaca gttacgtggc tgggattatc gtgatcgtcg     36720
     caaagacaag cgacgaacaa cgaatgccga ccgctgcgtg attctctgtg aaccgggagg     36780
     aactccactt tatgaagaca ctggcgttct cgaagcccgt ctgcagaaag atggcagtgt     36840
     gcgttttcgt gatcggagga atggcgagtt agtctgtgtg gattatgggg accgtgtggt     36900
     gttctaccat catcaggaca gaaatgaact ggtggataag ctgaatctga ttgctcctgt     36960
     attgtttgat cgtgagccag gaatgggttt tgaaccggaa ggctcatatc aacagtttaa     37020
     tgatgtattt gcggaaatgg tggcctggca taatgcagct ggaataaccg gaaatggaca     37080
     ctttgtaatc agccgcccgg atgtggattt acatcgtcag cgtagtgaac agtactacca     37140
     cgaatatatc aggcaacaga aaagcatatc cggggggcat ggcgcatctt atgctccagt     37200
     tcaggataat gagtggacgc caccatcacc tggaatgtag ggatgaggag tggatattaa     37260
     aaatcttaac ttgtattagt taagattttc tttgctctga cagagctatg gtactgagat     37320
     ctatatgggt tgaggagcaa tatatggggg taaagaaaat cgttatactg gctattttag     37380
     tcagctttgt ggcgggatgt gcgccattac atccttcaaa ttgccataaa actacagccc     37440
     tgggtagttg cagttcagga cgttgggatg atcaggatga atggggggag caggcacggg     37500
     gaatcaggga tgcaattaat gctaaacttg atgatccgca aaaatggaaa aggaaaaaat     37560
     gcaggttgca tatggaattc tcccgggatg gcacggcgtt aaaaatatca accagtaatg     37620
     gcgataaagc ctattgcgaa gcgataaagt cagcagccca taaagctaaa ttcccggcct     37680
     tcaacaatcc ggaagtttat agagattttc aaaaatccgg ctttgacatg cgcggttagc     37740
     tacacgacat atctgtaggg ctaacagaag actgtcaggt cggctgatta ctggaacctg     37800
     aggtactttg cctcaggtta tgttgacata ctcaaaaaaa gattcttaca ttatcccggt     37860
     aacggcgtcc ttcatcggcc tgtccgttaa actcaggcta cctcacacct cacacctcac     37920
     acctcacacc tcacacctca cacctcacac ctcacacctc acacctcaca acagcgggtc     37980
     tggacagaaa gcggctcttg atgtggatta tcgcatggtg tgggctttca gcggcatggt     38040
     gactggaaag taacgatatt gcatctgtgg caacgaaaat tgcagagttg gtactctttg     38100
     aactgcataa gtaagcagaa aggtaaggtt atgctttgcg attgaaattc agccttaacg     38160
     tacaataatt ttcgatatcc aaactgcccc cctataacag caaaaggtcc cacaagacgc     38220
     tcgtggaata tattttaaaa gagaacaaaa attgcaatat gtggtggctc catacagagg     38280
     attgacaaca ttcccatgct aattgttaag attcaaattg aagtatatct atctgtcatt     38340
     tttgcaaatg acatgcggta gcataacgtt ccgggggctc ctgtgccgtc atgcgtgacg     38400
     acattgatca gccaataatg gcacgtgacc acagccagat acggccagcc ttcatccgta     38460
     cgtaaatatg tgatgtctcc cgcccacttc tggttcgggc cactggcgta aaaatcctgc     38520
     tccagcagat tttctgacac aggctggctg tgtgcgcggt aacagaccgg actgaaattc     38580
     caggaagctt ttgccctcag tccgtgacgg cgcaggcttt ccgtcacggt ttttacttta     38640
     aaatggtaac cctgggcacg cagttcatcc atcaggcgtt gtgcatgacc gggtaaaagc     38700
     aacgaggaca acgctgtcgc agtgctgacg gaactgccga cgtgtactta tccttatccg     38760
     ccagtgatat aagacggtaa ttcaccattt ggattgtccg ctccacccaa catgttgttt     38820
     ccttgaggtt ctcacaccag aaaggacatc agcatgctga gcagagagga cttttacatg     38880
     ataaagcaaa tgcgccagca aggtgcgtat attgttgata ttgcgactca gattggttgc     38940
     tctgaacgaa cggtcagacg ttacctgaaa tacccagaac ctccggccag aaaaacacgc     39000
     cacaaaatgg ccgaaatgga ctatatcgac atgcgtctgg ctgagaatgt ctggaacggc     39060
     gaagttatcc tggcggaaat caaagcgatg ggttataccg gtggccgttc catgttgctt     39120
     cgccagttca ggaagacacc ggagcagcgc tttacgcagg aacacagtct gttcttccgg     39180
     ttgctgaacc gtcgatatga aaaagcgagc attgtgctga cgtccaataa agggttcgcc     39240
     gactggggga gagatgttcg gtgataacgt gctggcaaaa tattcaccca acgcattgag     39300
     cgtaataatc tgacgctacg cacccgcatt aagcggttga ctcgtaaaac catctgcttc     39360
     tcacgctcag ttgagatcca cgaaaaagtg atcggagcgt ttatcgaaaa acacatgttc     39420
     tactaattgg atgcaccacc gaatacatta atttatataa caacatcaaa atacatttta     39480
     ggttgtcgct aatcaaaaat tattaagtgt tacataatta gagggtatag atatgattca     39540
     tcctggctct tctttagata aagcaattaa caatacaaga gttaaaaatg ttagtactga     39600
     tgttaaacat ggccaaattc aagagagaaa aaggaacttt atctataaaa aaaatgatga     39660
     tatctcatcc agatttaaac tttacagttc gctcgtaaag cagaaaaatg cgacagaaga     39720
     tgttgtttta ataggcaaaa tgattttaga tgaagttaga agttacagaa ctatacataa     39780
     tgatcgaaat atcgtaagta actcaggaaa ctggaaaaca tcttttttat gtaatcttgc     39840
     tagactacta tatagcatat ttaatggtag taactatttt tgttcccgag agggtgaaaa     39900
     taattcatcc cccagttcta ctctacttac tatacatcag cctgaaaagc aggaactatt     39960
     acaacaaaag agtatcaaac atttaccaac aagtaataac atcgacggat acattaaaat     40020
     aagaaaaaca agaggcgctg aagatcaaac aacaactatc actcaaagtt tgataattaa     40080
     tgagttgtta aatggagttg atagaaatac catccctttt cagaaaataa gtgagctcaa     40140
     tgatatcata cattcatatg aaaatatgca aattaaaaat agtcgaaaag gtatagaaat     40200
     acttgttaag cagggagagc tgttatcatc attaataaat gataataaag gaaataaaca     40260
     attatcagac aatgcatcta aaataataaa cttattgggt atagagtatc agtcacataa     40320
     agtagacata gagccattta tacatgcagt atgggttgct ggcgcacctc ctgataatac     40380
     attttcatat ataacggcat ttttaaatac atataaagat tatacctacc tgctctggat     40440
     tgatcctaat gcctttggtg cggccaagtt tagtgggatt ttaaaaaata tagcgatgaa     40500
     ttatgcaatt atgcgtttga gaagaacgaa tccacattta gcggaagaaa tgaatgaagt     40560
     gatattaaaa atacaaaaca tacaaaatga aactatagaa tttaaggaaa caagagaaag     40620
     attgaaggaa cttgaaaata gatataaatc attaacgagt gaaactaaag aaaaattcaa     40680
     tgtttttttt cttgagtcaa tgataggtat gcaagacaac tattttacat attgtatatc     40740
     aaacggaata tcaaatactg atgatatatc cagacttgac tttttaacta acgttttaaa     40800
     actttcacca gaagttcaaa atgactttaa atctacagta gagaaaaaca aaagagatat     40860
     agacttatta aaaaatacaa tatctcaaaa atttggggat agatttcaac tgagagatat     40920
     taacacattg gagtcattta aaaaaccaca agattatttt ttttatcaac aagagatgct     40980
     attaagatgg aactacgccg ctgcatcaga tcaggtaaga attaatatat tgaaagagta     41040
     tggagggatt tataccgata cagatattct tcctgcatat tcagataaag tatcacagat     41100
     aataaatgaa aaaagtgatg ataagaggtt ttttgaagat ttaaaactaa gaaggattat     41160
     atcagaatct attctgtctc tgataaaagg ggaaaagtac tcaattaaac atgatggatt     41220
     agatgaaaca acactaaatc agttaaataa catattgagt gaaatagaaa aactgacgat     41280
     agatgattat tttaaacccg ttgagacaaa agttgtcaga gatacattta aaatttttaa     41340
     aagatatcaa aaatggacag aaaacacctg gaatattaga gggaataata atttcatgtt     41400
     aactcacaag ggaagtaaat gtattgattt tattctatca ggacagaaaa aacagtattt     41460
     agaactccaa cgcatcagag ataatataag ttataataat ctattttata ctacagagga     41520
     tctaaagtct ttaaataatg tggcaatagg aggaatacct gcaaagaaat atttagaaca     41580
     cggtttgttt tctgaatata gacaggacgg tacaattcct tatgtggtta gcactttaaa     41640
     tatatctggc ccagacatga ttatgcgaca aatgaaaaaa tactataaat ctcttgggcg     41700
     cataggtgaa gtgcatatta aagataataa attgagtgat gttaattttt tgggtgtata     41760
     tgcaagttca aataaagaca ataaaagttt taactggcta aatccagtga gtgttggtat     41820
     taatgatatt acaccagatg atgaaagctc atgggctgtc agaaataatg atataaataa     41880
     aattctattc gaaaaaataa actgccatgt acccgaaaaa ctacctacct ccctatacta     41940
     tgaaatcgat tcgcggtctt tttttcaggg gtgggataat aaaagcataa agcatgttac     42000
     agagattaat aaagacctca tcaaagatat taatttatta ttaacatcgt ctaatattga     42060
     tgttaaactt ttaataaaac tggatcgtga attatatgcg attagcagta aaatagataa     42120
     tccgttggcc ttgcgctcta taagaacctt acagctacaa ttagctaatt acgtaacttc     42180
     gaatacattt gaacctgaaa acacaattaa ttttatttat gatttttata gaaaaaaaca     42240
     agatgactta ctcagcgcaa taaaattatt ttcgcgtaat gatgccgata caaaaattat     42300
     tgtctggtac aattccgtaa tggaaaaaaa tgtgtttctc cgagaggtta tatcatgtgt     42360
     tctacgaagt aaaaaagtag atagttatat aaatgaaaac aaaaaaaact tatctaagga     42420
     ggatgccgga gctttaagag attatgcaaa attaaaaatg aaagaactat tttcgatgtt     42480
     agatgatgat ggttataaaa aaatcataac tacaaatgca tatattaaag agagggataa     42540
     actatcaggc attatataca acatcgaaaa ttcgattata tcgggtcatg aatcatttga     42600
     tataatacga agcaatcaac atgagtgggg ggatttatca acggtagagc aatttaaaaa     42660
     atttgagttc tatgtgaaaa gtgaattatc ttcggctaag tcaattttcg atgatataaa     42720
     aaacaaatat ataacagatc ctgaaacaaa acgaaacgta ctctaccatc agttagatag     42780
     tgatattaaa gagcgaatag catttctcga tatatcccac tatgcatatc cgggtagttt     42840
     attagaaaaa ttacaattaa gtggctacgt tttttctgat atcaacataa ttgcagaata     42900
     cttattggct agttacggag tttctggaca ttattctcac ggcgtggtat atccagctcc     42960
     atctgataaa ttacttgagc tattaagaag acatacaaag agcaattctg agtggataga     43020
     aaaaataacc ccatatgttt atgatatatt atccgataat gtatccaacg tcttgcgccc     43080
     ccctttatca gaagaacaga aaaaaatatt gaatgatata aaattagaaa ttagtaaatc     43140
     tgtatcagaa cagtatttca tgaagttgac agagcaaaaa tcatcagtta ttggtattaa     43200
     atattctgtt gattttgaca gatacaatga gaatttgttt ttgtctttac ctataaatca     43260
     aaatttaacg ctgcctttta tgtatcgcta cttcgagatg ctatatgaca ttcacattgg     43320
     aataatagaa aacaaggcaa acagggagtt tatatatagt aagttttcat ctttaaacct     43380
     ggattttttg attaatgacg agagagtttt gaatcttgaa ggtttaataa aaaaatataa     43440
     atatttatcg ctgagtgaaa tacatagaac tttaacaaat agtacttcat ttgcagatat     43500
     ttctatacca ttattgcaga ccatatgtcc cagcataaca acaataataa aaaaaacaga     43560
     atattatggg catcagttaa caaatgctat gactgttgct tcagtggtta aaccatatga     43620
     ctttagcaat cttggtgcca taaatagtat agataaatcc gtttctgatg tgcctgcatt     43680
     gcatacaatt gttgaacaag caaaatataa tttactttca tggaatgatt tttataacac     43740
     tcatgcgtca atatgggata caatagcaag acagcataaa agtacaaata tcgaatttca     43800
     cccacaaagt cttctttttg atagagattc gaaaggaaag tgccttggtt tatctcttct     43860
     gtatcttgat acaggggggt acggaggcgg atatcaaaaa ctgaggcaca atattgacac     43920
     tgccagcaca ttatatcaaa caaaatacaa tgacaatcta aaattatcta accgtgatga     43980
     tttcttttta agaaaaacac agcgtatcat tacaatgtcc aatgagttag gtaataacag     44040
     gttaaaaaat gcacagttag aggttctgga attgaaagac cctatactaa ctgaaggcat     44100
     attataccag cgtcgtatat catctctttt aataacaaca gaatatcatt cacttgcatt     44160
     acaacaaata tcttcttttt ggagagtaac tgatcctaat tttggtcatt gtgactttca     44220
     ttccttagca caggctttaa cgtttataaa aaatataacg agcaatcgta acttttcatc     44280
     tttatatgga agtggcattg ttaaaattta cttcagtgaa tctcttaata attggaagta     44340
     tattaagctc ccccttgttc agactggttc tttgttaaga gacatatatt taacaacccc     44400
     agaaaaatta tccacaagcg ggggttcatt aaatattatg gggcatctcg tgcctgtcag     44460
     ttttatttat gatatcggag gggttattaa tggtaacaga ataagtgaaa gtacagatgt     44520
     gaaaaataaa attaggagct taaaaataaa tggggatatt ttacaacatt atataaatac     44580
     gcattatttg tcagaggagc aaactcagaa gataaaagat attgtggatt ttttaggtat     44640
     tcaggataac acaataaaag ttaagcttga aagtgatatt aaacctataa gtgaaatcca     44700
     acagcccctt cattccattc tttcacggca gaaagaacac gtaaagaatt tactatctgg     44760
     attgcttgat gagttttcaa ataagttaag aaagcaaggt ctttcactta aaacaaatgt     44820
     tctttcagtt aataacttca aagaatcaaa gataaatagt gatacagtgg aggttacagt     44880
     aacagatctg caaggaagac tttatcgtgt tgatatagat acaagagtta ttggcttaac     44940
     ttttaaagag gggataaata gtttatccga agcactcgaa cacatgaata tcgatgcgat     45000
     tatgtctgtt attggcttgg ttcaatatgc acgaatgata aaaatgaatg acaatattag     45060
     tgcaatagat catgcaggag cagtatcaga tataaaaaat attgtagaca aatttttagg     45120
     cggaattttg actcttacta ataatcgcgt atataatcct ggcggtgtat ctggtgcctc     45180
     gcttgaagga tttatatctt ctgggttgga ggtgtgtgct tcaagaatgg gtggcaccgc     45240
     agggcgttat cttagcaatg tggcaaaagt aattaaatta cctttgctag atataggcat     45300
     aaatatttgg tcattatatg attcttcatt aaatcatgct aaagccacca cacaaattga     45360
     atatatatca acagcaatag atgtatcttt ttcatctata aatacagctt tgtcaatagg     45420
     cgcaatcgca tatcctcctt tggcaatagc tatagttccg ataactattt tttctcatga     45480
     agtaaaaaac tatgctgttt atgtgaatca aattaatgag cgccataagt tatggctcga     45540
     agctgaaaag tatctggaca atggaagtgc aaaggttcta agcattaaca aagccacagg     45600
     cataatcgat ttatcaaata atcaggtgtt aggtaatatt tatttagata tgagagaaaa     45660
     tcctccaata ttacacggtg agaaatcata taatagcgga aagaatattg gtagtcatcc     45720
     tgatatgact gacagagaga ttatggagtc tagagcatac aattttgcat gcacaaaact     45780
     ctcagatgca ggtgaacccg atattttcgg ttggggagat aaggaaatat gtaattcaat     45840
     ggaattatca gaatcacaat tagctaatgg gtattctaac cgccaatggc cttctcagat     45900
     tccagttatt ccagaaggaa tttataatac agtatatctt ggatatggag aaacattgcg     45960
     agctaatact gaagttacat tgagtagcac tggttacttt tacgagattg caagggcata     46020
     tactgatgat gaactatctg agccattatt aacagtatgt aaccaacata gtcatgttat     46080
     tggtggaaaa gaaccattaa caattattat tcccgctatt gaacatggta tgcttggctc     46140
     taatctacat atgattgaac gttttaaaaa ctataatttc tcgatatcag gagggaaggg     46200
     agggataaaa ttaatggttg gtggtattgg tgattacaac atagaatgta cccccggtgt     46260
     tagaaatatt atatcgtttg aacaattatc acgtgacttc aatctggatt tggatttatc     46320
     agatgggagg aaacaaaatt ttaattttca tcatccctca ggtttttatt caggaaaagt     46380
     tatgagcata acgcaaaagg gtataaatgc ggttgttggt actaaactgg gatatgataa     46440
     gattcgtggt aataatcttg ataatacctt ttctcttggg agtggaggag gtgttatata     46500
     ttctggagga gggagcaata cctatttcgt tcccgccaca ctacaggata atttacacat     46560
     atatatatca gaaaaatcaa atggcaatca tattatatta ggtgatatgc actctcgcct     46620
     atctattgaa tgccacttta gtaataatga aagagagttt ataaagatgg gctactataa     46680
     tggatgtgat gtgattttag aaagtgacac tatacaaaaa ataaaatcat ttgcaaaaaa     46740
     tataacaata cagacagcgg atggagttat ggcaaattgg gatgataaac taaatactct     46800
     gtctgtttat tcaatagata tgattgcatg gagggataaa aataaaactg caaaagaacc     46860
     gttaccagtt gatgtaatcc agttaactaa ttggaggatg cataacacat gctctttatt     46920
     ttatgataaa tatcaagttg atattgaagc caataagtta acgtatacag tcttatttcc     46980
     tgatacggag ttacccgttc agctcaatta taccagtatt atttatggta atcatggggc     47040
     aaaatacacc ttcctcaatt caggaagtaa aactatagat attcacattc ttgataaaaa     47100
     tagtgattat gatacttttg acttccgtaa tattattttt gaacattaca ccaatgagat     47160
     atttataagt tttgataatc aaggaggatt tgttatatca atattaaata atgctacgag     47220
     tgaagcggcg aacattaatg tattccgaaa aaacatgact tctttagata gtagtggttc     47280
     attgatatat ttgcctagcg gtgatattta tcatatttca gatatctata aaatgtccag     47340
     aggtagaaaa tcgtttaaat taaatgtaga aaagaaacct gacattgatg atatcatcaa     47400
     tgtggctatt ttagaaactt cttatctaca aataaaaaaa atccccaata atgatgatag     47460
     tgattatatt ttatgtttag acaaccctaa cctctcatct tacacattga actttaatga     47520
     cttgtctgga tacatatcaa gtttatggga taatattagg ggtagtttta ccccttttca     47580
     taaaaatact gtaaacatcg cccctaatga aaaaaaatat atttccctaa tcggacttga     47640
     taagttgtca ttcaatattg atgtttttag acaagcatta gaggtaaaaa ataagaatag     47700
     ttacaagata agtaaattta catgggaaac gtatggtgat atcgttgtat cacctgaaga     47760
     tagaatttct catctggagt tagatgggtt taattatttt tcacaacccg agttagatac     47820
     tccaatatct gactcatttt catatttata tgataatttt cagatcgttg atagtgatgt     47880
     gcatattaag cttcttcatc tcaacagaga aacaaagcaa ataacaccac atcgtattat     47940
     tcttaaaaga tactttatag actcatttgc taaaacaagt atcactgaca gagaaaagaa     48000
     tatatatcct gtgatttgtg attcacctga tcacttcaca agcgacatat ataggcatcc     48060
     atttagaata gttctcggga ataagacatt gtatccatca gaagaacttg taaaattcat     48120
     aagcacctca aaagaatatt taagcaatat ggatgtgatt aacaatgtta ttgttcctca     48180
     aaaaacaaca aagaaaaaca aattatccat agttagttta aatagcaata tcaaaaatga     48240
     tattgtattg tccggagtaa tgaccggaac atcaaagatt tttcatctaa ataattcagg     48300
     tgatttattg ttaacaacct caaaaactca tggtggtggg gttgtggtta tttttaaaga     48360
     ttttataaat aactggtgga aatataatct tactttaata acagttccta ttgataataa     48420
     attgtcagac aatagaataa atataacccc aatggggata aagatacagg aaacagtcag     48480
     tggaaatgac aggttgtttt tttaccctac tccattaaaa aatggatgtt ttatcttgca     48540
     taatccactt tactctaact cattcccttc tttatattca catgaattat ttgatttgat     48600
     tgaagcatat agaaatccaa cgtattcgta tttacagaac aatattatca atagatatat     48660
     acatactgtt tctgagtatg ctggaaaaga cggtattgcc aatatgtcat tatctatata     48720
     cgcatactcg acatgtcgtt tctggtcaaa agaaagtgtg gctgtaggag atacaataaa     48780
     attgtctaat tatgagcata ttgagtttag ctttaattca tttagtaagg attactttcg     48840
     tgaacaaaat agtgatatat ataaaatatt ttttaaaatt gcttcttcga gtaattcggt     48900
     tgttgtggat aaaaatacgc tcactcaaaa aaacttccta gaaaacaata catttttcag     48960
     tattacaggt atagatgagt ctctctatga aaagcatata atctttatca ctcttaaggt     49020
     tattgtcccc tcaaaaaagt agcgctgatt tcctgtatgc ggaatttgct gactaatctt     49080
     acccagcatc agcagacgtt ccaaaggcca cgacatactt cgcgaaacgc ctgatggatg     49140
     aactgcgtgc ccagggttac cattttaaag taaaaaccgt gacggaaagc ctgcgccgtc     49200
     acggactgag ggcaaaagct tcctggaatt tcagtccggt ctgttaccgc gcacacagcc     49260
     agcctgtgtc agaaaatctg ctggagcagg atttttacgc cagtggcccg aaccagaagt     49320
     gggcgggaga catcacgtat tgtgtgcccg gagttcaggg cgagcatgga ggctcaaatg     49380
     aaccacgagt ctgtctggaa tattgaaccg gtaactctct cctttgatat tcagcgtggt     49440
     tgagtgatgt agcagccggt ccaggatcgc tgttgccagc acatgctctc cgaacatttc     49500
     tccccagtct gcgaaccctt tgtttgacgt cagtatgatg ctcgcttttt catatcgacg     49560
     gttcagtagc cggaagaact gaacgcgcag ttcacgattt tcacgttcca gctctttcag     49620
     acgctgacgt tcagcggtgg tgagtccacc atcaccactc ccggtatccc gctcatgctg     49680
     acgaacccac acacgcagag tctctggtgt acagccaatc tttggggcaa tggaacaaat     49740
     tgccgcccat tgtgagtcat attcgccctg actttccaga accatacgaa ctgcccgttg     49800
     acggacctcg ggggaaaaac gagtattttt agtcatcctg tttacctctt tctcagggag     49860
     tttagtctcc aggatttccg gggcggttca atcaccggat tgccggtatc agcagggatg     49920
     acgggctgat aactctgcag gatgcggaag gtaacacgcg gctgatttcg ccccgggagg     49980
     cggtggctga aggcgtcaca ctgtaccccc cggacaccat cagggtgggg accggtgacc     50040
     ggatgcgctt cacgaagagt gaccgggggc gtggttatgt ggccaacagc gtctggacgg     50100
     tgacagcggt ttccggtgac agtgtcacgc tgtcgggcgg acagcagacc cgggtgattc     50160
     gccccgccca ggagcgggca gagcaacata ttgacctggc ctatgccatc accgctcacg     50220
     gtgcgcaggg ggcaagtgaa acctttgcca tcgcgcttga aggtacggaa ggcagccgga     50280
     aactgatggc cggctttgag tcagcctacg tggccctgtc gcgtatgaag cagcatgtgc     50340
     aggtgtacac cgataaccgt cagggctgga cggatgccat taacaatgcc gtacagaaag     50400
     gaacagccca cgatgtgttt gaaccgaaac cggaccggga ggtcatgaat gcagagcggc     50460
     tgttcagtac ggcgcgggag ctgcgggacg tggcggcagg gcgtgccgtt cttcgtcagg     50520
     cggggcttgc cgggggagac agtcctgcac ggtttattgc tccgggacgt aaatatccac     50580
     agccgtatgt ggcactgccg gcgtttgacc gtaacggcaa gtctgccggt atctggctga     50640
     acccgctgac cacggatgac ggaaacgggc tgcggggatt cagtggtgaa ggacgggtga     50700
     aaggcagcgg ggatgcgcag ttcgtggccc tgcagggcag ccgtaacgga gagagcctgc     50760
     tggctgataa tatgcaggat ggtgtccgga ttgcccgtga taatcctgac agcggtgtgg     50820
     tggtgagaat cgccggtgaa ggtcgtccgt ggaatcccgg tgccatcacc ggtggtcgcg     50880
     tgtgggggga tatcccggac aacagcgtcc agccgggagc cggaaatggc gagccggtca     50940
     cggcagaggt actggcacag cggcaggctg aagaggccat ccgccgtgaa acggaacgcc     51000
     gcgcagatga aattgtccgt aaaatggcag agaacaaacc tgacctgccg gacggcagaa     51060
     cagagcaggc tgtcagggag attgccgggc aggagcgtga acgggctgtc acttctgaac     51120
     gggaagccgc gctgccggag agtgtactgc gtgaaccaca acgggagcgg gaggcggtcc     51180
     gtgaggttgt ccgggaaaac ctgctgcagg agcgactgca gcagatggag cgggatatgg     51240
     ttcgtgacct gcagaaagag aaaaccctgg gcggagactg atacaggaag acaaacactg     51300
     atgacaacgg ataacacgaa cacgacacgt aacgattcac tggctgcccg gaccgatacc     51360
     tggttgcagt cgttgctggt ctggtcaccc ggacagcggg atatcatcaa aacggtggca     51420
     ctggtgctga tggtactgga ccacgcaaac cgcattctgc atctggacca gacgtggatg     51480
     tttctggccg ggcgtggagc ctttccgttg tttgctctgg tgtgggggct gaatctgtcc     51540
     cgccatgcgc atatcaggca gtcggccatt aaccggctgt ggggatgggg aattattgcc     51600
     cagttcgcgt attatctggc aggctttccg tggtatgagg ggaatatcct gtttgccttt     51660
     gcagtggcgg cacaggtgct gacgtggtgt gaaacgcgca gtgggtggcg tacagcagcg     51720
     gccattctcc tgatggcact gtgggggcct ttgtccggca ccagttacgg cattgccggg     51780
     ctgctgatgc tggcagtcag ccaccggctg taccgggcgg aagacagaac ggaacgtctg     51840
     gtgctggttg catgcctgct ggccgtgatt ccggcactta accttgcctc cagtgatgcg     51900
     gcggctgtag ctggtcttgt gatgacggtg ctgaccgttg gtctggtgtc ctgtgcaggg     51960
     aaatcattac cccgtttctg gcccggagat tttttcccga cgttctatgg ctgtcatctg     52020
     gctgtgctgg gcattctggc gttgtgactg gtatgatact gacgctgatt ctgcttatta     52080
     ataaacaaca taacacagga tatttatgaa aattacggat cacaaactct ctgaaggtat     52140
     tgccctgaca tttcgtgttc ctgaaggaaa tataaaacat cctttgatta tcttatgcca     52200
     tgggttttgc ggtatcagga atgttctgct cccttgcttt gcgaatgcct tcacagaagc     52260
     aggattcgca acgattactt ttgattatcg aggattcggt gagagtgatg gagaacgagg     52320
     gcgtctggtt cctgcaatgc agaccgaaga tattatttca gttatcaatt gggcagaaaa     52380
     gcaggaatgt attgataatc agcgtattgg gttatgggga acatcgctgg gaggggggca     52440
     tgtcttcagt gcagctgcgc aggaccaacg cgtaaaatgt attgtcagcc agctggcttt     52500
     tgctgacggt gatgttctgg ttaccggaga gatgaatgaa tcggagagag cgtcttttct     52560
     atccacgctg aataaaatgg cagagaagaa gaaaaacacc gggaaagaga tgtttgtggg     52620
     ggttacacgg gtactaagtg atgatgaatc gaaggtattc ttcgagaaaa tcaaagcccg     52680
     gcatcccgaa atggatataa aaataccttt ccttacggtc atggaaacgt tgcaatataa     52740
     accggcagag agtgcagcca gcgtccagtg cccagttttg gttgttattg ccggccagga     52800
     tagcgttaat ccaccggaac agggaagagc attatatgat gctgttgctt ctggtactaa     52860
     ggaattatac gaggaagctg atgcatgcca ttatgatatt tatgagggcg cgttttttga     52920
     acgtgtagta gctgtgcaga cacaatggtt taaacaatat ctttaattgt cagtatttat     52980
     acgttaaagg tcgttgaaat taacttcctg ttacgatgag ccgtttcaac ggcctgcagg     53040
     gcatattttc acgaaggtca gagtaagcat ggcagagcaa aaacgaccgg tactgacact     53100
     gaagcggaaa acggaaggag agacgcctgt ccgcagccgg aaaaccatca tcaatgtcac     53160
     cacgccacca aaatggaagg tgaaaaagca gaagctggcc gagaaagcag cccgggaagc     53220
     ggagctggcg gcaaaaaaag cgcaggccag acaggcgctg tccatttatc tgaacctgcc     53280
     cacgcaggat gaggccgtga acaccctgaa accctggtgg ccgggattat ttgacggtga     53340
     cacgccccgg cttctggcct gcggtatccg ggacgtgtta ctggaagacg tggcgcagcg     53400
     gaatatcccg ctctcgcata aaaagctgcg cagggcgctg aaggccatca cccgttcaga     53460
     aagctatctg tgtgccatga aagccggtgc ctgccggtat gacacggaag ggtatgtgac     53520
     ggagcatatt tctcaggagg aggaagcgta tgcggcagcg cgtctggata aaatccgccg     53580
     ccagaaccgg ataaaggcag aacttcaggc cgtgcttgat gagaaataaa aaaagcctcc     53640
     ctcagagaga ggaggcaggg aaataaggct taaaaggaaa taacttccgt acccgaaagg     53700
     aagccaattc agtagattat ttaacaccat aatactgacg ggttaaagag gagtgataaa     53760
     gatgaatgga ttcagaaaca gttcacggaa cggtcaggtc tggcgttacc agcgtgccgg     53820
     aagccgggcc gttattctgg aagtcagtgg acgctggatg gaagcggcag aagcatggcg     53880
     acgggctgcc ggtgttgcac cccggactga ctggcagcag tttgcccgaa aaagggctga     53940
     acactgccac cggcgctgcc gaggaagggg gtaacgaaaa aagcagcctt cattactcca     54000
     gggattcaga aggctgaata atgcatgaga tttgcttttt ttaatatccg gtcgggcagt     54060
     atgaccggcc agttctgagt agcacagagt tttttccgta ttaagtcgtg attttatatt     54120
     ttgtgattaa tttcacaaaa taaggtgtta ttaagtgtgt gctgcaatat tcaggatgcc     54180
     tgaaatacag gtgctattta tctgatacgg agaataacat gaggaaatat attccactgg     54240
     tattatttat cttttcatgg ccggtattgt gtgcagatat tcatggacgg gttgttcgtg     54300
     tactggacgg tgataccatc gaggtcatgg actcacggaa ggtggtgcgg atcaggctgg     54360
     taaatattga tgcgccggaa aagaaacagg attatggccg gtggtcgaca gacatgatga     54420
     aatcactggt tgcaggaaaa acggttaccg tcacatattt tcagcgagat cgttatggtc     54480
     gtatgctcgg gcaggtttat gcaccagacg gaatgaatgt taatcagttt atggtccggg     54540
     ccggggccgc ctgggtatat gagcagtaca acacagatcc cgtgctgcct gtccttcaga     54600
     acgaagccag acaacaaaaa cgtgggctct ggtcagatgc tgatccggtt cccccctgga     54660
     tatggagaca ccgtaaataa agcgatggca atcttatcat tcatctgttc tcagcgggaa     54720
     taaaaatgga aaaaacaaaa caggaatggc tgtatcaatt acggcgatgt tcatcagtca     54780
     atacgctgga aaaaattatt cataaaaaca gagacagttt atcgaccagt gaacgtgaat     54840
     catttaattc agcagcagac caccggttag cagaattaat caccggaaag ttatatgaca     54900
     ggataccaaa agaaatatgg aaatatgtaa ggtaatagtt cagcataatt aattaccagg     54960
     agcagataaa caatgaagct gattattttt attctcattg ttctgattat tgcagcgtta     55020
     cttatccgga ttatcctcag aagtgtaaat cagcattctc ctttgctgat gcaattgcat     55080
     gcggcaggta tacggaccgg tgatgcagag cgaatactgt ccggcggtga atatgatgcc     55140
     agccatttac gacctgaacg cagacgccgg gatattcttc tggaagaggt tctgaggcag     55200
     gctggtattc cgttgctcag aagccacgat gccagaaaac tgctgcagat gaccggagaa     55260
     tggctgaata caacaggggc tgctcagcag tcaccggaac atcgtagctg acgccttcgc     55320
     gttgctcagt tgtccaaccc cggaaacggg aaaaagcaag ttttccccgc tcccggcgtt     55380
     tccataactg aaaaccatac tatttcacag tttaaatcac attaaacgac agtaatcccc     55440
     gttgatttgt gcgccaacac agatcttcgt cacaattctc aagtcgctga tttcaaaaaa     55500
     ctgtagtatc ctctgcgaaa cgatccctgt ttaagtattg aggaggcgag atgtcgcaga     55560
     cagaaaatgc agtgacttcc tcatctggcg caaaacgagc atacagaaag gggaatccgc     55620
     tttctgatgc agagaaacaa agattatcag tggcccgtaa aagagcttcg ttcaaggaag     55680
     taaaagtatt tcttgaacca aagtataagg ccatgctcat gcaaatgtgt catgaagatg     55740
     gcctgactca ggctgaagtt ctgaccgcac tgataaaaag tgaagcgcaa aaacgatgtg     55800
     tgtgatgatg ggcttacatt cttgagtgtt cagaagatta gtgctagatt actgatcgtt     55860
     taaggaattt tgtggctggc cacgccgtaa ggtggcaggg aactggttct gatgtggatt     55920
     tacaggagcc agaaaagcaa aaaccccgat aatcttcaga aagtttggcg actgagaaga     55980
     ttaccggggc ccacttaaac cgtatagcca acaattcagc tatgcgggga gtatagttat     56040
     atgctcggaa aagttcaaga cttctttctg tgctcgctcc ttctgcgcat tgtaagtgca     56100
     ggatggtgtg actgatcttc aacaaacgta ttaccgccag gtaaagaacc cgaatccggt     56160
     gttcacaccc cgtgaaggtg ccggaacgct gaagttctgc gaaaaactga tggaaaaggc     56220
     ggtgggcttc acctcccgtt ttgatttcgc cattcatgtg gcacatgccc gttcgaaggg     56280
     actgcgtcgg cgcatgccac cggtactgcg tcgccgggct attgatgcgc tgctgcaggg     56340
     gctgtgtttt cactatgacc cgctggccaa ccgtgtccag tgctccatca ccacactggc     56400
     cattgagtgc ggactggcga cggagtctgc tgccggaaaa ctctccatca cccgtgccac     56460
     ccgggccctg acgttcctgt cagagctggg actgattacc taccagacgg aatatgaccc     56520
     gcttatcggg tgctacattc cgaccgacat cacgttcaca ccggctctgt ttgctgccct     56580
     tgatgtgtct gaggatgcag tggcagctgc gcgccgcagc cgtgttgaat gggaaaacag     56640
     gctgcgcaaa aagcaggggc tggataccct gggtatggat gaactgatag cgaaagcctg     56700
     gcgttttgtg cgtgagcgtt tccgcagtta ccagacagag cttaagtcac ggggaataaa     56760
     gcgtgcccgt gcgcgtcgtg atgcgggcag ggaacgtcag gatatcgtca ccctggtgaa     56820
     acggcagctg acgcgtgaaa tctcggaagg gcgcttcact gctaatcgtg aggcggtaaa     56880
     acgcgaagtg gagcgtcgtg tgaaggagcg catgattctg tcacgtaacc gcaattacag     56940
     ccggctggcc acagcttccc cctgaaagtg acctcctcag aataatccgg cacgcgccgg     57000
     aggcattcgc acgcctgaag cccgccggtg cacaaaaaat cagcaccaca tcccaaaaac     57060
     aacctcatca tctaccttct ggtgcatccg gtcccccctg ttttgataca aaacacgtct     57120
     cacagacggg caattttgtt tatccacatt aaactgcaag ggatttctct gtaagattac     57180
     aaccgttcat gtcataaagc accagccgcc aggcttacag ggtgcaatgt atcttttaaa     57240
     cacccgttta tatctccttt aaactactta attacattca tttaaaaaaa agacttattc     57300
     actgcctgtc ctgtggacag acagatatgc acctcccacc gcaagcggcg ggccccaacc     57360
     ggagccactt tagttacaac acacaaaaac aacctccaga aaaaccccgg tcccgcgcag     57420
     aactgaaacc acaaagcccc tccctcataa ctgaaaaacg gccccgcccc ggcccaaagg     57480
     gccggaacag agtcgctttt aattatgaat gttgtaacta agcatcatca tcgctgtcag     57540
     tcttctggct gaacgttctc agtacacgct cgtaagcggc cctgagggct cgctaacgcg     57600
     gagatacgcc ccgacttcgg gtaaaccctc gtcgggacca ctccgaccgc gcacataaac     57660
     tctctcatgg ctgaaagcgg gtatggtctg gcagggctgg ggggggggta aggtgaaatc     57720
     catcaatcag taccggctta cgccgggctt cggcggtttt acacctgtgc tacatgtaac     57780
     ctccgtatac cgccttacat gcgctgacgc gcattatttg ccttgttccg tctgaaagta     57840
     atcactatga ttaaatatga ttaacgacta atcggatatg caaatgaaaa acaataccgc     57900
     acaagcaaca aaagtcatta ccgcgcatgt gccattacct atggctgata aagtcgacca     57960
     gatggccgcc agactggaac gctcccgggg ttgggttatc aaacaggcgc tttctgcatg     58020
     gcttgcccag gaggaggagc gtaatcgcct gacgctggaa gccctggacg atgtgacatc     58080
     cggacaggtt attgaccatc aggctgtaca ggcctgggcg gacagcctca gtactgacaa     58140
     tccgttaccg gtgccacgct gatggaactg aagtggagca gtaaagcgct ttctgatttg     58200
     gcgcggttat atgattttct ggtgctagcc agtaaacctg ctgccgccag aacggtacag     58260
     tccctgacac aggcaccggt cattctgtta actcatccac gtatggggga acagttattt     58320
     cagtttgaac ccagggaggt cagacggatt tttgctggcg agtacgaaat ccgttacgaa     58380
     cttaatggcc agactattta tgtattgcgc ctgtggcaca cacgagaaaa caggtagatt     58440
     gtgtgtgggg acaacttaac atagcctgca gatattaatt ctggaacatt attatcaggc     58500
     cagatattta aataatcttg taggagataa aatgaattac gatgaaataa cgaaaattac     58560
     cgctgaacgt attagcgact acatgactga agcagttaat acagactcta tagccgttgc     58620
     ggaaatgttt cataacgcag catggggagt gcgaacattg tggtttgaac tcgtcacaaa     58680
     aatagatata gatatacata aaaagaacag atatgcgagt tatgatcttg atcgatagga     58740
     atttaaatcc caaaaagatt aaaaaaacac ccaaaaacgg atgtttattc aacactgcct     58800
     gcgtgccatg agtgcaccgc cgtcaattaa atggatctat ttcatcctga ccagcatagt     58860
     gctccagacg gctcatcggc accggcggtt ttttcaggta agagccgaag tacaccgcca     58920
     catgtgtggc gttatccatc acccgggata cgttgacatt ccagccccgc cggtaatgac     58980
     tgtccaggaa gcgattccag tcccgtttac tgcttccttc tgctgccagc gcatccggta     59040
     tcaccaggtc cggtgaggtg tactggcaat agcggacact accatttgtt ctttttttaa     59100
     gcagccatct gatgatattt ttccctgaag gctgccgggg agatattccc cagacgagag     59160
     tgacgacgct gacgattgta gaaaatctca atgtattccc gtattactga gatggcttca     59220
     tcccggttat taaaacgata gtggctcagg ctctcatttt tcagcgttcc ccagaagctt     59280
     tccatcggag cgttgtcgta acagttacct ttacgcgaca ttgatgtttt cagaccaaac     59340
     tgctcctgta tgacccggta atcgtatgcg cagtactgtg aacctcgatc agagtggtgg     59400
     attagcccgg caggtgggcg ctggctcctg agcgccataa acagggcttt acctgtcagc     59460
     tcttttgtca tgcgctctcc catggcgtag ccgacaattt cgcacgtata aacatctttg     59520
     atgccagcga ggtacaacca tccctcctgt gtggcaacat acgtcaggtc cgccacccag     59580
     acctgatttg gtgctgcagg agcgaacgtc tggttcagca gatttggcgc aactggcaga     59640
     ttgtggttcg agttcgtagt cgcacatctg cctggcggca gatttcctgt atcacatccg     59700
     cagcaatgcg gctcatctct gccagtaacc accggttgtg gaacaccagg gaccagtact     59760
     ggcagggaag tgtgaacaca atatgctgcc acggacagtc gggaaccaga ctcagcagat     59820
     actgtatcca ctgtgcgcca gccttcactc cgcagtgcgg gcaggagcga cttttacacc     59880
     ggaagcagac cttttttatg tggctgcagt ccggagatga acagcaccac tgtgtgtacc     59940
     ccatcagcgt ggtcccgcag gccatgattt ttgtcacaga ctcaatgact accggacgca     60000
     ctgaaccttc cggttgtttc tccagccagt taagccagcg gtttccctgc tgaaaaatgt     60060
     cggcaaaacg gggaagcatc agaagggcgg gggaactccg tccggccagt gaaccgtgcc     60120
     acactccggg cagtacatgc cgccggcgct gataccggca agaatggtcg caaactcccg     60180
     ctccgtgcag cgggctattt caggataccc ttcgtcatca acacgtacaa accagaagac     60240
     cagctttttg tttctgacat ccacaaagaa gggaatattc aggtctgcgc agcactcaac     60300
     ggcatcgtca gttgcggctt ggaacccctt agtatttttt gtctgtagta tctatcccag     60360
     caataggtat atcctgttgc atcaataaag ttgacttttg tatacaacat gcgaatttcc     60420
     cttaatccgg agctattcgt atgataaaaa aaactcttcc tgttctgatt cttctggcgc     60480
     tatcggggag cttttctacc gctgtagccg ctgataaaaa agagactcaa aatttctact     60540
     atccagaaac actggattta actcctctga gattacacag ccctgaatca aatccctggg     60600
     gggctgattt tgattatgcc accagatttc aacagctgga tatggaggct ctgaaaaaag     60660
     atatcaaaga tttgctgaca acttcccagg attggtggcc tgcggattat ggtcattatg     60720
     gtcctttctt tattcgtatg gcttggcacg gtgccggaac atacaggaca tatgatggcc     60780
     ggggaggcgc cagtggtggt cagcaacgtt ttgaaccgct gaacagctgg ccggataacg     60840
     ttaatctgga taaagcccgt cgattgctgt ggccagtcaa gaaaaaatac ggctccagta     60900
     tttcctgggg agacctgatg gtcctgactg gtaatgttgc ccttgaatcc atgggattta     60960
     aaacgctggg atttgctggc ggaagagaag atgactggga gtcggacctg gtatactggg     61020
     ggcctgacaa caagcctctt gcagataacc gggataaaaa cgggaaactt cagaaacctc     61080
     ttgccgccac gcagatggga cttatttatg tcaatcctga aggccccggt ggaaaaccag     61140
     atcctctggc ttccgcgaaa gatatcaggg aagctttttc acgtatggcc atggatgatg     61200
     aggagactgt ggccctgatc gcgggagggc atacatttgg taaagcacat ggtgcagcgt     61260
     ctcctgaaaa atgtattggc gcagggcctg atggtgcacc tgtggaggag cagggactgg     61320
     gatggaaaaa taaatgtggt acaggaaacg gcaaatatac catcaccagt ggcctggaag     61380
     gagcctggtc gacatcgcca acccagttca caatgcagta tctgaagaat ttatataaat     61440
     atgaatggga gctgcacaag agtcctgccg gtgcttatca gtggaagcct aaaaaagcgg     61500
     caaatatagt tcaggacgcg catgatccgt ctgtcctgca tccgttgatg atgtttacga     61560
     cggatattgc tcttaaagtt gatcctgaat ataagaaaat aaccacccgt ttcctgaatg     61620
     atccaaaagc ttttgagcag gcattcgcaa gagcatggtt taaactgacc caccgggata     61680
     tgggaccggc agcccgatat cttggtaatg aagttcctgc agaatcattt atctggcagg     61740
     atcctcttcc tgcggcggat tatacaatga ttgatggtaa agacattaag tcgctgaaag     61800
     agcaggttat ggatttgggt atccctgcat ctgagctgat aaagacagcc tgggcttcag     61860
     cttccacatt tcgtgtgact gattatcgtg ggggaaataa tggtgcccgc atcaggttac     61920
     agcccgaaat taactgggaa gttaatgagc ctgaaaaact gaagaaagta ctggcatccc     61980
     tgacctcatt acagcgtgaa tttaacaaaa aacagtctga cggaaagaaa gtgtcgttgg     62040
     ctgatttaat tgttctttcg ggtaatgctg caatcgaaga tgcggccaga aaagccgggg     62100
     tggaacttga gattcccttt actccgggaa gaactgacgc ctctcaggag cagacggatg     62160
     ttgcctcatt cagtgtactg gagccgacag cagatggatt cagaaattat tactcaaaaa     62220
     gcagaagtca tatatcgccg gttgaaagcc tcattgataa agccagtcag ctggatctca     62280
     ccgttcctga aatgacggca ttactgggtg gtctgcgggt aatggatatt aatacaaata     62340
     attcttcgtt gggagtgttt accgataccc ctggtgttct ggataacaag ttttttgtta     62400
     atctgctgga tatgtcaaca cgatggagta aagcagataa agaagataca tacaatggat     62460
     tcgatcgtaa aacgggagca ttaaaatgga aagcatcctc tgttgattta atcttcagtt     62520
     caaatcctga attacgtgcg gtggcagaag tatatgcctc ggatgatgcg agaaataagt     62580
     ttattcatga ttttgttaaa tcgtggaata aagttatgaa tagcgatcgg tttgatttaa     62640
     acaataaatg ataaaactga tgagggaggg cacctccctc atgaaggaga aattatgcag     62700
     aaaagcaata aagttataat cagctgtggt atggcattat attttttgtg tggggggatt     62760
     acagtggcag aagaacttga tgaaagcatg caagttcttg caaggaatat gagtgtactt     62820
     cagtcatcaa tggataaaaa ggagcttctt gaagctcttg acagaatgga tgatgctgta     62880
     gatgagtcaa tgaagcgtct tcctgagagc atttcaccgg ctgatgaaga agggaagaat     62940
     gactatataa aagaacttca aaagcttgaa aaagagatta tgctggcgaa acaaaaagtc     63000
     ttatcgggac agttatcaga tatacccgat tcggtaaaca agatgaataa aatcagagtt     63060
     gaggggcatg ataaattcag ataaatcagt tggttgattc ctgcgggacg aatacatacg     63120
     tcaggaacat aactttatgg ctggaacgtg aaaatcgtga actgcgccgc agtaacgata     63180
     tccttcgcca ggcttccgct tattttgcga aggcggagtt cgaccgcctc tggaaaaaat     63240
     aatgccactg ctggataagc tgcgtgagca gtacggggtc ggaccggtat gcagtgagct     63300
     gcatattgcc ccgtcaacgt attaccactg tcagcaacag cgacatcatc ctgataaacg     63360
     cagtgcccgt gctcagcgcg atgactggct gaagagagag atacagcgcg tatacgatga     63420
     aaatcatcag gtgtacggtg tgcgtaaagt ctggcgccag ttgttacgcg aaggtatcag     63480
     ggtggccaga tgtacagtgg cgcgcctcat ggcggttatg ggacttgccg gtgttctccg     63540
     gggtaaaaag atccgtacta ccgtcagccg gaaagccgtt tccgcaggcg accgcgtaaa     63600
     ccgtcagttc gtggcagaac gtcctgacca gctgtgggtg gctgatttta cttacgtcag     63660
     cacatggcag ggcttcgtct atgtggcgtt catcattgat gtgtttgccg gatgtatcgt     63720
     ggggtggcgg gtctcatcgt ctatggaaac gacattcgtg ctggatgcac tggagcaggc     63780
     gttgtgggcc cgtcggccgt ccggcacagt ccatcacagt gataaaggtt ctcagtatgt     63840
     atcactggcc tatacggagc gactaaaaga agcaaaactg ctggcatcaa cagggagtac     63900
     aggtgactcg tatgacaacg cgatggcgga gagcatcaat ggtctttaca aagcggaggt     63960
     aatacaccgt aagagctgga aaaaccgtgc agaagtggaa ctggccacac tcacgtgggt     64020
     ggactggtat aacaatcgac gattgctggg aaggctgggt catatccctc cggcagaagc     64080
     agaaaaagct tattatgctt ccatcagaaa cgatgatctg gcagcctgag ttcacagata     64140
     aaacactctc caggaaaacc ggggcggttc agtgtttgtt atccgtatga taacaaacac     64200
     ataaaggagt aaacatttat ctggacgatg attacaatgt tcacgactgt cagagacaca     64260
     cctctgatac attagaaaaa ccaatgtttc ccttaaaaat ggagcttata tgaataaaat     64320
     atactctctt aaatacagcc atattacagg agggttaatc gctgtttctg aattatccgg     64380
     cagagtatca tcaagagcaa ctggtaagaa aaaacacaaa cgcatacttg cattatgttt     64440
     tttaggctta ttacaatcct catattcttt tgcgtcacag atggatattt caaatttcta     64500
     catccgtgac tatatggatt ttgcacagaa caagggcata tttcaggctg gcgcaacaaa     64560
     tattgaaata gtgaagaaag atggctccac cctgaaacta ccggaagtac catttcctga     64620
     cttctcaccg gttgcaaaca aagggtcaac cacatctatt ggtggtgcat acagtatcac     64680
     agccacacac aatacgaaaa accaccactc agttgcgacg caaaactggg ggaacagcac     64740
     gtacaaacaa actgactgga atacttcaca tcctgatttt gcagtatccc gacttgacaa     64800
     gtttgttgtt gagacccgag gtgcgactga aggcgcagat atttcgttat caaaacagca     64860
     ggcacttgaa cgttacgggg ttaattataa aggagaaaag aaacttatcg cattcagagc     64920
     cggctctggt gtggtatccg ttaaaaaaaa tggacgcata actccattta atgaggtttc     64980
     ttataagcca gaaatgttaa atggctcttt cgttcacatt gatgactgga gtggatggct     65040
     gatattaacc aacaaccagt ttgatgagtt taataacatt gcctctcagg gtgacagcgg     65100
     ttcagcactg ttcgtctatg ataaccaaaa gaaaaagtgg gttgtcgctg gaactgtctg     65160
     ggggatttat aattacgcca atggcaaaaa ccacgcagca tacagtaaat ggaaccagac     65220
     aaccattgac aacctgaaga acaagtattc ttacaacgtg gatatgtcag gggctcaggt     65280
     tgcaaccatt gaaaatggaa aactgacagg cactggctca gacaccaccg atataaaaaa     65340
     taaggactta atatttactg gcggtggaga tatcctcctg aaatcctctt ttgataatgg     65400
     tgctggcggt cttgtcttta atgataaaaa gacctatcga gtaaacgggg atgatttcac     65460
     ctttaaaggt gccggtgttg atacaagaaa cggcagcacc gttgagtgga atatccggta     65520
     tgataataaa gacaaccttc acaaaattgg tgatggcaca ttagatgtcc gaaaaaccca     65580
     gaacaccaac ctgaaaacag gtgagggtct tgtcattctt ggagctgaaa aaacattcaa     65640
     taatatctac ataaccagtg gtgatggaac tgtccgactg aatgcagaaa atgcactgtc     65700
     tggcggtgaa tacaacggta ttttctttgc gaaaaatggc ggaactcttg acctgaacgg     65760
     atataatcag tctttcaata aaattgctgc aactgattca ggtgctgtaa taaccaatac     65820
     gtcaaccaaa aaatccattt tatccctgaa taatactgct gactatatct atcacggcaa     65880
     cataaacggg aatctggacg tacttcagca tcatgagacg aaaaaagaga accgtcgtct     65940
     tattcttgat gggggcgtgg acacaacaaa tgatataagc ctgcgtaata cacaactgtc     66000
     catgcaggga catgccactg aacatgccat ttatcgggat ggagctttct cttgttcact     66060
     accagctcct atgcgctttt tgtgtggcag tgattatgtt gcaggaatgc aaaatacaga     66120
     agctgatgct gtaaaacaaa acggaaatgc ctataaaacc aacaatgctg tctctgattt     66180
     atcgcagcca gactgggaaa ccggaacatt cagatttgga acgctacatc ttgaaaattc     66240
     cgatttttct gttggtcgta atgcaaatgt aatcggggac attcaggcca gtaaatcaaa     66300
     cattactatt ggtgacacta cagcatatat tgatttgcat gctggtaaaa atattaccgg     66360
     tgatggtttt ggcttccgcc agaatattgt gcgtggaaac tcacaaggag aaacgctgtt     66420
     tacaggaggg atcacagcag aagacagcac tatcgttatt aaagataaag caaaagcatt     66480
     attttcaaat tatgtatacc tgctgaacac aaaagcaacc atagagaacg gtgctgatgt     66540
     gacaactcaa agtggtatgt tctccacgag cgatatcagc atctctggta atctgtccat     66600
     gacaggcaat cccgacaaag acaataaatt cgagccctca atatatctga atgatgcttc     66660
     ttatctactg actgacgact ccgccagact cgttgccaaa aataaagcat ctgtggtggg     66720
     agatatacac tccactaaaa gtgcatccat catgtttggt catgatgaaa gcgacctctc     66780
     gcagttgtct gacagaacct caaaagggct tgcacttggt cttttaggtg gctttgatgt     66840
     ctcatatcgc ggttcagtca atgccccgtc agcatctgcc actatgaaca acacctggtg     66900
     gcaactaacc ggagattctg cgctgaaaac actgaaaagt acaaacagca tggtctattt     66960
     cactgacagc gcaaacaata agaaattcca tacgctgacg gtcgatgagc tggcaaccag     67020
     caacagcgcc tatgcgatgc gtacaaacct ttctgaatca gacaaactgg aggtcaaaaa     67080
     acacttgtct ggtgagaaca atattttact cgttgatttc cttcagaaac caacgcctga     67140
     aaaacaactg aatattgaac tggtaagcgc gccaaaagac accaatgaaa atgtctttaa     67200
     agccagtaaa caaaccattg gtttcagtga tgtaacgccg gtcattacaa ccagggaaac     67260
     cgatgacaaa ataacatggt cactgacagg ctataacacg gtagcaaaca aggaagcaac     67320
     ccggaatgcc gccgccctgt tctctgttga ctataaagcg tttctgaacg aggtcaacaa     67380
     cctgaacaaa cgtatgggtg acctgcgtga tatcaacggc gaagccggtg catgggcacg     67440
     catcatgagc ggtaccggct ctgccagtgg tggtttcagt gacaactaca cgcacgttca     67500
     ggtcggggtc gacaaaaaac acgagctgga cggactggat ttgtttaccg gtttcactgt     67560
     cacacacact gacagcagtg cctccgccga tgttttcagt ggtaaaacga agtctgtggg     67620
     ggctggcctg tatgcttccg ccatgtttga ttccggtgcc tatatcgacc tgattggcaa     67680
     gtatgttcac catgataatg agtacactgc aacctttgcc ggactcggaa cccgtgatta     67740
     cagcacgcat tcatggtatg ccggtgcaga agcgggctac cgctatcatg tcactgagga     67800
     tgcctggatt gagccacagg ctgagctggt ttacggttct gtatccggta aacagtttgc     67860
     atggaaggac cagggaatgc atctgtccat gaaggacaag gactacaatc cgctgattgg     67920
     ccgaacgggt gtggatgtgg gtaaatcctt ctctggtaag gactggaaag tgacagcccg     67980
     tgccggtctg ggctaccagt tcgacctgct ggctaacggc gaaaccgtat tgcgggatgc     68040
     atctggtgaa aaacgcatca aaggtgaaaa ggacagccgt atgctgatgt ccgttggcct     68100
     gaatgcagaa atcagggata acgtccgctt tggactggag tttgagaaat ccgcctttgg     68160
     taagtacaac gttgataatg ctgtcaacgc taatttccgt tactcgttct gatactccgt     68220
     attcaaaagg gcctgcgggc cctttacgct cagtgcctgc cgccctgata tgtctgagag     68280
     acatttccgg gatgtcagtc gactggttta cttaactgcg atgactaaag ctggcagtaa     68340
     tgccggcttt tttacggcca catacgtctt cctctcatcc ggaactgtga tacaaatcct     68400
     gcatacagga ttgaccgccg gttcctgcaa atggcacatt ttcagtaaga tagcgaaggt     68460
     tacatttgtc actggttaac ataccgatgg taaaaggggc aagcagcgcc agcaattcat     68520
     cagcccgggg gccaaaagtg taggccagaa cgccaccagt tttcgtgttg tacgcgtacc     68580
     agagcctgtg ctgtcacgct ttactgccga taaaactcca ttgctcatca agttcgcaga     68640
     tgagtgccat atcagcatga gcgaccgggg atgacgttat tcttcgtggc gagcgttttt     68700
     taaagtccga atgacagtat taatgccgat tttcagcgta cgggcagtat cgcgaactcc     68760
     ggcaccgttg aaaggcattt cagtgatttg gtcttgaact cccggtttac gggcctcgta     68820
     acggtaagtg agctgaaaca ctcgatgaca gtcacggcag cgaaatcgat catgtccttt     68880
     tgggttcttc ccgtgacggt aaacctgaac ggactggcaa cgggggcaat gaaggttaac     68940
     tgtgaccatt aaagaacctt aaaagtgact attatacccc taattcaact aattggaggc     69000
     attaccatgc attagtgcaa gcgccttgtg gattcttttg ctaatggcgg aaacatattg     69060
     tacaatattg catttatccc tcaataaata aatgagttat cagattgcaa aaatctgtta     69120
     tcaaactaat tcaaataaaa agagattgat acgaccaacg tacacaaaaa ttttcgatat     69180
     tcgaactaaa taacagctcc taataccgct acactttagc tatccagtct gcgcctcaga     69240
     aatggacgat gccgttgaag gactggtgta tggcaatgag ccgctttatt atcgaattcg     69300
     gtgaccgctt ggacggtcac ttcggagaaa aggcatttac acagcatcct aaacaggttc     69360
     agcataggtg atataccgcc ttttcatttt cttctccatt atttataagg gaggtgtatt     69420
     attatgcaat attattggtt ttatccattg tttttagttc atgaatgttt gcaaaaaaaa     69480
     taaatgaaca ataattttat gtatttaaaa taaattgatt ttacttctgt aatggtgtca     69540
     tgattagcag ctttttaaac taatatcgac tttcaataaa taaggacagg taatggacaa     69600
     caaaaatatc tgaacccggg tgagattcat aagttgcaca gtgctgtctt caaagtgcca     69660
     cacccggaac gtaatcactg cctgctcctt atggggtatc ttcatggtgt ccaagcatca     69720
     gagttattag gtataaaact gtctgatatt gatttgcagg ccggtaacct gaatatccgg     69780
     cggctctaaa cggtttgtca actcagcccc tcggctgaaa caggaggtac agtccattcg     69840
     tcgctggctg aaacttcggg atgaatgggt agaagaggga tatgaatggt tatttaacct     69900
     ctatggcagg tctgctacag gtattactgt tgttctgggg ggcactggtg tggttaatat     69960
     ctacgatgca agagattctc acgatggccc ggtccatcag tgcatgcggc gcgatattgt     70020
     gcgagtattt ttcaggggga gtggtatccg gatgcagaaa attccgctac tcgactggtt     70080
     ttatgcaata aatcaggatg ataatcttct gattttttac tgaggcggat atctctcgct     70140
     gtgtttactg aaattgcggt attctgtttt ttctgaaaaa cagaaaatct gattaaaaag     70200
     agcatatgcg ttaagggaaa tttaagttct ggttgattaa ctgataaaaa tattaaaaaa     70260
     tccctgttgt cggtaatctc cggaccattc cgggattaca caataatatc accatgtgtg     70320
     atatctatgg atcctcactg ttgtttacgc gaggatattt tcagaatgct taacagacga     70380
     ttattttttt atgttgaatg caaggcatct tcccgtactg atgtatcatc atgtcagtcg     70440
     ttgtccgggg cttgtgacac tctcacctga aacattttgt gaacagatga agtggctcgc     70500
     agataataac tggcggacgg taacatctgc tgagcttgaa tatttttatc aggggggaac     70560
     gcttccacga aagagtgtca tgctcacatt cgatgatggt tatcttgata actggctcag     70620
     agcatggccg gtcctgaagg aatataacct tcatgcacat atttttctca ttacggggct     70680
     gattggtaag ggaaacgtac gtagcaggca ggagcaggaa tattctcacc gcgactgtga     70740
     acggttgatt gccgataacc gttcagatga ggtcatgctt cgctggtctg aagtccggga     70800
     aatgcgtgat tccggactgg ttgaatttca tgtgcacacc cattcacata aacgctggga     70860
     caggttgtct gtatcacgtg ctgaacagtg ccggctcatg aaagaagata ttctggtggg     70920
     aaaacaatgt ctgacggaaa agctggggtt ctgtagttcc catctgtgct ggcctgaagg     70980
     atattataat cgggattata ttaatctcgc cggtaagctt ggtttctctt atttatatac     71040
     aaccgaaaga agaatgaact gtcctgaaaa tggttcatta cgcatagggc gtatcagcac     71100
     caaagagcgg gaacattccg gctggctgaa acgacgcctt ttttattata caacgccact     71160
     tttttcttca gtactggctc ttcataaggg gccaagatta ccagataatt aatgatgaaa     71220
     attttattca ctgaatcttc gtcagatatt gggggccagg agctgcaggc actggcccag     71280
     atgactgctc ttcaaaagca gggacattcc gttttacttg cctgcagaga aaaaagtaaa     71340
     attgctccgg aagccagaaa aagagggcat gatgtcactt ttattccttt caggaacagc     71400
     cttcaccttc cttccatcct cagacttcga cggattatcg gggaatttaa acctgatctg     71460
     gtcatctgcc atagtggcca tgacagtaat atagcaggac tgagccgtct gatatgctgt     71520
     caccgcttca gtattgtcag acaaaaaacc tacatcaccc gtaagaccag aacgttttcc     71580
     ctgaattatc tgtgtgattt cattgttgtg cctagctcag ccatgatggc gcatctgatg     71640
     gcggaaggtg tcaggacacc ggtaacggtt attccaccgg gtttcgactg gcccgcattg     71700
     cataatgaag ccatgcgacc gttacccctg catatccacg cctgggctgc atcagcagac     71760
     aatgttccgc ttatcgttca ggtggggatg ctacgtcccg aaaaaggaca tgaatttatg     71820
     ctgcgtgtat tgtatcagct gaagatggaa gggaaatcat ttcgctggct cgtggtgggc     71880
     gccgggcgtg aagaatacga agcacgtctg cgtcagcaga cagaacacct gggaatgagc     71940
     ggagatgtgt taatggcagg tgcccttttc ccagcgttac cggtctaccg gattgccagt     72000
     gtggtggtca tgccttcgga aaatgaagcg tttggtatgg tactggctga agcgtcagtc     72060
     tccggcgtgc ccgttatcgc cagtgagacg ggcgggatcc ctgatgtcat tcagaagaat     72120
     gtgacaggga cgctgttacc cgtgggggat gtgtctgcat ggaccggcgc actgcgcgat     72180
     tttttatccc gaccggaacg cttccggatg atggcagcca gcgccagaga agatattgag     72240
     taccggtttg atattaacag aacggcacag atcattgtgt ctctggctag tcaggctaag     72300
     gggaaatgca acagataacg gcggatcctc ttttcagccc gaattttgtt cagcggtttt     72360
     ccggtaacgg agtaatttat cacattgttt aaatacgggg acggtcaatg catttaaata     72420
     ccggacagaa caggcctact ttcagctgga gcgcgctggg atgggcaatt ttttattttg     72480
     gctttttttc cactctcctg caggtcatca tcttcagcag tgggtacagc ggaacgaatg     72540
     gaatacggga ctcactgtta ttcagttgtc tgtggttgat cccggtgttt ctctatcctg     72600
     atcggataaa aataattgca gctgttgtcg gtttcattct ctggggcacg tcgctggcag     72660
     cactttgtta ttattttctc tatggtcatg aattctctca aagtgttctt ttcgttatgt     72720
     ttgaaacgaa tgccagagag gctggtgaat atttcagcca gtatttcagc cttaaactgt     72780
     tgcttatctc gctggtatat actgcggtgt ccgtttttct gtggacacgt ctgcgtcctg     72840
     tatatattcc tttgccatgg cggagaattg tctctttcct gctgctttat gctctgcttc     72900
     tgcatccggt tgttctgaaa tcgttaatca gacaggagcc gctgaatgat actctaggca     72960
     aactggcatc ccgaatggag cctgctgccc cctggcagtt tgtatccagt tattatcagt     73020
     accatcagca actgaatgca ctgacaacct tcctgaatga aaatagcgca ctgccaccac     73080
     tgggtaatct cagggatgaa tcaggggaga gaccacgcac actggtcctg gtgattggtg     73140
     agtcgacaca gcgcgaacgc atgagcttat acgggtatct acgtgaaacg acgccggagc     73200
     tggatgcact gcgtaaaacc gatccgggtc ttactgtgtt taataatgtg gtggcatcgc     73260
     gtccgtacac cattgaagca ttgcaacagg cccttacttt cgccaacgaa aagaatcctg     73320
     atctgtatct gacgcagccg tcgctgatga acatgatgaa gcaggcaggc tataaaacat     73380
     tctggattac caaccagcag acaatcacag cccgtaacac catgctcact gtattttcgc     73440
     gccagacgga caggcagtac tacatgaatc agcagcgaac acaaagtgcg cgtgaatatg     73500
     acactaacgt gctgaagccg ttccgggaag tgctgaatga ccctgcacca aagaaactga     73560
     tcatcgtgca tctgctgggt acgcacatta agtataaata ccgttatccg gaaggtcagg     73620
     ggcggtttga tggcattaca gggcatattc ccactggatt aaatgcgaaa gagctggaag     73680
     tgtataacga ttacgataat gccaatctgt ttaacgatca tgtggtggcc agtctgataa     73740
     aggacttcag agcaactgcg ccggacggct ttctgcttta tttttcagac catggtgaag     73800
     aagtatatga tactccgcca tataaaacgc agggacggaa tgaagataac cccacacgtc     73860
     ccatgtacac tgttccgttc ctgctgtgga cctcggaaaa gtggcatgct gcacatccgc     73920
     gagatttttc gcagtatgtt gaccgcaaat acagtctggc tgaactgatc cacacctggt     73980
     cagatttggc gggactgaca tacgatggtt acgatccgac ccgttctctg gtgaatccgc     74040
     aattcaggga aaccacccgc tggattggaa atccgtataa aaagaatggg ctcactgatt     74100
     tcgacactct tccgtatggt gagccatagt attttcttat cttcggttcc gttctgaagg     74160
     caggaggatg tgttttcctc tgctgtccgg tggcctccag ggatggtacc accttctgct     74220
     gtactctgtt atcataatga gataagcagg cagataccgg taaatatgaa aaatatcaga     74280
     actgagttta ttccccgctt taaccttaca ttatgcttcc cccgttactg gatgacgtgg     74340
     acaggtatcg gtattatctg tgtgtttgca atggtccccc ccgcactgag agatccattg     74400
     ttgggaaaat tgggcatgct ggttgggcgt ctggggaaaa gcgcacgtca acgggccttg     74460
     attaatttat cgctttgttt tccggagtac agtgataaag aaaaggagaa tatcgttgat     74520
     gccatgtttg caacagcctc catggccgtt gtgcttatgg ctgaattagc actgtccggg     74580
     cctgataaaa tttcgcatcg tatacgctgg aatggtctgg agattgtgga gaagatggca     74640
     cagaacaatg aaaaggtcat ttttcttgtg ccacatgcct ggggagtgga tattcccgca     74700
     atgctgatgg ctgcgtcggg cagaaaaatg gcagcgatgt ttcataacca gagaaatccg     74760
     gtggtggatt atgtctggaa cagtgttcgt cgtcgtttcg gaggaaaact gcacgcacgt     74820
     aatgacggta ttgcctcctt tgtccgctca gtccggcagg gatactgggg atattatctt     74880
     cctgatcagg atcatggccc ggaattcagt gagtttgcag atttttttgc gacgtataaa     74940
     gcaactttac cggttatcgg acggctcagc aggatcagtg gtgcacggat aataccgctt     75000
     ttccctgttt atgacggaaa gacccatcat ctgactattc atgtcagccc gccacttgct     75060
     atacgacaga agagtgatgc tcatattgcg cgacagataa acgaagtggt tgaaaatttc     75120
     gttcgtccac atcctgagca gtatacgtgg atcctcaagt tgctgaaaac gcgtaaagaa     75180
     ggggaagagg atccttactg aggcagcttt ttcaggataa tgagcttacc cagcaatagt     75240
     ggacacacgc taagtgagta aactctcagt cagaggtggc tcatatgaca aaaaaacagt     75300
     accaaccagt aaaaaacccc gtaaatagca ttcgcctgaa tttcgcagtg aagccctgaa     75360
     gcttgctgaa cgcatcggtg ttgctgtcgc agctcgtgtg ctcagtctgt atgaatcaca     75420
     gcttgtaagc ggctcgtcag aactgtattg atatttactg agcggtcagt tcaacggtaa     75480
     gcgtacagcc tgaaccgtct ggtcagaatc tgacgaatta gacaaagtgg tgtccaccaa     75540
     ataagtagtg ggaaccaaag tatcagatat gcagaaaaat gtgactcccg gcaggcgaaa     75600
     aggctgccct aattatcctc ccgaatttaa acagcagctc gttgctgcct cctgtgaacc     75660
     cgggatatcc atctcaaaac ttgctcttga aaatggcatt aacgccaatc tgttgttcaa     75720
     atggcgacaa caatggcgcg agggaaagct gctattacct tcttcagaga gcccccagct     75780
     acttcctgtg actctcgatg cagctgccga acagccagaa tcgctcgcag aggacccgga     75840
     acccctcagt atcagctgtg aggtaacgtt ccggcacggg acgctccgct tcaatggcaa     75900
     tgtcagcgaa aagctcctga ctctgctgat acaggaactg aagcgatgat cccgttacct     75960
     tccgggacca aaatttggct ggttgccggt atcaccgata tgagaaatgg cttcaacggc     76020
     ctggctgcga aagtacaaac ggcgctgaaa gacgatccca tgtccggcca tgttttcatt     76080
     ttccggggcc gcagcggcag tcaggttaaa ctgctgtggt ccaccggtga cggactgtgc     76140
     ctcctgacca aacggctgga gcgtgggcgc ttcgcctggc cgtcagcccg tgatggcaaa     76200
     gtgttcctta cgcaggcgca gctggcgatg ctgctggaag gtatcgactg gcgacagcct     76260
     aagcggctgc tgacctccct gaccatgctg taaatctctt tatcctggtt gtcacagaat     76320
     aagcccggta aaatacgggc ttatgaacga catctcttct gacgacatct tcctgctgaa     76380
     acagcgcctg gccgaacagg aagcgctgat ccacgccctg caggaaaagc tgagcaaccg     76440
     ggagcgcgaa atagaccatc tgcaggcgca gctggataaa ctccgccgga tgaacttcgg     76500
     cagtcgttcc gaaaaagtct cccgccgtat cgcacaaatg gaagccgatc tgaaccggct     76560
     tcagaaagag agcgatacgc tgactggtag ggtgtatgac ccggcagtac agcgtccgtt     76620
     gcgtcagacc cgcacccgta agccgttccc tgaatcacta ccccgtgacg aaaagcgact     76680
     gttgcctgcg gcgccgtgct gcccgaactg cggcggttca ctgagctatc tgggcgagga     76740
     taccgccgaa cagctggagt tgatgcgtag cgccttccgg gttatccgga cggtacggga     76800
     aaaacatgcc tgtactcagt gcgatgccat cgtgcaggca cctgcacctt cgcggcccat     76860
     cgagcggggt atcgccggac cggggctgct ggcccgcgtg ctgacctcga agtatgcaga     76920
     gcacaccccg ctgtatcgcc agtcagaaat atacggccgg caaggtgtgg agctgaggcg     76980
     ttcactgctg tcgggctggg tggatgcatg ctgccggctg ctgtctccgc tggaagaggc     77040
     gcttcatggc tatgtcatga ctgacggcaa actccatgcc gatgataccc cggtccaggt     77100
     actgctgccg ggtaataaga agacgaagac cgggcggttg tgggcgtatg ttcgtgatga     77160
     ccgcaatgca gggtcagcgt tggcacctgc agtgtggttc gcttacagcc cggacagaaa     77220
     aggcatccat ccgcagactc atcttgcctg cttcagcggt gtgctgcaag cggatgcgta     77280
     cgccgggttc aacgagctgt atcgcaatgg tgggataacg gaagctgcct gctgggctca     77340
     tgcccgccga aagatccacg atgtgcacgt ccgcatcccg tcagcactga cggaagaagc     77400
     cctggagcag atcggtcagt tgtacgccat agaggcggat ataaggggaa tgccggcaga     77460
     gcagcggctt gctgaacgtc agcgaaaaac gaaaccgttg ttgaaatccc tggaaagctg     77520
     gttgcgtgaa aagatgaaga ccctgttgcg acactcagag ttggcgaagg cgttcgcgta     77580
     cgcacttaac cagtggccgg cactgacgta ctatgcgaac gatggctggg tggaaatcga     77640
     caacaacatc gctgaaaatg ccctgcgggc ggtcagtctg ggtcgtaaaa acttcctgtt     77700
     cttcggctct gatcatggtg gtgagcgggg agcgctactg tacagcctga tcgggacgtg     77760
     caaactgaat gacgtggatc cagaaagcta ccttcgccat gtgcttggcg tcatagcaga     77820
     ctggccggtc aaccgggtca gcgaactgct tccgtggcgc atagcactgc cagctgaata     77880
     acacatcccc gtcaatacgg ccctcgctgt acgcttacgt tcaacgtaag cgagtgttat     77940
     gcgccatgga agcttaccca ggaatatgtt atcaggcctc agcatggcga agtgttgcaa     78000
     cgctggaagc agaatgaccg cggtcaacaa cttgttttac cgcttcaatt ttaaaatctt     78060
     cgggataacg cttaccgctc atgggcacct ctctttaagc catttaaaat gactctgagg     78120
     tgtctgttaa acccgtggcg attcaatctg gatatagtgg ctaagaatac ctttattttt     78180
     tttttttttt tttttttttt tttttttttt ttggtttttg tttttttatt gagttttgtt     78240
     ttgtatgtta aatatttgtt gttgattcat tatcacacaa aagaatgtat cataatgcaa     78300
     ttgtttgatg tgttaaacgt tataaacata ttaattgtcg tgttttgtgc ttgcttatca     78360
     aaaggatagt tagcttgctt tttttgcaaa atataataat aaaataagtt aaaggacgtt     78420
     ataagagtta attctttggt caggatatat ttacgaaaca ggtgtaaata tgttataaaa     78480
     ataaccaacg actagtgaat aagtcgctcc tgaaaaaata aaatatagaa atactgttat     78540
     atccggctgc atgaacacta aaatgaatga gagatggaga acaccgatga aattaaagta     78600
     tctgtcatgt acgatccttg cccctctggc gattggggta ttttctgcaa cagctgctga     78660
     taataattca gccatttatt tcaatacctc ccagcctata aatgatctgc agggttcgtt     78720
     ggccgcagag gtgaaatttg cacaaagcca gattttaccc gcccatccta aagaagggga     78780
     tagtcaacca catctgacca gcctgcggaa aagtctgctg cttgtccgtc cggtgaaagc     78840
     tgatgataaa acacctgttc aggtggaagc ccgcgatgat aataataaaa ttctcggtac     78900
     gttaaccctt tatcctcctt catcactacc ggatacaatc taccatctgg atggtgttcc     78960
     ggaaggtggt atcgatttca cacctcataa tggaacgaaa aagatcatta atacggtggc     79020
     tgaagtaaac aaactcagtg atgccagcgg gagttctatt catagccatc taacaaataa     79080
     tgcactggtg gagatccata ctgcaaatgg tcgttgggta agagacattt atctgccgca     79140
     gggacccgac cttgaaggta agatggttcg ctttgtttcg tctgcaggct atagttcaac     79200
     ggttttttat ggtgatcgaa aagtcacact ctcggtgggt aacactcttc tgttcaaata     79260
     tgtaaatggt cagtggttcc gctccggtga actggagaat aatcgaatca cttatgctca     79320
     gcatatttgg agtgctgaac tgcctgcgca ctggatcgtg cctggtttaa acttggtgat     79380
     taaacagggc aatctgagcg gtcgcctaaa tgatatcaag attggagcac cgggtgagct     79440
     gttgttgcat acaattgata tcgggatgtt gaccactccc cgggatcgct ttgattttgc     79500
     caaagacaaa gaagcacata gggaatattt ccagaccatt cctgtaagtc gtatgattgt     79560
     taataattat gcgcctctac acctaaagga agttatgtta ccaaccggag agttattgac     79620
     agatatggat ccaggaaatg gtgggtggca tagtggtaca atgcgtcaaa gaataggtaa     79680
     agaattggtt tcgcatggca ttgataatgc taactatggt ttaaatagta ccgcaggctt     79740
     aggggagaat agtcatccat atgtagttgc gcaattagcg gcacataata gccgcggtaa     79800
     ttatgctaat ggcatccagg ttcatggtgg ctccggaggt gggggaattg ttactttaga     79860
     ttccacattg gggaatgagt tcagtcatga agttggtcat aattatggtc ttggtcatta     79920
     tgtagatggt ttcaagggtt ctgtacatcg tagtgcagaa aataacaact caacttgggg     79980
     atgggatggt gataaaaaac ggtttattcc taacttttat ccgtctcaaa caaatgaaaa     80040
     gagttgtctg aataatcagt gtcaagaacc gtttgatgga cacaaatttg gttttgacgc     80100
     catggcggga ggcagccctt tctctgctgc aaaccgtttc acaatgtata ctccgaattc     80160
     atcggctatc atccagcgtt tttttgaaaa taaagctgtg ttcgatagcc gttcctccac     80220
     cggcttcagc aagtggaatg cagatacgca ggaaatggaa ccgtatgaac acaccattga     80280
     ccgtgcggag cagattacgg cttcagtcaa tgagctaagt gaaagcaaaa tggctgagct     80340
     gatggcagag tacgctgtcg tcaaagtgca tatgtggaac ggtaactgga caagaaacat     80400
     ctatatccct acagcctccg cagataatag aggcagtatc ctgaccatca accatgaggc     80460
     cggttataat agttatctgt ttataaatgg tgacgaaaag gtcgtttccc aggggtataa     80520
     aaagagcttt gtttccgatg gtcagttctg gaaagaacgt gatgtggttg atactcgtga     80580
     agcgcgtaag ccagagcagt ttggtgttcc tgtgacgacc ctggtggggt attacgatcc     80640
     ggaaggcacg ctgtcaagct acatctatcc tgcgatgtat ggtgcctatg gcttcactta     80700
     ttccgatgat agtcagaatc tatccgataa cgactgccag ctgcaggtgg atacgaaaga     80760
     agggcagttg cgattcagac tggctaatca ccgggctaac aacactgtaa tgaataagtt     80820
     ccatattaac gtgccaacag aaagtcagcc cacacaggcc acattggttt gcaataacaa     80880
     gatactggat accaaatcgc tcacacctgc gccagaagga cttacctata ctgtaaatgg     80940
     gcaggcactt ccagcaaaag aaaacgaggg atgcatcgtg tccgtgaatt caggtaaacg     81000
     ttactgtttg ccggttggtc aacggtcagg atatagcctt cctgactgga ttgttgggca     81060
     ggaagtctat gtcgacagcg gggctaaagc gaaagtgctg ctttctgact gggataacct     81120
     gtcctataac aggattggtg agtttgtagg taatgtgaac ccagctgata tgaaaaaagt     81180
     taaagcctgg aacggacagt atttggactt cagtaaacct aggtcaatga gggttgtata     81240
     taaataatcc tgagacggtg cggccacttc ggccgcatta gtaacacatt cgtcccgtta     81300
     atcaaaacat aaagtagcgt ccagcgtttt attatgttgt tctttctatc attccggggt     81360
     gaccggggct tatttataaa agatatcgta cttaaaatgc tgacgccaaa ccggctattg     81420
     tgcgtaattt tacttattgc cggatatcag ctggtgtcgg ttatccatca tttctggctg     81480
     actcaggcag catcggtgcc cggcttatcc cgtgttagcg cgccggaaac agcggtaact     81540
     ggtgatcaaa ctgaagaacg ttttgttttt acgttattcg gcagggcatc cccactatca     81600
     tcggagggga gagcgcagga aacaatgcct tccctgtcag atgatctgct ttcaggggag     81660
     gatcttgacg tgagaggtat actttatagt tcggttgcag agcattccgt tgccatattt     81720
     gcacataata acagacagtt cagtctgagc gtcggcgaaa aagtacccag ctacgatgct     81780
     acgattagtg ctatttttag cgatcatatt gttattaact atcagggaaa aactgtatca     81840
     ctgcctctgc gatatgataa taccgaaaaa aagaatgcat atgacaataa taatttaaca     81900
     gttggagacg tgataaccca agataatttt cgggtagaaa gtgtttttga tattatgagc     81960
     ttttcagccg ttacggttaa taatacatta agcggttatc gcttgattcc gggtaagcac     82020
     agttcgttat tttataatgc tgggttgcat gataacgatc tggccgtatc ggttaatggt     82080
     tcagaattgc gtgataccag acaggcgcag cagataatga agcaattgcc agaacttaaa     82140
     gaaataaaaa taaccgtcga gcgtgatggt cagttatatg atgcatttat tgctgtagga     82200
     gaaaactgat tgttcaggaa atggttgaat gggcgtttgc cggtacttgt gttcactaca     82260
     gtaattttgg gggccattcc agggtggggg gctgaatttt cggccaactt taaagatacg     82320
     gatattcagg agttcataaa tactgtcagt aaaaatttac acaaaacggt aataattaat     82380
     cctgacgtgc agggaaccat cactgtacgc agctacgata tgctgaacga ggaacaatat     82440
     tatcagttct ttctcagtgt gctggacgtt tatggttttg ctgtggtcga tatgcacaac     82500
     ggtatactga aagtagtgcg ctcaaaagat gccaaaacgt cggcggtgcc ggtagctagt     82560
     gatgtcagtc ccgggactgg tgatgaggtt gttacccggg tggtccccgt aagtaacgtg     82620
     gcagccagag atctggcgcc tttgctgcgt cagctcaatg ataatgctgg cgcaggaagc     82680
     gtggtgcatt atgaaccttc taatgttttg ttgatgaccg gacgtgctgc agtgatgaaa     82740
     cggttgatgg agattgttga acgtgtggat aaggtgggta atcgcagcgt tgccacggtc     82800
     ccgctcacct acgcgtccgc aacagacgta gccagacttg ttacggaact gactaaagaa     82860
     acagataaga cagctatacc tgcttggatg acggcgaaac tggttgcaga cgagaggaca     82920
     aactcagtgc tcgtcagcgg agagccaatc tcccaacagc gtatcatctc cataattaag     82980
     caactggatc gtcaggagga tgttcagggt aatactaagg tgatttacct gaaatatgcg     83040
     aaggcgaagg atttagtgga agtcctgaca ggtatcagca gcagtattga aaacgactct     83100
     aaaaagagtc cgtcaacgga agccttgcgc aaaggagtga cgattaaatc ccacgaacaa     83160
     accaatgccc tgatcctgac gggggcccct gacgtcatcc gcgaccttga aaatgtgatt     83220
     tcgcagttgg atattcgtcg tcctcaggtc ctggtggagg ccatcattgc tgaaatacag     83280
     gatgctgacg ggctgaacct tgggatccag tgggtgaata aacatgccgg tgtggcgcag     83340
     ttcaccagta ccggtttacc tattaccacg atggttcaga ctcgtcagaa cgaaatctta     83400
     gacagcgatc agagcaatgc cctgagcatg tttaacggaa ttgcagcggg gttttatcag     83460
     ggaaactggg cgatgctgtt gacggcgctc tccacaagta gcaagaatga tatcttggcg     83520
     acccccagta ttgtcacgct ggacaatatg gaggccactt tcaatgttgg tcaggaggtc     83580
     ccggtacttt cgggctcaca gacaacctct ggggacaata tttttaacac ggtcgagcgc     83640
     aaaacggtgg ggatcaaact cagggtaaaa ccccagatca acgagggtga ttccgtgtta     83700
     ctggagatag aacaggaggt gtccggtgtg gcggacactg cagtagccac cactactgac     83760
     ttgggagcaa ccttcaacac ccgaacagtg accaatgcca tgctggtcgg gaatggcgaa     83820
     acggtggtgg tcggaggatt actggataag tcgatcaggg ggagtgagag taaagtgcca     83880
     ctgctggggg atatcccggt actggggcat ctttttcgcg caaaaagcga acagacagct     83940
     aagcgtaatc tgatgctgtt cattcggcca actattattc gtgagcgcga cggatttcgt     84000
     catgcttcgg ccgaaaaata ccagtcgttt aatcaggaac aggtgcagtc gcgtggcaaa     84060
     gaaacaacgg cgctgacgct gaatgaggaa cagctcaggc tgtcccccga tcaagacgat     84120
     acggctttcc ggaaggtgaa agcggcgatt gctgcgtttt atgcgcagga gatgtaatga     84180
     gcagagtagt acagaatgtc agtgaatcac gtccccttct gcctttttcc ttttcccgta     84240
     cgcagagaat tttgttgctg cgtgaacagg aggggaatcg agtgttctgc atggaggaca     84300
     cacctgccag tgccctgttg gaggtgcgca gggtggctga aggtcctctg aatgtcacaa     84360
     cagtgtcggc ggaagcgttt gaaaaacagc tggtgagcag ctatcaacgt gattctgatg     84420
     aagcgcgaca aatgatggct gagattggta atgaaatgga tttttatacc gtcgcagggg     84480
     agttgcctga ccgtgaggac ttactggatg cgaatgacga tgcgccaatt atccgcctga     84540
     ttaacgcaat gctgacagag gcaattaaag agaaagcctc agatattcat attgaaactt     84600
     acgaacgcca tctgcaggtt cgctttcgca ttgatggcgt tctgcgggag atcctccgtt     84660
     tacataggaa tctggcttcg ttactgattt cacgcattaa agtcatggcc cggttggata     84720
     ttgccgaaaa acgcgttccc caagatggcc gcatggtact gcgtatcggt ggtcgggcgg     84780
     tggatgtgcg tgtttcaacg ttgccttcaa atcatggtga acgcatcgtg ctgcgtttac     84840
     tagacaaaaa tagcgttagt ctcgatcttg ctgcactcgg catgtcgcag cagaatcagc     84900
     gacacattga tgcactgatc cgccgtcctc acggcattat tttggtgacc gggcctacag     84960
     ggtcgggtaa aagcacgacg ctttatgccg cgttaagcct gctgaatccc cgagaccgca     85020
     acattatgac ggtcgaggat cctgttgaat atgaactgga cggtatcagt cagacccagg     85080
     tcaacccgaa ggtggacatg acctttgccc ggagtctgcg cgctatttta cgtcaggatc     85140
     cggacgtggt gcttgtgggg gagatccgtg acggtgaaac agcccagatt gctgtgcagg     85200
     cctcgctgac agggcatttg gtgctgtcaa cgttacatac gaatagtgca gcaggcgcgc     85260
     tgtcgcgtct gcaggatatg ggcatccctc cttttctgct ttccacctca ttactggctg     85320
     ttctggccca gcgactggtt cgcacgttgt gtccgcgctg tcgtcagccc tgtcaggtca     85380
     gtactgagtt agcgatggac atggacattc cccctgaaac cacgatctgg cagcctgccg     85440
     ggtgtcagca ctgcagtttc acgggctatc acgggcgcac cgggatccac gagctgttgc     85500
     tgattgacga tcgcattcgg acggcaatct atcaggggga gggggagctg ggtattaccc     85560
     gcttggcagg gagtcgctat ctgacgctgc gtggcgacgg gcgacaaaag gtactagccg     85620
     gtgagaccag ttgggaggag gtggttcgcg ttactgaaag cagattgcag gaagaggaat     85680
     gatatggcgt tgtttcatta tcaggcatca gatattcacg gtagaaaacg cagtggcatt     85740
     ctggaggcgg attcggcccg acatgcccgt cagttgctgc gtgagcaggc gcttattcca     85800
     gtcaggttgg atgagaaaca ggtccatcac aagcactcac tgcggagtat cctgaggttt     85860
     cgtccgcgcg gggggagcag cgccgaactc gcgttactga cacggcagtt agccacacta     85920
     gtggccgcat ctctgccgct tgaagaggcg ctggatgcgt tgttgaggca gagtgaaaaa     85980
     ccgcgtcagc ggaacttaat cgctgccgtg cgcaccaagg ttctcgaggg acattccttg     86040
     gccgcggcga tgggcatgtt tccaggtacg tttgagcgtc tttattgtgc gatggtggcg     86100
     gcgggggaaa catccggtcg tttggacgtg gtgctcagtc gtctggctga ctataccgag     86160
     cagcgccaga tcatgcgaaa ccgtctactc caggcattgc tctatccttg tgttctgacg     86220
     ttggtggcgg ttggggttat tgccattctg cttactgcgg ttgtgccgaa agtggttgag     86280
     cagtttattc atatgaaaca gacccttccc ttatctaccc gcgtactgat gggggctgct     86340
     gaggtgagcc agacttgggg cccgtggctg ttactggccg cagcgctggg cgggatagcg     86400
     gggcgcatga tattacatca gccctcccag cgtctggctt ttcatcatct gctgttgcgg     86460
     ctgccggtcg tggggcgcat atcgcgcggt ctgaataccg cacgttatgc ccgcacgctg     86520
     agcattctta atgccagtgc ggtaccgctg ctccaggcga tgcacatcag tggtgacgta     86580
     ctgagtaatg actgggcccg tcatcagtta gctaccgcgg ccgagttggt tagggaaggg     86640
     gtcagcctgc atcaggcact ggagcagact tcgctgtttc cgcctatgat gcggcacatg     86700
     attgccagcg gtgaaaatag tggcgaactc gacagcatgt tggaacgggc cgccgacaat     86760
     caggatcgtg agttcagcac acagatgcaa ctggcgctgg gattgtttga accgctgttg     86820
     gtggtgggta tggccggggt cgttttgttt attgttctgg caattctgca gccgctcctg     86880
     cagctcaaca acatgatgaa tatgtgaatc cttctttaac agtcaacgga gaaaaacatg     86940
     cgaaaacagc atcagcgtgg ttttaccttg ctggaaataa tggtggtaat tgtgatcttg     87000
     ggagttttgg ccagtctggt ggtcccgaat ctgatgggaa ataaggataa ggccgatcgg     87060
     cagaaagtga tgagcgactt ggttgcgctg gaaagcacgc tcgatatgta ccggttagat     87120
     aataaccggt atccgacaac ggagcaggga ctgcgggcac tggtcagtaa acccaccgtg     87180
     caacctgaac cccgtaacta ccggcaggat ggttatatcc gccgtttgcc ccaggatcct     87240
     tggggggggg attatcagct gttaaatcct ggtcagtaca gcgacattga tatcttttct     87300
     cctggcccgg atggtgtgcc aaacactgaa gatgatattg gtaactggac gctcggtaac     87360
     gcgcagccat gagtcagcgc ggtttcacaa tactggagat gatgctgatc cttttgttga     87420
     tgggcatcac tgcagggctg gtactaatgt catttcctga ctctgctcag aatcatctgc     87480
     aacaacagcg ggagcgtctg caggcgcagc tggattatgc cttggataga agccagcagg     87540
     acggcttgct gatggggatt caggttcggt ttgacggatg gaaatttaag gttctgcagc     87600
     gcggaacagc ggaaagcccc ccgacattag ctgagggagg ggatatttgg caggggtatg     87660
     tctggcaaac ttggcaaccg cgacgtgcag ccatgggggg caaacttccg gatgatgtgc     87720
     gtcttgagct gcagtatctc agaggtttgc agtggatgtc tgagcatgat gacggggctg     87780
     aacccgatat tttgctgctt cccggaggtg aggtaacgcc gttcagactt cttttcaggc     87840
     aggtcggaga ggaggccgtt gtcgggctgc aggttgatga gaacggtttg atgactcttt     87900
     ttgaaggtga ggtctcattg tgaaggggca agaaggaatg acattactgg aagtcatagt     87960
     agctctggtt gtgtttgcgc tggcaggaat ggcgctgatg caggcctcga cccagcaggc     88020
     tgcggggatc ggacggatgg aagagaaggt gctggcaggc tggttggccg ataaccagat     88080
     ggtgcaattg caactcgaga aaacttggcc ggaaaatggc tggggcgaga agacgatcag     88140
     cttcgctggc accgaatggt atttacgctg gggcgggccg gacagcgacg tgccgcagcc     88200
     gcgctcctta gaggtagagg tacggcgcac taaagaggag acgtccgcct tggtttcctt     88260
     gcgtagcagt gtggttcgtg aatgagtcag caacgggtaa aaggttttac gctactggaa     88320
     atgctgttgg cactggctgt ttttgcagcg ttgagcatca gcgcatttca ggtgctgcag     88380
     ggtggaatac gggcgcacga gctgtcccgg gataaagtac agcgtctggc tgagctgcag     88440
     agagggatca gccagatgga gcgagatctt acgcagatgc tcccaaggca cagccggggg     88500
     aatgaaggcc tgctgctcgc tgcacctcat ctgctaaaaa gtgatgactg ggggatttct     88560
     tttacgcgaa acagctggct gaatcccgcc gggatgctgc cgcgcccgga gttacagtgg     88620
     gtaggttatc ggttgcgaca gcaaaagtta gaacgcctga gctactttca tgtcgatcac     88680
     ccttccggtg tttctccgga tgtcagggtg atgctggacg gcgttcacgc atttcgtctg     88740
     cgtttttttg ttaacggtga ttggcaggcg cgctgggaca gtaccggcat cctgccgcag     88800
     gctgttgaag tgacgctggt tatggatgat tttgctgaac tgccccgtct gtttcttgtg     88860
     agcaaggaga ccgctgaatg aaattgcggg aacagggcgt ggcgcttctg gtggtattgc     88920
     tgatcctgtc gttaatggta acgatagcgg cggtgattgc ggagcgcaac ggtcggacat     88980
     ttttgcgtac agtagcgcag ttggatcagc tgcaggcaaa gtgggatggc tatacggcag     89040
     agacgatagc aaaacaaatc ttacagagga gcaggcagga gtcgccccgg aaaacgcatc     89100
     tggcacaaaa ttgggcgcag tcagaacgac agtttgagac cagaggggga gatgtgcggg     89160
     ggcagatcgt ggatgcgcag gcctgtttta atcttaatgc tattaattat ggagtggtgg     89220
     atctgaccag tataccttat gccgccagaa tttttcagca gctattaatc aacttgcagg     89280
     tagagctttt acaggcccgg caagtgacgg cagccctacg tgactggatc gatcgtgatg     89340
     ataagccggt aaggggcggt gctgaagacg aggtgtatat ggggatggaa cctccctatc     89400
     tggcagccaa ccagccgatg caggacgtca gtgagttacg ccttatccgg ggaatagatg     89460
     ccaggcttta ccgcaaactt ttgccgtatg tttgtgtact gcctacgtca gatctgtctg     89520
     tgaatgtgaa tactctgctg gattcacagg cgccgctgct ggcggcgctc tttctgacga     89580
     aaccggacag tcttccggtg acggaattac tgcagcggcg accccgtact ggttgggaga     89640
     gcgtggcggc gtttcttgac gcgccaccgc ttaaggacat tgacaccagt gcggccatgc     89700
     cggtattggc cgtcagcagc aactattttc tggttcggtt acatgtgcgc tccggggaac     89760
     acctgttcag tcagcagact ttaatgcagt ggagggagga gcgtttccgg atcattcagc     89820
     gacagtatgg attaacgatg agggaggttc cctgaaaaaa aataacaaac atgtcgaggc     89880
     tggtcggctt tttctgcgac tgccggagga tgactcggag cctttattgt ggaggctgat     89940
     tgcgccagag gagacaggag ccggcagtgt ggcagtcgga gaaacggatc cgcagttagt     90000
     cggtttgctg tcccgttatc ccgcctgggt gctggttccg tcaggcagaa ttgccttcca     90060
     tcaggtcacg ctgccacacc gcacgtggcg tcagcgtttg caggtgctgc cctttcttct     90120
     ggaagagcag ttggcgacag acattgagca gctgcacttc gccattcttc atcagtcggg     90180
     tgacaggtgt gatgtggcgg tggtcgaaaa agcggttatg catcgctggt tagcgtactg     90240
     tggacaactt ggggttcggg aggtgaggtt gctgcctgac gtactgatgc tgccgttggc     90300
     aactgaagga tggagtgccg taaagcttgc cgggcagtgg ctgtttcgcc gggatcgtta     90360
     cgccgggatg acggtagagt tatcgtggct gacacatttc ttgtctctta ctgcgccgcc     90420
     ggtgattgag tcctactccg tgccgccagt accgtgcccg ggtccgaaga ccactgagtg     90480
     gcgaaatcag cccggacgcg atctgctgca gttggtggcc gaaggtgacg ggtatgatgg     90540
     cgcagatctg cggcagggag aatttgcccg ccagggaaca tggtatgcac gatttcgccc     90600
     atggaggtat gtcgcagggg ctctgctggc ctgtgttttt ctggccggga gcaacgcggg     90660
     gctggcacat tatcggctct ggcagcaggc tcaattctgg cggtatgaga gcgtacgtgt     90720
     ctatcagcag ctgtttccga gtgaaaaggc ggtgaaggat ccccgccggc agatgctgag     90780
     acatctgcaa cagtcgacgg gtaacaatat accggaactc gggagcgtga tgcgccagct     90840
     tcagcaactg ctgtcagaaa cctcaacgat acgcttacag gcactcgcct gggacagcag     90900
     cagccagaca ctgaaaattg atttgcaggc ggcttctttt caggcgctgg aacactttca     90960
     gcagatcgcc ggagaaaaat acctcatcca gcctggtgag atacgacagc agccgcaggg     91020
     ggtagaaagt cgtctgatcc tgagagtgaa caatgaacga gcttaaaaaa cgtttgcagt     91080
     atgttagccc ccgtgagcgc aggctgctta tcggatgtgt tgccttactg gttgttgttt     91140
     ttgtctatta cgtcctctgg cagccctggc tgatacgaga ggataagtgg cggactgtag     91200
     ttacccgtga aaaaaacaca gtggagtgga tgaaacaaca ggtacccaac ataaagagac     91260
     gggaggcaag tatgcctgaa cagggggagc cgttaggttt atctgcggcc gtgacacgta     91320
     cttcagccgc atacggtgta tcggtcaccc ggttgcagcc tcaaggggag cgtctggccg     91380
     tcaccttagc cccggttgaa tttaatgcgc tgatgcagtg gcttacgcaa ctggagcgtc     91440
     ggcaccgtat tcgtaccatg gtatttgatg tggccgcgca gggcaaccca cccggacagg     91500
     taacggttaa tcggctggtt ttgtcccaag atgacgtaaa caaggacgct tcgcttagtc     91560
     gctgatgtcg taatttacag attaatgctt gatgtaaaaa ttggacttat aaaggaggat     91620
     gtgtgagtag tttgccggaa tttgcggttg attatccctt gttgtggctc atctgcaccg     91680
     gagggctggg gggcgttacc ggcagttttc ttaacgtcgt gattcatcgt ctgccgataa     91740
     tgttggagag gcggtggcgg cgtgaagcgc tgacgctatt ggcacattct gtgcctgagt     91800
     ccgggccggc ctttaacctg atgataccgc agtctcattg tccctgctgt tttcatccgc     91860
     tcggcatcag ggataacatt cccctgttaa gctacctatt tctgaagggg aaatcacgct     91920
     gttgtggcga gcgtattccc gtttactacc cgctagtcga aataacgaac tcagtgttat     91980
     tcattctggc cgcgagcagg tttccaccag ggctgacatt agcggctgcc tggcttttta     92040
     tttccatgct gttggttctg gcggttattg actgccatac ggcgctgctg ccggatgtgc     92100
     tgacgttgcc attgctctgg cttggcctgt tattcagttt acagagaggc gttgtcacct     92160
     tagaggaggc ggtagtgggg gcggtatctg ggtatctctg tctgtgggga ctgtactggc     92220
     tttttcgttt cgctaccggg agggaagggt taggttacgg tgattttaag ctagctgcgg     92280
     cattgggagc atggatgggt tggcaggcat taccctcaat acttttgttt gcctcagtca     92340
     gtgggttaat cgtaacagta ctgttgcgta ttgtaacagc tacggacttt acccgcccgc     92400
     tgccttttgg gccgtggctc gctttgagcg gagtgtgcca ttttttgttg atgtagcgtt     92460
     cggttaccgg ggctagtaat aaaaacggct cagcggataa aagaactgtt gtaaaccggt     92520
     atcaggttaa acgataccta gtaaaaaatg atgggtaata ttttgaaaaa actgaattgt     92580
     atcgcgtcat tactagtctt agtgactatc tctggttgtc atcagtcacc ctccatccat     92640
     aagcaggcca ctgttcctcc gagcgaacaa ctggaacaaa tggcgtcgat tgtctctgcg     92700
     acacggtatc tgaaaatgag atgtaaccgt agtgatttac cagatgaaca gtcgatccta     92760
     aatgtcgcta accggatcgc tatcgggaaa gggtggcagt cattaactca ggaggatata     92820
     cgtaaacaca gcgatgatat ctatgtgcgt ctgactaggg acagtacgcc tgagtatata     92880
     aaatgcagag aattcaatcg gcggctggtc ccatttatcg gtgaattatt ggcaaggggt     92940
     cgtggataat atgaaccgcc ccggaaatcc tggagactaa actccctgag aaagaggtaa     93000
     acagcatgaa taaaaatggg tcttcccttg tagtggtggc tgaaggcatg atgattgtag     93060
     tggcacactg aatttggcca cctgaacaga ggtgatatgc tcacctcaga acaacacagg     93120
     tgctccaatg aaaaaaagaa atttcagcgc agagtttaaa cgcgaatccg ctcaactggt     93180
     tgttgaccag aactacacgg tggcagatgc cgccaaagct atggatatcg gcctttccac     93240
     aatgacaaga tgggtcaaac aactgcgtga tgagcgtcag ggcaaaacac caaaagcctc     93300
     tccgataaca ccagaacaaa tcgaaatacg tgagctgagg aaaaagctac aacgcattga     93360
     aatggagaat gaaatattaa aaaaggctac aaccgcgctc ttgatgtcag actccctgaa     93420
     cagttctcga taatcgggaa actcagagcg cattatcctg tggtcacact ctgccatgtg     93480
     ttcggggttc atcgcagcag ctacagatac tggaaaaacc gtcctgaaaa accagacggc     93540
     agacgggctg tattacgcag tcaggtactt gagttgcata acatcagcca tggttctgcc     93600
     ggggcaagaa gcatcgccac aatggcaacc ctgagaggct tcagaatggg gcgctggctt     93660
     gccggcaggc tcatgaaaga actgggactg gtcagttgcc agcagcctgc gcaccgttat     93720
     aaacgaggtg gtcgtgaaca tgtcactatc ccgaatcacc ttgggcggca gttcgcagtg     93780
     acagagccaa atcaggtatg gtgcggcgac gtgacgtaca tctggacggg gaaacgttgg     93840
     gcataccttg ccgttgttct cgacctgttt gcaaggaaac cggtaggttg ggcaatgtcg     93900
     ttctctccgg acagcagact gaccatcaaa gcgctgaaaa tggcctggga aatccgcagt     93960
     aaaccagccg gggtaatgtt ccacagcgat cagggcagcc actatacaag caggcagttc     94020
     cggcagttac tgtggcgtta ccagatcaaa cagagtctga gtcgacgagg aaattgctgg     94080
     gataacagcc cgatggagcg cttcttcagg agtctgaaaa acgagtggat accggtgacg     94140
     ggttacatga acttcagcga tgctgcccat gaaataacgg actatatcgt tgggtattac     94200
     aacgcgctca ggccgcacga atataacggt gggttgccac caaatgaatc ggaaaaccga     94260
     tactggaaaa actctaaagc ggtggccagt ttttgttgac cactacatcc cgtcagccga     94320
     tttacgggcc gtaagtaacg aagttggatg caaatgtcag atcgtgtgcg cctgttatgg     94380
     ctcggctggt aagagagcct tataggcgca tttgaaaaaa ctccagctat accggaagag     94440
     atttattatt aacaggagag gtttgctttt ctgtgtaggt ttagattttg tgtttgcagg     94500
     gtaaacaaaa ctgattaact cgtcatttcg gtaactgaaa tagtttgctg tattctgttt     94560
     acaatctctt taataaggca tttgtcacgt ggctattcat atgaaaatca tacgttatct     94620
     tacaaatcaa tcatctgagt gtta                                            94644
//

If you have problems or comments...

PBIL Back to PBIL home page