(data stored in SCRATCH zone)

EMBL: CP001172

ID   CP001172; SV 2; circular; genomic DNA; STD; PRO; 3759495 BP.
XX
AC   CP001172; CP024911;
XX
PR   Project:PRJNA30993;
XX
DT   16-DEC-2008 (Rel. 98, Created)
DT   12-NOV-2019 (Rel. 142, Last updated, Version 8)
XX
DE   Acinetobacter baumannii AB307-0294, complete genome.
XX
KW   .
XX
OS   Acinetobacter baumannii AB307-0294
OC   Bacteria; Proteobacteria; Gammaproteobacteria; Pseudomonadales;
OC   Moraxellaceae; Acinetobacter;
OC   Acinetobacter calcoaceticus/baumannii complex.
XX
RN   [1]
RP   1-3759495
RX   DOI; 10.1128/JB.00834-08.
RX   PUBMED; 18931120.
RA   Adams M.D., Goglin K., Molyneaux N., Hujer K.M., Lavender H., Jamison J.J.,
RA   MacDonald I.J., Martin K.M., Russo T., Campagnari A.A., Hujer A.M.,
RA   Bonomo R.A., Gill S.R.;
RT   "Comparative genome sequence analysis of multidrug-resistant Acinetobacter
RT   baumannii";
RL   J. Bacteriol. 190(24):8053-8064(2008).
XX
RN   [2]
RP   1-3759495
RA   Hamidian M., Wick R., Judd L., Russo T.A., Holt K.E., Hall R.M.;
RT   "Complete genome sequence of Acinetobacter baumannii Strain AB307-0294";
RL   Unpublished.
XX
RN   [3]
RP   1-3759495
RA   Adams M.D., Goglin K., Molyneaux N., Hujer K.M., Lavender H., Jamison J.J.,
RA   McDonald I.J., Martin K.M., Russo T., Campagnari A.A., Hujer A.M.,
RA   Bonomo R.A., Gill S.R.;
RT   ;
RL   Submitted (26-SEP-2008) to the INSDC.
RL   Infectious Disease and Genomics--Center of Excellence, University at
RL   Buffalo, 701 Ellicott Street, Buffalo, NY 14203, USA
XX
RN   [4]
RP   1-3759495
RA   Hamidian M., Wick R., Lewis J.M., Boyce J.D., Judd L., Russo T.A.,
RA   Holt K.E., Hall R.M.;
RT   ;
RL   Submitted (16-NOV-2017) to the INSDC.
RL   School of Life and Environmental Sciences, The University of Sydney, Cnr.,
RL   Maze Cres., and Bultin Ave, Sydney, NSW 2006, Australia
XX
DR   MD5; 56e7531418fadbc4273984d9fd400642.
DR   BioSample; SAMN02603889.
DR   EnsemblGenomes-Gn; ABBFA_000016.
DR   EnsemblGenomes-Gn; ABBFA_000017.
DR   EnsemblGenomes-Gn; ABBFA_000242.
DR   EnsemblGenomes-Gn; ABBFA_000259.
DR   EnsemblGenomes-Gn; ABBFA_000281.
DR   EnsemblGenomes-Gn; ABBFA_000282.
DR   EnsemblGenomes-Gn; ABBFA_000302.
DR   EnsemblGenomes-Gn; ABBFA_000303.
DR   EnsemblGenomes-Gn; ABBFA_000306.
DR   EnsemblGenomes-Gn; ABBFA_000307.
DR   EnsemblGenomes-Gn; ABBFA_000470.
DR   EnsemblGenomes-Gn; ABBFA_000471.
DR   EnsemblGenomes-Gn; ABBFA_000472.
DR   EnsemblGenomes-Gn; ABBFA_000475.
DR   EnsemblGenomes-Gn; ABBFA_000499.
DR   EnsemblGenomes-Gn; ABBFA_000500.
DR   EnsemblGenomes-Gn; ABBFA_000528.
DR   EnsemblGenomes-Gn; ABBFA_000529.
DR   EnsemblGenomes-Gn; ABBFA_000554.
DR   EnsemblGenomes-Gn; ABBFA_000660.
DR   EnsemblGenomes-Gn; ABBFA_000661.
DR   EnsemblGenomes-Gn; ABBFA_000662.
DR   EnsemblGenomes-Gn; ABBFA_000663.
DR   EnsemblGenomes-Gn; ABBFA_000664.
DR   EnsemblGenomes-Gn; ABBFA_000665.
DR   EnsemblGenomes-Gn; ABBFA_000704.
DR   EnsemblGenomes-Gn; ABBFA_000796.
DR   EnsemblGenomes-Gn; ABBFA_000798.
DR   EnsemblGenomes-Gn; ABBFA_000799.
DR   EnsemblGenomes-Gn; ABBFA_000824.
DR   EnsemblGenomes-Gn; ABBFA_000933.
DR   EnsemblGenomes-Gn; ABBFA_001039.
DR   EnsemblGenomes-Gn; ABBFA_001096.
DR   EnsemblGenomes-Gn; ABBFA_001097.
DR   EnsemblGenomes-Gn; ABBFA_001098.
DR   EnsemblGenomes-Gn; ABBFA_001131.
DR   EnsemblGenomes-Gn; ABBFA_001201.
DR   EnsemblGenomes-Gn; ABBFA_001202.
DR   EnsemblGenomes-Gn; ABBFA_001203.
DR   EnsemblGenomes-Gn; ABBFA_001204.
DR   EnsemblGenomes-Gn; ABBFA_001985.
DR   EnsemblGenomes-Gn; ABBFA_002310.
DR   EnsemblGenomes-Gn; ABBFA_002352.
DR   EnsemblGenomes-Gn; ABBFA_002474.
DR   EnsemblGenomes-Gn; ABBFA_002480.
DR   EnsemblGenomes-Gn; ABBFA_002757.
DR   EnsemblGenomes-Gn; ABBFA_002766.
DR   EnsemblGenomes-Gn; ABBFA_002779.
DR   EnsemblGenomes-Gn; ABBFA_002780.
DR   EnsemblGenomes-Gn; ABBFA_002781.
DR   EnsemblGenomes-Gn; ABBFA_002782.
DR   EnsemblGenomes-Gn; ABBFA_002900.
DR   EnsemblGenomes-Gn; ABBFA_002901.
DR   EnsemblGenomes-Gn; ABBFA_002902.
DR   EnsemblGenomes-Gn; ABBFA_002903.
DR   EnsemblGenomes-Gn; ABBFA_002936.
DR   EnsemblGenomes-Gn; ABBFA_002937.
DR   EnsemblGenomes-Gn; ABBFA_003137.
DR   EnsemblGenomes-Gn; ABBFA_003138.
DR   EnsemblGenomes-Gn; ABBFA_003202.
DR   EnsemblGenomes-Gn; ABBFA_003203.
DR   EnsemblGenomes-Gn; ABBFA_003204.
DR   EnsemblGenomes-Gn; ABBFA_003255.
DR   EnsemblGenomes-Gn; ABBFA_003257.
DR   EnsemblGenomes-Gn; ABBFA_003258.
DR   EnsemblGenomes-Gn; ABBFA_003259.
DR   EnsemblGenomes-Gn; ABBFA_003260.
DR   EnsemblGenomes-Gn; ABBFA_003347.
DR   EnsemblGenomes-Gn; ABBFA_003348.
DR   EnsemblGenomes-Gn; ABBFA_003397.
DR   EnsemblGenomes-Gn; ABBFA_003398.
DR   EnsemblGenomes-Gn; ABBFA_003496.
DR   EnsemblGenomes-Gn; ABBFA_003497.
DR   EnsemblGenomes-Gn; ABBFA_003532.
DR   EnsemblGenomes-Gn; ABBFA_003533.
DR   EnsemblGenomes-Gn; ABBFA_003534.
DR   EnsemblGenomes-Gn; ABBFA_003535.
DR   EnsemblGenomes-Gn; ABBFA_003536.
DR   EnsemblGenomes-Gn; ABBFA_003537.
DR   EnsemblGenomes-Gn; ABBFA_003538.
DR   EnsemblGenomes-Gn; ABBFA_003539.
DR   EnsemblGenomes-Gn; ABBFA_003540.
DR   EnsemblGenomes-Gn; ABBFA_003541.
DR   EnsemblGenomes-Gn; ABBFA_003542.
DR   EnsemblGenomes-Gn; ABBFA_003543.
DR   EnsemblGenomes-Gn; ABBFA_003544.
DR   EnsemblGenomes-Gn; ABBFA_003545.
DR   EnsemblGenomes-Gn; ABBFA_003546.
DR   EnsemblGenomes-Gn; ABBFA_003547.
DR   EnsemblGenomes-Gn; ABBFA_003548.
DR   EnsemblGenomes-Gn; ABBFA_003549.
DR   EnsemblGenomes-Gn; EBG00001199633.
DR   EnsemblGenomes-Gn; EBG00001199634.
DR   EnsemblGenomes-Gn; EBG00001199635.
DR   EnsemblGenomes-Gn; EBG00001199636.
DR   EnsemblGenomes-Gn; EBG00001199637.
DR   EnsemblGenomes-Gn; EBG00001199638.
DR   EnsemblGenomes-Gn; EBG00001199639.
DR   EnsemblGenomes-Gn; EBG00001199640.
DR   EnsemblGenomes-Gn; EBG00001199641.
DR   EnsemblGenomes-Gn; EBG00001199642.
DR   EnsemblGenomes-Gn; EBG00001199643.
DR   EnsemblGenomes-Gn; EBG00001199644.
DR   EnsemblGenomes-Gn; EBG00001199645.
DR   EnsemblGenomes-Gn; EBG00001199646.
DR   EnsemblGenomes-Gn; EBG00001199647.
DR   EnsemblGenomes-Gn; EBG00001199648.
DR   EnsemblGenomes-Gn; EBG00001199649.
DR   EnsemblGenomes-Gn; EBG00001199650.
DR   EnsemblGenomes-Gn; EBG00001199651.
DR   EnsemblGenomes-Gn; EBG00001199652.
DR   EnsemblGenomes-Gn; EBG00001199653.
DR   EnsemblGenomes-Gn; EBG00001199654.
DR   EnsemblGenomes-Gn; EBG00001199655.
DR   EnsemblGenomes-Gn; EBG00001199656.
DR   EnsemblGenomes-Gn; EBG00001199657.
DR   EnsemblGenomes-Gn; EBG00001199658.
DR   EnsemblGenomes-Gn; EBG00001199659.
DR   EnsemblGenomes-Gn; EBG00001199660.
DR   EnsemblGenomes-Gn; EBG00001199661.
DR   EnsemblGenomes-Gn; EBG00001199662.
DR   EnsemblGenomes-Gn; EBG00001199663.
DR   EnsemblGenomes-Gn; EBG00001199664.
DR   EnsemblGenomes-Gn; EBG00001199665.
DR   EnsemblGenomes-Gn; EBG00001199666.
DR   EnsemblGenomes-Gn; EBG00001199667.
DR   EnsemblGenomes-Gn; EBG00001199668.
DR   EnsemblGenomes-Gn; EBG00001199669.
DR   EnsemblGenomes-Gn; EBG00001199670.
DR   EnsemblGenomes-Gn; EBG00001199671.
DR   EnsemblGenomes-Gn; EBG00001199672.
DR   EnsemblGenomes-Gn; EBG00001199673.
DR   EnsemblGenomes-Gn; EBG00001199674.
DR   EnsemblGenomes-Gn; EBG00001199675.
DR   EnsemblGenomes-Gn; EBG00001199676.
DR   EnsemblGenomes-Gn; EBG00001199677.
DR   EnsemblGenomes-Gn; EBG00001199678.
DR   EnsemblGenomes-Gn; EBG00001199679.
DR   EnsemblGenomes-Gn; EBG00001199680.
DR   EnsemblGenomes-Gn; EBG00001199681.
DR   EnsemblGenomes-Gn; EBG00001199682.
DR   EnsemblGenomes-Gn; EBG00001199683.
DR   EnsemblGenomes-Gn; EBG00001199684.
DR   EnsemblGenomes-Gn; EBG00001199685.
DR   EnsemblGenomes-Gn; EBG00001199686.
DR   EnsemblGenomes-Gn; EBG00001199687.
DR   EnsemblGenomes-Gn; EBG00001199688.
DR   EnsemblGenomes-Gn; EBG00001199689.
DR   EnsemblGenomes-Gn; EBG00001199690.
DR   EnsemblGenomes-Gn; EBG00001199691.
DR   EnsemblGenomes-Gn; EBG00001199692.
DR   EnsemblGenomes-Gn; EBG00001199693.
DR   EnsemblGenomes-Gn; EBG00001199694.
DR   EnsemblGenomes-Gn; EBG00001199695.
DR   EnsemblGenomes-Gn; EBG00001199696.
DR   EnsemblGenomes-Gn; EBG00001199697.
DR   EnsemblGenomes-Gn; EBG00001199698.
DR   EnsemblGenomes-Gn; EBG00001199699.
DR   EnsemblGenomes-Gn; EBG00001199700.
DR   EnsemblGenomes-Gn; EBG00001199701.
DR   EnsemblGenomes-Gn; EBG00001199702.
DR   EnsemblGenomes-Gn; EBG00001199703.
DR   EnsemblGenomes-Gn; EBG00001199704.
DR   EnsemblGenomes-Gn; EBG00001199705.
DR   EnsemblGenomes-Gn; EBG00001199706.
DR   EnsemblGenomes-Gn; EBG00001199707.
DR   EnsemblGenomes-Gn; EBG00001199708.
DR   EnsemblGenomes-Gn; EBG00001199709.
DR   EnsemblGenomes-Gn; EBG00001199710.
DR   EnsemblGenomes-Gn; EBG00001199711.
DR   EnsemblGenomes-Gn; EBG00001199712.
DR   EnsemblGenomes-Gn; EBG00001199713.
DR   EnsemblGenomes-Gn; EBG00001199714.
DR   EnsemblGenomes-Gn; EBG00001199715.
DR   EnsemblGenomes-Gn; EBG00001199716.
DR   EnsemblGenomes-Gn; EBG00001199717.
DR   EnsemblGenomes-Gn; EBG00001199718.
DR   EnsemblGenomes-Gn; EBG00001199719.
DR   EnsemblGenomes-Gn; EBG00001199720.
DR   EnsemblGenomes-Gn; EBG00001199721.
DR   EnsemblGenomes-Gn; EBG00001199722.
DR   EnsemblGenomes-Gn; EBG00001199723.
DR   EnsemblGenomes-Gn; EBG00001199724.
DR   EnsemblGenomes-Gn; EBG00001199725.
DR   EnsemblGenomes-Gn; EBG00001199726.
DR   EnsemblGenomes-Gn; EBG00001199727.
DR   EnsemblGenomes-Gn; EBG00001199728.
DR   EnsemblGenomes-Gn; EBG00001199729.
DR   EnsemblGenomes-Gn; EBG00001199730.
DR   EnsemblGenomes-Gn; EBG00001199731.
DR   EnsemblGenomes-Gn; EBG00001199732.
DR   EnsemblGenomes-Gn; EBG00001199733.
DR   EnsemblGenomes-Gn; EBG00001199734.
DR   EnsemblGenomes-Gn; EBG00001199735.
DR   EnsemblGenomes-Gn; EBG00001199736.
DR   EnsemblGenomes-Gn; EBG00001199737.
DR   EnsemblGenomes-Gn; EBG00001199738.
DR   EnsemblGenomes-Gn; EBG00001199739.
DR   EnsemblGenomes-Gn; EBG00001199740.
DR   EnsemblGenomes-Gn; EBG00001199741.
DR   EnsemblGenomes-Gn; EBG00001199742.
DR   EnsemblGenomes-Gn; EBG00001199743.
DR   EnsemblGenomes-Gn; EBG00001199744.
DR   EnsemblGenomes-Gn; EBG00001199745.
DR   EnsemblGenomes-Gn; EBG00001199746.
DR   EnsemblGenomes-Gn; EBG00001199747.
DR   EnsemblGenomes-Gn; EBG00001199748.
DR   EnsemblGenomes-Gn; EBG00001199749.
DR   EnsemblGenomes-Gn; EBG00001199750.
DR   EnsemblGenomes-Gn; EBG00001199751.
DR   EnsemblGenomes-Gn; EBG00001199752.
DR   EnsemblGenomes-Gn; EBG00001199753.
DR   EnsemblGenomes-Gn; EBG00001199754.
DR   EnsemblGenomes-Gn; EBG00001199755.
DR   EnsemblGenomes-Gn; EBG00001199756.
DR   EnsemblGenomes-Gn; EBG00001199757.
DR   EnsemblGenomes-Gn; EBG00001199758.
DR   EnsemblGenomes-Tr; ABBFA_000016-1.
DR   EnsemblGenomes-Tr; ABBFA_000017-1.
DR   EnsemblGenomes-Tr; ABBFA_000242-1.
DR   EnsemblGenomes-Tr; ABBFA_000259-1.
DR   EnsemblGenomes-Tr; ABBFA_000281-1.
DR   EnsemblGenomes-Tr; ABBFA_000282-1.
DR   EnsemblGenomes-Tr; ABBFA_000302-1.
DR   EnsemblGenomes-Tr; ABBFA_000303-1.
DR   EnsemblGenomes-Tr; ABBFA_000306-1.
DR   EnsemblGenomes-Tr; ABBFA_000307-1.
DR   EnsemblGenomes-Tr; ABBFA_000470-1.
DR   EnsemblGenomes-Tr; ABBFA_000471-1.
DR   EnsemblGenomes-Tr; ABBFA_000472-1.
DR   EnsemblGenomes-Tr; ABBFA_000475-1.
DR   EnsemblGenomes-Tr; ABBFA_000499-1.
DR   EnsemblGenomes-Tr; ABBFA_000500-1.
DR   EnsemblGenomes-Tr; ABBFA_000528-1.
DR   EnsemblGenomes-Tr; ABBFA_000529-1.
DR   EnsemblGenomes-Tr; ABBFA_000554-1.
DR   EnsemblGenomes-Tr; ABBFA_000660-1.
DR   EnsemblGenomes-Tr; ABBFA_000661-1.
DR   EnsemblGenomes-Tr; ABBFA_000662-1.
DR   EnsemblGenomes-Tr; ABBFA_000663-1.
DR   EnsemblGenomes-Tr; ABBFA_000664-1.
DR   EnsemblGenomes-Tr; ABBFA_000665-1.
DR   EnsemblGenomes-Tr; ABBFA_000704-1.
DR   EnsemblGenomes-Tr; ABBFA_000796-1.
DR   EnsemblGenomes-Tr; ABBFA_000798-1.
DR   EnsemblGenomes-Tr; ABBFA_000799-1.
DR   EnsemblGenomes-Tr; ABBFA_000824-1.
DR   EnsemblGenomes-Tr; ABBFA_000933-1.
DR   EnsemblGenomes-Tr; ABBFA_001039-1.
DR   EnsemblGenomes-Tr; ABBFA_001096-1.
DR   EnsemblGenomes-Tr; ABBFA_001097-1.
DR   EnsemblGenomes-Tr; ABBFA_001098-1.
DR   EnsemblGenomes-Tr; ABBFA_001131-1.
DR   EnsemblGenomes-Tr; ABBFA_001201-1.
DR   EnsemblGenomes-Tr; ABBFA_001202-1.
DR   EnsemblGenomes-Tr; ABBFA_001203-1.
DR   EnsemblGenomes-Tr; ABBFA_001204-1.
DR   EnsemblGenomes-Tr; ABBFA_001985-1.
DR   EnsemblGenomes-Tr; ABBFA_002310-1.
DR   EnsemblGenomes-Tr; ABBFA_002352-1.
DR   EnsemblGenomes-Tr; ABBFA_002474-1.
DR   EnsemblGenomes-Tr; ABBFA_002480-1.
DR   EnsemblGenomes-Tr; ABBFA_002757-1.
DR   EnsemblGenomes-Tr; ABBFA_002766-1.
DR   EnsemblGenomes-Tr; ABBFA_002779-1.
DR   EnsemblGenomes-Tr; ABBFA_002780-1.
DR   EnsemblGenomes-Tr; ABBFA_002781-1.
DR   EnsemblGenomes-Tr; ABBFA_002782-1.
DR   EnsemblGenomes-Tr; ABBFA_002900-1.
DR   EnsemblGenomes-Tr; ABBFA_002901-1.
DR   EnsemblGenomes-Tr; ABBFA_002902-1.
DR   EnsemblGenomes-Tr; ABBFA_002903-1.
DR   EnsemblGenomes-Tr; ABBFA_002936-1.
DR   EnsemblGenomes-Tr; ABBFA_002937-1.
DR   EnsemblGenomes-Tr; ABBFA_003137-1.
DR   EnsemblGenomes-Tr; ABBFA_003138-1.
DR   EnsemblGenomes-Tr; ABBFA_003202-1.
DR   EnsemblGenomes-Tr; ABBFA_003203-1.
DR   EnsemblGenomes-Tr; ABBFA_003204-1.
DR   EnsemblGenomes-Tr; ABBFA_003255-1.
DR   EnsemblGenomes-Tr; ABBFA_003257-1.
DR   EnsemblGenomes-Tr; ABBFA_003258-1.
DR   EnsemblGenomes-Tr; ABBFA_003259-1.
DR   EnsemblGenomes-Tr; ABBFA_003260-1.
DR   EnsemblGenomes-Tr; ABBFA_003347-1.
DR   EnsemblGenomes-Tr; ABBFA_003348-1.
DR   EnsemblGenomes-Tr; ABBFA_003397-1.
DR   EnsemblGenomes-Tr; ABBFA_003398-1.
DR   EnsemblGenomes-Tr; ABBFA_003496-1.
DR   EnsemblGenomes-Tr; ABBFA_003497-1.
DR   EnsemblGenomes-Tr; ABBFA_003532-1.
DR   EnsemblGenomes-Tr; ABBFA_003533-1.
DR   EnsemblGenomes-Tr; ABBFA_003534-1.
DR   EnsemblGenomes-Tr; ABBFA_003535-1.
DR   EnsemblGenomes-Tr; ABBFA_003536-1.
DR   EnsemblGenomes-Tr; ABBFA_003537-1.
DR   EnsemblGenomes-Tr; ABBFA_003538-1.
DR   EnsemblGenomes-Tr; ABBFA_003539-1.
DR   EnsemblGenomes-Tr; ABBFA_003540-1.
DR   EnsemblGenomes-Tr; ABBFA_003541-1.
DR   EnsemblGenomes-Tr; ABBFA_003542-1.
DR   EnsemblGenomes-Tr; ABBFA_003543-1.
DR   EnsemblGenomes-Tr; ABBFA_003544-1.
DR   EnsemblGenomes-Tr; ABBFA_003545-1.
DR   EnsemblGenomes-Tr; ABBFA_003546-1.
DR   EnsemblGenomes-Tr; ABBFA_003547-1.
DR   EnsemblGenomes-Tr; ABBFA_003548-1.
DR   EnsemblGenomes-Tr; ABBFA_003549-1.
DR   EnsemblGenomes-Tr; EBT00001570687.
DR   EnsemblGenomes-Tr; EBT00001570688.
DR   EnsemblGenomes-Tr; EBT00001570689.
DR   EnsemblGenomes-Tr; EBT00001570690.
DR   EnsemblGenomes-Tr; EBT00001570691.
DR   EnsemblGenomes-Tr; EBT00001570692.
DR   EnsemblGenomes-Tr; EBT00001570693.
DR   EnsemblGenomes-Tr; EBT00001570694.
DR   EnsemblGenomes-Tr; EBT00001570695.
DR   EnsemblGenomes-Tr; EBT00001570696.
DR   EnsemblGenomes-Tr; EBT00001570697.
DR   EnsemblGenomes-Tr; EBT00001570698.
DR   EnsemblGenomes-Tr; EBT00001570699.
DR   EnsemblGenomes-Tr; EBT00001570700.
DR   EnsemblGenomes-Tr; EBT00001570701.
DR   EnsemblGenomes-Tr; EBT00001570702.
DR   EnsemblGenomes-Tr; EBT00001570703.
DR   EnsemblGenomes-Tr; EBT00001570704.
DR   EnsemblGenomes-Tr; EBT00001570705.
DR   EnsemblGenomes-Tr; EBT00001570706.
DR   EnsemblGenomes-Tr; EBT00001570707.
DR   EnsemblGenomes-Tr; EBT00001570708.
DR   EnsemblGenomes-Tr; EBT00001570709.
DR   EnsemblGenomes-Tr; EBT00001570710.
DR   EnsemblGenomes-Tr; EBT00001570711.
DR   EnsemblGenomes-Tr; EBT00001570712.
DR   EnsemblGenomes-Tr; EBT00001570713.
DR   EnsemblGenomes-Tr; EBT00001570714.
DR   EnsemblGenomes-Tr; EBT00001570715.
DR   EnsemblGenomes-Tr; EBT00001570716.
DR   EnsemblGenomes-Tr; EBT00001570717.
DR   EnsemblGenomes-Tr; EBT00001570718.
DR   EnsemblGenomes-Tr; EBT00001570719.
DR   EnsemblGenomes-Tr; EBT00001570720.
DR   EnsemblGenomes-Tr; EBT00001570721.
DR   EnsemblGenomes-Tr; EBT00001570722.
DR   EnsemblGenomes-Tr; EBT00001570723.
DR   EnsemblGenomes-Tr; EBT00001570724.
DR   EnsemblGenomes-Tr; EBT00001570725.
DR   EnsemblGenomes-Tr; EBT00001570726.
DR   EnsemblGenomes-Tr; EBT00001570727.
DR   EnsemblGenomes-Tr; EBT00001570728.
DR   EnsemblGenomes-Tr; EBT00001570729.
DR   EnsemblGenomes-Tr; EBT00001570730.
DR   EnsemblGenomes-Tr; EBT00001570731.
DR   EnsemblGenomes-Tr; EBT00001570732.
DR   EnsemblGenomes-Tr; EBT00001570733.
DR   EnsemblGenomes-Tr; EBT00001570734.
DR   EnsemblGenomes-Tr; EBT00001570735.
DR   EnsemblGenomes-Tr; EBT00001570736.
DR   EnsemblGenomes-Tr; EBT00001570737.
DR   EnsemblGenomes-Tr; EBT00001570738.
DR   EnsemblGenomes-Tr; EBT00001570739.
DR   EnsemblGenomes-Tr; EBT00001570740.
DR   EnsemblGenomes-Tr; EBT00001570741.
DR   EnsemblGenomes-Tr; EBT00001570742.
DR   EnsemblGenomes-Tr; EBT00001570743.
DR   EnsemblGenomes-Tr; EBT00001570744.
DR   EnsemblGenomes-Tr; EBT00001570745.
DR   EnsemblGenomes-Tr; EBT00001570746.
DR   EnsemblGenomes-Tr; EBT00001570747.
DR   EnsemblGenomes-Tr; EBT00001570748.
DR   EnsemblGenomes-Tr; EBT00001570749.
DR   EnsemblGenomes-Tr; EBT00001570750.
DR   EnsemblGenomes-Tr; EBT00001570751.
DR   EnsemblGenomes-Tr; EBT00001570752.
DR   EnsemblGenomes-Tr; EBT00001570753.
DR   EnsemblGenomes-Tr; EBT00001570754.
DR   EnsemblGenomes-Tr; EBT00001570755.
DR   EnsemblGenomes-Tr; EBT00001570756.
DR   EnsemblGenomes-Tr; EBT00001570757.
DR   EnsemblGenomes-Tr; EBT00001570758.
DR   EnsemblGenomes-Tr; EBT00001570759.
DR   EnsemblGenomes-Tr; EBT00001570760.
DR   EnsemblGenomes-Tr; EBT00001570761.
DR   EnsemblGenomes-Tr; EBT00001570762.
DR   EnsemblGenomes-Tr; EBT00001570763.
DR   EnsemblGenomes-Tr; EBT00001570764.
DR   EnsemblGenomes-Tr; EBT00001570765.
DR   EnsemblGenomes-Tr; EBT00001570766.
DR   EnsemblGenomes-Tr; EBT00001570767.
DR   EnsemblGenomes-Tr; EBT00001570768.
DR   EnsemblGenomes-Tr; EBT00001570769.
DR   EnsemblGenomes-Tr; EBT00001570770.
DR   EnsemblGenomes-Tr; EBT00001570771.
DR   EnsemblGenomes-Tr; EBT00001570772.
DR   EnsemblGenomes-Tr; EBT00001570773.
DR   EnsemblGenomes-Tr; EBT00001570774.
DR   EnsemblGenomes-Tr; EBT00001570775.
DR   EnsemblGenomes-Tr; EBT00001570776.
DR   EnsemblGenomes-Tr; EBT00001570777.
DR   EnsemblGenomes-Tr; EBT00001570778.
DR   EnsemblGenomes-Tr; EBT00001570779.
DR   EnsemblGenomes-Tr; EBT00001570780.
DR   EnsemblGenomes-Tr; EBT00001570781.
DR   EnsemblGenomes-Tr; EBT00001570782.
DR   EnsemblGenomes-Tr; EBT00001570783.
DR   EnsemblGenomes-Tr; EBT00001570784.
DR   EnsemblGenomes-Tr; EBT00001570785.
DR   EnsemblGenomes-Tr; EBT00001570786.
DR   EnsemblGenomes-Tr; EBT00001570787.
DR   EnsemblGenomes-Tr; EBT00001570788.
DR   EnsemblGenomes-Tr; EBT00001570789.
DR   EnsemblGenomes-Tr; EBT00001570790.
DR   EnsemblGenomes-Tr; EBT00001570791.
DR   EnsemblGenomes-Tr; EBT00001570792.
DR   EnsemblGenomes-Tr; EBT00001570793.
DR   EnsemblGenomes-Tr; EBT00001570794.
DR   EnsemblGenomes-Tr; EBT00001570795.
DR   EnsemblGenomes-Tr; EBT00001570796.
DR   EnsemblGenomes-Tr; EBT00001570797.
DR   EnsemblGenomes-Tr; EBT00001570798.
DR   EnsemblGenomes-Tr; EBT00001570799.
DR   EnsemblGenomes-Tr; EBT00001570800.
DR   EnsemblGenomes-Tr; EBT00001570801.
DR   EnsemblGenomes-Tr; EBT00001570802.
DR   EnsemblGenomes-Tr; EBT00001570803.
DR   EnsemblGenomes-Tr; EBT00001570804.
DR   EnsemblGenomes-Tr; EBT00001570805.
DR   EnsemblGenomes-Tr; EBT00001570806.
DR   EnsemblGenomes-Tr; EBT00001570807.
DR   EnsemblGenomes-Tr; EBT00001570808.
DR   EnsemblGenomes-Tr; EBT00001570809.
DR   EnsemblGenomes-Tr; EBT00001570810.
DR   EnsemblGenomes-Tr; EBT00001570811.
DR   EnsemblGenomes-Tr; EBT00001570812.
DR   EuropePMC; PMC2593238; 18931120.
DR   EuropePMC; PMC2863528; 20194587.
DR   EuropePMC; PMC2937447; 20643860.
DR   EuropePMC; PMC2976157; 20713680.
DR   EuropePMC; PMC3043498; 21147956.
DR   EuropePMC; PMC3067174; 21282446.
DR   EuropePMC; PMC3165691; 21764928.
DR   EuropePMC; PMC3187012; 21788470.
DR   EuropePMC; PMC3428692; 22911967.
DR   EuropePMC; PMC3440325; 22984530.
DR   EuropePMC; PMC3691203; 23826102.
DR   EuropePMC; PMC3699609; 23843955.
DR   EuropePMC; PMC4089545; 25005102.
DR   EuropePMC; PMC4136133; 24899031.
DR   EuropePMC; PMC4367897; 25534766.
DR   EuropePMC; PMC4700137; 26779129.
DR   EuropePMC; PMC4862468; 26953198.
DR   EuropePMC; PMC5320584; 28348844.
DR   EuropePMC; PMC5472653; 28670571.
DR   EuropePMC; PMC5711439; 28436748.
DR   EuropePMC; PMC5923157; 29463529.
DR   EuropePMC; PMC6333632; 30687280.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00127; t44.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00442; ykkC-yxkD.
DR   RFAM; RF00504; Glycine.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01695; C4.
DR   RFAM; RF01734; crcB.
DR   RFAM; RF01766; cspA.
DR   RFAM; RF01854; Bacteria_large_SRP.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   SILVA-LSU; CP001172.
DR   SILVA-SSU; CP001172.
XX
CC   On or before Jan 14, 2019 this sequence version replaced
CC   CP024911.1, CP001172.1.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3759495
FT                   /organism="Acinetobacter baumannii AB307-0294"
FT                   /strain="AB307-0294"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:557600"
FT   gene            95..1492
FT                   /gene="dnaA"
FT                   /locus_tag="ABBFA_00001"
FT                   /old_locus_tag="CTY05_00001"
FT   CDS_pept        95..1492
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaA"
FT                   /locus_tag="ABBFA_00001"
FT                   /old_locus_tag="CTY05_00001"
FT                   /product="Chromosomal replication initiator protein DnaA"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:P03004"
FT                   /protein_id="ATY42477.1"
FT                   /translation="MLWTDCLTRLRQELSDNVFAMWIRPLVAEEVEGILRLYAPNPYWT
FT                   RYIQENHLELISILAEQLSEGRVRQVEILVDSRPGSILSSSEQPATTTAALQTAPIPQP
FT                   AKVKREPEPVANTAVSSKSSKKKLLNPQFTFSLFVEGRSNQMAAETCRKVLTQLGASQH
FT                   NPLFLYGPTGLGKTHLMQAVGNALLQAKPNARVMYMTSESFVQDFVSSLQKGKVEEFKK
FT                   NCRSLDLLLVDDIHLLAGKEASLVEFFYTFNALLDESKQIILTSDRYPKELTELDPRLV
FT                   SRFSWGLSVGVEPPDIETRIEILLKKAENSGVDLPRNCALFIAQQVVANVRELEGALNK
FT                   VVAISRFKGAPIDLDVVRESLKDVLAIRARTISVENIQRVVSEYFRIPLKELVGPKRTR
FT                   IYARPRQLAMGLARELTGDSFPEIGMAFGGRDHSTVMHACEKVVSLREEDPIFDEDYKN
FT                   LLRLLQS"
FT   gene            1590..2738
FT                   /gene="dnaN"
FT                   /locus_tag="ABBFA_00002"
FT                   /old_locus_tag="CTY05_00002"
FT   CDS_pept        1590..2738
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaN"
FT                   /locus_tag="ABBFA_00002"
FT                   /old_locus_tag="CTY05_00002"
FT                   /product="DNA polymerase III subunit beta"
FT                   /EC_number="2.7.7.7"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:P0A988"
FT                   /protein_id="ATY42478.1"
FT                   /translation="MRLKIAKESLLNVLSHVVGAVERRHTLNILSNVKIQTNAQALTIT
FT                   GSDLEVELVASTALSEGACLEAGETTVPARKLMEICKSLPTAALIDLQITEDQRCILKS
FT                   GNSRFVLGTLPAEDYPLLTTENSQGTQVQVTQRELKRLFEKTAFAMAVQDVRFYLTGTL
FT                   LEIDENQLRAVTTDGHRLALCEILASSTSSQLVQAIVPRKAVGELQRLLSIEDEQLTLL
FT                   IGRELLNVTINTPSRDKEQGDITVRFTTKLIDGKFPDYRRVIPRGGDKHVLIGHDVFKQ
FT                   SLQRVAILSNEKLRGVFLNFNQDSLQLRANNPEQDEAIEDLAIQYQSAPLEMSFNAQYL
FT                   LDVLGVLDGDDVNMSMTEANQSVLVQDPAHPDQTYVVMPMRV"
FT   gene            2753..3835
FT                   /gene="recF_1"
FT                   /locus_tag="ABBFA_00003"
FT                   /old_locus_tag="CTY05_00003"
FT   CDS_pept        2753..3835
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recF_1"
FT                   /locus_tag="ABBFA_00003"
FT                   /old_locus_tag="CTY05_00003"
FT                   /product="DNA replication and repair protein RecF"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:P0A7H0"
FT                   /protein_id="ATY42479.1"
FT                   /translation="MHLTRLNIERVRNLKTVALHGLQPFNVFYGANGSGKTSILEAIHL
FT                   LATGRSFRTHIPKNYIQYEADDAIVFAQSATEKIGMQKLASGEQLMKVNGDTVATQGQL
FT                   AKLLPLQHIDPQSTDIIDHGAKPRRQLLDWLMFHVEPEFYFAWQYYSRALKQRNTLLKT
FT                   RRNLSLADLEPWNKMLSDYGEILHSQRLSIVEQWNVYFQNDLSQLLPDLEIELEYSPGF
FT                   HTEQGLMQDLLNQHQKDIERRYTEYGPHRADLRLKTPFGHADDVLSRGQKKLLIIALKL
FT                   SQIAMLHASNKETVVLLDDLTAELDLTAQQRLIERLSQLGSQVFMTTLDHASVKKHLHD
FT                   LSISYQLFSVESGQVSLAAP"
FT   gene            3888..6356
FT                   /gene="gyrB"
FT                   /locus_tag="ABBFA_00004"
FT                   /old_locus_tag="CTY05_00004"
FT   CDS_pept        3888..6356
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gyrB"
FT                   /locus_tag="ABBFA_00004"
FT                   /old_locus_tag="CTY05_00004"
FT                   /product="GyrB"
FT                   /EC_number="5.6.2.2"
FT                   /note="DNA gyrase subunit B"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:P0AES6"
FT                   /protein_id="ATY42480.1"
FT                   /translation="MSSESQSASQTEQTNEKAYDSSSIKVLRGLDAVRKRPGMYIGDTD
FT                   DGTGLHHMVFEVVDNAIDEALAGHCDEIIVTIHEDESVSVSDNGRGIPTDIHPEEGVSA
FT                   AEVILTILHAGGKFDDNSYKVSGGLHGVGVSVVNALSSKLHLTIYRAGQIHEQEYHHGD
FT                   PQYPLRVIGETDNTGTTVRFWPSAETFSQTIFNVEILARRLRELSFLNAGVRIVLRDER
FT                   INLEHVYDYEGGLSEFVKYINEGKNHLNEIFHFTADADNGIAVEVALQWNDSYQENVRC
FT                   FTNNIPQKDGGTHLAGFRAALTRGLNQYLENENILKKEKVNVTGDDAREGLTAIISVKV
FT                   PDPKFSSQTKEKLVSSEVKPAVEQAMNKEFSAYLLENPQAAKSIAGKIIDAARARDAAR
FT                   KAREMTRRKSALDIAGLPGKLADCQEKDPALSELYLVEGDSAGGSAKQGRNRKMQAILP
FT                   LKGKILNVERARFDKMISSQEVGTLITALGCGIGREEYNPDKLRYHKIIIMTDADVDGS
FT                   HIRTLLLTFFFRQMPELVERGHIYIAQPPLYKLKKGKQEQYIKDNDALETYLISNAIDE
FT                   LALHISADAPAITGEALAKVIQDYQVSQKSLQRLTLRYPASLLDALLEVDAFKADQNHD
FT                   QAYVQQWAYQVREAVQRLQPSLRPEITLETFERENAQGEKSAHYWPRVTVYVHNLPHAY
FT                   LLDAGLLNSAEYARLLKNSKSWFKLIEDGAYLQKGDRRIQVANFHQVWQHILQDSRRGM
FT                   MIQRYKGLGEMNAEQLWETTMDPENRNMLQVTIDDAIEADRMFSCLMGDDVEPRRAFIE
FT                   ENALNADIDA"
FT   gene            6394..6786
FT                   /gene="cybC"
FT                   /locus_tag="ABBFA_00005"
FT                   /old_locus_tag="CTY05_00005"
FT   CDS_pept        6394..6786
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cybC"
FT                   /locus_tag="ABBFA_00005"
FT                   /old_locus_tag="CTY05_00005"
FT                   /product="Soluble cytochrome b562 precursor"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:P0ABE7"
FT                   /protein_id="ATY42481.1"
FT                   /translation="MMSQKILASMLISCAALVSHSAFAADLEADMKTLAKSTKAFAEAK
FT                   DIDNAKQQLVIMRQAALSSKLSLPHKLEGLPPENVQVKEYQAGLDQLVAEIDRVTVFVD
FT                   KGQLDQAKTEAINLVNIRNENHKKFR"
FT   gene            complement(6870..7427)
FT                   /gene="yqjA_1"
FT                   /locus_tag="ABBFA_00006"
FT                   /old_locus_tag="CTY05_00006"
FT   CDS_pept        complement(6870..7427)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yqjA_1"
FT                   /locus_tag="ABBFA_00006"
FT                   /old_locus_tag="CTY05_00006"
FT                   /product="Inner membrane protein YqjA"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:P0AA63"
FT                   /protein_id="ATY42482.1"
FT                   /translation="MNFIDFITNFEQFLPILIQEYGAWVYAILFLIIFSETAFVFMFFL
FT                   PGDSLLLTVGALCSVVELMHLGYMITLLTVAATLGYIVNYSIGRHFGNRIFEAKSRFIK
FT                   KEYLNKTNRYFLQHGGKTILLARFIPFARSFAPLAAGSSNMSYGKFLIYNVAGAILWIC
FT                   ILLTAGYLFGHALIQVTDFVEN"
FT   gene            complement(7678..9609)
FT                   /gene="yheS_1"
FT                   /locus_tag="ABBFA_00007"
FT                   /old_locus_tag="CTY05_00007"
FT   CDS_pept        complement(7678..9609)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yheS_1"
FT                   /locus_tag="ABBFA_00007"
FT                   /old_locus_tag="CTY05_00007"
FT                   /product="putative ABC transporter ATP-binding protein
FT                   YheS"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:P63389"
FT                   /protein_id="ATY42483.1"
FT                   /translation="MIQFDQVSLRRGGRVLFQKASMQLHPGWKIGLTGVNGAGKSTLFA
FT                   ALLGSLGADEGSLTRPSVWTVAHMAQEVKALDMPAIDFVLSGDEEYWDIQNKLAQPEQL
FT                   TDSDLAKLHGRFDEIHGYSAPSKAAQLMAGLGFLEHQLRLNVASFSGGWRMRLNLARTL
FT                   MSRSDLLLLDEPTNHLDLDAILWLEDWLKAYEGTLILISHDRDFLDAITDHILHIENQE
FT                   LTLYTGNYSTFETTRSERLAQQQQAFEKQQEARAHLQKFIDRFKAKATKARQAQSRIKQ
FT                   LERMQQLAPAHVDTPFTFSFREPTKMSSPLLTLENASIGYGDKKIAEKIKLQITPNSRI
FT                   GLLGMNGAGKSTLIKSLVGDLPLLAGERKASELLNIGYFAQHQMDALDGQASPMLQLAR
FT                   IADKQISEATLRSFLGSFGFSGERMDTPCESFSGGERARLALALIVWQRPNVLILDEPT
FT                   NHLDLDMRHALSMALQDFEGAVVLVSHERQLIASVCDELLLVHGGKCTEFEGDLQDYAK
FT                   WLREARQQQINAQTAIEQNNSSSAAPAPAKVDKEAQRKEAARRREQTRPIRKNIEKVES
FT                   QIEKLQPRLAEIEEALADTSLYEANRKDDLLKLMNEQTELKAKLEQYEEQLLELMMELE
FT                   EMEASFEN"
FT   gene            9866..10870
FT                   /locus_tag="ABBFA_00008"
FT                   /old_locus_tag="CTY05_00008"
FT   CDS_pept        9866..10870
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABBFA_00008"
FT                   /old_locus_tag="CTY05_00008"
FT                   /product="hypothetical protein"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /protein_id="ATY42484.1"
FT                   /translation="MKKRLGIVSAVICCAMGTTHAGQNVCVFDLLGKSGESYKMMEEWA
FT                   LAAKSWQADITLIPFQDEALVDRRLREGKCDAAYMTSMRARNYNKFAGSIDAIGGVTSN
FT                   AIAQKAISYVLDQRNKHRMLTTQNGTNYEVVGIVQIGLAYLFVRDRNLNSIEKVRGTKF
FT                   AILQYDAAQKIMVESVGAQPIPSEITDFVKKFNSGQVEAIAAPAYAYKPLEIGKGIGAN
FT                   GAMFTFPVVNVTGDLIARSDKFPANFGMKSREWFIKQLPQNFAMVKRLETGIPPKIKLN
FT                   FSAEDKLKYQKILREGRLGLTKQGVYDATMMSVLKRARCTIERTNFECTLTGE"
FT   gene            11126..12133
FT                   /locus_tag="ABBFA_00009"
FT                   /old_locus_tag="CTY05_00009"
FT   CDS_pept        11126..12133
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABBFA_00009"
FT                   /old_locus_tag="CTY05_00009"
FT                   /product="hypothetical protein"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /protein_id="ATY42485.1"
FT                   /translation="MKKIVLAMAAASVVGFSASAQAASTVCVFDLLGKAGDSYKMMEEW
FT                   ALAAKGWGTEINLVPRQDEAVADNDFKAGKCDAVAMTAMRARQYNKFAGSIDSLGGVPN
FT                   NQIAQRAITYVLDARNAAKMTTNLGGKKYEVAGISPLGSAFIFVRDKNINSVEKAAGKK
FT                   FAVLGYDDAQKIMVQRVGAQAVLSDISNFAAKFNNGQVDMVGAPAYAYKPLELNKGLGA
FT                   NGVMWNFPVLHVTADLVLRADKFPAGFGQKSRDWFVKQLPKSFAMINRLEAQIPGKYKM
FT                   NLSAEDKLKYQKMLRDGRMDLTKRGIYDAGMMSVLKKARCSVDKANFECSMPGE"
FT   gene            12476..13480
FT                   /locus_tag="ABBFA_00010"
FT                   /old_locus_tag="CTY05_00010"
FT   CDS_pept        12476..13480
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABBFA_00010"
FT                   /old_locus_tag="CTY05_00010"
FT                   /product="hypothetical protein"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /protein_id="ATY42486.1"
FT                   /translation="MRFSKTLLLAMGLTTISFAAEAKQTICVFDFVGKNGDVYALMKDY
FT                   QLAAKNWGADIELKVNQNEAVIAEDFKAGKCDGISVSGMRGRQFNSFTGSLDAIGAIPD
FT                   LKLAVKVMQGLASQTFSKYMVNGRYEVVGVIPVGDAYLLVNDRSINTVAKAAGKKIAVL
FT                   DYDEAQKIMVQQVGAQAVSADVTNFGAKFNNHQVDIIGAPAAAFKPLELQKGLGTKGAI
FT                   VNYPILQVTGNIIIRPDKFPAGFGQKSREWVAGQLPRAFTILGKMKADIPQKYWMEVPA
FT                   ADKPGYQKLMRESRINLTKRGVYDKRMMKLLWQFRCKQDAKNFECGLQDENYK"
FT   gene            13605..13940
FT                   /gene="erpA"
FT                   /locus_tag="ABBFA_00011"
FT                   /old_locus_tag="CTY05_00011"
FT   CDS_pept        13605..13940
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="erpA"
FT                   /locus_tag="ABBFA_00011"
FT                   /old_locus_tag="CTY05_00011"
FT                   /product="Iron-sulfur cluster insertion protein ErpA"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:P45344"
FT                   /protein_id="ATY42487.1"
FT                   /translation="MNAQALVLTDNAANKVRQLRDSEGNDDLMLRVYVTGGGCSGFSYG
FT                   FNFAESVNEDDAEFVNGDVKMLVDSLSYQYLVGSVVDYVEGLEGSRFIVQNPNATTTCG
FT                   CGSSFSI"
FT   gene            complement(13998..14843)
FT                   /gene="dehH1"
FT                   /locus_tag="ABBFA_00012"
FT                   /old_locus_tag="CTY05_00012"
FT   CDS_pept        complement(13998..14843)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dehH1"
FT                   /locus_tag="ABBFA_00012"
FT                   /old_locus_tag="CTY05_00012"
FT                   /product="Haloacetate dehalogenase H-1"
FT                   /EC_number="3.8.1.3"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:Q01398"
FT                   /protein_id="ATY42488.1"
FT                   /translation="MDLTKRIHQYTRGAWTFDVIDSGPIDGPLVVLLHGFPETAHSWEQ
FT                   TSELLHEHQFRTLAIHQRGYSLNARPQSRFHYALSELTEDVAVFIKGLGQPVYLIGHDW
FT                   GSVIASSVAMKYPQYIQHLTLVSVPHQAAFLKACLSSNQLLKSYYFAVFQLPILPELLF
FT                   KKMPKAGRKFLKTSGMTEQQIKIFETEFIKENRLTTALNWYRGFFWDKPENPFKTIDVP
FT                   TLFIWGKHDIAVTEKSAKLNSGYFKNNYKAIFMDASHWIPYQNAPELVQYFLESLHEQA
FT                   "
FT   gene            complement(14971..16098)
FT                   /gene="anmK"
FT                   /locus_tag="ABBFA_00013"
FT                   /old_locus_tag="CTY05_00013"
FT   CDS_pept        complement(14971..16098)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="anmK"
FT                   /locus_tag="ABBFA_00013"
FT                   /old_locus_tag="CTY05_00013"
FT                   /product="Anhydro-N-acetylmuramic acid kinase"
FT                   /EC_number="2.7.1.170"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:Q8EHB5"
FT                   /protein_id="ATY42489.1"
FT                   /translation="MSAIYIGVMTGTSMDGVDIVAASFEPLQLHATLTVPFEPELRDEL
FT                   MALTLPDDNEIDRMGKADVALAKMIGHGINSLIEKHQLDRRQIKAIGSHGQTIRHRPEH
FT                   GFTLQIGDPNIITEITHIPVVSDFRRRDMAAGGQGAPLVPAFHQALFQHPSIHRVILNL
FT                   GGIANVSMLPANNPDGVFGFDTGPANILMDAWCHRHTGHPYDENGDWAAYGHPIRSLLD
FT                   RLYAHEYFSKEPPKSTGREDFNIDWLDDQLIDWRNDLTYDELEDTPENIQATLLKLTVR
FT                   AIQKAIYRSNMETGEVYVCGGGAYNSYLLEQLRWRLRKHNWSVQTTDVLGLSPTWVEAT
FT                   AFAWLAMRFVDGLSGNLPAVTGASDFRILGTITAV"
FT   gene            16178..17392
FT                   /gene="tyrS"
FT                   /locus_tag="ABBFA_00014"
FT                   /old_locus_tag="CTY05_00014"
FT   CDS_pept        16178..17392
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tyrS"
FT                   /locus_tag="ABBFA_00014"
FT                   /old_locus_tag="CTY05_00014"
FT                   /product="Tyrosine--tRNA ligase"
FT                   /EC_number="6.1.1.1"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:Q4K517"
FT                   /protein_id="ATY42490.1"
FT                   /translation="MSNFLPAEEQLALIQRGTHEIISEEDLLKKLKENRPLKIKAGFDP
FT                   TAPDLHLGHTVLINKLKTFQDLGHEVTFLIGDYTAMIGDPTGKSATRPPLSREQVEANA
FT                   KTYQEQVFKILDPNKTKVRFNSEWFNQKSAADLIQLASQQTVSRMLERDDFTKRYNNHQ
FT                   PIAIHEFLYPLVQGYDSIALEADVELGGTDQTFNLLMGRTLQSRYGQESQVCITVPILE
FT                   GLDGVNKMSKSLGNYIGVFDAPGAMYQKVLSMPDSLIERYFDLLSFKSLDEIKALLDEI
FT                   AAGRNPQEVKRILALELVERFHDAEAAANAHKSAGNRITEGEVPADTPEVTISRGEFGG
FT                   EIFIATILRVAGLNPNAAAAKDAVARGAVKVDWNVVDASFSVKENGTFIIQSGKKAIAR
FT                   VTFTD"
FT   gene            19909..19985
FT                   /locus_tag="ABBFA_00015"
FT                   /old_locus_tag="CTY05_00015"
FT   tRNA            19909..19985
FT                   /locus_tag="ABBFA_00015"
FT                   /old_locus_tag="CTY05_00015"
FT                   /product="tRNA-Ile"
FT                   /note="tRNA-Ile(gat)"
FT                   /inference="COORDINATES:profile:Aragorn:1.2"
FT   gene            20041..20116
FT                   /locus_tag="ABBFA_00016"
FT                   /old_locus_tag="CTY05_00016"
FT   tRNA            20041..20116
FT                   /locus_tag="ABBFA_00016"
FT                   /old_locus_tag="CTY05_00016"
FT                   /product="tRNA-Ala"
FT                   /note="tRNA-Ala(tgc)"
FT                   /inference="COORDINATES:profile:Aragorn:1.2"
FT   gene            23787..24386
FT                   /gene="yfcG_1"
FT                   /locus_tag="ABBFA_00017"
FT                   /old_locus_tag="CTY05_00017"
FT   CDS_pept        23787..24386
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yfcG_1"
FT                   /locus_tag="ABBFA_00017"
FT                   /old_locus_tag="CTY05_00017"
FT                   /product="Disulfide-bond oxidoreductase YfcG"
FT                   /EC_number="1.8.4.-"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:P77526"
FT                   /protein_id="ATY42491.1"
FT                   /translation="MIIYGDVDSGNCYKIKLLLSLLNINHRWIHVDILNKDTQTAEFLS
FT                   LNPNGKIPVLVLDDGRVLSESNAILGYLAEGTELIPADPYMKAKMYQWMFFEQYSHEPF
FT                   IAVARFINKYLGLPPERIEEYHKLQPKGHKALSIMNKALVGHDYLVGNKFTIADIALYA
FT                   YTHVAEEGGFDLKLYPNIQEWCQRIQKYPKYVSMVE"
FT   gene            complement(24444..25136)
FT                   /locus_tag="ABBFA_00018"
FT                   /old_locus_tag="CTY05_00018"
FT   CDS_pept        complement(24444..25136)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABBFA_00018"
FT                   /old_locus_tag="CTY05_00018"
FT                   /product="hypothetical protein"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /protein_id="ATY42492.1"
FT                   /translation="MKILKLSFLVLGMGLSGFAQADFIGVKGDVGYWFYDGKANMSSQS
FT                   PEDQDLDRKGSAQLSLAFEHPIPFIPNAKIRYVNLDTQTKSETLGQANYNVDLDHSDFI
FT                   LYYELLDNIVSVDAGLGATVLNGDITAYTGKRVDIDKTYPIAYLSGEVKLPFTGLSAKG
FT                   EATYTNFDDAKITDALVEAKYKFADNLLIDLGLTAGYRILNIDLDDYDNNDLKFEFKGP
FT                   YVGLEAHF"
FT   gene            25766..27244
FT                   /locus_tag="ABBFA_00019"
FT                   /old_locus_tag="CTY05_00019"
FT   CDS_pept        25766..27244
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABBFA_00019"
FT                   /old_locus_tag="CTY05_00019"
FT                   /product="Sodium:neurotransmitter symporter family protein"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="protein motif:Pfam:PF00209.12"
FT                   /protein_id="ATY42493.1"
FT                   /translation="MTDTRENWTSRSGFIIAAVGSAVGLGNIWRFPYVAYENGGGAFLI
FT                   PYLLALITAGLPLLFLDYAVGHRSTGSPPKAYRALFKGGETLGWWQVCVCIIIGLYYAS
FT                   VLTWAGSYVYFSIGQMWGSDPEGFFFNTYLQTTKATGFDLQFVGHLFWPIVGIWALTLI
FT                   ILYGGVKKGVELSNKIFMPLLFILFTILVIQSLRLPGAVQGLNAFFTPNWSAMMDYKVW
FT                   LAAYGHTFFSLSVGFGIMVTYASYLKPKTNLTGSGLIVGFANASTEILAGIGIFAALGF
FT                   MAHAAGTEVKDVVSGGIGLAFIAFPKIISSLGSGADLFGLLFFSSLFVAGISSMVSILE
FT                   VPIAAMQDKLKWGRKKAVTIIGGGSALVSIILFSSVNAIKLVDIVDHFINNIGIIGGAL
FT                   LSIISVAWFKRSALKELRDHVNRISTIQLGKGWDFTLTVITSLILLTTLCMTVFNLIKN
FT                   GYDTYSMSLQGVFGWGSVIFCAVVAIVLSKMKDR"
FT   gene            27257..27400
FT                   /locus_tag="ABBFA_00020"
FT                   /old_locus_tag="CTY05_00020"
FT   CDS_pept        27257..27400
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABBFA_00020"
FT                   /old_locus_tag="CTY05_00020"
FT                   /product="hypothetical protein"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /protein_id="ATY42494.1"
FT                   /translation="MNTSAIVMLIISMVFVWGGLALSILHLTKHPEELDEVLEEVKDQH
FT                   TL"
FT   gene            complement(27444..28748)
FT                   /gene="rsmB"
FT                   /locus_tag="ABBFA_00021"
FT                   /old_locus_tag="CTY05_00021"
FT   CDS_pept        complement(27444..28748)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rsmB"
FT                   /locus_tag="ABBFA_00021"
FT                   /old_locus_tag="CTY05_00021"
FT                   /product="Ribosomal RNA small subunit methyltransferase B"
FT                   /EC_number="2.1.1.176"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:P36929"
FT                   /protein_id="ATY42495.1"
FT                   /translation="MSQVTSNSSRFNLRAQVVQTLLKVQQGQSLASILNTQLNQVAERD
FT                   RALFHELVLGTLRQWFALKSISLPLLSKPLNNETVETCLYVGLYQVLCTRIAAHAAISE
FT                   TVDATKQLGFPALSGIVNAILRRATRETEDFEQGLHQAHGLPSWLFKRLKKDWGEQTEA
FT                   LCQSLKQVAPLTLRVNQRHIGRDAYLAKLQSLDIQARACLFSEAAIVLEQSVQITQLPG
FT                   FEQGWFSVQDEHAQLCATLLPDLNNKTVIDACAAPGGKTAHLLEKFKPAQLIAIDQDPS
FT                   RLVRVTENLNRLALDQSHTEILAADATKWNPVQPVDCIVLDAPCSATGVIRRHPDIRLL
FT                   RQSSDIAQTIELQKQILEHMWQQLKVGGTLLYITCSILKSENEQQMINFFTEHPDAKEV
FT                   KIEADWGIEQVHGRQLLPEAQSGDGFYYCKIQKIT"
FT   gene            complement(28745..29707)
FT                   /gene="fmt"
FT                   /locus_tag="ABBFA_00022"
FT                   /old_locus_tag="CTY05_00022"
FT   CDS_pept        complement(28745..29707)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fmt"
FT                   /locus_tag="ABBFA_00022"
FT                   /old_locus_tag="CTY05_00022"
FT                   /product="Methionyl-tRNA formyltransferase"
FT                   /EC_number="2.1.2.9"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:Q9KVU4"
FT                   /protein_id="ATY42496.1"
FT                   /translation="MKIIFAGTPEFAATALAALLKTSHEIIAVYTQPDRKAGRGQKLTP
FT                   SPVKQLALEHNIPVYQPLHFKASTEEGLAAQQELAALGADVMVVAAYGLILPQAVLDTP
FT                   KYGCLNIHGSLLPRWRGAAPIQRAIATGDDETGITIMQMAAGLDTGDMMYKTYCPITSE
FT                   DTSATLHDKLAAQGATAICAVLESEETLQKYLAEREVQDESLTVYAHKLVKSEARIDWS
FT                   MNAVQVDRNIRAFNPWPVAFIQLDENNALRVWNSTISSQSKVNAQAGEIIAIDKQGVHV
FT                   ACGENTFICLTSVQWPGGKALNAQQIAQTQKLHVGQILP"
FT   gene            30056..31885
FT                   /gene="ilvD"
FT                   /locus_tag="ABBFA_00023"
FT                   /old_locus_tag="CTY05_00023"
FT   CDS_pept        30056..31885
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ilvD"
FT                   /locus_tag="ABBFA_00023"
FT                   /old_locus_tag="CTY05_00023"
FT                   /product="Dihydroxy-acid dehydratase"
FT                   /EC_number="4.2.1.9"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:Q2K9I7"
FT                   /protein_id="ATY42497.1"
FT                   /translation="MPDYRSKTSTHGRNMAGARGLWRATGMKDEDFGKPIIAVVNSFTQ
FT                   FVPGHVHLKDLGQLVAAEIQAAGGVAKEFNTIAVDDGIAMGHDGMLYSLPSRDLIADSV
FT                   EYMVNAHCADAMVCISNCDKITPGMLMAAMRLNIPVVFVSGGPMEAGKVKFRGDEKAID
FT                   LVDAMVVAADDSYTDEEVAEFERSACPTCGSCSGMFTANSMNCLTEALGLSLPGNGSIV
FT                   ATHANRKKLFLKAGQLIVELAKRYYEQNDASILPRSIATKAAFKNAMTLDIAMGGSTNT
FT                   VLHLLAAANEAEVDFTMDDIDELSRRVPVLSKVAPAKQDVHMEDVHRAGGIMAILGELD
FT                   RANLLDVSVPTVHEKTLKDALDKWDIIRTEDPDVYEFYRSSPGGVPTQVAFSQNRYYST
FT                   LDGDREKGVIRNAEHAFSKDGGLAVLYGNIALDGCIVKTAGVDESILKFTGSARVFESQ
FT                   DAAVEAILGNEIKAGDVVIIRYEGPRGGPGMQEMLYPTSYLKSKGLGKDCALVTDGRFS
FT                   GGSSGLSIGHVSPEAAEGGAIGLVEDGDTIEIDIPNRTIHLNIDDATLAHRRTVQEAKG
FT                   WHPKEERKRKVSKALKVYAMHTTSAAKGAVRVL"
FT   gene            32199..33488
FT                   /locus_tag="ABBFA_00024"
FT                   /old_locus_tag="CTY05_00024"
FT   CDS_pept        32199..33488
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABBFA_00024"
FT                   /old_locus_tag="CTY05_00024"
FT                   /product="hypothetical protein"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /protein_id="ATY42498.1"
FT                   /translation="MSLLRRWFDPIRSSWFYQKPSRQAVLPTENGLSIYLRLDDVYSYL
FT                   AVQQLSQLDEILSDELKPLKIIISHTASEPPNSMTHEEWQHYCLNDAKILANQHRFAFD
FT                   EFPEIPSPESLKQAAVILKRTPLQGQNFLHLLEDIFHMLWQQQYGKLRTLHAMAVKHQV
FT                   PQHFPERIFTDEPVRAAYFEFGGRKYHAVDDLLRLTRRLKQQKLLTGNPIFLINHIEWR
FT                   EHLINDAEALNEIQALHPELDVFIALEDPMSWLLLAYIKEELADYYDIQLKVYPLSYRG
FT                   RDWFDWSLATRVSKRTEVAFTPFCRPTEESTLGMAKLFYSVPENQQLDTIFTILQAVWT
FT                   KGKDLSFQKHFQQLQQQLGIEQLTEQDIQSVLAQNDALCQDKHQPDLPVLELRIDGQSY
FT                   VFNSLYRVWMIESIFSNVLEEKYKTASTSN"
FT   gene            33567..34298
FT                   /locus_tag="ABBFA_00025"
FT                   /old_locus_tag="CTY05_00025"
FT   CDS_pept        33567..34298
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABBFA_00025"
FT                   /old_locus_tag="CTY05_00025"
FT                   /product="Sulfite exporter TauE/SafE"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="protein motif:Pfam:PF01925.13"
FT                   /protein_id="ATY42499.1"
FT                   /translation="MTFLAIIMMVFAFAGMIKGMIGLGLPAVSMGLLTIAMSPFQAASL
FT                   LIVPSMVTNVWQLFAEGHVWAFIRRFWTLLAGIVVGSIWSFLPTLSQSHGQSSEILLGC
FT                   MLALYGLYGLCVKKLPHLGKHERWLSPIIGYIGGAVTVATGVIIIPIVPYLQSLHLKRD
FT                   ELVQALGLTFTVSTICLAVFLHHNPMSGITLDYRLSFAALLAALIGMWIGKKIRYRLNE
FT                   QIFRRIFFIGLMSLGLYMILH"
FT   gene            complement(34307..35197)
FT                   /gene="hcaR_1"
FT                   /locus_tag="ABBFA_00026"
FT                   /old_locus_tag="CTY05_00026"
FT   CDS_pept        complement(34307..35197)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hcaR_1"
FT                   /locus_tag="ABBFA_00026"
FT                   /old_locus_tag="CTY05_00026"
FT                   /product="Hca operon transcriptional activator"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:Q47141"
FT                   /protein_id="ATY42500.1"
FT                   /translation="MRFDFFDLQLVLHIVSTGSLTKGADRSAISLQAASERIKKLEQYF
FT                   ETPLFIRQTTGVELTTAGHAFVEHARQLLAQKDQLEHEMQRFRQPTTEALTLWCNSSAQ
FT                   SEYLPTLLPQYLVLHPEMNIDLHEAESSEIVDALTQGIASLGLVSSFFNTRHLQTKEFA
FT                   SDPLVLICPVTHELAHYKELNLVDALSYGFIGLKSHHSLQQSIETQAKLLGFNIQYRLR
FT                   LPNFGAIAEVVAKGVGIAIMPARAAQRLQSDYDFHSIQLLGAWANRKLLLATQSFNQLP
FT                   SSYQQFADFLLQHRP"
FT   gene            complement(35277..36572)
FT                   /gene="rutG"
FT                   /locus_tag="ABBFA_00027"
FT                   /old_locus_tag="CTY05_00027"
FT   CDS_pept        complement(35277..36572)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rutG"
FT                   /locus_tag="ABBFA_00027"
FT                   /old_locus_tag="CTY05_00027"
FT                   /product="Putative pyrimidine permease RutG"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:P75892"
FT                   /protein_id="ATY42501.1"
FT                   /translation="MSNWFPKWQPYQGDVDHRPVSTNEYLPPVQSAILGIQHAFAMFGA
FT                   TVLAPLLMGFNPNLAILMSGICTILFFLITGGRVPSYLGSSFAFIGVVAAATGHITGSG
FT                   ANPNLSIALGGIVACGIFYALIGFIVMLTGTRWIEKLMPPVVTGAIVMIIGLNLAPVTI
FT                   KGVAGQPFEMWMALITVLCMGSIAVFTRGLLQRLLLLVGLILAYVIYAIATNGLGLGKP
FT                   IDFSQISQASWFGIPSFSHPTFDTKAILIIAPVALILVAENLGHIKAVGAMTGENLTPQ
FT                   LGKAFVADGLATTLSGSVGAPGMTTYGENIGVMAVTRVYSTIVFVIAGIFAIFLGLSPK
FT                   FGAVISTIPSAVLTGASIVVFGLITIAGAKIWIENKVDFSNNKNLIVASVTIILGAGNF
FT                   ELLFGNFNLGGIGTATFAAIILNWLFSLKDKT"
FT   gene            complement(36873..39557)
FT                   /gene="ppc"
FT                   /locus_tag="ABBFA_00028"
FT                   /old_locus_tag="CTY05_00028"
FT   CDS_pept        complement(36873..39557)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ppc"
FT                   /locus_tag="ABBFA_00028"
FT                   /old_locus_tag="CTY05_00028"
FT                   /product="Phosphoenolpyruvate carboxylase"
FT                   /EC_number="4.1.1.31"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:P00864"
FT                   /protein_id="ATY42502.1"
FT                   /translation="MVQQIDAPLREDVRLLGNLLGETLKQHAGQELFNQIEQIRALAKG
FT                   ARDGQAEAEKQLEQLFLELPDEELLPLTRAFSHFLNFANIAEQYHVVRSRRQAEFDPDA
FT                   NSPNPLVHLFKKFKDKNISTEKLFQQICDLKIELVLTAHPTEVSRRTLIQKYDDINACL
FT                   SQLDQQKLTPRERQNALANLKQQISSAWQTDEIRQHRPTPVDEAKWGFATIEQTLWNAV
FT                   PKFIRELNELVQDNCQQNLPLHIAPVRFASWMGGDRDGNPNVTHQITQEVLWLSRWQAA
FT                   DLYLRDIENLRWELSIQSCSEEMVEAIGSPHPEPYREYLRATRERLKATRHWLAQRLQG
FT                   LEADDSNVIKSKDELLQPLLLCYRSLIDSNLPEIANGQLLDFIYRVNCFGIELLKLDIR
FT                   QESGRHRQAISAITEYLGLGNFESWTEQARQNFLIQELQSKRPLLPKYINEPEGSLIGH
FT                   PDVQEVFATMRTLADQPPESLGAYIISMAEYPSDVLAVLLLQKEAGIQHPLRVVPLFET
FT                   LKDLDGAATTMNTLFNMHWYKQHIQGKHEVMIGYSDSAKDAGFMSANWAQYRAQEELTA
FT                   IARKHGVQLTLFHGRGGSISRGGAPTQQALFSQPPGSISGAIRVTEQGEMIRFKFGLEG
FT                   IAMQNLEIYTAATLEATLLPPPEPKAEWRELMNRMTDHSVKVYRQTVRENPHFVKYLRT
FT                   VTPELELQMLPLGSRPAKRKVSGGIESLRAIPWVFAWTQIRLMLPAWLGTGAAINEVIA
FT                   DQQKATLDEMLQQWPYFQTLIDMLEMVLSKADANIALYYESHLTEDEDLKVLGNQLRQR
FT                   LKDAVETLLTLKDESKLLSDNEVLDQSMQVRKPYLLPLHLLQAELMKRRRDYLAERQAE
FT                   HTPVDHALMVSIAGIAAGLRNTG"
FT   gene            complement(39728..40351)
FT                   /gene="acrR"
FT                   /locus_tag="ABBFA_00029"
FT                   /old_locus_tag="CTY05_00029"
FT   CDS_pept        complement(39728..40351)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acrR"
FT                   /locus_tag="ABBFA_00029"
FT                   /old_locus_tag="CTY05_00029"
FT                   /product="HTH-type transcriptional regulator AcrR"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:P0ACS9"
FT                   /protein_id="ATY42503.1"
FT                   /translation="MQTVNQSGRPKDLEKRARILQAAKAIFLKSGYHGTSMNLIAQEAG
FT                   VTKLTVYNHFQDKANLFICAITETCEETLGTKPFELDASADFYQTLYMVCSRALQIIYS
FT                   PEALKLEHVLFELAAEQSPLALQFFNASHTRLQNQLVEFFQKAAQLGFIQADDPLYQTE
FT                   LLLTLLLGVRHHKVLLGIIPVPNTQEIDRFIRDAIDLFLLKYRH"
FT   gene            40501..41601
FT                   /gene="macA_1"
FT                   /locus_tag="ABBFA_00030"
FT                   /old_locus_tag="CTY05_00030"
FT   CDS_pept        40501..41601
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="macA_1"
FT                   /locus_tag="ABBFA_00030"
FT                   /old_locus_tag="CTY05_00030"
FT                   /product="Macrolide export protein MacA"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:P75830"
FT                   /protein_id="ATY42504.1"
FT                   /translation="MNLLKPLIMSMMIVCMVTLMGCSKEAPKTEEIPYVMVTQPSTTLH
FT                   EQKSYAGDVQARQQTALAFRVGGQVTARYVDVGDRVRVGQVLAKLDVADAQLQLNAAKA
FT                   QLENAQAAAKTASDELKRFQQLLPINAVSRSQYDTVKNQYDAAQAALQQARSNYEVSAN
FT                   QTGYNQLVSNKNGVITARNIEIGQVVAAGQAAYQLAIDGEREVVIGVPEQAVSEIKVGQ
FT                   AAWITLWSKPNERFAGYVREVSPAADQSRTFTVKVALKEGQSAIQLGQSARVFFSSTQT
FT                   NVMSVPLSSVSATDNQPYVWVVNANQTLRKVPVTIGAYARDSVPVLSGLTPNDWVVIGG
FT                   VHLLRDKQKIHPIDRENRAVKIQGAK"
FT   gene            41604..44729
FT                   /gene="czcA_1"
FT                   /locus_tag="ABBFA_00031"
FT                   /old_locus_tag="CTY05_00031"
FT   CDS_pept        41604..44729
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="czcA_1"
FT                   /locus_tag="ABBFA_00031"
FT                   /old_locus_tag="CTY05_00031"
FT                   /product="Cobalt-zinc-cadmium resistance protein CzcA"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:P13511"
FT                   /protein_id="ATY42505.1"
FT                   /translation="MKFNLSEWALNNKGIVLYFMLLLGIIGAISYSKLSQSEDPPFTFK
FT                   VMVVQTYWPGATAKEVSTLVTDRIEKELMTTGQYDKIMAYSRPGESMVTFVAKDSLTSA
FT                   QIPDVWYNVRKKVNDIRHELPSGVQGPFFNDEFGDTFGNIYVLTGKDFDYALLKEYADR
FT                   LQLQLQRVKDVGKVELIGLQDQKIWIEISNTKAVQLGIPVSAIQEALQKQNSMASAGFF
FT                   ETGTDRIQIRVSGQLQSVEDIKKMPLLVGDKTIQLGDVADVYRGFSQPAQPRMRFMGDN
FT                   GIGIAVSMRKGGDIIALGKNLETEFAQLQKTLPLGMKLQKVSDQPVAVQRSIHEFVKVL
FT                   AEAVIIVLLVSFFSLGFRTGLVVAFSIPLVLAMTFAGMNLFDVGLHKISLGALILALGL
FT                   LVDDAIIAVEMMAIKMEQGYSRIKAAGFAWKTTAFPMLTGTLITAAGFLPIATAQSSTG
FT                   EYTRSIFQVVTIALLVSWVAAVLFVPYLGEKLLPDFTKTGHQAPWYVRLWARVTKKPQP
FT                   QTVAISQDHHYDPYQSSFYLRFRKMVEFCVTYRKTVIATTVGIFVLSVLMFKMVPQQFF
FT                   PPSNRAEILVDLKLEEGASLTATEQAVKKVEQFLSKQKGIDNYVAYVGTGSPRFYLPLD
FT                   QQLPQASFAQFVVLASSLDDRDEIRRSLETQIKQLLPQVRTRVSLLENGPPVGYPLQYR
FT                   VSGEDLNLVRKEAQQVARVISENPNTTNVHLDWGEPSKIISIQIDQDRARQMGVSSLDL
FT                   ANFLNASITGSAIEQYREKRELIEIRLRGDKAERVEVASLASLAVPTANGTTVPLAQIA
FT                   KIEYKFEDGLIWHRNRLPTITVRADIRTNLQPATVVGELAESMDKLRAELPSGYLIEVG
FT                   GTVEESARGQSSVNAGMPLFLAVVMTLLMIQLKSLSRATIVFLTAPLGLIGVVLFLLLF
FT                   NKPFGFVAMLGTIALSGMIMRNSLILIDQIEQDRQAGHPTWEAIIDATVRRFRPIILTA
FT                   LAAVLAMIPLSRSIFFGPMAVAIMGGLIVATLLTLFFLPALYAAWFKVKKTA"
FT   gene            44869..45246
FT                   /locus_tag="ABBFA_00032"
FT                   /old_locus_tag="CTY05_00032"
FT   CDS_pept        44869..45246
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABBFA_00032"
FT                   /old_locus_tag="CTY05_00032"
FT                   /product="hypothetical protein"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /protein_id="ATY42506.1"
FT                   /translation="MGQDHIEQHRRYIVISYAFMFLALFTVIFAAFAYLVARKVAVVDD
FT                   AEVWIHAHALWIMRNGILFLLMSVFAVVWFIPLFFFAWDSNLWVTASTVAGVVFSAIAW
FT                   LFLLNAWLKGLSKYLKNKAVF"
FT   gene            45351..46463
FT                   /gene="dnaJ"
FT                   /locus_tag="ABBFA_00033"
FT                   /old_locus_tag="CTY05_00033"
FT   CDS_pept        45351..46463
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaJ"
FT                   /locus_tag="ABBFA_00033"
FT                   /old_locus_tag="CTY05_00033"
FT                   /product="Chaperone protein DnaJ"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:P08622"
FT                   /protein_id="ATY42507.1"
FT                   /translation="MAKRDYYEVLGVSKTASDDEIKKAYRKLAMKYHPDRNPDNAEAEE
FT                   KFKEASEAYEILSDSEKRSMYDRMGHNAFEGGFGGAGGGFGGFSAEDIFSQFGDIFGGA
FT                   FGGGGRQQRQRRGSDLRYVMELTLEEAVKGVKKTITFTAPAPCDVCDGKGSKNPKDVET
FT                   CKTCHGSGQVRMQQGFFSVQQTCGTCRGQGKIIKNPCHACHGSGVADRQQTLEVTIPAG
FT                   VDNGDRVRLSGKGEAIRDGQAGDLYVEVVVREHEIFQRDGADLYMDVPVSIADAALGKE
FT                   IEIPTLEGRVSLKIPEGTQTGKLFRLRGKGVRPVRSSMVGDLLCRIVVETPVNLTSRQR
FT                   ELLKELQASFDGEDSASSPKKKSFFDRLFD"
FT   gene            complement(46578..46928)
FT                   /locus_tag="ABBFA_00034"
FT                   /old_locus_tag="CTY05_00034"
FT   CDS_pept        complement(46578..46928)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABBFA_00034"
FT                   /old_locus_tag="CTY05_00034"
FT                   /product="hypothetical protein"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /protein_id="ATY42508.1"
FT                   /translation="MHSKVIGLIAIMGIISSVAFAEPAIQPGETLESLSKARITTNVNT
FT                   QAATPTAQTSDANAEVKVEDIDPIIEEKTEETLKAAVQPAPQATVEAIVAPVTSSELNV
FT                   SVDDIDVAHPTE"
FT   gene            47113..47934
FT                   /gene="dapB"
FT                   /locus_tag="ABBFA_00035"
FT                   /old_locus_tag="CTY05_00035"
FT   CDS_pept        47113..47934
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dapB"
FT                   /locus_tag="ABBFA_00035"
FT                   /old_locus_tag="CTY05_00035"
FT                   /product="4-hydroxy-tetrahydrodipicolinate reductase"
FT                   /EC_number="1.17.1.8"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:Q1IF57"
FT                   /protein_id="ATY42509.1"
FT                   /translation="MSAAPRIGILGAGGRMGRILIQAVQQAGYQLGAAVVRPESTLIGA
FT                   DAGELAGIGSIGVKLTGSLAEVLEDCDVVIDFSTPAATSEHLKLCREAGVAIVIGTTGM
FT                   SDEQKAELDETAKHIPVVYAANYSVGVNVSIKLLELAAKVFGDTVDIEVIEAHHRHKVD
FT                   APSGTALMMGEAIADTLGRNLKEVAVYGREGHTGPRDRQTIGFETIRGGDIVGEHTVMF
FT                   IGEGERVEVTHKATNRMNFAAGAVRAAAWVVGREARKYDMKDVLGLNDVQV"
FT   gene            47986..48639
FT                   /locus_tag="ABBFA_00036"
FT                   /old_locus_tag="CTY05_00036"
FT   CDS_pept        47986..48639
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABBFA_00036"
FT                   /old_locus_tag="CTY05_00036"
FT                   /product="START domain protein"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="protein motif:Pfam:PF01852.13"
FT                   /protein_id="ATY42510.1"
FT                   /translation="MNKKQIALTTLLCLSSLYTGAASTDKAKLSLDRNHIKVWTYQKAD
FT                   NPVFQYKAETTFDVPLERAVAVILDVDRAAQWVPYMGKVQMLSQDEKKGEFTLYMVLDF
FT                   PFPLKDRDVVVKGKMSKAANGLITIKNTAVNSNYPIQPDVVRLTRYEGDWTFQKLANNK
FT                   VKVTTSGYADPAGAIPLSFVNMFVQQQPYQMLLKMKREVMNPIYEQPKLPEILK"
FT   gene            complement(48680..49870)
FT                   /gene="ydhP_1"
FT                   /locus_tag="ABBFA_00037"
FT                   /old_locus_tag="CTY05_00037"
FT   CDS_pept        complement(48680..49870)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydhP_1"
FT                   /locus_tag="ABBFA_00037"
FT                   /old_locus_tag="CTY05_00037"
FT                   /product="Inner membrane transport protein YdhP"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:P77389"
FT                   /protein_id="ATY42511.1"
FT                   /translation="MNTQSNTAFSLLALAIGAFAIGTTEFSPMGLLPNIANDLGISIPT
FT                   AGMLITGYALGVMLGAPFMTLWFGGFARRNALIFLMAIFTVGNLIAAFSPNYMSLLGAR
FT                   LITSLNHGAFFGIGSVVAASIVPAHKQASAVATMFMGLTIANIGGVPLATWVGQNIGWR
FT                   MSFLAISVLGIITMLALWKALPQGMVAQKPNVKAELKVLTRTPVVLALLTTVLGAGAMF
FT                   TLYTYIAPSLTEFTHASPTFITFMLVLIGVGFSIGNHLGGRFADLSINKTLIGFLVLLI
FT                   VMMVTFPILAQSQIGAAIALVIWGAATFALVPPLQMRVMSVAHEAPGLASSVNIGAFNL
FT                   GNAVGAAAGALVLDLGWGYSAVSFAGALLAGLGLLLVLFQIKRESSPAQTLQQCSD"
FT   gene            complement(49875..50678)
FT                   /gene="dkgB"
FT                   /locus_tag="ABBFA_00038"
FT                   /old_locus_tag="CTY05_00038"
FT   CDS_pept        complement(49875..50678)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dkgB"
FT                   /locus_tag="ABBFA_00038"
FT                   /old_locus_tag="CTY05_00038"
FT                   /product="2,5-diketo-D-gluconic acid reductase B"
FT                   /EC_number="1.1.1.346"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:P30863"
FT                   /protein_id="ATY42512.1"
FT                   /translation="MNIPRFGLGTFRLKEQAVIDSVKNALDVGYRAIDTAQIYENEAAI
FT                   GQAIAESGVSRQDLFLTTKIWVDNFAQEKFIPSLKESLQKLRTDHVDLTLIHWPAPDLG
FT                   VSIPEIMQLLLEAKQQGLTKQIGISNFNIALTQQAIDTIGVEHIATNQIELSPYLQNHK
FT                   LVNFLQEKNIDVTSYMTLAYGKVLQDPVLAEIAAAHKATTAQIALAWALQRGFAVIPSS
FT                   TKRENLISNLKAQDIELTAAEMQMIAELDRNSREVSPEPWAPVWD"
FT   gene            50799..51701
FT                   /gene="dmlR_1"
FT                   /locus_tag="ABBFA_00039"
FT                   /old_locus_tag="CTY05_00039"
FT   CDS_pept        50799..51701
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dmlR_1"
FT                   /locus_tag="ABBFA_00039"
FT                   /old_locus_tag="CTY05_00039"
FT                   /product="HTH-type transcriptional regulator DmlR"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:P76250"
FT                   /protein_id="ATY42513.1"
FT                   /translation="MKSTIEELVAFITIVDTGSFVAAAEHLKQTPSGVSRSLTRLEAKL
FT                   DVTLLERTTRKLKLTQEGQQFLIKARKILNELNAAEEELQKSDQGTAGLIRVDSATPFV
FT                   LHVIAPLMHKFRECYPDIEIELNSNDQVIDLLQHKTDVAFRFGELNDSSLHAKLVCKSR
FT                   LYIVASPDYLALKGTPTQPEELEHHDLIGFTRPTYINSWPIKVGDEYFFAQSKIKASSG
FT                   ETVRQLTIRGHGIARLSEFEIWKDMEEGRLIALFEDKIEHQYQSIHAVYYQQEHLPKRI
FT                   RLFIEFLAEQLKDGFKNAL"
FT   gene            complement(51685..52059)
FT                   /locus_tag="ABBFA_00040"
FT                   /old_locus_tag="CTY05_00040"
FT   CDS_pept        complement(51685..52059)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABBFA_00040"
FT                   /old_locus_tag="CTY05_00040"
FT                   /product="hypothetical protein"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /protein_id="ATY42514.1"
FT                   /translation="MKLKVILLFTIVLAGCQPQPKNEQHRHTVCQSLIEGYLKMTNQQD
FT                   YKMEQRTNDETSAISHYEYKRNSSNEVVMVNSVYSKLYFSCQEQQKSYFLSQHSAQGQT
FT                   TPILEVHIPTDSYTTFRERF"
FT   gene            52150..53574
FT                   /gene="ydcR_1"
FT                   /locus_tag="ABBFA_00041"
FT                   /old_locus_tag="CTY05_00041"
FT   CDS_pept        52150..53574
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydcR_1"
FT                   /locus_tag="ABBFA_00041"
FT                   /old_locus_tag="CTY05_00041"
FT                   /product="putative HTH-type transcriptional regulator YdcR"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:P77730"
FT                   /protein_id="ATY42515.1"
FT                   /translation="MTFQYQVLANQLAHRIYQDELKPHQKLISLRDFARQQGISLSTAK
FT                   SCYELLEARGLIYVKPKSGYFVVARTPSSPIPDSPDFLSLPRHVSNLELHNQIQEAALQ
FT                   SHLVPLGSIQLTPHFIPVEGLRRSIQRALKNCQPQDFLYCNKQGHEQLRKALSDHWRED
FT                   GIYIAPEDIFITNGCMPALSLVIQKLTEVGDSILIPTPTYNGHLQLLASLKRQIVEIPA
FT                   DHRGIDLERLESLMQQGLAKVCLMTANYQNPLGYCFSNAEKQKIAELAAKYQCFIIEDD
FT                   IFGECGYSSERPLPIRYWDREGYVIWCGSVSKSLSSAYRVGWFCLTTKLEYLKLELLVS
FT                   NIGVNTPLQLGLADFIYSRGYREHLEQLRPNLMRQVEEYRSCILKAFEGIPIALSQPEG
FT                   GYALWIQLPKSVDSLALYYTAQAQGITVVPGHVFGEDERYRHFIRLNAGHELTADVRQA
FT                   IMSLADWSRQQMQTVS"
FT   gene            complement(53577..54605)
FT                   /gene="ahr"
FT                   /locus_tag="ABBFA_00042"
FT                   /old_locus_tag="CTY05_00042"
FT   CDS_pept        complement(53577..54605)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ahr"
FT                   /locus_tag="ABBFA_00042"
FT                   /old_locus_tag="CTY05_00042"
FT                   /product="Aldehyde reductase Ahr"
FT                   /EC_number="1.1.1.2"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:P27250"
FT                   /protein_id="ATY42516.1"
FT                   /translation="MSNNTIQAYAAMQAGEKLVPYQFDAGELQPHQVEVKVEYCGLCHS
FT                   DISVLNNEWRSTVYPVVAGHEIIGRIVALGSEAKGLQIGQRVGIGWTAESCQACDECIG
FT                   GQQVLCTGENVATIVGHAGGFADKVRAGWQWAIPLPEDLDPESAGPLLCGGITVFDPLL
FT                   KHKIQATHHVGVIGIGGLGHIAIKLLKAWGCEITAFSSNPDKTEELKAMGADHVVNSRD
FT                   TEAVKAQKGKFDLLLSTVNVTLNWRAFISTLAPNGSLHFLGLTLEPVPVSVGSLIDGAK
FT                   SVTGSPTGSPAALRQLLKFAARKKIAPQIELFPMSQLNEAIERLHSGQARYRIVLKADF
FT                   AE"
FT   gene            complement(54644..55204)
FT                   /gene="tag"
FT                   /locus_tag="ABBFA_00043"
FT                   /old_locus_tag="CTY05_00043"
FT   CDS_pept        complement(54644..55204)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tag"
FT                   /locus_tag="ABBFA_00043"
FT                   /old_locus_tag="CTY05_00043"
FT                   /product="DNA-3-methyladenine glycosylase 1"
FT                   /EC_number="3.2.2.20"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:P05100"
FT                   /protein_id="ATY42517.1"
FT                   /translation="MKTQRCGWCSDDPLYIAYHDEEWGKPEHDEARLFEMLCLEGQQAG
FT                   LSWITVLKKRESYRQHFFNHPIADIAAFTDDFLETKLSDAGLIRHLGKLKAIRDNAIAW
FT                   QALKAQVGDVSKWLWQFVDAAPQNNDVADYRKAPAQTELSLKLSKTLKKNGFKFVGPTT
FT                   CYAFMQAVGMVNDHENDCQFKAS"
FT   gene            complement(55235..55480)
FT                   /locus_tag="ABBFA_00044"
FT                   /old_locus_tag="CTY05_00044"
FT   CDS_pept        complement(55235..55480)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABBFA_00044"
FT                   /old_locus_tag="CTY05_00044"
FT                   /product="hypothetical protein"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /protein_id="ATY42518.1"
FT                   /translation="MSEALINRLVEFAESGNQQKIILNGNSYQGWIMEISDDALLISTG
FT                   FSDKVGKDFWLKFEDLTQAELYYWDTRPNEWVPFKL"
FT   gene            complement(55490..56026)
FT                   /gene="lytH"
FT                   /locus_tag="ABBFA_00045"
FT                   /old_locus_tag="CTY05_00045"
FT   CDS_pept        complement(55490..56026)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lytH"
FT                   /locus_tag="ABBFA_00045"
FT                   /old_locus_tag="CTY05_00045"
FT                   /product="L-Ala--D-Glu endopeptidase precursor"
FT                   /EC_number="3.4.-.-"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:O32130"
FT                   /protein_id="ATY42519.1"
FT                   /translation="MRRFVSHLSLGFLIILLAACASAPKKPAPLSPAQVSKLKSMQLPS
FT                   RLPVPVKGVDRDELKDTWGAARSQGRSHEGIDILAPRGTKVYSATEGLIADLRNNNLGG
FT                   KVIWILGPAGTWHYYAHLDGHKRGLNVGDYVKKGDLIGYVGNTGNARYTSPHLHYGLYL
FT                   DGKGRGAVNPYSYLR"
FT   gene            complement(56074..57108)
FT                   /gene="mutY"
FT                   /locus_tag="ABBFA_00046"
FT                   /old_locus_tag="CTY05_00046"
FT   CDS_pept        complement(56074..57108)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mutY"
FT                   /locus_tag="ABBFA_00046"
FT                   /old_locus_tag="CTY05_00046"
FT                   /product="A/G-specific adenine glycosylase"
FT                   /EC_number="3.2.2.-"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:P17802"
FT                   /protein_id="ATY42520.1"
FT                   /translation="MPEFSFSDALLNWFDQHGRHDLPWQVADDPYKVWVSEIMLQQTQV
FT                   KTVLQYFDRFMERFPTVEALGHATWDEVAPYWAGLGYYARARNLHKAASLVAQQGKFPE
FT                   TLEEWIALPGIGRSTAGALMSLGLRQYGVIMDGNVKRVLARFFAIEDDLSKPQHEREMW
FT                   KLAEELCPTHRNHDYTQAIMDLGATICTPKKPLCLYCPMQAHCQAYQQGLEQELPFKKP
FT                   KKTPPVKTADVLIIQCEDEWFWQQRQAHGLWGGLFCLPILENEHERLKLSQQFKLQPRP
FT                   QTFQISHSFTHFTWLLNAHVFHVEPDQKEHLAIELEGQWLSPEQAIAKGVPTAMKKLIS
FT                   TSRS"
FT   gene            complement(57249..57611)
FT                   /locus_tag="ABBFA_00047"
FT                   /old_locus_tag="CTY05_00047"
FT   CDS_pept        complement(57249..57611)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABBFA_00047"
FT                   /old_locus_tag="CTY05_00047"
FT                   /product="AP-4-A phosphorylase"
FT                   /EC_number="2.7.7.53"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:O06201"
FT                   /protein_id="ATY42521.1"
FT                   /translation="MTDKKCPYCDFDEYDIIDKNEFAVILPDPNPLSKGHCVVTPLRHV
FT                   SSFFDITSKEHQGLLTLLEIARHETQLRHQPDGFHIGFNDGEVFGQTSDHFHIHVIPYY
FT                   KNQPLKLDQRWGVQKD"
FT   gene            complement(57796..58533)
FT                   /gene="clcD_1"
FT                   /locus_tag="ABBFA_00048"
FT                   /old_locus_tag="CTY05_00048"
FT   CDS_pept        complement(57796..58533)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="clcD_1"
FT                   /locus_tag="ABBFA_00048"
FT                   /old_locus_tag="CTY05_00048"
FT                   /product="Carboxymethylenebutenolidase"
FT                   /EC_number="3.1.1.45"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:P0A115"
FT                   /protein_id="ATY42522.1"
FT                   /translation="MSTAIKTREIQYTAPDGSHLIGYFAAPESETPVPGVIIGPEWWGR
FT                   NEYTEQRARELAEHGYAALAIDMYGDKKVTTTAAQAYEWMMQTFEDLDTVTDRANAGLQ
FT                   TLAAQPEVNSEKLAAVGFCYGGKVVLDLARSGAPLKATATFHGTLAPKAPAQKGNIQGE
FT                   VLVLHGELDSMVTLEDVANFEKEMQAAEVKHEVVVLKDAKHGFSNPLADERAKANGVDL
FT                   GYNSEAEKQGLAKMYALLERTLK"
FT   gene            complement(58705..58863)
FT                   /locus_tag="ABBFA_00049"
FT                   /old_locus_tag="CTY05_00049"
FT   CDS_pept        complement(58705..58863)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABBFA_00049"
FT                   /old_locus_tag="CTY05_00049"
FT                   /product="hypothetical protein"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /protein_id="ATY42523.1"
FT                   /translation="MFRWAIIFAVIALIASLLGFGGVAGLSKDFAVILLVIAVILAVIG
FT                   FISRGRT"
FT   gene            59058..59516
FT                   /locus_tag="ABBFA_00050"
FT                   /old_locus_tag="CTY05_00050"
FT   CDS_pept        59058..59516
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABBFA_00050"
FT                   /old_locus_tag="CTY05_00050"
FT                   /product="hypothetical protein"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="protein motif:CLUSTERS:PRK05170"
FT                   /protein_id="ATY42524.1"
FT                   /translation="MSTETSLRPLFWKNYTLEQLTQAEWEALCDGCGLCCLVKLEDEDT
FT                   HEVAYTKVACKLLDCNTGRCSDYPNRQQQVPDCLQLTPETLKTINWLPSSCAYKRLNEG
FT                   KNLPSWHYLNTGSRQSVVKAKKSVAGRCIPETDVHEDDIEDYVVRWVR"
FT   gene            59626..60798
FT                   /gene="yliI_1"
FT                   /locus_tag="ABBFA_00051"
FT                   /old_locus_tag="CTY05_00051"
FT   CDS_pept        59626..60798
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yliI_1"
FT                   /locus_tag="ABBFA_00051"
FT                   /old_locus_tag="CTY05_00051"
FT                   /product="Soluble aldose sugar dehydrogenase YliI
FT                   precursor"
FT                   /EC_number="1.1.5.-"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:P75804"
FT                   /protein_id="ATY42525.1"
FT                   /translation="MMRRLAAPLLCSSFFLLMACGSNNTNSKSPEQNTTAKTEQTNAAK
FT                   QIYQVEAVAHFKEPWAITSLPDQRLLVTERQGKLKIFNPQNKQMLDIQGIPAVSYGGQG
FT                   GLGDVALHPDFAKNHWIYLSYAAKGQGGSGAVISRAKLDLSNPNQPKLTDVKQIWQQVP
FT                   KVSGQGHYGHRMLFGADGKLWVSSGERQKFDPAQNMKSNLGKILRLNDDGSAALGNPFY
FT                   KQGGVTAEIWSLGHRNPLGMAFDRKGQLWVVEMGPKGGDELNIITKGENYGYPIVSNGD
FT                   HYSGQPIPDHHTRPEFKAPEIDWTPVISPSSLIIYRGQQFPAWQNKALIGGLSSEAIIV
FT                   VDLEHKPVKEVQRLEMKQRIRGLHEAQDGSIWVIEDGSKARLLKLSKKLS"
FT   gene            60904..62169
FT                   /gene="rarA"
FT                   /locus_tag="ABBFA_00052"
FT                   /old_locus_tag="CTY05_00052"
FT   CDS_pept        60904..62169
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rarA"
FT                   /locus_tag="ABBFA_00052"
FT                   /old_locus_tag="CTY05_00052"
FT                   /product="Replication-associated recombination protein A"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:P0AAZ4"
FT                   /protein_id="ATY42526.1"
FT                   /translation="MSDTHIPLPERLRPRDLSEIIGQDHLLGEHAPLRQMIDQGHLPSI
FT                   IFWGPPGVGKTTIALLLAQAIDRPFVSLSALNTGVKELREVIAESGDLLTPVVFIDEIH
FT                   RFNKSQQDALLGAVEKGKITLIGATTENPSFEVNSALLSRCQVYTLNSLDSEAIQMLLN
FT                   NALQNDKFLKERYIHIEEYDALLQFAAGDARKALNLLDLIASTFEPEVENTINNAVVVK
FT                   VAQQNIARYDKSGEQHYDLVSAFIKSIRGSDPDAALYWMARMLKGGEDPVFIARRMLIA
FT                   ASEDIGNSNPNALLLAGECFRSVQAVGMPEARIILGQTAVYLATSAKSNSTYLAINKAL
FT                   ELAEKTANLPVPLHLRNAPTKLMKQQGYGINYLYPHDYPEHFVLQDYLPPELKGTKLYE
FT                   SARNKREVEGERLQQRRWQQEQ"
FT   gene            complement(62185..63024)
FT                   /gene="yfdC"
FT                   /locus_tag="ABBFA_00053"
FT                   /old_locus_tag="CTY05_00053"
FT   CDS_pept        complement(62185..63024)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yfdC"
FT                   /locus_tag="ABBFA_00053"
FT                   /old_locus_tag="CTY05_00053"
FT                   /product="Inner membrane protein YfdC"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:P37327"
FT                   /protein_id="ATY42527.1"
FT                   /translation="MDHELEEEKVDQTLSWREKMAVEEHEKLSPRLVYEIIRRDGAEEL
FT                   DRPTAALIFSGIAAGLVISFSFVFKAIIASYIPTDAIWTDLITNFGYTIGFLIAILGHM
FT                   QLFTENTITTVVPLFKPFTLDKLRAVGRLWGIVILCNIIGTGLASLFFLTTDLFTPNID
FT                   KALDELAHHVASFSATQNLLKGVMSGLLIAALVWMLPSVSNKFLVIFFMTYLIGLGDFT
FT                   HVVVGSTEMSYLVWQGEASLGEYMFNFLIPTTIGNIIGGTGVFTLLIYGQVTEELEQ"
FT   gene            complement(63310..63513)
FT                   /locus_tag="ABBFA_00054"
FT                   /old_locus_tag="CTY05_00054"
FT   CDS_pept        complement(63310..63513)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABBFA_00054"
FT                   /old_locus_tag="CTY05_00054"
FT                   /product="hypothetical protein"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /protein_id="ATY42528.1"
FT                   /translation="MELFKPEKRLMNHPIHFGENPLVILSNFSHSALKQGWSQAEVETV
FT                   ISEASQGDYMKLIRTLRAYTLF"
FT   gene            complement(63703..64422)
FT                   /gene="purC"
FT                   /locus_tag="ABBFA_00055"
FT                   /old_locus_tag="CTY05_00055"
FT   CDS_pept        complement(63703..64422)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purC"
FT                   /locus_tag="ABBFA_00055"
FT                   /old_locus_tag="CTY05_00055"
FT                   /product="Phosphoribosylaminoimidazole-succinocarboxamide
FT                   synthase"
FT                   /EC_number="6.3.2.6"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:Q4KGP5"
FT                   /protein_id="ATY42529.1"
FT                   /translation="MLKQTLLYTGKAKSVYETDNADHLILVFRDDASAFNGEKIEQLDR
FT                   KGKVNNRFNAFIMEKLAEAGIETHFEKLLSPTEVLVKKLQMIPVECVIRNYAAGSLCRR
FT                   LGVEEGKELTPPTFELFYKDDGLGDPMVNESQAIALGWATAEQLEQMKVLTYKVNDVLK
FT                   ALFAEGNMILVDFKLEFGVFHDRIVLGDEFSPDGCRLWDKDTKKKLDKDRFRQGLGGVV
FT                   EAYEEVAARLGVDLSDI"
FT   gene            complement(64459..65064)
FT                   /locus_tag="ABBFA_00056"
FT                   /old_locus_tag="CTY05_00056"
FT   CDS_pept        complement(64459..65064)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABBFA_00056"
FT                   /old_locus_tag="CTY05_00056"
FT                   /product="hypothetical protein"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /protein_id="ATY42530.1"
FT                   /translation="MMQLRLGLVLAVSALSLAGCGRFALNNHSLDYKNAKQLAPLEYPA
FT                   DATVRPATPLYPAPTVDQLAIDHAPKFENKRGNRFALPRPEPLQTDTTADASAQTGSAL
FT                   GRPQLVTDGNKNPLLKIDGSTAEIWQYTKATLSTLNYNVIAQGNNQATIKVNDNTYVLK
FT                   LTGVGSSHSLALFNPDNTFASPDVAAEVLNQIYQNWPA"
FT   gene            complement(65077..65970)
FT                   /gene="dapA_1"
FT                   /locus_tag="ABBFA_00057"
FT                   /old_locus_tag="CTY05_00057"
FT   CDS_pept        complement(65077..65970)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dapA_1"
FT                   /locus_tag="ABBFA_00057"
FT                   /old_locus_tag="CTY05_00057"
FT                   /product="4-hydroxy-tetrahydrodipicolinate synthase"
FT                   /EC_number="4.3.3.7"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:Q9I4W3"
FT                   /protein_id="ATY42531.1"
FT                   /translation="MTQQAQTIQGSIVAIVTPMLKDGGVDWKSLEKLVEWHIEQGTNSI
FT                   VAVGTTGEASTLSMEEHTQVIKEIIRVANKRIPIIAGTGANSTREAIELTKAAKDLGAD
FT                   AALLVTPYYNKPTQEGLYQHYKAIAEAVELPLILYNVPGRTGVDLSNDTAVRLAEIPNI
FT                   VGIKDATGDVPRGKALIDALNGKMAVYSGDDETAWELMLLGADGNISVTANIAPKAMSE
FT                   VCAVAIAKDEQQAKTLNNKIANLHNILFCESNPIPVKWALHEMGLIDTGIRLPLTPLAE
FT                   QYREPLRNALKDAGII"
FT   gene            66300..66944
FT                   /gene="rutB"
FT                   /locus_tag="ABBFA_00058"
FT                   /old_locus_tag="CTY05_00058"
FT   CDS_pept        66300..66944
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rutB"
FT                   /locus_tag="ABBFA_00058"
FT                   /old_locus_tag="CTY05_00058"
FT                   /product="Peroxyureidoacrylate/ureidoacrylate
FT                   amidohydrolase RutB"
FT                   /EC_number="3.5.1.110"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:P75897"
FT                   /protein_id="ATY42532.1"
FT                   /translation="MKMNKQPQNSALVVVDVQNGFTPGGNLAVADADTIIPTINQLAGC
FT                   FENVVLTQDWHPDNHISFAANHPGKQPFETIELDYGSQVLWPKHCIQGTHDAEFHPDLN
FT                   IPTAQLIIRKGFHAHIDSYSAFMEADHTTMTGLTGYLKERGIDTVYVVGIATDFCVAWT
FT                   ALDAVKQGFKTLVIEDACKGIDLNGSLEQAWQTMQQQGVVRIQSTDLLNEC"
FT   gene            66999..67937
FT                   /locus_tag="ABBFA_00059"
FT                   /old_locus_tag="CTY05_00059"
FT   CDS_pept        66999..67937
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABBFA_00059"
FT                   /old_locus_tag="CTY05_00059"
FT                   /product="Sodium Bile acid symporter family protein"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="protein motif:Pfam:PF01758.10"
FT                   /protein_id="ATY42533.1"
FT                   /translation="MSALLRFTQFVQKTFALWVIIFAALALWQPEFFVWLKAYIPWILG
FT                   IIMLGMGMTMTVDDFKGVLQSPKAVLIGVVAQFVVMPGLAFILCKLFNLPPEIAVGVIL
FT                   VGCCPGGTASNVITYMAKGNVALSVACTSVSTLLAPVLTPAIFYLLASQWLKIDAASMF
FT                   ISILQVVLLPIVIGLILRTWLKRQVESYIQVMPLVSVIAIVAIVAAIIGGSKAAILQSG
FT                   LLILAVVILHNGLGYLLGFTAARFFKLPYADSKAIAIEVGMQNSGLGVALAAVHFAASP
FT                   ITAVPSAIFSLWHNISGPALATYWASKHKQE"
FT   gene            68115..69458
FT                   /gene="norM_1"
FT                   /locus_tag="ABBFA_00060"
FT                   /old_locus_tag="CTY05_00060"
FT   CDS_pept        68115..69458
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="norM_1"
FT                   /locus_tag="ABBFA_00060"
FT                   /old_locus_tag="CTY05_00060"
FT                   /product="Multidrug resistance protein NorM"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:O82855"
FT                   /protein_id="ATY42534.1"
FT                   /translation="MNQIFKLFIPMLSSNLIVVLSGLIDIAYVGHFSNDHVAALSVTLS
FT                   LYTVVYVIGMGILQGVMLKLSEAYGCHDIPRIRQIFIQGVWLMLCSALVSIALLYLFRD
FT                   LPKLFGASEHVVSTTKNCIWALVFILPAHLLMRLFTALSQVTENAYKVLLSDSLFFILK
FT                   IILSYLLIYGVALFSIPPLGAIGALLATIIVRWFMLAVYYLFFLEKRYIFIEHPKQSVE
FT                   DSRQSLCMILKIGIPTAIMALMDVVAFCSVAILILPFGSVVSAAYQIVASTGGFMFIFP
FT                   SSIASAYSILVSRTMGSGNMKEADKIARQSIWVIMAVSGSLSLCLWLERGLIVTFYSDD
FT                   LAVQILAASLLLIVCMSHFLDGLMTLLTSLLRCWDVSILPMLIFLVVVLCFGLGGGWWM
FT                   AYKGLHWGSHSISAMGIYGFWSMAAISYLVACVLSAFCFRFRKQLRGF"
FT   gene            complement(69468..69941)
FT                   /locus_tag="ABBFA_00061"
FT                   /old_locus_tag="CTY05_00061"
FT   CDS_pept        complement(69468..69941)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABBFA_00061"
FT                   /old_locus_tag="CTY05_00061"
FT                   /product="hypothetical protein"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /protein_id="ATY42535.1"
FT                   /translation="MLLISACLIGEPVRYDGRSCLHTTLKQLFLNKKAHALCPELLGGF
FT                   TTPRLPAEIVGGTGQDVLDGKAKIMDSSSLDVTELYLKGAYRTLDIAQQIQATCVVLKE
FT                   NSPSCGSQKIYNGTFQGEKITGVGITTALLQRHGFEVISENEIEEWLAAHPLC"
FT   gene            70464..71519
FT                   /gene="hpd"
FT                   /locus_tag="ABBFA_00062"
FT                   /old_locus_tag="CTY05_00062"
FT   CDS_pept        70464..71519
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hpd"
FT                   /locus_tag="ABBFA_00062"
FT                   /old_locus_tag="CTY05_00062"
FT                   /product="4-hydroxyphenylpyruvate dioxygenase"
FT                   /EC_number="1.13.11.27"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:P80064"
FT                   /protein_id="ATY42536.1"
FT                   /translation="MDILENPLELCGFAFIEFVSKENELDPIFETIGFSKVAKHKSKKA
FT                   YLWRQGNINIILNYQPESYASFFFNEHGPSACAMGFKTRDAAKAFKKAVELGAEPMYSK
FT                   VGPMELNIPAIKGIGGMPIFLVDRDIYENDFVFFDDAQRNPEGAGLKEIDHLTHNVYKG
FT                   RMEYWANFYEKIFNFQEIRYFDIKGEYTGLTSKALTAPDGMIRIPLNEDSDKGNGQIAE
FT                   FLADFNGEGIQHIAFICDDLISTWDKLKGLGLKFMTPPPNTYYEMLEERLPEHGEPTEE
FT                   LKQRGILLDGSTKDGQKKLLLQIFSENMIGPVFFEFIQRKDDDGFGEGNFKALFESIER
FT                   DQIRRGVLEAK"
FT   gene            complement(71584..72363)
FT                   /gene="iclR"
FT                   /locus_tag="ABBFA_00063"
FT                   /old_locus_tag="CTY05_00063"
FT   CDS_pept        complement(71584..72363)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="iclR"
FT                   /locus_tag="ABBFA_00063"
FT                   /old_locus_tag="CTY05_00063"
FT                   /product="Acetate operon repressor"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:P16528"
FT                   /protein_id="ATY42537.1"
FT                   /translation="MIEEKISGGVQSLEVGLSVLNALLEHNQPIILKDLSSKLEMHPAK
FT                   VHRYLVSLIRMDYAKQLEDGQYALGDQAWRLGLNCIQHSDTLQLVQHLIYDLQSKIGCG
FT                   IQISKWSPKGPVVVQSIESNHPISIVTKVGSIMPLVNSAAGRLFASYLPEHFVRPLLET
FT                   EWQKHQELGLNIAPHNWEEFLELKETIRQQQMSAAKGDLLTGINAVGLPVFNSNQGIEF
FT                   CIVALDSEMFLPVDPQSKIIETLKNEINSINQYIKSR"
FT   gene            complement(72663..73211)
FT                   /locus_tag="ABBFA_00064"
FT                   /old_locus_tag="CTY05_00064"
FT   CDS_pept        complement(72663..73211)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABBFA_00064"
FT                   /old_locus_tag="CTY05_00064"
FT                   /product="fosfomycin resistance protein FosB"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="protein motif:CLUSTERS:PRK04101"
FT                   /protein_id="ATY42538.1"
FT                   /translation="MTFAIKKIHHVAYRCKDAKETVEWYKKMLNMDFILAFAEDHVPST
FT                   KAFDPYMHLFLDAGQGNVLAFFELPTQPEMGRDENTPQWVQHIAFEVEDLNALLAAKKH
FT                   LEDNGVKVLGITNHGIFHSIYFFDPNGHRLELTYNDAHAEEKIAKITEEMKTEMLEEWS
FT                   KTKRAPHHTHFLHEEELGA"
FT   gene            complement(73229..73861)
FT                   /gene="nagL"
FT                   /locus_tag="ABBFA_00065"
FT                   /old_locus_tag="CTY05_00065"
FT   CDS_pept        complement(73229..73861)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nagL"
FT                   /locus_tag="ABBFA_00065"
FT                   /old_locus_tag="CTY05_00065"
FT                   /product="Maleylpyruvate isomerase"
FT                   /EC_number="5.2.1.4"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:O86043"
FT                   /protein_id="ATY42539.1"
FT                   /translation="MKLYSYFRSSAAYRVRIGLNLKSLAYETVPVHLVKNEQQSEDYLK
FT                   LNRSALVPTFVDGDLTLSQSLSILEYLDEQYPETKLLPNDVKERAKIRAFAQAIACDIH
FT                   PLNNLRVLKYLKNDLNVSDEQKNYWYQHWILEGFQTLEQQLQDSNGQFCFGQHATIADC
FT                   CLIPQVYNAKRFKIDLSAFPKIESIYQHCLSIPAFYNAAPEQQPDWE"
FT   gene            complement(73848..75155)
FT                   /locus_tag="ABBFA_00066"
FT                   /old_locus_tag="CTY05_00066"
FT   CDS_pept        complement(73848..75155)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABBFA_00066"
FT                   /old_locus_tag="CTY05_00066"
FT                   /product="Fumarylacetoacetate (FAA) hydrolase family
FT                   protein"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="protein motif:Pfam:PF01557.12"
FT                   /protein_id="ATY42540.1"
FT                   /translation="MEQKLNSFIEVSPQSDFTIHNLPYGIFSRTAEGERQVGVAIGDWV
FT                   IDLAALEKHGLLKLSDQDTYFNQPTLNKFIESGKANWSKVRKTLQSLLSVDNLTLQENE
FT                   ALRQEVLVKQDSVTLHLPIQVPGYTDFYSSKEHATNVGCMFRDPKNALLPNWSELPVGY
FT                   NGRASSVVVSGTHVVRPSGQIKLPNEERPVFSATRKLDFELETAFIVGKPTQLGQPIAI
FT                   EDAWDHIFGMVLLNDWSARDIQQWEYVPLGPFNAKTFASSISPWVVTLEALEPFKVEGP
FT                   KQEPKPLAYLQENIANTYDINLSVEIQSPKSAQPDVICRTNFKYMYWSMAQQLTHHTIG
FT                   GCNVQVGDLMGSGTISGSTPDSYGSLLELTWNTTKPLTLANGETRGFLQDGDTLIMKGH
FT                   CEKNGIRIGFGEVRNTVLPALTFDFAETSEPNYEAV"
FT   gene            75514..76902
FT                   /gene="aroP_1"
FT                   /locus_tag="ABBFA_00067"
FT                   /old_locus_tag="CTY05_00067"
FT   CDS_pept        75514..76902
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroP_1"
FT                   /locus_tag="ABBFA_00067"
FT                   /old_locus_tag="CTY05_00067"
FT                   /product="Aromatic amino acid transport protein AroP"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:P15993"
FT                   /protein_id="ATY42541.1"
FT                   /translation="MSTQEQGNLKHGLSNRHIQLIALGGAIGTGLFLGISQSIKLAGPS
FT                   VILGYAIAGFIAFLMMRQLGEMVVEEPVSGSFSHFAYKYWGPFAGFMSGWNYWVLNVLV
FT                   CMAELSAIGLYIQYWWPQIPTWASALTFFILINGINLLHVKFFGEMEFWFSIVKILAIL
FT                   AMIGFGSYLLATGTAGPQASISNLWALGGFFPFGIEGLVMAMAVIIFAFGGIELFGITA
FT                   AEARDPDKTLPKAVNQIIYRILIFYIATLFVLFSLFPWNQMAEGGSPFVMVFASLDSQG
FT                   VATLLNFVILTAAVSVYNGTSYCSSRMLLGLAQQGNAPKALARINKRGIPTNAVLVSAF
FT                   VTVLCVLLNYIFPEKAFGLLMMLVVAAIVINWVVISWTHLKFRKFMQRQGQTTKFPSFM
FT                   YPFSNYLCMAFMLGILVVMSLTPDMRVAVMMIPGWILCLMVAYQFKRRKIKAEQPVHAL
FT                   EADM"
FT   gene            77065..77748
FT                   /locus_tag="ABBFA_00068"
FT                   /old_locus_tag="CTY05_00068"
FT   CDS_pept        77065..77748
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABBFA_00068"
FT                   /old_locus_tag="CTY05_00068"
FT                   /product="Peptidase M15"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="protein motif:Pfam:PF08291.5"
FT                   /protein_id="ATY42542.1"
FT                   /translation="MKRYLGLLVLSLVACSTQTPQPTITHRSPSLPQPSKTVVKIKQQP
FT                   EDYIVWIATADHRQSVQAYKQFLKQKGLADLVPDHELLRSARDWQKCGVEPYAVPPREI
FT                   WSNIVPTLNILKALVDDGVINDFEVTSVYRALALNRCAGGADASRHVFNAALDFRIGPE
FT                   QPSDLDQFNIQQTKTKLCQFWATKGQAFNMGLGVYASGQIHIDSQGFRAWGPDHHYRTS
FT                   ICQGL"
FT   gene            77891..79156
FT                   /gene="yciC_1"
FT                   /locus_tag="ABBFA_00069"
FT                   /old_locus_tag="CTY05_00069"
FT   CDS_pept        77891..79156
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yciC_1"
FT                   /locus_tag="ABBFA_00069"
FT                   /old_locus_tag="CTY05_00069"
FT                   /product="Putative metal chaperone YciC"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:P94400"
FT                   /protein_id="ATY42543.1"
FT                   /translation="MISLNIIQRDQAMHTAIANSFAKLPVTVLSGFLGAGKTTLLNHIL
FT                   NNREGRRIAVIVNDMSEVNIDAALVREGGAELSRTDEKLVEMSNGCICCTLREDLLVEV
FT                   RRLADEGRFDQLVIESTGISEPLPVAETFTFEDEDGNSLNEFARLDTMVTVVDAFNFLK
FT                   DYSSVDSLQQRGESLGEQDERTVVDLLIDQIEFCDVIVLNKIDLIDQAQQDQLIAILKT
FT                   LNPRARIEIAQFGKVALDKILNTQLFDFDEAAQAPGWLKELRGEHTPETEEYGISSFVY
FT                   RARRPFHPERFYDLVQAEWPGVVRSKGFFWLAAEPTLAYSWSQAGAMARHGLAGYWWAA
FT                   VAEEDWPSDLASIEQIKKNWDARTGDARQELVLIGMQMDEQALIQRLDSCLLSDEEIAL
FT                   GPQVWQSWSNPFKQDDETMLIA"
FT   gene            complement(79191..80303)
FT                   /gene="oatA"
FT                   /locus_tag="ABBFA_00070"
FT                   /old_locus_tag="CTY05_00070"
FT   CDS_pept        complement(79191..80303)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="oatA"
FT                   /locus_tag="ABBFA_00070"
FT                   /old_locus_tag="CTY05_00070"
FT                   /product="O-acetyltransferase OatA"
FT                   /EC_number="2.3.1.-"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:Q7A3D6"
FT                   /protein_id="ATY42544.1"
FT                   /translation="MRNYKIDILRGISILLVLLHHFNIPYKLKDTWLGFDFLGEAFSTV
FT                   IARNGNYGVTMFFVISGFLITHHTLKRDKQFSAINLKHFYIRRAARILPCLVLLILGVS
FT                   ILGSFDLKPFMNQAPNGIEVSYPLTIFAALTFWMNILIIKFGWVNYALGVLWSLSVEEV
FT                   FYFVFPLLCLLTRSNKVFIAVLVGVILYGPYFRSLHFGEESGAYLYHYFSSFDGIAVGC
FT                   LMAIFSHKYQPNWTYKKPLSWLIILSMTALYLYAPIKEVSTWGISLFALATGLLILCFQ
FT                   HPSETQAHSLFTKVMVWLGQRSYETYLFHLVVLGLMKVAFIPAQTDSSIKIMLLIGYLV
FT                   LTFIISAAIEKYYSTPLNSYIRKVFIKDKS"
FT   gene            80656..81408
FT                   /gene="yvoA_1"
FT                   /locus_tag="ABBFA_00071"
FT                   /old_locus_tag="CTY05_00071"
FT   CDS_pept        80656..81408
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yvoA_1"
FT                   /locus_tag="ABBFA_00071"
FT                   /old_locus_tag="CTY05_00071"
FT                   /product="HTH-type transcriptional repressor YvoA"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:O34817"
FT                   /protein_id="ATY42545.1"
FT                   /translation="MPRTSKQEHTELSIEADSPVPLYQRVKQLISQKIYEGSWAVNKKI
FT                   PSESELVNQLGCSRMTVNRALRELTTEGLLVRIQGVGSFVAEGQGRTALFQINNIADEI
FT                   IARNHKHHAEVLVLEQIYANAEQSVLMQTREGQKLFHSIIVHYENDVPVQVEDRLVDAA
FT                   LIPDYLEQDFKTITPNAYLMAKAPVTEGEHIVEAVLASPQECKWLKITKAEPCLLIRRR
FT                   TWSNKQLISSARLIYPGSRYYLEGKFNP"
FT   gene            81405..81980
FT                   /locus_tag="ABBFA_00072"
FT                   /old_locus_tag="CTY05_00072"
FT   CDS_pept        81405..81980
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABBFA_00072"
FT                   /old_locus_tag="CTY05_00072"
FT                   /product="hypothetical protein"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="protein motif:CLUSTERS:PRK11396"
FT                   /protein_id="ATY42546.1"
FT                   /translation="MIELIRADQYTKMLWKNGAGFTLEIARSQGEADFEWRISMADVTT
FT                   SGPFSLFPNKQRIISVLDGQGMVLHVDNLPAKKLKQGDIFAFHGESQVQSELVDGAIRD
FT                   LNLIYDPAKFHARFQWLNEAAEQAFISSADLIFIFNQGGETEVNVDDDFVQLAAHETLK
FT                   IEKNASVTSINFPKKQLKSCYIIELIQR"
FT   gene            82232..83908
FT                   /gene="hutU"
FT                   /locus_tag="ABBFA_00073"
FT                   /old_locus_tag="CTY05_00073"
FT   CDS_pept        82232..83908
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hutU"
FT                   /locus_tag="ABBFA_00073"
FT                   /old_locus_tag="CTY05_00073"
FT                   /product="Urocanate hydratase"
FT                   /EC_number="4.2.1.49"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:Q9HU83"
FT                   /protein_id="ATY42547.1"
FT                   /translation="MTTMTTKFRDVEIRAPRGTELTAKSWLTEAPLRMLMNNLDPDVAE
FT                   NPKELVVYGGIGRAARNWECFDKIVDTLKNLETDETLLVQSGKPVGVFKTHKDAPRVLI
FT                   ANSNLVPHWANWEHFNELDAKALAMYGQMTAGSWIYIGSQGIVQGTYETFVEAGRQHYN
FT                   GDLKGRWVLTAGLGGMGGAQPLAATLAGACSLNIECQQASIDFRLRTRYVDEQATDLDD
FT                   ALARIDRYTKEGKAISIALHGNAAEILPELVRRGVRPDMVTDQTSAHDPLNGYLPVGWT
FT                   WDEYRERAKKEPEAVVKAAKQSMAKHVQAMLDFQKMGVPTFDYGNNIRQMAKEEGVANA
FT                   FDFPGFVPAYIRPLFCRGIGPFRWAALSGDPEDIYKTDAKVKELIPDDEHLHHWLDMAR
FT                   ERISFQGLPARICWVGLGLRAKLGLAFNEMVRSGELSAPIVIGRDHLDSGSVASPNRET
FT                   EAMQDGSDAVSDWPLLNALLNTAGGATWVSLHHGGGVGMGFSQHSGVVIVCDGTDEAAA
FT                   RIARVLTNDPATGVMRHADAGYEIAINCAKEQGLHLPMITQ"
FT   gene            83996..85534
FT                   /gene="hutH"
FT                   /locus_tag="ABBFA_00074"
FT                   /old_locus_tag="CTY05_00074"
FT   CDS_pept        83996..85534
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hutH"
FT                   /locus_tag="ABBFA_00074"
FT                   /old_locus_tag="CTY05_00074"
FT                   /product="Histidine ammonia-lyase"
FT                   /EC_number="4.3.1.3"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:P21310"
FT                   /protein_id="ATY42548.1"
FT                   /translation="MELLIQPGKLTLADLRQAYLNPIKVKLDESASSAINASVACVEQI
FT                   VNEGRTAYGINTGFGLLASTKIAPEDLEKLQRSLVLSHAAGVGEALDDAMVRLIILLKA
FT                   NSLARGFSGIRRKVIDALLALINAEVYPHIPLKGSVGASGDLAPLAHMSLVLLGESKAR
FT                   YKGEWLPAVEALKIAGLEPISLAAKEGLALLNGTQVSTAYALRGLFEAEDLFAAATVCG
FT                   GLSVEAMLGSRAPFDARIHEVRGQRGQIDVAAAYRDLLTDSSEISRSHEECGKVQDPYS
FT                   LRCQPQVMGACLTQIRQAAEVLEIEANAVSDNPLVFAEQGDVISGGNFHAEPVAMAADN
FT                   LALAIAEIGSLSERRISMMMDRHMSQLPPFLVANGGVNSGFMIAQVTAAALASDNKALA
FT                   HPASVDSLPTSANQEDHVSMAPNAGKRLWYMADNVRGILAVEWLGACQGLDFREGLKSS
FT                   PKLEQARKILRDQVPYYSEDRFFAPDIEQASELLASGCLNELLIPKLLPSLSEV"
FT   gene            85599..87011
FT                   /gene="proY"
FT                   /locus_tag="ABBFA_00075"
FT                   /old_locus_tag="CTY05_00075"
FT   CDS_pept        85599..87011
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="proY"
FT                   /locus_tag="ABBFA_00075"
FT                   /old_locus_tag="CTY05_00075"
FT                   /product="Proline-specific permease ProY"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:P0AAE2"
FT                   /protein_id="ATY42549.1"
FT                   /translation="MSQNSTLQRGLNTRHIRFLALGSAIGTGLFYGSATAIKMAGPSVL
FT                   LAYIVAGIAIYIVMRALGEMAVHNPVSGSFSHYASQYIGPLAGFTTGWTYVFEMVIVAI
FT                   ADVTAFGIYMGFWYPDVPRWIWILSLIMFLGAINLIHVKVFGELEFWLSIVKVSAIVAM
FT                   ILGGLGLMFYGFHADHSSVVPGIQNLWIYEGFMPHGIAGLVACLSVVVFAFGGIEIIGI
FT                   TAGESQDPKTTLPKAINAVPVRILLFYVLTIFVLMSIFPWNQIGSQGSPFVQIFENLGI
FT                   KSAANILNIVVVTAAISAINSDVFGAGRMLYGMANRGQAPRIFQKLSRNGVPWMTVVVM
FT                   AGVLLIGVVLNYLIPENVFVIIASIATFATVWVWLMILLSQVAMRRKLSTAEIKALDFP
FT                   VFGWPYAPAFAIGFMVFILVMMGYFPDSRPAIYVGITWLALLTIAYRIWVKPEQSLGKE
FT                   SEPVQQNIEMES"
FT   gene            87063..88268
FT                   /gene="hutI"
FT                   /locus_tag="ABBFA_00076"
FT                   /old_locus_tag="CTY05_00076"
FT   CDS_pept        87063..88268
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hutI"
FT                   /locus_tag="ABBFA_00076"
FT                   /old_locus_tag="CTY05_00076"
FT                   /product="Imidazolonepropionase"
FT                   /EC_number="3.5.2.7"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:Q8U8Z6"
FT                   /protein_id="ATY42550.1"
FT                   /translation="MKKLWQNCHIATMQNGQYSYIEDAAIVTEGHLIHWIGKQQQLPAD
FT                   TYSETVDLNGAWVTPGFIDCHTHSVFGGNRSVEFEKRLQGVSYAEIAASGGGIASTVRA
FT                   TREASEEQLLNSALKRIRCMQQDGVTTIEIKSGYGLNYENERKMLRVIRQIGEKLPMTV
FT                   KSTCLAAHALPPEYKDQSDAYIEHICTEMLPKLHAEGLVDAVDAFCEHLAFSPAQVERV
FT                   FKTAQSLGLPVKLHAEQLSSLGGSSLAARYHALSADHLEYMTEDDVKAMAESGTVAVLL
FT                   PGAFYLLRETQYPPIESLIKHGVRIALSSDLNPGTSPALSLRLMLNMGSTLFRLTPEQA
FT                   LAGITIHAAQALGLEQTHGSLEQGKVADFVAWDIEHPSEIVYWLGGDLPKRVVQHGQEV
FT                   IF"
FT   gene            88246..89199
FT                   /gene="hutG"
FT                   /locus_tag="ABBFA_00077"
FT                   /old_locus_tag="CTY05_00077"
FT   CDS_pept        88246..89199
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hutG"
FT                   /locus_tag="ABBFA_00077"
FT                   /old_locus_tag="CTY05_00077"
FT                   /product="Formimidoylglutamase"
FT                   /EC_number="3.5.3.8"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:Q9KSQ2"
FT                   /protein_id="ATY42551.1"
FT                   /translation="MDKKLFFKRCHMNHTFKWQGRHDGEGEVHQRIHHIVNTTQHAEFA
FT                   LIGFSSDEGVKRNKGRVGAADAPDAIRTQLANLPIHRPVSIVDLGTVTCEYGNLEQAQS
FT                   ELAEQVANSLEHGLKPVVLGGGHEVAFGSFSGLFQYVQAHAPDKKIGIINFDAHFDLRE
FT                   AEHATSGTPFLQAARLSEQHQKQFNYLCIGVANHANTKILFDTADALNCSYLRDHEVNI
FT                   FNLNNVLAAVDAFIEKVDCLYVTIDLDVFAAAVAPGVSAPAVKGIDLATFEAIFKHIQE
FT                   SGKIKLLDIAECNPKFDLDNRTAKLAAYIVYQYLFS"
FT   gene            89454..91280
FT                   /locus_tag="ABBFA_00078"
FT                   /old_locus_tag="CTY05_00078"
FT   CDS_pept        89454..91280
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABBFA_00078"
FT                   /old_locus_tag="CTY05_00078"
FT                   /product="hypothetical protein"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /protein_id="ATY42552.1"
FT                   /translation="MKNRTLHFACISVLFWMSHSSNAATPEINTNTIEKSQSKQKSDIS
FT                   VRVKALNQLLQEQWEYTLKNSPETATVLGDLRYNDRWTEFSKTQIEKDKKSTQNFLKRF
FT                   EAIDSTGFSATDQLNKDLMIYQLKETLKNYDLKLYEMPFNQMWGLHLQFPGFISAIPFD
FT                   NTKQYQDYIARLKQIPLILDQGIQLAKQGQKDGLMPPKYLIEKVAKQINSIATPAGKDS
FT                   VFASPLKQFPKNISKAEQERLSREILQTIDQNVRPAYQKLGAFIQKDYLPHGRQHEGIW
FT                   SLPNGDELYRFYVENNTTTLESPENIHQLGLKEVARIEAEMLKIAKAQGFNDLKSFQQS
FT                   LKTNPAVFPKSREEILEIYRGYIAQMQPELPKLFGLLPKNKVEVLPVEQYREKEAAGAE
FT                   YHQGTPDGSRPGQVYVNTGDFSERSKISMEATAYHEAIPGHHMQIDIAQNLPNLPMFRK
FT                   QPNHTAYIEGWALYAEQLGKDVGFYKDPLSDYGRLSSELFRACRLVVDTGVHYKKWTRQ
FT                   QMIDFMREHSALDEPDIQAETDRYIAIPAQALAYKMGQLKILELRELAKHELGDRFDIK
FT                   AFHDMVLNAGTLPLNILDARIKNWIKEQKVAA"
FT   gene            91380..92018
FT                   /locus_tag="ABBFA_00079"
FT                   /old_locus_tag="CTY05_00079"
FT   CDS_pept        91380..92018
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABBFA_00079"
FT                   /old_locus_tag="CTY05_00079"
FT                   /product="5'-nucleotidase"
FT                   /EC_number="3.1.3.5"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:Q9I767"
FT                   /protein_id="ATY42553.1"
FT                   /translation="MEKNLKEYQAIIFDLDGTLADSFHFFLSVLNQLSAKYKFKSVELH
FT                   EVEQYKHLSPKEIMKEMNVSRWKLPWIAKDFIRLMKERDQEVYMFEGMRDHLMELHKRG
FT                   YTLAIITSNSKENCQSILGKELCELFSHIDGGSSIFGKAKRIKRVLNILNLNKEQAIYV
FT                   GDQTTDGEAAHKAGIDFAAVGWGYTSAEKLKTIQPKVVLTDLATMKEFF"
FT   gene            92042..92842
FT                   /gene="racE"
FT                   /locus_tag="ABBFA_00080"
FT                   /old_locus_tag="CTY05_00080"
FT   CDS_pept        92042..92842
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="racE"
FT                   /locus_tag="ABBFA_00080"
FT                   /old_locus_tag="CTY05_00080"
FT                   /product="Glutamate racemase 1"
FT                   /EC_number="5.1.1.3"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:P94556"
FT                   /protein_id="ATY42554.1"
FT                   /translation="MNNNNNPIGMIDSGLGGLSLFKHIRQALPNEDIIYFADSKYVPYG
FT                   DKESDWIVSRTTHLISNLVTQGKCKAIVVACNTMTAVAIETIRAQISVPLIAIEPAVKP
FT                   AVAITQSKHIAVLATATTVKGKNLKSLIETYAQDIKVSLVPCIGLAEKIETGKAYTAEV
FT                   KDYLENILAPLVEQKVDTIILGCTHYPFVSDTIQEIVGRDIQIIEPSEAVTAQLIRQLN
FT                   QYHLNSESPNEGNHIIWTSSDPLEVADITFSLLGTQLPVKAIEK"
FT   gene            93556..93840
FT                   /locus_tag="ABBFA_00081"
FT                   /old_locus_tag="CTY05_00081"
FT   CDS_pept        93556..93840
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABBFA_00081"
FT                   /old_locus_tag="CTY05_00081"
FT                   /product="hypothetical protein"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /protein_id="ATY42555.1"
FT                   /translation="MKLHKFILFLNLVFGVYSITNDDANAQQEFKRICLSDEHLQASCN
FT                   CVCQQLAQVYSPQTVQRLKHTSLQSPDLPQDFAPNLFSSIQRCDKNKMG"
FT   gene            94319..95386
FT                   /gene="ydiO"
FT                   /locus_tag="ABBFA_00082"
FT                   /old_locus_tag="CTY05_00082"
FT   CDS_pept        94319..95386
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydiO"
FT                   /locus_tag="ABBFA_00082"
FT                   /old_locus_tag="CTY05_00082"
FT                   /product="putative BsuMI modification methylase subunit
FT                   YdiO"
FT                   /EC_number="2.1.1.37"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:O34939"
FT                   /protein_id="ATY42556.1"
FT                   /translation="MKVIDFFSGCGGASEGLRQAGLDITIGLDFDIKAAETYQANFPEA
FT                   LFYNVDIRELDEKELAKAFKEKNREKEPLLFVACAPCQPFSTQNKSKSEDDIRRTLLDE
FT                   THRFISKLKPEYILVENVPGLQKIDKEKDGPYKRFITFLESKKYKITEFIAKSEEYGVP
FT                   QKRKRFVLLASKSGKIEIPAKTHGEGLEPIKTVRDFIGEFPAIKAGEIHPDDLWHRSPT
FT                   LNERNLVRIQNTPEGGDRRHWPNHLINECHKAHSGHMDVYGRMSWDKPAPTLTTRCYSY
FT                   SNGRFGHPDTNQHRAISVREASRLQTFPQDFIFKGSVVEASRQIGNAVPCEMAKQFGLS
FT                   ILKHYEEVKNKNGKD"
FT   gene            95373..98366
FT                   /gene="mprB"
FT                   /locus_tag="ABBFA_00083"
FT                   /old_locus_tag="CTY05_00083"
FT   CDS_pept        95373..98366
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mprB"
FT                   /locus_tag="ABBFA_00083"
FT                   /old_locus_tag="CTY05_00083"
FT                   /product="Signal transduction histidine-protein
FT                   kinase/phosphatase MprB"
FT                   /EC_number="2.7.13.3"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:O53895"
FT                   /protein_id="ATY42557.1"
FT                   /translation="MAKIKTRARTLDMLGRQQIAGIPTALSELFKNAHDAYADNVEVDY
FT                   IRKKNLLILRDNGLGMTRAEFEDRWLTIGTDSKFEDEDAIEKPAIDINKDKRPVMGEKG
FT                   IGRLAIAAIGPQVLVMTRSKRDNELGELVVSFINWSLFSLAGLDLSDIDIPILTKQHGE
FT                   NATFEDVESLKHQAIENVKHLSNKISASKINKICNEIESFSYDPNFWRNALNKQDENSR
FT                   LIANRDYLQVCDTGCGTHFIISPVDSVITNEIDESDDKEVSKLKKVLLGFSNTIQNDRK
FT                   PRINASFRDHNLAGETIDHIAEQEFFTPDDIELADHYFAGNVNQFGQFSGKGKIFKQLF
FT                   DNVPINWKNIDNSPISCGPFRIVLAAVQGTKKETLLSPELHEYLRGKTIKLGGIYIYRD
FT                   DIRVLPYGGPDVDFFGVEKRRTYRAADSYFSNRNMICYIELTRENNSTLQEKAGREGFI
FT                   ENKAYKQFRSIIENFFISVAKQYFVESGELAETFKFEKERNKKNYDALEKRAKLKNEKK
FT                   KQLVKDLDGFFEHFKDENFTTLILNKKIEIENKVYSFNENLVDYDSFITNIELEKVKFL
FT                   EDLKSKFNIKIPSGVGFNREISNRIDKYNLVKENFLIELEKFNSNLNKLFVDFENKYGN
FT                   KVDLKKRITDSLIQQEESYKQSISQLYSETNSAIKELTEWATKEIRRNKEEGFKALVQL
FT                   QTEVASVDFSSKSNEELIELKSTVEKQFQNLSETVSNSLKDIQTQINTSREQTSENTLS
FT                   SSRLVSILETEYEVLKEQQEENLEMIQLGMAFGVIHHEFNHNILRVRRGIKDLTPWAKA
FT                   NPKLQEIYDNIRTGFDHLDGYLRTFTPLSRRLTRRKSIITGEALSLFLKEIFSERLEKE
FT                   NVEMLFTTEFLNFKIQAFSSTLYPAIVNLVDNAIYWANKSSSLQKKVKLHADNENLFIA
FT                   DTGPGVPLIDRENIFEFGFSRKIGGRGMGLYIARQTLERDGFNLELEEFDPEIGAVFKI
FT                   SHIEVEGD"
FT   gene            98371..100071
FT                   /locus_tag="ABBFA_00084"
FT                   /old_locus_tag="CTY05_00084"
FT   CDS_pept        98371..100071
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABBFA_00084"
FT                   /old_locus_tag="CTY05_00084"
FT                   /product="hypothetical protein"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /protein_id="ATY42558.1"
FT                   /translation="MNTQVQVVSPQNFFDESRSIAEKFIQTVVAVDDNISFIERPNSVN
FT                   NSDLNVQVPDDESGLGTSSVGTHELSLDAPDLNNDLNYQELSACFADKSILCSALKAYE
FT                   GEDGEQKTIEATFNISKKADITILDWQMERDQSNYGNIAKGAIKKLLQYDVDGNGRLRL
FT                   ILIYTSESIPTVLRALKDQFTEFQPKIENEKEIQFSFESLSLCKVVVINKQTNIESLVD
FT                   RSIEEFTHMTCGLLSNATLAAITEIRDKTHHHLYKFNKKLDAAYISHVLGLISSPAMRE
FT                   NAHEVAFDYGIDLLAEEIKSDLQISSQVKKSLSKDVLQNWPNFIIEKNPETIFKFKIGD
FT                   SFEVPVTLERVKRILSVTDKSEFENILEEEPKFLLDSSSGTIAKTFSDKYIQFMINDDN
FT                   LQEHLELSAIQCTRRNMKNRGSYVPTLKQGVIVKRREDKKFYVCIQPLCDSVRVKDLTN
FT                   FTFLRISKVPNAKPMTHVIHGVDVPYLAFDVDPKSKNIYMAQFLPDPSEKMVKAELCNQ
FT                   KYIFKAGDEVFEWCGEFKQPIFQGIVNDVSASLARVGFDSFEWLRQRKS"
FT   gene            complement(100740..102578)
FT                   /gene="glmS"
FT                   /locus_tag="ABBFA_00085"
FT                   /old_locus_tag="CTY05_00085"
FT   CDS_pept        complement(100740..102578)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glmS"
FT                   /locus_tag="ABBFA_00085"
FT                   /old_locus_tag="CTY05_00085"
FT                   /product="Glutamine--fructose-6-phosphate aminotransferase
FT                   [isomerizing]"
FT                   /EC_number="2.6.1.16"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:P17169"
FT                   /protein_id="ATY42559.1"
FT                   /translation="MCGIVGGVAERCVTEILIEGLKRLEYRGYDSAGVALLNKQQILRE
FT                   RRVGKVINLEDAVADQQLTGTIGIAHTRWATHGKPTENNAHPHMSGKVAVVHNGIIENY
FT                   QELKDDLQALGYVFTSQTDTEVVAHLVAEALKNTDSLLEAVESVVPQLKGAYALGIIHS
FT                   DYPDELITVREGSPLVIGVGIGENFISSDQLALLPVTNRFIYLEEGDIARLTRTSIEVF
FT                   VKGERVERPVKELDATVSSASKGEYKHYMLKEIYEQPEAIKQTISQALDGNNLRDDFLK
FT                   DADADFSKLQSVQIIACGTSYHSGMIAKYWFEQLIGVPCQVEIASEFRYRTPVIVENTL
FT                   YICISQSGETADTLAALRETQKRAKANNIDIQTLTICNVATSSMVRETDHHLLTLAGPE
FT                   IGVASTKAFTTQLAALMLLILKIGQVKQRISNVMIEELARELWHSPKVILDTLKQDAEI
FT                   LRLSELFVEKQHCLFLGRGTHYPIALEGALKLKEISYIHAEGYAAGELKHGPLALVDTE
FT                   MPIVILAPNDEMLDKLKSNMEEVQARGGELFVFADENSGVVEKDRQHVVQIPAVNEWLA
FT                   PIIYSVPVQLLSYHVAVLRGTDVDQPRNLAKSVTVE"
FT   gene            complement(102591..103955)
FT                   /gene="glmU"
FT                   /locus_tag="ABBFA_00086"
FT                   /old_locus_tag="CTY05_00086"
FT   CDS_pept        complement(102591..103955)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glmU"
FT                   /locus_tag="ABBFA_00086"
FT                   /old_locus_tag="CTY05_00086"
FT                   /product="Bifunctional protein GlmU"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:A4TSJ5"
FT                   /protein_id="ATY42560.1"
FT                   /translation="MSTTVIILAAGKGTRMRSQLPKVLQPLAGRPLLGHVIKTAKQLLA
FT                   ENIITIYGHGGDHVKKTFAQENIQWVEQAEQLGTGHAVQMTLPVLPKDGISLILYGDVP
FT                   LVRQTTLEQLIEVSNKTGIGMITLHVDNPTGYGRIVRQDGKIQAIVEHKDATEAQRQIQ
FT                   EINTGIYCVSNAKLHEWLPKLSNENAQGEYYLTDIVAMAVADGLEIASIQPELAFEVEG
FT                   VNDRLQLAALEREFQKQQAKELMQQGVTFADPARFDLRGTVKVGHDVRIDVNVIIEGNC
FT                   ELGDFVEIGAGCILKNTTIAAGTKVQAYSVFDGAVVGENTQIGPFARLRPGAKLANEVH
FT                   IGNFVEVKNTTIGLGSKANHFTYLGDAEIGAESNIGAGTITCNYDGANKHKTTIGDAVF
FT                   IGSNSSLVAPVTIGNGATVGAGSVITKDVAEQSLSFERAQQISKANYQRPQKLKK"
FT   gene            complement(103972..104487)
FT                   /gene="pgpA"
FT                   /locus_tag="ABBFA_00087"
FT                   /old_locus_tag="CTY05_00087"
FT   CDS_pept        complement(103972..104487)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pgpA"
FT                   /locus_tag="ABBFA_00087"
FT                   /old_locus_tag="CTY05_00087"
FT                   /product="Phosphatidylglycerophosphatase A"
FT                   /EC_number="3.1.3.27"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:P18200"
FT                   /protein_id="ATY42561.1"
FT                   /translation="MDTNTLHKPPIHFKDMSWFNRCIVFCGVGFGSGLAPKAPGTFGSA
FT                   FALLFVPIWLSLGFTLSLIAILIMSVVGIYICGQTAKVINVHDDGRIVWDEFAGQSITF
FT                   LPLLYLQQINWIWVITGFILFRIFDVWKPWPIRVIDRQVHGGFGIMLDDIIAGVWAALC
FT                   TLIIIHLS"
FT   gene            complement(104465..105382)
FT                   /gene="thiL"
FT                   /locus_tag="ABBFA_00088"
FT                   /old_locus_tag="CTY05_00088"
FT   CDS_pept        complement(104465..105382)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiL"
FT                   /locus_tag="ABBFA_00088"
FT                   /old_locus_tag="CTY05_00088"
FT                   /product="Thiamine-monophosphate kinase"
FT                   /EC_number="2.7.4.16"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:P0AGG0"
FT                   /protein_id="ATY42562.1"
FT                   /translation="MAEFSIIDQYFNRQSHPDVALGIGDDSALITPPPNQQLVICADTL
FT                   VAGRHFPLETSPHAIGWKSVAVNLSDIAAMGAKPHSILLAISLPQVDHEWLEGFSQGIY
FT                   DCCNQFGVALIGGDTTQGPHLTITVTAMGWIETGKAVLRSGAKVGDYVCVSGQIGDAAY
FT                   GLQHLGHSLQQRLDYPTPRCKLGEELKGLASSMIDVSDGLAQDLGHILKASKVGARLIL
FT                   EKLPVDPVLQQIEEQQRWQYALAGGDDYELCFTITPQNYEKLLQKQLDVKITMIGQIVE
FT                   QTKLTFEHLGSDYPLQIHGYQHFA"
FT   gene            complement(105398..105847)
FT                   /locus_tag="ABBFA_00089"
FT                   /old_locus_tag="CTY05_00089"
FT   CDS_pept        complement(105398..105847)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABBFA_00089"
FT                   /old_locus_tag="CTY05_00089"
FT                   /product="hypothetical protein"
FT                   /note="N utilization substance protein B homolog"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:Q3K652"
FT                   /protein_id="ATY42563.1"
FT                   /translation="MSQTLQAAYAAKRKARRFAVQGIYEWQMSHNPVHEIEARTRAENA
FT                   MHKVDLNYYHELLTQVIAQHEDLDALLIPVLDREIDALDGVELATLRLGAYELRDHLEI
FT                   PYRVVLDEAIELAKHFGGADSHKYINGVLDRLSSTLRSAEKQQAK"
FT   gene            complement(105851..106321)
FT                   /gene="ribH"
FT                   /locus_tag="ABBFA_00090"
FT                   /old_locus_tag="CTY05_00090"
FT   CDS_pept        complement(105851..106321)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ribH"
FT                   /locus_tag="ABBFA_00090"
FT                   /old_locus_tag="CTY05_00090"
FT                   /product="6,7-dimethyl-8-ribityllumazine synthase"
FT                   /EC_number="2.5.1.78"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:P99141"
FT                   /protein_id="ATY42564.1"
FT                   /translation="MAIRRIEGLLHLASEGRYAILVGRFNSFVVEHLLEGAIDTLKRHG
FT                   VNEDNITVIHAPGAWELPIVAKKLATSNQFDAIIALGAVIRGSTPHFDFVAGECAKGLG
FT                   VVALESSLPVINGVLTTDSIEQAIERSGTKAGNKGSEAALTAIEMVNLLKAI"
FT   gene            complement(106333..107454)
FT                   /gene="ribBA"
FT                   /locus_tag="ABBFA_00091"
FT                   /old_locus_tag="CTY05_00091"
FT   CDS_pept        complement(106333..107454)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ribBA"
FT                   /locus_tag="ABBFA_00091"
FT                   /old_locus_tag="CTY05_00091"
FT                   /product="Riboflavin biosynthesis protein RibBA"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:A5U2B7"
FT                   /protein_id="ATY42565.1"
FT                   /translation="MPLSRVEELVADIRAGKMVILMDDEDRENEGDLVIAATHVRPEDI
FT                   NFMITHARGLVCLTLSRERCKQLNLPLMVDQNGAQHGTNFTLSIEAAEGITTGISAAER
FT                   AHTIQAAVAAHAKPTDIVQPGHIFPLMAQPGGVLHRAGHTEAGCDLARLAGLEPASVIC
FT                   EIIKEDGTMARRADLEIFAEKHGLKIGTIADLIHYRMTNEQTVERLDQRMIQTEYGSFE
FT                   LYRYREIGNPDIHLALVKGEPKEGVTTVRVHGFSPVRDLLKLNKADGEPAWNLDRALQT
FT                   IAASDRGVLVWIGQDHLQDLGPALDDLTKPKPVKSNAALSHQYQTIGVGAQILRDLGVE
FT                   KMKLLSSPLRFNALSGFNLEVVEYVTADQITTK"
FT   gene            complement(107694..108983)
FT                   /locus_tag="ABBFA_00092"
FT                   /old_locus_tag="CTY05_00092"
FT   CDS_pept        complement(107694..108983)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABBFA_00092"
FT                   /old_locus_tag="CTY05_00092"
FT                   /product="hypothetical protein"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /protein_id="ATY42566.1"
FT                   /translation="MIAPRQGLFASLLIISFALHTFLLVIATTHQLNENRASQGQLMTS
FT                   QLVADSLSELEPANTVSLALIANRYATNPSVASIRILDANKQVLATSGMSKTRQGEIFV
FT                   RDALQNEKKVGSIEITLIQPSIGEILRTQWLAILASLFLHVLLWLAYRAIARPTRSEYL
FT                   ARINEENRLKHEIQELTQALALEKQNTVTLVAQAQQQAKAKPIVRSQPEKSLESTDQNT
FT                   LALNIQFYDPKQLLSSVNQSVSVPYFKLCQLFLNKSIELCTKHYHLKANDIDVVDEFHA
FT                   EGATLAISTSHPHAVECLLMVGTVFQLLSDVLYKRYREDKRFALQTRSAVCNAVEAMQI
FT                   DAKEAAQRLAQHLHAKESALYLDNEQLKAIQDSYQLVAMPNPSNVMTRHAFMINGMNAE
FT                   CAELAQNIRTEILMGKKSIPQNDSPSSAAS"
FT   gene            109061..110284
FT                   /gene="serB"
FT                   /locus_tag="ABBFA_00093"
FT                   /old_locus_tag="CTY05_00093"
FT   CDS_pept        109061..110284
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="serB"
FT                   /locus_tag="ABBFA_00093"
FT                   /old_locus_tag="CTY05_00093"
FT                   /product="Phosphoserine phosphatase"
FT                   /EC_number="3.1.3.3"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:A0QJI1"
FT                   /protein_id="ATY42567.1"
FT                   /translation="MREIILISFLGPDQPNQFTRLMQVLSVHSLQILDVGQAVIHNQLT
FT                   LGIVVASENETATALAMKEILILAHDIGLTVRFKPISGAEYDQWVSEGGRTRYIVTALA
FT                   PELTAAHLQAVTQIVSSQGFNIETVTRLSGRVDLEKDSTLPRRACVQFGLSSGPTLDAQ
FT                   AMRAACLLLSSELNIDVAVQEDNAYRRNRRLVCFDMDSTLIEQEVIDELALEAGVGEQV
FT                   AEITERAMQGELDFQQSFRARVALLKGLDASVLPKIAERLTITEGAERLISTLKALGYK
FT                   TAILSGGFQYFAEYLQAKLGIDEVHANVLDVQDGVVTGEVKGVIVDGARKAELLRELAN
FT                   KLGISLEQAMAVGDGANDLPMLAIAGLGVAYRAKPLVRQNANQAISSVGLDGVLYLLGM
FT                   HDKDLSRA"
FT   gene            110694..111029
FT                   /locus_tag="ABBFA_00094"
FT                   /old_locus_tag="CTY05_00094"
FT   CDS_pept        110694..111029
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABBFA_00094"
FT                   /old_locus_tag="CTY05_00094"
FT                   /product="hypothetical protein"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /protein_id="ATY42568.1"
FT                   /translation="MVTANFAAIAGLSLIAVALVAVFFSPYRRWLGFMLAGMFFWGLLE
FT                   VVRFGVQVTFEMPVTYSYLTALSLAMVMVTFVLLREDKQAQKALANRQYIEHTPVYEDD
FT                   QQQCSSR"
FT   gene            111277..111762
FT                   /locus_tag="ABBFA_00095"
FT                   /old_locus_tag="CTY05_00095"
FT   CDS_pept        111277..111762
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABBFA_00095"
FT                   /old_locus_tag="CTY05_00095"
FT                   /product="hypothetical protein"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /protein_id="ATY42569.1"
FT                   /translation="MFMKLSSIPVVKLPLVDVSTDPLDLLVAGLAVRMKQLARTSPKFI
FT                   ELVHDRAFRIQIGTDLGVARQIIINHGHIDTVAGSPEKADFILQFADSEQGVKTLLKGD
FT                   PTAFMTGMQDGSIKMEGDFSLLVWFNQAAKLIPPKLPKPVKDKVRQARAFIKEKTGR"
FT   gene            complement(111802..112245)
FT                   /gene="dtd"
FT                   /locus_tag="ABBFA_00096"
FT                   /old_locus_tag="CTY05_00096"
FT   CDS_pept        complement(111802..112245)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dtd"
FT                   /locus_tag="ABBFA_00096"
FT                   /old_locus_tag="CTY05_00096"
FT                   /product="D-tyrosyl-tRNA(Tyr) deacylase"
FT                   /EC_number="3.1.-.-"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:P0A6M4"
FT                   /protein_id="ATY42570.1"
FT                   /translation="MRALIQRVLEAKVVVDGETTGEIQHGLLVFLGIGREDTLATGQKL
FT                   IDKILKYRIFDDEQGKMGWNVSQANGGILLVSQFTLMAQTQKGLRPDFGPAMPPSDAKA
FT                   LYEQLVEYTRSQFENVQTGVFAADMKVHLINDGPVTFNLEVEA"
FT   gene            112414..113628
FT                   /gene="pncB2"
FT                   /locus_tag="ABBFA_00097"
FT                   /old_locus_tag="CTY05_00097"
FT   CDS_pept        112414..113628
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pncB2"
FT                   /locus_tag="ABBFA_00097"
FT                   /old_locus_tag="CTY05_00097"
FT                   /product="Nicotinate phosphoribosyltransferase 2"
FT                   /EC_number="6.3.4.21"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:Q9HW26"
FT                   /protein_id="ATY42571.1"
FT                   /translation="MSPIIHSLLDTDLYKFTMLQVVLHKFPQTHSVYHFRCRNLEDTVY
FT                   PLVDILDDLNEQLDHLCNLKYKEDELQYLRKLRFIKSDFVDYLELFQLKRRFIHASIDE
FT                   EGRLDIRIEGPMVQAMMFEIFVLAIVNELYFSRIKTDEVWAEGERRLQAKLELIQQYEK
FT                   AQQPNDPPFLVSDFGTRRRYSFEWQKHVVAAFHNTVPNVFRGTSNVLLAKELNITPIGT
FT                   MAHEFLQAFQALDVRLRDFQKAALETWVQEYRGDLGIALTDVVGMDAFLRDFDLYFAKL
FT                   FDGLRHDSGDPYEWGDKAYAHYRKLKIDTKTKMLTFSDGLNLPKAWELHQYFKDRFQVS
FT                   FGIGTNLTNDMGQTPLNIVLKLVECNGQSVAKISDSPGKTMTDNDTFLAYLRQVFQIEE
FT                   LDEAI"
FT   gene            113773..114627
FT                   /gene="rhdA"
FT                   /locus_tag="ABBFA_00098"
FT                   /old_locus_tag="CTY05_00098"
FT   CDS_pept        113773..114627
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rhdA"
FT                   /locus_tag="ABBFA_00098"
FT                   /old_locus_tag="CTY05_00098"
FT                   /product="Thiosulfate sulfurtransferase"
FT                   /EC_number="2.8.1.1"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:P52197"
FT                   /protein_id="ATY42572.1"
FT                   /translation="MTMTLPDFKLDLLIEAEELVPYLGNEYIRIVDLSRASVYEQLHVP
FT                   HAIHLQPKWLVAQHEEATGVLPDEAGLQALIEKLNISPNHHVVVYDDEGGAWAGRLIWN
FT                   LHCLGFTRTSLINGGIHAWLGAGLPTTAEVEELPRVDNLIQIDLSHAAQFRVNYEELRK
FT                   QVEQESVQLWDCRTSDEYSGVRLAARRGGHIPNALHFEWSTALNRQNHLKLHPLERTRQ
FT                   RLEQLGFDLKQPVVVYCQSHHRSGLAYILARLLGWEAKAYDGAWSEWGNRLDSPIITGE
FT                   SPS"
FT   gene            114624..115475
FT                   /gene="psd"
FT                   /locus_tag="ABBFA_00099"
FT                   /old_locus_tag="CTY05_00099"
FT   CDS_pept        114624..115475
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="psd"
FT                   /locus_tag="ABBFA_00099"
FT                   /old_locus_tag="CTY05_00099"
FT                   /product="Phosphatidylserine decarboxylase proenzyme"
FT                   /EC_number="4.1.1.65"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:P0A8K1"
FT                   /protein_id="ATY42573.1"
FT                   /translation="MSFTSRLKKELFIKAQNLVPQHQLSRVVGKVAASENPILKAAVIH
FT                   AFKTKYGIDLSIAEQGNALKYKSFNDFFTRALKDGVRLVDENPDSIVSPADGAISQIGK
FT                   ITAGEVFQAKGQSFSVEKLIGDPQLAQPFQEGEFATVYLSPRDYHRVHMPFSGTLTETL
FT                   YVPGELFSVNQVTAENVPGLFARNERMVCLFDTELGRMAVVLVGAMIVAGIETVATGKV
FT                   KPSGRIELQHHELKLEKGAELGRFYLGSTAIILFEKDKIEWEKRFKAESVVVMGERMGH
FT                   TL"
FT   gene            115694..116890
FT                   /locus_tag="ABBFA_00100"
FT                   /old_locus_tag="CTY05_00100"
FT   CDS_pept        115694..116890
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABBFA_00100"
FT                   /old_locus_tag="CTY05_00100"
FT                   /product="Secretory lipase"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="protein motif:Pfam:PF03583.8"
FT                   /protein_id="ATY42574.1"
FT                   /translation="MIRKSNSLLKILFSSICLISGSAMAAPITDLSKQIVSEKPGSILS
FT                   IAQQDVTDLFPHADQRLLVNYRSRGVNDEPIVASAFILLPKGTPPKNGWPVLAWAHGTT
FT                   GVADTCAPSGDYAGGPVHSYQEVASKALEGWLARGYAVVAPDYQGLGTLGAHPYMNAKS
FT                   QLHTVVDAVRALHMLKPKDFNKQWLVMGHSQGGAAAITVAAYGQKDAPELDLKGAIALA
FT                   PGGYQYEGIAEYVLSHPNPEPSVAAFFPIVLLGAQAAEPSIIPENLVSPEMGNVLTQAR
FT                   SRCLSELQSDLKKSPSSIFRPNVDLKPLLSYLKQQSIENMVPTVPLMIVQGSKDHLVDP
FT                   RGTYAYYQQLCKSKKPTIYQSIDGGDHRDALRQSHTFATHFLNVIEKKQAKSYCSNFK"
FT   gene            complement(116960..118318)
FT                   /gene="phoR"
FT                   /locus_tag="ABBFA_00101"
FT                   /old_locus_tag="CTY05_00101"
FT   CDS_pept        complement(116960..118318)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phoR"
FT                   /locus_tag="ABBFA_00101"
FT                   /old_locus_tag="CTY05_00101"
FT                   /product="Phosphate regulon sensor protein PhoR"
FT                   /EC_number="2.7.13.3"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:P08400"
FT                   /protein_id="ATY42575.1"
FT                   /translation="MYEPYPVPEQVREQKLSRYSSLWTFAKQDLRLLLFFLIIAGLVGL
FT                   GIGYFWSCIFIAFVVFFTLQLRSLYLVNDWIANNPYDVPPNLNGIWGALLFNVYRAQRQ
FT                   ERIVQAEMVGLIDRAQSSLVALAEAVVLIDDQHQIEWWNPAAERLLGISPLDRGRNLLT
FT                   ILRQPTFIEYFNNIDQAPDGIKLHSNFDDDRYVQVKLTRFGGESRLLVAYDVTRMHNLE
FT                   QMRKDFVDNISHELRTPLTVLSGYIETFTDQEDINPRWKRAFDQMQSQTKRMNALVNDL
FT                   LLLSNLENNKKIAKNQIIEMPSLMNQLFDDAQAYNADYGHTLNLHIDSHCDLIGSDMEI
FT                   ASAFSNLITNAIKYTPKGGTITIGWHDDGEHAYFSVQDTGIGINPKHLPRLTERFYRVD
FT                   SDRSRQTGGTGLGLAIVKHVLMQHGAYLDVQSKENEGSTFTAVFPKERLYNMT"
FT   gene            complement(118328..119038)
FT                   /gene="phoB"
FT                   /locus_tag="ABBFA_00102"
FT                   /old_locus_tag="CTY05_00102"
FT   CDS_pept        complement(118328..119038)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phoB"
FT                   /locus_tag="ABBFA_00102"
FT                   /old_locus_tag="CTY05_00102"
FT                   /product="Phosphate regulon transcriptional regulatory
FT                   protein PhoB"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:P0AFJ5"
FT                   /protein_id="ATY42576.1"
FT                   /translation="MKDDYILIVDDELPIREMIHTSLDMAGFQCLQAEDAKQAHQIIVD
FT                   QRPALILLDWMLPGGVSGVDLCRRLKRDENLAEIPVIMLTARGEEDHKVQGLDAGADDY
FT                   MTKPFSTRELVSRIKAVLRRANALSGEKTIDANGLILDPVSQRVSFGNSILDMGPTEYR
FT                   LLAFFMTHPERAYTRAQLLDQVWGGNVYIEDRTIDVHIRRLRKVLEPFGVDRFVQTVRG
FT                   TGYRFSTRADLAAG"
FT   gene            complement(119294..119965)
FT                   /locus_tag="ABBFA_00103"
FT                   /old_locus_tag="CTY05_00103"
FT   CDS_pept        complement(119294..119965)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABBFA_00103"
FT                   /old_locus_tag="CTY05_00103"
FT                   /product="DNA-binding transcriptional regulator EnvR"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="protein motif:CLUSTERS:PRK09975"
FT                   /protein_id="ATY42577.1"
FT                   /translation="MATNDSTSKKKTKTVSKERQFKGLSLSERKEARREKLIEAGIATY
FT                   GTLGFFSVTVKDVCQEAKLTERYFYESFKKSEDLFQTIFLKMIEELQQNLMQAVIKAAP
FT                   DPEQMVDAGLRALLSTLKDDPRLARIVYVDAILVQELHNQATIQETLAQFDRMIQAFVM
FT                   LTMPQIQHNENELSLIATGLNGYVTQIAVRWVMGGFKQSLEQVLAACRIVFLALLAKVS
FT                   K"
FT   gene            120162..120995
FT                   /gene="sadH_1"
FT                   /locus_tag="ABBFA_00104"
FT                   /old_locus_tag="CTY05_00104"
FT   CDS_pept        120162..120995
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sadH_1"
FT                   /locus_tag="ABBFA_00104"
FT                   /old_locus_tag="CTY05_00104"
FT                   /product="Putative oxidoreductase SadH"
FT                   /EC_number="1.-.-.-"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:O53302"
FT                   /protein_id="ATY42578.1"
FT                   /translation="MKNFKNKVAAITGAGSGIGQQLAILLAKQGCHLSLSDINEKGLEK
FT                   TVELLKPYSNITVTTKKLDVSDREAVKQWAQETVQDHGCVNLIFNNAGVALGSTVEGAT
FT                   YEDLEWIVGINFWGVVYGTKEFLPFIKQTQDGHIINISSLFGLTAQPTQSGYNATKFAV
FT                   RGFTESLRQELDIEKCGVSSLCVHPGGIRTNIAKAAKMSDSLSSLGMDPTKSIQNFDKL
FT                   LRTPPEEAARQILDAVLKNKRRLLIGSDAKILDAFQRLFPTGYQRASTIVTKWMK"
FT   gene            complement(121052..122419)
FT                   /gene="mepA"
FT                   /locus_tag="ABBFA_00105"
FT                   /old_locus_tag="CTY05_00105"
FT   CDS_pept        complement(121052..122419)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mepA"
FT                   /locus_tag="ABBFA_00105"
FT                   /old_locus_tag="CTY05_00105"
FT                   /product="Multidrug export protein MepA"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:Q7A7N0"
FT                   /protein_id="ATY42579.1"
FT                   /translation="MPPRQSLIHQQNLWKTFFVFLLPLIATNILQNLSGTINTIFVGQM
FT                   MGVDAIAAVSVYFPILFLLLAFIIGISTGTTVLVGQAWGAQDIEKVQSVVGSTLFMTII
FT                   GGIITAIIGVFFAHDILELLGTDPKVMHLSLPYVQWMLAGSPLLFVYIIYTSILRGVGD
FT                   STTPLLALALTSVIGVIITPILLKGYFGFPALGIIAPAIASIISYIAILIFLAIYLNKK
FT                   KHPLRPNRQLLQHIRHNSALSKIILRLGVPTGIQMITTSMAGLVIVGLVNRFGAHATAA
FT                   YGAVNQVLNYIQFPAISISIAASIFAAQAIGAGKSDLLARVTRTALGMNFLFTGALIAL
FT                   GYLFSKYLMALFITDPTVVVLGQQLLFIVLWAILFFGAGAIFASIMRASGTVTVPMLIN
FT                   ISAILFIEMPCAYWFSSMWGLKGIWVAYALAFVSLCIIQGLYYQFIWKKKKIKVLI"
FT   gene            complement(122526..123680)
FT                   /gene="ybdL"
FT                   /locus_tag="ABBFA_00106"
FT                   /old_locus_tag="CTY05_00106"
FT   CDS_pept        complement(122526..123680)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybdL"
FT                   /locus_tag="ABBFA_00106"
FT                   /old_locus_tag="CTY05_00106"
FT                   /product="Methionine aminotransferase"
FT                   /EC_number="2.6.1.88"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:P77806"
FT                   /protein_id="ATY42580.1"
FT                   /translation="MLQLQSKFPAQGVTIFSTMTAMAQRLGALNLSQGFPDFPAPPALL
FT                   EALSQATLAGHNQYPPGDGILALREQLALQFQQRDQLQLDPVTQITITPGATIAIFCAI
FT                   QACINTGDEVIIFDPSYDSYGPSVELAGGKAVHIALQAPDFKVNWQQVKDRINDKTRMI
FT                   VVNTPHNPTGTIWSEQDWLELIALIQDKNIVVLSDEVYEHLVFDGQQHFSALHFPELRE
FT                   RSFVIGSFGKTFHVTGWKTGYCVASPDLMRLFRQIYQYVNFCGTTPCQIALAQYMQQHP
FT                   EHIQELSQFYQTKRDRFNQAIHNSRFLLKSSQGTYFQNLDYSQIRPDLNDVEMCQFLAE
FT                   QHKIVAIPVSVFYQQAPESLRLIRFCFAKNDETLQKAGEILNQC"
FT   gene            complement(123708..125018)
FT                   /locus_tag="ABBFA_00107"
FT                   /old_locus_tag="CTY05_00107"
FT   CDS_pept        complement(123708..125018)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABBFA_00107"
FT                   /old_locus_tag="CTY05_00107"
FT                   /product="hypothetical protein"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /protein_id="ATY42581.1"
FT                   /translation="MNMAEEVHHAPNLKRSKYFATMALIIVVVLWIGLLIANRFLPEHT
FT                   DLIHILMLGAEAGVVGGLADWYAITVLFRNPFGKLPIPKFLRDHTEIIPRNKARIAESM
FT                   GRFVQENFLSPQVVERSLEKTDLSLAIGQWLASPQNNTQVVQLIQQTVPKVFEFVSQEQ
FT                   IANFVQNNSVQWVRNTQVNKLASEMLRAVLENDFHQDVLQRGLDIAHEWVVQNPDKTRE
FT                   LTRKMFKALGVWSLAKGASWIGIDVQQRTIDSLVEKVESMLADHEHPWRQEIETIAHSL
FT                   MLELANPESIASQRLNSGKDALLDSPQVLNFISGAVTILCDAIKEDLMKEDSGIAMNLR
FT                   AAIQQLGENLVQNVKVREVLNKEMTGLAMNFTDQYSHKIIRYVSERIHEWDSREMIGKI
FT                   ENEVGGDLHMIRVNGVVVGAFIGLTLGVIRAAIESIL"
FT   gene            complement(125032..125595)
FT                   /locus_tag="ABBFA_00108"
FT                   /old_locus_tag="CTY05_00108"
FT   CDS_pept        complement(125032..125595)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABBFA_00108"
FT                   /old_locus_tag="CTY05_00108"
FT                   /product="hypothetical protein"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /protein_id="ATY42582.1"
FT                   /translation="MKYLSLCLALGTAITLSACSTVPSKPKTFDQLGQFSAYPLNAQTF
FT                   RISFQADPNMSYGAAEEITLVKSAQTTVQKGFRFFKVLNDPSNQSQKPPRQAVVYPSAP
FT                   SFYPYGYYRRYPGFWHDPFYDFPQVVNIDPVQVSYTIECYRDQKQAPQDAFDATLILKS
FT                   IGQKYGLSPTGELLPPPEPPVKQK"
FT   gene            complement(125655..126194)
FT                   /locus_tag="ABBFA_00109"
FT                   /old_locus_tag="CTY05_00109"
FT   CDS_pept        complement(125655..126194)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABBFA_00109"
FT                   /old_locus_tag="CTY05_00109"
FT                   /product="hypothetical protein"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /protein_id="ATY42583.1"
FT                   /translation="MNDQDILNFWFSPEHRSLWFAKSEDFDAKIRDQFADVHRQATRAE
FT                   LWSWRKTPEGRLAEIIVLDQFSRNIYRDQPESFAYDGLALALSQEAISLQLDAQLNPEQ
FT                   RSFLYMPFMHSESKLIHEFALKLFQRLGNEINLSFEKKHKVIIDRFGRYPHRNAILGRV
FT                   STPEETEFLLEPNSSF"
FT   gene            126363..127940
FT                   /gene="gshA"
FT                   /locus_tag="ABBFA_00110"
FT                   /old_locus_tag="CTY05_00110"
FT   CDS_pept        126363..127940
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gshA"
FT                   /locus_tag="ABBFA_00110"
FT                   /old_locus_tag="CTY05_00110"
FT                   /product="Glutamate--cysteine ligase"
FT                   /EC_number="6.3.2.2"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:P0A6W9"
FT                   /protein_id="ATY42584.1"
FT                   /translation="MSQPTTPSQSVIPAWVDSSLLQGMLRGIERESLRMQSNGFLSQEL
FT                   HPKALGSALTHPKITTDYSEALMEFITSPQPTIGDALHELTDIHAVVHRHLENGEKLWP
FT                   LSMPCMLDDNEERIRLAQYGTSNIGRFKTLYRRGLGIRYGRRMQTISGVHYNLSFPDSL
FT                   FSALQAHETDEKLKALSLQDYRSHRYFGLIRNFIRLTPLVMFLVGASPSVCRCFLTGHE
FT                   HHLLPLIKGSYYLPYATALRMGRLGYQNSAQKSLGIHYNNLTGYLDGLQKAVHSPYPPF
FT                   SRLGLNDASGEPLQINDHVLQIENEYYSLVRPKQVPQAGETPSQALKNRGVGYVELRAV
FT                   DVNPYSAIGVNETTAGFLEALALYCLLSDSPELLCPEQDLIEKNQTEVVNRGRAPNATI
FT                   TDLNGSYHIEDWARQHISKMQDCARLLDQTYATDLYSSALAVMQERIDEVDETLSAHVI
FT                   DDTLKHGGTWSFGSHMAQLHAETYEKHEISAETLQYFEQLAVQSLQQQEQLEQDSQISF
FT                   DQYLEQYR"
FT   gene            127955..128470
FT                   /gene="dsbB"
FT                   /locus_tag="ABBFA_00111"
FT                   /old_locus_tag="CTY05_00111"
FT   CDS_pept        127955..128470
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dsbB"
FT                   /locus_tag="ABBFA_00111"
FT                   /old_locus_tag="CTY05_00111"
FT                   /product="Disulfide bond formation protein B"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:P0A6M2"
FT                   /protein_id="ATY42585.1"
FT                   /translation="MRLSYRLVSGLLVLASIVGMSFALYLEHVKGLEPCPLCIFQRVGL
FT                   MAMGFVALIAFLHNPVSNAIKRFYAFLAGVAILWSVGVAGRHVWLQHLPPDQVPSCGPG
FT                   LNYLIDALPMKTVLQEVLSGSGECAAIDWTFLGQSLPVWSLVYFLLLLLVCLWQLFRFY
FT                   PVFKTAKK"
FT   gene            128636..131941
FT                   /locus_tag="ABBFA_00112"
FT                   /old_locus_tag="CTY05_00112"
FT   CDS_pept        128636..131941
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABBFA_00112"
FT                   /old_locus_tag="CTY05_00112"
FT                   /product="VgrG17"
FT                   /note="Predicted VgrG T6SS tip protein. Required for the
FT                   delivery of Tae17; (Previously published as VgrG3;
FT                   Fitzsimons et al. 2018, Infect Immun 86: pii: e00297-18).
FT                   Pfam05954, Pfam13296, Pfam10106"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="protein motif:Pfam:PF04717.6"
FT                   /protein_id="ATY42586.1"
FT                   /translation="MLFNIFSVLEKIGLNAQKRAIHVQFSNELLNHQVFLQRIEGQHQL
FT                   NGGLMAELICLSTNAQIALKQFIGVQVAVDQVTDSGQLFRTTGIVTEASYGQSDGALTL
FT                   YKLTIEDATNLWHKRRNSRVFMNKSIVEITEVLFKEWQEKSPLFAASLSLDLGGLSQNY
FT                   DIRPFTMQHNESDYDFLTRLWRSEGVSWLIDESELFVPHFTAPIQAQKLRLIDDNNQYQ
FT                   ALARRSIRYHRSSATEYQDSITGFVAVRSLQPTAVHVQRWQPDALAQEEGNGSVVTTHT
FT                   HSDNFDSATLSLEQAWHVSPAWMQDLKGEDQATASSSSQLEKLNQHFTDMHASRAKYFK
FT                   AYSSVRDTQVGYWFNLREHPEIDQHEGADQEFLIIAKNFYNQNNLPKDLHQQVSQLLTQ
FT                   SRWDQHGYDDIERQSNELTLIRRQIKTAPEYNPEQHRPIAYPQRAKVVGPEGETIHVDE
FT                   WGRIKVRFLFTRSDDHGHDGGAGSNDNDTDSAWVDVLTPWAGEGYGARFLPRIGEVVVI
FT                   DFFDGNIDRPFVTGRIHEAQRSPTKFDVKGQLPDTKKLSGIRSQEVNGSGFNQLRFDDT
FT                   TGQISTQLQSSHAATQLNLGNLSHPKEQATSQGRGEGFELRTDAWGAVRAGKGMLISTY
FT                   AQEQAIADHLEAAQAQSLLSQGYESMKMLSEVAAKQQTDALNVINRLPKFIQSLELKTT
FT                   GQALNSTVNLFKEGINNDPIHALKDCGGFIQDIGALGGNAKGVVDEFNSFFSDAKDAVE
FT                   NLKAFIENVEEHGPDIVKGKLASIKDRIHKNPFESIQEVGRVLANVETKDFDLMSTCGT
FT                   FSKGSKLEVSPSKALSSLQGFMEGYTQGLESSSDTKQQEQGKIFRQALMLLASPNGIAL
FT                   TTPENIILQASQDIAESASGSINLSAQKNIIGHAQDKISLFAAQKGLRAYAAKGKLELQ
FT                   AQDDAIEAIAKKVIKLISTEEKIELTSPKEIVLTAGGSQLKINANGVFSTTGGKFESKA
FT                   GQHLFTSGAKVSYEVPELPSSFDYSNRIDLYKIFQWSDFENIKYSAIFENQRVTQGNLD
FT                   ELGRTERFKSSMPDKMKVLVGYSADKWHKETEEFEDFDDYETNNDSNLNNNSN"
FT   gene            131953..133701
FT                   /locus_tag="ABBFA_00113"
FT                   /old_locus_tag="CTY05_00113"
FT   CDS_pept        131953..133701
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABBFA_00113"
FT                   /old_locus_tag="CTY05_00113"
FT                   /product="Tae17"
FT                   /note="T6SS effector protein. Demonstrated antibacterial
FT                   activity and active in the periplasm. Predicted amidase
FT                   activity. Secreted via the T6SS by VgrG17; (Previously
FT                   published as LysM; Fitzsimons et al. 2018, Infect Immun 86:
FT                   pii: e00297-18). Pfam01476"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="protein motif:Pfam:PF01476.14"
FT                   /protein_id="ATY42587.1"
FT                   /translation="MNKKGLIQFRFVELFTGNNIPNLYHVIKNEKGTTIASGMTNSNGL
FT                   TVMISRDVGDTLYVYLKNIITGDLKEKVRHTVIYKKEIVRVTSSKILLDNIILAKSTNK
FT                   PGNYRYLTHKVKKGENLSLISHRFNCKISEIVHLNKLKNPDHIDVGQIIKIPYKGGSSD
FT                   SKKSPDNKQSKHENNKSSSTQKVNSHENNNKNTSDKPQKRIESKDITDEYTKESGKPMK
FT                   VATNATSPCICKQYNLAWGSKVSCEFRKRVIKIAQNLWPNDSENMASQLMAVMHLESAG
FT                   TFSPKIGTFISKKLTDDAKGGYVGLIQFGKFASIDLKVKRSDLAKMSAVQQLDYVEKYY
FT                   KLNSAHTKIKNLTGLYLWVNYPKNVKENRLEDEDIVYAAPKDAEVTSKKFLESPYHQNP
FT                   SFMKENEEYKRDGKKVIRQGFKNGSTKVWEVEQEIKKHLTEGIKSQNLEKNYNCAYINH
FT                   TEIKNTQKINLEKFAEILRKRAKEKSQHQCAKYVRIALEAGGADTSGHPVAASDWGPTL
FT                   KKIGYKEIPEEFNKPQLGDIYIITKTDKHQYGHIAGYDGSQWISDFKQKGHRIYSDHVN
FT                   YRYFRM"
FT   gene            133723..134181
FT                   /locus_tag="ABBFA_00114"
FT                   /old_locus_tag="CTY05_00114"
FT   CDS_pept        133723..134181
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABBFA_00114"
FT                   /old_locus_tag="CTY05_00114"
FT                   /product="Tai17"
FT                   /note="Immunity protein that neutralises the activity of
FT                   Tae17; (Previously published as LysMI; Fitzsimons et al.
FT                   2018, Infect Immun 86: pii: e00297-18)"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /protein_id="ATY42588.1"
FT                   /translation="MKLLILEILCLSLLSGCASAKEAECYNTSKALITDLYNKFPINGD
FT                   EVIENKNIKTLSNFFDKNLTNLLIKDQECSARNNGVCNIDFNILIHSQDTPNKYKILQD
FT                   TDNLVTVKVEYHQYSEFINFVINKESSCKKIGNIKYDDGSDLIKMLRK"
FT   gene            134183..134539
FT                   /locus_tag="ABBFA_00115"
FT                   /old_locus_tag="CTY05_00115"
FT   CDS_pept        134183..134539
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABBFA_00115"
FT                   /old_locus_tag="CTY05_00115"
FT                   /product="hypothetical protein"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /protein_id="ATY42589.1"
FT                   /translation="MKYSILFLILLFANYTFANTEIWNGTYHYYSSEELPDGNVATIES
FT                   TLTVAPKKCVYSIVGFQVDKSYVCKVKKKNNELYFFDNKSGNRFGKVVFKKGKYYLYSP
FT                   EVLDSKDNLFIKDE"
FT   gene            134636..135373
FT                   /locus_tag="ABBFA_00116"
FT                   /old_locus_tag="CTY05_00116"
FT   CDS_pept        134636..135373
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABBFA_00116"
FT                   /old_locus_tag="CTY05_00116"
FT                   /product="hypothetical protein"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /protein_id="ATY42590.1"
FT                   /translation="MRTSFIKFHNFLLIFSVCITSNATDYKPEQLDEKTIYSNSEHELN
FT                   SVYSDIKGYISDNKNEVKYLVDTQRFWLKNRNLKCNFNGKEANSGNYKCLSDFNNSKIK
FT                   DLKNSYLDLDNLEGKLIKPFRYTNGIMKELETGGCYCSESTIKILKDKIYIYQACDQGL
FT                   KEPRIYNIVGKKKDSFSVEYQIDTNNKVPEFNLAFVTNGKNVWNIVPKIFRKEDLINLN
FT                   FGINYTTDMNIKNKKNDCHDDEE"
FT   gene            135486..136211
FT                   /locus_tag="ABBFA_00117"
FT                   /old_locus_tag="CTY05_00117"
FT   CDS_pept        135486..136211
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABBFA_00117"
FT                   /old_locus_tag="CTY05_00117"
FT                   /product="Bacterial SH3 domain protein"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="protein motif:Pfam:PF08239.5"
FT                   /protein_id="ATY42591.1"
FT                   /translation="MEKHFKFIISTVLMMGPVGSSYADFGFIQDKDGYVNVRGNSSLNS
FT                   KVTSKLNNNEIVSCVMDEGTNNFCLVNASNGVTGFVYKNRVNNFSGYNSIKLSQYSREK
FT                   SVYNDKNIIVEVYAKKAILDPKLYKTFKGEYKYFNNKKFFGTDGTLPNNNFLQLDKIII
FT                   KSKDMKIEIGKNDIEQYFFPKNGIDGDKNELADFKIYFLNNNIFILNTFNNGGAAAYNI
FT                   VLNIKNGKLVANKAWKVEI"
FT   gene            complement(136278..137621)
FT                   /locus_tag="ABBFA_00118"
FT                   /old_locus_tag="CTY05_00118"
FT   CDS_pept        complement(136278..137621)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABBFA_00118"
FT                   /old_locus_tag="CTY05_00118"
FT                   /product="PGAP1-like protein"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="protein motif:Pfam:PF07819.7"
FT                   /protein_id="ATY42592.1"
FT                   /translation="MPSLTPLHETYCKWDRTPPSQADVLEGLAQLFSTSLNGVHELIQV
FT                   INIEVLKNAFGISAQNAKNFQKRPSVQKAYQFSYGALQKYGSCFLAPGLRRIIEKFPTL
FT                   HEKPLTPTLHFLVGVLNGIFGDYLLKQHSPLALPMVLYDHYGAIQQGELAGRIVILVHG
FT                   LCMNHLTWSNAHYGGIGERLLAQRDHNTMLYLNYNTGRRISANGRSFSNLLEDLVQRNP
FT                   RITSIDLIGHSMGGLVSRSALFYGKQNMYQWIHMVENLVCIGSPHHGAVLERFGFALQD
FT                   RLGAFPFVGLIGQLVNIRSNGILDLRHGSVRDDDWEYMDARIGMMDDNRAPAPLPSHIN
FT                   TFLVAGTLEFEKVRNKALTVIGDYLVSVKSALGEHPNPRFQLKVPDSHKAVFYGLNHFE
FT                   IQYHSSVAEQITRWLYPHVNDYVQDGIQTHIIDMPNYSLEDLEGIVET"
FT   gene            137833..138414
FT                   /locus_tag="ABBFA_00119"
FT                   /old_locus_tag="CTY05_00119"
FT   CDS_pept        137833..138414
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABBFA_00119"
FT                   /old_locus_tag="CTY05_00119"
FT                   /product="esterase YqiA"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="protein motif:CLUSTERS:PRK11071"
FT                   /protein_id="ATY42593.1"
FT                   /translation="MNIIYLHGFNSSSSSIKGLSLKQYCSELGINVHLPDLNRSPEQVV
FT                   AQVSELIESLQEVALVGSSLGGFFATYFVAKYNIPAVLINPAMQPWKLFDELFQVESMP
FT                   YKVNDQWSIDHIQLRQLEQLELKQPENADKILVLLQQGDEILDYRQAQRYYSAATPSSL
FT                   ILTDAHGNHAMEDFEEKLPLVIEFFAHTIK"
FT   gene            138429..140312
FT                   /gene="parE"
FT                   /locus_tag="ABBFA_00120"
FT                   /old_locus_tag="CTY05_00120"
FT   CDS_pept        138429..140312
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="parE"
FT                   /locus_tag="ABBFA_00120"
FT                   /old_locus_tag="CTY05_00120"
FT                   /product="DNA topoisomerase 4 subunit B"
FT                   /EC_number="5.6.2.2"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:P20083"
FT                   /protein_id="ATY42594.1"
FT                   /translation="MTQYTAQSLEVLSGLDPVRRRPGMYTDTSRPNHLAQEVIDNAVDE
FT                   ALAGHADKICVTVYKDGSLSVEDNGRGMPVDIHPEYGQSGIEIILTKLHAGGKFSTDNY
FT                   QFSGGLHGVGISVVNALSTRVEVEVQRQGNLYQMAFEQGEPVAPLAVLEGKAPKRATGT
FT                   TVRFWPEAKYFDSPKFALKALKHNLKAKAVLAAGLKITYIDQINDEKIEWQFENGLVDY
FT                   LMDELQDREILPNPAFVSSGQADRAACEFAICWNVEGGEQVQESYVNLIPTAQGGTHVN
FT                   GLRSGVTEALREFCELRNLLPRNLKLSAEDVWDGVNYILSLKFQEPQFSGQTKERLSSR
FT                   EAANIVLNIAKDAFALWLNQHAEIAMQLAEMAISKAGRRLKAAKKVERKKIVSGPALPG
FT                   KLADCVGQTREESELFIVEGDSAGGSAKQARDKNFQAIMPIRGKILNTWEVSSDEVLAS
FT                   QEVHDIAIAIGVDPGSDDLSELRYGKICILADADSDGLHIATLLCALFVKHFPALVEEG
FT                   HLYVAMPPLFRIDIGKDVHYALDDEELETILKNVKGNKNPQITRFKGLGEMNAIQLRET
FT                   TMDPNTRRLVQLDLDDAHLTAGLLDKLLAKKRAADRKQWLEQKGNLADITV"
FT   gene            complement(140434..140937)
FT                   /gene="allA"
FT                   /locus_tag="ABBFA_00121"
FT                   /old_locus_tag="CTY05_00121"
FT   CDS_pept        complement(140434..140937)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="allA"
FT                   /locus_tag="ABBFA_00121"
FT                   /old_locus_tag="CTY05_00121"
FT                   /product="Ureidoglycolate lyase"
FT                   /EC_number="4.3.2.3"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:P59285"
FT                   /protein_id="ATY42595.1"
FT                   /translation="MIMKNIQIQPLTIENFQPFGEVICCDGHDFFHINDAHTERYHALV
FT                   ETEIEGEAKAGISIFRNIKASVLPMEISMLERHPKGSQAFIPLQQQKFLIIVAPALDEN
FT                   TPDISKLCAFVSDGKQSINYRAGTWHHPLLTFEAPSDFAVVDRIGGGANCDVFQFPEAI
FT                   KITV"
FT   gene            complement(140934..141944)
FT                   /gene="alc"
FT                   /locus_tag="ABBFA_00122"
FT                   /old_locus_tag="CTY05_00122"
FT   CDS_pept        complement(140934..141944)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="alc"
FT                   /locus_tag="ABBFA_00122"
FT                   /old_locus_tag="CTY05_00122"
FT                   /product="allantoicase"
FT                   /EC_number="3.5.3.4"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="protein motif:HAMAP:MF_00813"
FT                   /protein_id="ATY42596.1"
FT                   /translation="MATLHAPAFELPEILNTKTNLADARIGAQVIECSDDFFAEAKRML
FT                   QFEAPIFVEDKFDDHGKWMDGWETRRKRHAGYDWCIVKLGVSGKISALDIDTTFFTGNY
FT                   PASASLEACYAPNGDLTGVTWQSILENTELGPSQHHIFMVNNDAIFTHIRLNIFPDGGV
FT                   ARLRVYGDVHIQVTDHEQTLDLLALENGGRVIAYSDAHFGHPRNLINPGRGVNMGDGWE
FT                   TKRRRAPGYDWCILALGKSGKIEKIEIDTAHFKGNFPAEVSIQAVYLENATDAQLIPQS
FT                   MFWSYLLEAQPMQMDHIHEYVNEILKHEKISHIRINMIPDGGISRVRLWGKIAKS"
FT   gene            142144..143301
FT                   /gene="hpxO_1"
FT                   /locus_tag="ABBFA_00123"
FT                   /old_locus_tag="CTY05_00123"
FT   CDS_pept        142144..143301
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hpxO_1"
FT                   /locus_tag="ABBFA_00123"
FT                   /old_locus_tag="CTY05_00123"
FT                   /product="FAD-dependent urate hydroxylase"
FT                   /EC_number="1.14.13.113"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:A6T923"
FT                   /protein_id="ATY42597.1"
FT                   /translation="MNVVIIGAGMGGLTTGIALKKFGHQVRIFEQTEKILPVGAAISLW
FT                   SNGVKCLNYLGLTEKIAKLGGQMDDLAYVDGLTGDVMTQFSLRPLIEEVGQRPYPVARA
FT                   DLQNMLMDEFGRDQIYLGKKMVGLEDKADFVEVHFADGSSTQADLLIGADGTHSMTRAY
FT                   VLGQQVQRRYAGYVNWNGLVEISEDLAPAQQWTTYVGEGKRASLMPVADGRFYFFLDVP
FT                   LPAGLENNRDEYKKLLKQYFADWCQPVQQLIERLDPQKTNRVEIHDIEPFTQFYKGRVV
FT                   ILGDAAHSTTPDIGQGGCQAMEDAIYLARSLQINTLGLEDALRRYQNKRNERANELVLR
FT                   ARKRCDVTHMKDETVTQAWYAELRREQGGHIMQGIISNIVGNPLD"
FT   gene            complement(143354..144079)
FT                   /locus_tag="ABBFA_00124"
FT                   /old_locus_tag="CTY05_00124"
FT   CDS_pept        complement(143354..144079)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABBFA_00124"
FT                   /old_locus_tag="CTY05_00124"
FT                   /product="Nucleoside-specific channel-forming protein, Tsx"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="protein motif:Pfam:PF03502.7"
FT                   /protein_id="ATY42598.1"
FT                   /translation="MQLKQLAATCALLSATAMVQAKPIWQDFSVTGLYGENYEVVDDKE
FT                   TTITLEYAAKVKYADVFFFMDRMRGENDHKSTYFELSPRLSLGEVSGKKLAYGPIKDVL
FT                   ISTTWESNSENGNNFDNFLYGFAVDLDIPYFQYANLNFYRANNEKTDDDYQMTFVYGIP
FT                   FKIASEDFLVDGFLDWSTAEGDHASELNWTTQWKWNVGKHISPDTRLYLGIEHSVWNNK
FT                   FGIKGADENNVSALVKYHF"
FT   gene            complement(144202..145569)
FT                   /gene="pucK"
FT                   /locus_tag="ABBFA_00125"
FT                   /old_locus_tag="CTY05_00125"
FT   CDS_pept        complement(144202..145569)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pucK"
FT                   /locus_tag="ABBFA_00125"
FT                   /old_locus_tag="CTY05_00125"
FT                   /product="Uric acid permease PucK"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:O32140"
FT                   /protein_id="ATY42599.1"
FT                   /translation="MNHQQKNAISPEHEYLGISKSFAYGLQHVLTMYGGIVAPPLIIGT
FT                   AAGLSAAQVGMLIAAALFVGGLATLIQTIGTKYLGAKLPLVQGVSFAGVATMVAIITTG
FT                   GGLPAVYGAVIAASLIGLCLAPYFSKIIRFFPPVVTGCVITIIGLSLLPVAIRWMMGGN
FT                   NKAPDWGSVENISLALLTLGIVIILNILPQASIRRLSILLAIVAGTTLAYFMGFGDFSQ
FT                   VSSGAWLQFPHLFAFGLPTFELSAILSMLIVTLVIMTETTADIIAVGDIVGTQVDSKRI
FT                   ANGVRADMFSSAIAPIFGSFMQSAFAQNVGLVAITGIKSRFVVAAGGVILIILGLLPVM
FT                   GRLIAAIPMPVLGGAGLVLFGSVAASGIRTLAKIDYNDQKNLIIVATALSAGMIPIINH
FT                   EFYAHFPVWVQTLFHSGISSTCIFAILLNLLFNHLPSFRSSRTPHLSQTINTRNTH"
FT   gene            complement(145594..145917)
FT                   /gene="hiuH_1"
FT                   /locus_tag="ABBFA_00126"
FT                   /old_locus_tag="CTY05_00126"
FT   CDS_pept        complement(145594..145917)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hiuH_1"
FT                   /locus_tag="ABBFA_00126"
FT                   /old_locus_tag="CTY05_00126"
FT                   /product="5-hydroxyisourate hydrolase precursor"
FT                   /EC_number="3.5.2.17"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:Q4VYA5"
FT                   /protein_id="ATY42600.1"
FT                   /translation="MISTHILDTNLGKPAAQVEVKLFHAATHELIATAITNQDGRVSDF
FT                   GIKNLGKGAYQLEFEVAPYFSSQQIKTFFPRVCIQFFIEDTNQHYHIPLLISPFAYSTY
FT                   RGS"
FT   gene            complement(145914..146417)
FT                   /gene="uao"
FT                   /locus_tag="ABBFA_00127"
FT                   /old_locus_tag="CTY05_00127"
FT   CDS_pept        complement(145914..146417)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="uao"
FT                   /locus_tag="ABBFA_00127"
FT                   /old_locus_tag="CTY05_00127"
FT                   /product="Uric acid degradation bifunctional protein"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:Q45697"
FT                   /protein_id="ATY42601.1"
FT                   /translation="MFLAEFNQAPPDQLKTLLNNCVHIPVWAEKIISERPYSSTSVLLG
FT                   YAEQLSHTWSWQEIQAALATHPKIGERQAKKQLNAKEQNFSAQEQAGISLDEQTQQALL
FT                   QGNIEYEQKFGFIFLIKAAGLSSDEILKKLHQRLQNNLAIEKTIVHEQLAAIALLRLSQ
FT                   EVQA"
FT   gene            complement(146517..147482)
FT                   /locus_tag="ABBFA_00128"
FT                   /old_locus_tag="CTY05_00128"
FT   CDS_pept        complement(146517..147482)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABBFA_00128"
FT                   /old_locus_tag="CTY05_00128"
FT                   /product="Polysaccharide deacetylase"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="protein motif:Pfam:PF01522.15"
FT                   /protein_id="ATY42602.1"
FT                   /translation="MSESYLSGAELIEQIQKSPYSRDLIGYHGQPPEVKWPNNAKVAVQ
FT                   FVLNYEEGGEKHIEHGDEGSEQFLSEIIGAASYPAKHMSMDSMYEYGARAGFWRIHNEF
FT                   QRRKLPMTIFGVAMALVRNPYIVEAIKQADYDVVSHGYRWLHYQETDLEVEKQHMEQAL
FT                   SVLENLFGNKTIGWYTGRDSPNTRQLLAEFPQIQYDSDYYGDDLPFWTTLTDTAGASRP
FT                   HLIIPYTLECNDMKFCSPGGFNSSEQFFQYLKDSFDVLYAEGETAPKMMSIGMHCRILG
FT                   RPGRFKALQRFLDYIEMHDRVWVCRRQDIAEYWYKNHINQ"
FT   gene            147735..148085
FT                   /locus_tag="ABBFA_00129"
FT                   /old_locus_tag="CTY05_00129"
FT   CDS_pept        147735..148085
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABBFA_00129"
FT                   /old_locus_tag="CTY05_00129"
FT                   /product="Sigma 54 modulation protein / S30EA ribosomal
FT                   protein"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="protein motif:Pfam:PF02482.13"
FT                   /protein_id="ATY42603.1"
FT                   /translation="MNIEIRTDKNIHNSERLITYVRAELTQEFQRHSERITHFSVHFSD
FT                   ENGDKGGDKDIHCMIEARPSGLKPVAVHHKAGNIDASIHGAIEKLKRSLEHTFEKKEHP
FT                   RGGQPEFIDDEV"
FT   gene            148244..148789
FT                   /locus_tag="ABBFA_00130"
FT                   /old_locus_tag="CTY05_00130"
FT   CDS_pept        148244..148789
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABBFA_00130"
FT                   /old_locus_tag="CTY05_00130"
FT                   /product="Ankyrin repeats (3 copies)"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="protein motif:Pfam:PF12796.1"
FT                   /protein_id="ATY42604.1"
FT                   /translation="MLTTQQQALIKAIEELELAQVQKLLAEGLDPNFIDPEQGPPVSII
FT                   CDGIFKWWEDVSEAYEAGTPLSQEEKQQALQVYLDILEALIQAKANVHLWDAEEFYGPL
FT                   WDAASSACAPAVQRLLDEKVDPNTRDEEGLTILSSISQLFFDCDFDEIDWSEALQEERE
FT                   TLELLRRHGAKMSKELTT"
FT   gene            148802..149569
FT                   /locus_tag="ABBFA_00131"
FT                   /old_locus_tag="CTY05_00131"
FT   CDS_pept        148802..149569
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABBFA_00131"
FT                   /old_locus_tag="CTY05_00131"
FT                   /product="hypothetical protein"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /protein_id="ATY42605.1"
FT                   /translation="MRTFQILTFALTTVAAGSTFAAEFSFDRPGSGFGTGITPVGKLAW
FT                   EQGLPSATYTETTVDGVKEKTVTVNEDMLFRTGLADGLELQLGWQGPAWTQTKRAGKKT
FT                   DNSGFGDVSIGLKKAIDLNDENLTMAVLAEAVIATGNDEFTAHDDIYSLSSAVAYKYND
FT                   LLDTSITMRYEVQNSNWAVTAIPTINYKIAGKLSGYSEFVYRKAESQDYQYGLGTGLVY
FT                   AVNNRTQLDANIGVDLEGQDKSYKGGLGMAFLF"
FT   gene            149598..151412
FT                   /gene="dsbD"
FT                   /locus_tag="ABBFA_00132"
FT                   /old_locus_tag="CTY05_00132"
FT   CDS_pept        149598..151412
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dsbD"
FT                   /locus_tag="ABBFA_00132"
FT                   /old_locus_tag="CTY05_00132"
FT                   /product="Thiol:disulfide interchange protein DsbD
FT                   precursor"
FT                   /EC_number="1.8.1.8"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:P36655"
FT                   /protein_id="ATY42606.1"
FT                   /translation="MKKLISQGIIYFLVAATFVLSQFVFAEDKLLSPEQAFSFSVESPQ
FT                   SHTAKLSWQIQPNYYLYQHKFTVQQGNQPLTLNLPKAVSQYDENYGQSQVYYHQVNFQI
FT                   KTKPSEHYTVTWQGCAKDRICYPPQTIEFQTDANGLVGLQNQAGAAPKRLLDLANTQAS
FT                   SSTESLENQSSATQAEGAAPEIAQDQVWSAKLIEHSLWYGVLLFLGLGMLLAFTPCSLP
FT                   MLPILTSLIIRDHKGLKAWTIALTFVCSMALVYAGLGLIASSAGLNFQRWLQQPATLIA
FT                   FSLLFVVFALNLFGLFELRLPQTWLNRLDRIQSMQQGGTLVGAGVMGVVSALLVGPCMT
FT                   APLAGTLLFISQTQNQWQGALLLFCLGFGMGIPLLIASVLGAKFLPKAGDWMHQIKVIF
FT                   AFMMLGLSLYFIRPLLPDWGMQALSFVLGLAFIIYALYQFFWKKGQLQWLYALLFLLVT
FT                   PFVVYNQYQHIQNRSLQNSEHMAEWHVATTAADFQKILAAAPADRAIVVDVYADWCVAC
FT                   QPIEHRILKSPEVQTALVPYYLIKLDLSHYDQSHEALLKQWNILGPPTYLFLNKQQQEI
FT                   RSLRLTGAFSQQELLQQLASLSKAKDSN"
FT   gene            complement(151404..152597)
FT                   /gene="ycdT"
FT                   /locus_tag="ABBFA_00133"
FT                   /old_locus_tag="CTY05_00133"
FT   CDS_pept        complement(151404..152597)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycdT"
FT                   /locus_tag="ABBFA_00133"
FT                   /old_locus_tag="CTY05_00133"
FT                   /product="putative diguanylate cyclase YcdT"
FT                   /EC_number="2.7.7.65"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:P75908"
FT                   /protein_id="ATY42607.1"
FT                   /translation="MKIRLITRPINKIKQVILDFIHHNHIINWTPLQKSALMLTLACAM
FT                   NFSWILWKGYILITPSIWQWANLSLVESQIWLNLLTLFLLAVLIIPCYRYKDQAWAQKI
FT                   VPLISVQAFMLMLCHDGYLIGSISPATMVGYVGTIGVGLVLFERKIVYSAFIPATIILA
FT                   VCTYLSMTGVISYAPLFNFKTMRHAQTNPFWLGSMLFFIMPILVACFILFEILLTQWRQ
FT                   RETYIQRLSQIDPLTNVLNRRSLNTHLEALHEQQFDYAVILLDIDHFKKINDIYGHHQG
FT                   DQVLIEIARCLSENLRNEDIIGRFGGEEFILLLPHTDIIQAEKIAERCRQALQELTIFN
FT                   NQNIQIHVSASFGISSSAFANDPYLVIRQADQALYAVKASGRNQVRTFHQLPQIKSI"
FT   gene            complement(152773..153684)
FT                   /gene="lipR_1"
FT                   /locus_tag="ABBFA_00134"
FT                   /old_locus_tag="CTY05_00134"
FT   CDS_pept        complement(152773..153684)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lipR_1"
FT                   /locus_tag="ABBFA_00134"
FT                   /old_locus_tag="CTY05_00134"
FT                   /product="Putative acetyl-hydrolase LipR precursor"
FT                   /EC_number="3.1.1.-"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:O53301"
FT                   /protein_id="ATY42608.1"
FT                   /translation="MNIPNVLKYYFTETFLKTAIRKPSQLNLPPTALRPMLEQLCRAFP
FT                   KQKNVTVRPIRLAGIKGEEIKAQDSATQLIFHIHGGAFFLGSLKTHHAFMTDLAARTQM
FT                   QIIHVDYPLAPEHPYPEATEALYDVYQSLLVQGIQPKDIILSGDSCGANLALALCLRLK
FT                   EQPELMPSGLILLSPFLDLTLTSESLRFNQKHDALLSLEALQIGIQHYIGNHIAADDPR
FT                   VSPIFDNLEGLPPTLVQVGSKEILLDDAKRFREKAEEAGVKVHFKLYTGMWHNFQMFNA
FT                   WFEEAKQAMADIAEFAHELDKT"
FT   gene            153834..154271
FT                   /locus_tag="ABBFA_00135"
FT                   /old_locus_tag="CTY05_00135"
FT   CDS_pept        153834..154271
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABBFA_00135"
FT                   /old_locus_tag="CTY05_00135"
FT                   /product="hypothetical protein"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /protein_id="ATY42609.1"
FT                   /translation="MKKIALALGLVGMAAFANAADPLNGTVWKTIDDQTNKPKAVVKFT
FT                   EQKDGTLTATIQNILTPGEENACTKCEGPYKNKPLKGVTIVHNLKNVGGNNYENGTILD
FT                   PKSGKTYKLKGELAEGGKKLKLRGYIGVSALGRNQTWIRAN"
FT   gene            complement(154309..154659)
FT                   /locus_tag="ABBFA_00136"
FT                   /old_locus_tag="CTY05_00136"
FT   CDS_pept        complement(154309..154659)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABBFA_00136"
FT                   /old_locus_tag="CTY05_00136"
FT                   /product="putative reductase"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="protein motif:CLUSTERS:PRK10853"
FT                   /protein_id="ATY42610.1"
FT                   /translation="MLKIYGIKNCNSMKKAFDALQAKGLSYEFHDYKKQGIDADTLKIW
FT                   LKEIGQDTVLNKKGTTWKKLSEEEQTRALSSEDHLIEALIAQPSLIKRPVLQTSKGFLV
FT                   GFDETAYQNLSA"
FT   gene            complement(155115..155939)
FT                   /gene="exoA"
FT                   /locus_tag="ABBFA_00137"
FT                   /old_locus_tag="CTY05_00137"
FT   CDS_pept        complement(155115..155939)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="exoA"
FT                   /locus_tag="ABBFA_00137"
FT                   /old_locus_tag="CTY05_00137"
FT                   /product="Exodeoxyribonuclease"
FT                   /EC_number="3.1.11.2"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:P37454"
FT                   /protein_id="ATY42611.1"
FT                   /translation="MIPKDQYPSDVKILRVVSINVNGLRSSVTKGLLEWLEQSDADVVC
FT                   MQESRITHEQWTEKFRPEGWHTHLFPAERAGYAGTAIYSRLPFVSIKDGLGFELADSQG
FT                   RFISAEFDLGLSHPVHIASLYLPSGSSGEEAQARKDLFLGEYAKILKQWRDENKSIIIC
FT                   GDYNIVHKRIDIKNWSGNQKSSGCLPHERAWLDHIYDELGYVDTFRVVRTEAELYSWWS
FT                   NRGQARAKNVGWRIDYHACSPDWKARTVNAWVYKDQWFSDHAPVIIDYKIQE"
FT   gene            155978..156628
FT                   /gene="pyrE"
FT                   /locus_tag="ABBFA_00138"
FT                   /old_locus_tag="CTY05_00138"
FT   CDS_pept        155978..156628
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrE"
FT                   /locus_tag="ABBFA_00138"
FT                   /old_locus_tag="CTY05_00138"
FT                   /product="Orotate phosphoribosyltransferase"
FT                   /EC_number="2.4.2.10"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:P0A7E3"
FT                   /protein_id="ATY42612.1"
FT                   /translation="MTTPVSFHPQAFIELALSRGVLKFGEFTLKSGRVSPYFFNAGLLN
FT                   DGEALSLLAQGYADKLTQCENVDVIFGPAYKGIPFVAATAVALSQTHNKSVPWGFNRKE
FT                   AKDHGEGGILVGAAVEGKKVWIIDDVITAGTAIREVVTILKNAGATIAGVLVALDRQER
FT                   GQGELSAIQEVQKELEIPVHALITMKDLMDYLEAKGEKEALANMQAYREKYGI"
FT   gene            complement(156679..158868)
FT                   /gene="fhuA_1"
FT                   /locus_tag="ABBFA_00139"
FT                   /old_locus_tag="CTY05_00139"
FT   CDS_pept        complement(156679..158868)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fhuA_1"
FT                   /locus_tag="ABBFA_00139"
FT                   /old_locus_tag="CTY05_00139"
FT                   /product="Ferrichrome-iron receptor precursor"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:P06971"
FT                   /protein_id="ATY42613.1"
FT                   /translation="MLRISISSPQIKGSFPLSLLSLMILNIQGANAEELIDSSSKAAAT
FT                   MPTIKIEAMSELDPIKSYIDYDKANVTRNGLDKKDIPQTVDTIDVQKYKIYGSNDLSVM
FT                   LQGTPGVSTSYDMRGDGITIRGFGADTGDIYRDGIRESGQVRRSTANIERIEILKGPAS
FT                   VLYGRSAGGGVVNMVSKFANFDSKSSVGAYAGSYDNYGTTADINQVLNDNLAVRLTGEY
FT                   GEAGSFRSGIENKIEMFSPSFTYKNDDGKLTWTTQYTYDKLGRVPDRGPTRDNLPAGTS
FT                   IKMGFAQDDDYVDDILQVVRTDVNYEYAPDWNFHWAASYRQAEQNFDHFYFGNYCGLDG
FT                   KNSKNEACTKKGYIDQIYYWQQTSNKTTTNTFDIKGKFKTGQLEHQIMVGTDWTYEQRE
FT                   PRLANKTQNGSAIYGYVNPITGEREYSRGNGPLKISQHNYNEGTTYGVFIQDLIGLNDQ
FT                   LKLMMGLRYDYFDFSTTNKIKNEHRNVKDSTFSPNVGLVWQPVPEHSFYTSYSKSFAPF
FT                   GGQMGVNQVTGSTDVAKMDKEPQYNEQYEVGVKSEWFDNRLNTQFSVFDIRKNNIRYKP
FT                   NPDSEPEVWATAGQHQSRGLEFSFIGRVLDNVFVRGGYGYTDAKVKEDNQNPEREGNYL
FT                   ANTSKNTGNLFVRYLPTEQWYTEVGVTYVGSYYPNINNQVKMEGFNRVDAAIGYSADPW
FT                   NVTLAVNNLTNKEYWRSDSMPGTPRNVLLRLNYQF"
FT   gene            complement(159097..159309)
FT                   /locus_tag="ABBFA_00140"
FT                   /old_locus_tag="CTY05_00140"
FT   CDS_pept        complement(159097..159309)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABBFA_00140"
FT                   /old_locus_tag="CTY05_00140"
FT                   /product="hypothetical protein"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /protein_id="ATY42614.1"
FT                   /translation="MKLYRYLTGPDDSAFCARVTKALNHGWELYEAPTMTFNGSQVIVG
FT                   QAICKTIDENYDPEMDILDVLKNNA"
FT   gene            159471..160415
FT                   /gene="gshB"
FT                   /locus_tag="ABBFA_00141"
FT                   /old_locus_tag="CTY05_00141"
FT   CDS_pept        159471..160415
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gshB"
FT                   /locus_tag="ABBFA_00141"
FT                   /old_locus_tag="CTY05_00141"
FT                   /product="Glutathione synthetase"
FT                   /EC_number="6.3.2.3"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:P04425"
FT                   /protein_id="ATY42615.1"
FT                   /translation="MRVLVVMDPIETVNLKKDSTMAMLWAASRRGHELGYALQQDLYID
FT                   QGKAYGLISPLKVFEDYNHYYELGEKKKESIAAYDVVLMRKDPPFDMNFVYTTYVLEQA
FT                   EREGSWIINKPQSLRDCNEKLFATQFPELQVPTLVTSQQSLIREFITEHGDVIVKPLDG
FT                   MGGMGIFRLYQDGVNIGSTLEMLTELGTRPIMAQRYIPEIVEGDKRILMVNGEPIPYCL
FT                   ARIPQNGEVRGNLAAGGLGQARPLTENDKLIAAKVGPFLREKGLVFVGLDVIGNYVTEI
FT                   NVTSPTCIREIDAQFGTSIADDLFDVLEAGRPA"
FT   gene            160653..161750
FT                   /gene="murG"
FT                   /locus_tag="ABBFA_00142"
FT                   /old_locus_tag="CTY05_00142"
FT   CDS_pept        160653..161750
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murG"
FT                   /locus_tag="ABBFA_00142"
FT                   /old_locus_tag="CTY05_00142"
FT                   /product="UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide)
FT                   pyrophosphoryl-undecaprenol N-acetylglucosamine
FT                   transferase"
FT                   /EC_number="2.4.1.227"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:Q9HW01"
FT                   /protein_id="ATY42616.1"
FT                   /translation="MTDSQQSKPKHVMMMAAGTGGHVFPALAVAKQLQQQGCQVSWLAT
FT                   PTGMENRLLKDQNIPIYQIDIQGVRGNGVIRKLAAPFKILKATFSAMRYMKQLKVDAVA
FT                   GFGGYVAGPGGLAARLLGIPVLIHEQNAVAGFTNAQLSRVAKVVCEAFPNTFPASEKVV
FT                   TTGNPVRREITDILSPKWRYDEREQAGKPLNILIVGGSLGAKALNERLPPALKQLEVPL
FT                   NIFHQCGQQQVEATQALYADAPANLTVQVLPFIEDMAKAYSEADLIICRAGALTVTEVA
FT                   TAGVAAVFVPLPIAVDDHQTANAKFLADVGAAKICQQSTMTPEVLNQLFTTLMNRQLLT
FT                   EMAVKARQHAQPNATQHVVDLIQKM"
FT   gene            161762..163210
FT                   /gene="murC"
FT                   /locus_tag="ABBFA_00143"
FT                   /old_locus_tag="CTY05_00143"
FT   CDS_pept        161762..163210
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murC"
FT                   /locus_tag="ABBFA_00143"
FT                   /old_locus_tag="CTY05_00143"
FT                   /product="UDP-N-acetylmuramate--L-alanine ligase"
FT                   /EC_number="6.3.2.8"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:Q3K745"
FT                   /protein_id="ATY42617.1"
FT                   /translation="MSPTTAANQAKKLIKVPEMRRIKHIHFVGIGGAGMCGIAEVLANQ
FT                   GYKISGSDIKASKTTQQLEENGIKVYIGHEAENIKNANVLVVSTAIDPENPEVKAAIEQ
FT                   RIPIVRRAEMLGELMRYRHGIAVAGTHGKTTTTSLLTTMLAEENLDPTYVIGGLLNSTG
FT                   VNAALGESRFIVAEADESDASFLYLQPMAAIVTNIDADHMDTYEGSFDKLKDTFVQFLH
FT                   NLPFYGLAVVCGDDANIREILPRVGRPVITYGFNEDNDIRAIDVEQDGMRSHFTVLRKG
FT                   REPLRLTINQPGLHNVLNALAAIGVATDEGVSDEAISRALKGFSGVGRRFQVQGEFELG
FT                   EGNVKLVDDYGHHPKEVEATIKAARQSHPDRRLVMLFQPHRYSRTRDCFDDFIEVLSQV
FT                   DQLLLLEVYPAGEKPIVGADSRTLARSIRLRGQVEPILIDPVEGNLQNIMQNVLQPNDL
FT                   LLTQGAGNVGAISVELAQHHLYVK"
FT   gene            163248..164174
FT                   /gene="ddl"
FT                   /locus_tag="ABBFA_00144"
FT                   /old_locus_tag="CTY05_00144"
FT   CDS_pept        163248..164174
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ddl"
FT                   /locus_tag="ABBFA_00144"
FT                   /old_locus_tag="CTY05_00144"
FT                   /product="D-alanine--D-alanine ligase"
FT                   /EC_number="6.3.2.4"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:Q3K746"
FT                   /protein_id="ATY42618.1"
FT                   /translation="MSNATKFGKVAVLLGGKSAERAVSLDSGQAVLDALLRSGVQAEAF
FT                   DPQNRSVTELVNYDRAFIVLHGRGGEDGQIQGVLEWLNIPYTGTGVQGSAIGMDKVKTK
FT                   QIWQGSDLPTAPYRIITKETDLDSVIAELGLPVIIKPVHEGSSVGMSKVEKAEDFAAAI
FT                   EKATQHDAVVMAEKWITGREFTISFLNGQPLPVIRLQPPADVAFYDYEAKYQRNDVEYG
FT                   IPCGLSETEEKKLQALCLRAFQAVGAEGWGRIDAMQDEQGNFWLLEVNTVPGMTSHSLV
FT                   PKAAKAVGYSFDELCVAILDQTLEGTA"
FT   gene            164177..165031
FT                   /gene="ftsQ"
FT                   /locus_tag="ABBFA_00145"
FT                   /old_locus_tag="CTY05_00145"
FT   CDS_pept        164177..165031
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsQ"
FT                   /locus_tag="ABBFA_00145"
FT                   /old_locus_tag="CTY05_00145"
FT                   /product="Cell division protein FtsQ"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:P06136"
FT                   /protein_id="ATY42619.1"
FT                   /translation="MAQLPASMRRKRAAITSIHEKPPTRKQKLANAGGWVLLVIAFLVL
FT                   AVGIYGLYKVITDATVAKLEVVGSTTPVETQQVMRYVQPIVKDNYFTSDLEQIRDKALE
FT                   ISWVDRVVVSRAWPNGIRVRVMPRHAIARWGTGRLLSDGGDVFSEAEPRLHPELPLLHG
FT                   PVSQSKMMMRRYNEINQLFHPVNLRLKELYLTERMTWFMQFDSGLRIIVDQDQTMNKLQ
FT                   RLSHLAQSDLKPVWTKISAIDLRYRNGLSIQWKNATPPKIVNGQFVVTSDDTSIAGGTK
FT                   AKP"
FT   gene            165092..166354
FT                   /gene="ftsA"
FT                   /locus_tag="ABBFA_00146"
FT                   /old_locus_tag="CTY05_00146"
FT   CDS_pept        165092..166354
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsA"
FT                   /locus_tag="ABBFA_00146"
FT                   /old_locus_tag="CTY05_00146"
FT                   /product="Cell division protein FtsA"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:P0ABH0"
FT                   /protein_id="ATY42620.1"
FT                   /translation="MSEAVPSVVAIDIGTHKVSVLIGKIHAPDNIQVIGMATARNRGMN
FT                   KGKIVSLDKVIAAIKNAVAEAENMAECRIHSAWVSIPSTELQSFYASGRTPVANPAHVI
FT                   TTNEVVRALELAKASHVTSDYYLASAVPLGFELGDSSEWVQNPINMTAHSMTGHYQLMM
FT                   MPIATMQNLDRAMKGANIGVEKMVVSCLATAEASLLKDEKEYGVCLVDIGAGITNLAVY
FT                   LDGRLALARTLQRGGEHVTRDIAAVLQTTTEEAERIKILHGCVDLSAVKPDHMIQVQGI
FT                   DGPQTISRIELAEIIIARYEEIFSQIREELEQSGAIHGLYHGVVLTGDACQIEGMVSLA
FT                   RRMLGVSAHLGNPPLQVYADDQHQAALRRSMYATAAGLLMFSQSELQEAVEEPEEGNDR
FT                   SVWERMVNGWNAFNSKLKAIF"
FT   gene            166519..167694
FT                   /gene="ftsZ"
FT                   /locus_tag="ABBFA_00147"
FT                   /old_locus_tag="CTY05_00147"
FT   CDS_pept        166519..167694
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsZ"
FT                   /locus_tag="ABBFA_00147"
FT                   /old_locus_tag="CTY05_00147"
FT                   /product="Cell division protein FtsZ"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:P77817"
FT                   /protein_id="ATY42621.1"
FT                   /translation="MASFEFIEDELNDGNGQARFTVFGVGGGGGNAVQHMVQSDIQGVK
FT                   FVCANTDKQALDCMNAPFKIQLGEQSTRGLGAGANPEVGQVAAEESREIIRQHLEGTDM
FT                   VFVTAGMGGGTGTGAAPVVAEVAKEMGILTVGVVTTPFNFEGRRRQKSAERGIEALEAH
FT                   VDSLIIIPNQRLLSVYGDISMKDAYKKADDVLLNAVRSIFDLVVNRGHINLDFADLKTA
FT                   MSTRGYAMMGAGLGRGEDRARQAAEQAIRSPLLDNVNIINAKGVLINITGGDDITLRET
FT                   EIITDVVNQIVDLDEGEIFYGTVFDPDARDELRVTVIATGLTRNAADAEPRKRNTVSHT
FT                   STQSAQSVDEDDVPAINKRQNAENDVNNAPSSTPRSSPMSIQDYLKNQQRK"
FT   gene            167805..168707
FT                   /gene="lpxC"
FT                   /locus_tag="ABBFA_00148"
FT                   /old_locus_tag="CTY05_00148"
FT   CDS_pept        167805..168707
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lpxC"
FT                   /locus_tag="ABBFA_00148"
FT                   /old_locus_tag="CTY05_00148"
FT                   /product="UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine
FT                   deacetylase"
FT                   /EC_number="3.5.1.-"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:P47205"
FT                   /protein_id="ATY42622.1"
FT                   /translation="MVKQRTLNRVVKASGIGLHSGQKVMINFIPHTVDGGIVFRRIDLD
FT                   PPVDIPANALLIQEAFMCSNLVTGDIKVGTIEHVMSAIAGLGIDNLIVEVSASEVPIMD
FT                   GSAGPFIYLLMQGGLREQDAPKKFIKILKPVEALIDDKKAIFSPHNGFQLNFTIDFDHP
FT                   AFAKEYQSATIDFSTETFVYEVSEARTFGFMKDLDYLKANNLALGASLDNAIGVDDTGV
FT                   VNEEGLRFADEFVRHKILDAVGDLYLLGHQIIAKFDGYKSGHALNNQLLRNVQSDPSNY
FT                   EIVTFDDEKDCPIPYVSVT"
FT   gene            complement(168805..169245)
FT                   /locus_tag="ABBFA_00149"
FT                   /old_locus_tag="CTY05_00149"
FT   CDS_pept        complement(168805..169245)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABBFA_00149"
FT                   /old_locus_tag="CTY05_00149"
FT                   /product="hypothetical protein"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /protein_id="ATY42623.1"
FT                   /translation="MSKPDNVFQQTGKHIKTGNLTFLTTQVAQWQRLTKIIQPLLPQPE
FT                   QWQVVCYQNGSLIITGENQAMISQLSYLQSQYVSKLSQLEGLKDLQRIQVRLRNKTIPV
FT                   TTSSEPSKSIPPETQEMLRSAADFVSDPKLSQALLRLASNKK"
FT   gene            169353..170045
FT                   /gene="mepM_1"
FT                   /locus_tag="ABBFA_00150"
FT                   /old_locus_tag="CTY05_00150"
FT   CDS_pept        169353..170045
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mepM_1"
FT                   /locus_tag="ABBFA_00150"
FT                   /old_locus_tag="CTY05_00150"
FT                   /product="Murein DD-endopeptidase MepM"
FT                   /EC_number="3.4.24.-"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:P0AFS9"
FT                   /protein_id="ATY42624.1"
FT                   /translation="MHTRRILLAFSLAASAASVAFADYQNINQSTDSDRLEQLSKTLSQ
FT                   GSYTHPDDLDLPASAKVSVTLREKTVELNNDSLAKKYGTTTAKNSFKTSSSNPYSWLVS
FT                   HPLPDTVRVSSNFGGRTMGGRAEHHGGLDMAAPSGTPIYATGPGIVTKSGWGTGYGQYV
FT                   EINHGNGYLTRYAHASRLMVRVGDQVSAGDHIANVGCTGRCTGPHLHYEVVKDGQRKNP
FT                   STYLAMLP"
FT   gene            170296..173013
FT                   /gene="aceE"
FT                   /locus_tag="ABBFA_00151"
FT                   /old_locus_tag="CTY05_00151"
FT   CDS_pept        170296..173013
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aceE"
FT                   /locus_tag="ABBFA_00151"
FT                   /old_locus_tag="CTY05_00151"
FT                   /product="Pyruvate dehydrogenase E1 component"
FT                   /EC_number="1.2.4.1"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:P0AFG8"
FT                   /protein_id="ATY42625.1"
FT                   /translation="MAFYGDSDAQETQEWQDAFDSVLQHMGTERAAFLLEKLYQQAIAK
FT                   HVPIQRLNTPYLNTISVEEQPAMPGDQDMERRIRALIRWNALAMVLRANKTGDDLGGHL
FT                   ASFASSATLYDVGFNHFFRANSDNFGGDMIYYQGHCAPGIYARSFLEGRLTEEQLSNFR
FT                   REVGGNGLPSYPHPYLMPDYWQFPTVSMGLGPIMSIYQAHIQKYLMNRGLIKEEDRKVW
FT                   AYLGDGEMDEPESLGAISLAGREKLDNLIWVVNCNLQRLDGPVRGNGKIIQELESIFRG
FT                   AGWRVIKVVWGRHWDPLLAKDTSGALKARMEEAVDGDYQRYQVKGGAYTREKFFGKYPE
FT                   AAELVKDLSDEDIDNLNRGGHDPYKVFAAYAEAMKAKGQPTVILAKTIKGYGLSEEIEA
FT                   VNKTHQIKKMQIDSLRYVRDRFNLPFTDEQLEELPFYRPSENSPEMKYMKARREALGGY
FT                   LPARRRESESLAIPDLSVFDAVLKGSGGKEQSTTMVMVRLIAALLKEKAIKDRVVPIVP
FT                   DEARTFGLEGMFRQLGIYAAHGQKYTPEDQEQLMHYREAKDGHMLQEGINEAGAMSAWA
FT                   ALATSYSTNNLPMIPMYMYYSMFGFQRIGDIAWAAGDAQAQGFLLGATAGRTTLNGEGL
FT                   QHQDGHSHILANTIPNCVSYDPCFGYELAVIVHDGLQRMYVNQERVFYYLTVMNENYEH
FT                   PAMPEGVEEGIKRGMYLFEKDEKATVQLLGSGVILREVIKAAKILRDEYQIHSNVWSVT
FT                   SFNELARDGMACEEYNRLHPLAEEVKESWVSKQLRGTEGIVVSATDHMRAYSEQIRAYL
FT                   PDGRPFVALGTDGYGRSDTRANLRSFFGVDAAHIVVATLKKLADEGEVDARLVKDAISN
FT                   FELDTDRPVAWAPQAHPEVQPVAEYNETQTGEGN"
FT   gene            173016..174995
FT                   /locus_tag="ABBFA_00152"
FT                   /old_locus_tag="CTY05_00152"
FT   CDS_pept        173016..174995
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABBFA_00152"
FT                   /old_locus_tag="CTY05_00152"
FT                   /product="Dihydrolipoyllysine-residue acetyltransferase
FT                   component of pyruvate dehydrogenase complex"
FT                   /EC_number="2.3.1.12"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:P10802"
FT                   /protein_id="ATY42626.1"
FT                   /translation="MQIKTPDIGVDKANVAEILVKVGDRVEVDDSIVVLESDKATVEVP
FT                   STSAGVVKSILINQGDDVTEGVALIEIEAEGAAQAAPEPTPAPAAEKPAAPAPAQQTQA
FT                   SAQPAATSSATVEVTVPDIGVEKALVGEILVKVGDQIDVEQSIVVVESDKATVEVPSSV
FT                   AGTVESIQVKEGDTVKEGVVLIQVKTAAASNAQAEAPATTPAPAAVAEPVAAKQETVAA
FT                   APAQSGSVDINVPDLGVDKAIVAEILVQVGDKVDVDQSLVVVESDKATVEVPSTVAGVV
FT                   KAIHLQAGQQVSQGVLLATIEAEGQAPAAAPAAKAEAAPAPQAAAPKAAAPVATQSAPA
FT                   APASGTDKLTKEQEAENAKVYAGPAVRKLARELGVILSQVKTSGEHGRVVKEDIFAYVK
FT                   SRLTAPQAAPVAQATAAPAGLPSLPDFTAFGGGEVKPMTRLQQVSVPQLSLNNYIPQVT
FT                   QFDLADITELEAWRGELKDGFKKQGVSLTILAFIAKAVAHLLKEEPYFAGHLADDQKSV
FT                   LLRNEIHMGIAVATPDGLTVPVLRNPDQKSIKQIAVELGELSKKARDKKLTPKDLQGAN
FT                   FTITSLGSIGGTAFTPLVNWPQVAILGISPATMQPVWNGKDFDPRLMLPLSLSYDHRVI
FT                   NGADAARFTNKLTKLLKDIRTLLI"
FT   gene            175144..175416
FT                   /locus_tag="ABBFA_00153"
FT                   /old_locus_tag="CTY05_00153"
FT   CDS_pept        175144..175416
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABBFA_00153"
FT                   /old_locus_tag="CTY05_00153"
FT                   /product="hypothetical protein"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /protein_id="ATY42627.1"
FT                   /translation="MLGFLKIMLPLLLVVFLLMGIWVSILHFPWEWMTYVVMGIEVFVA
FT                   TLILPLEYQTGTSSSHIGFISISACFAVLLGIARLFVWTWVKFFA"
FT   gene            175665..176240
FT                   /locus_tag="ABBFA_00154"
FT                   /old_locus_tag="CTY05_00154"
FT   CDS_pept        175665..176240
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABBFA_00154"
FT                   /old_locus_tag="CTY05_00154"
FT                   /product="hypothetical protein"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /protein_id="ATY42628.1"
FT                   /translation="MQEFLISTSIVALAEMGDKTQLLALLLSARFRKPIPILIAILLAT
FT                   LINHGISAVLGQWITTVLSPEILVWVLAVGFIGMAFWMLIPDELDDETASINKWQKFGV
FT                   FGATFILFFLAEIGDKTQIATVALAARYDSIFWVMLGTTLGMMIANAPAVFIGNKLAER
FT                   LSIALIHKIGAAIFFIVGVSTLVQHYFF"
FT   gene            complement(176300..178456)
FT                   /gene="fhuA_2"
FT                   /locus_tag="ABBFA_00155"
FT                   /old_locus_tag="CTY05_00155"
FT   CDS_pept        complement(176300..178456)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fhuA_2"
FT                   /locus_tag="ABBFA_00155"
FT                   /old_locus_tag="CTY05_00155"
FT                   /product="Ferrichrome-iron receptor precursor"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:P06971"
FT                   /protein_id="ATY42629.1"
FT                   /translation="MTQRFAFSTSKTLLAVTIFTSMTTSHAEEPAEQQNSTNVLPTISI
FT                   QAQKENPTSYVATKANSALKSDAPLFKTAQSVSVVTREQLDQKQARTLADALEGVAGVE
FT                   AGKLGRRGWDDFIIRGQTSSDSVYVDGLRVGQNTYVATELSGMDQVQILKGPASINFGL
FT                   VAPGGMVNLVTKRPEAESFARASMTYGSYSLKEGTFDLNYSPNNSEKGAFRLNGRISDQ
FT                   DDPTDYVYFKNFYISPSYNFDLGDNTDLSVIASYQHREYIRQQGLPVIGTLKDNPNGPI
FT                   DRSLYIGDPNFGKYEADVYRTGYTFKHTFDNGWNFNQNFAVQKTEMDGKAVFARTGSNF
FT                   WAKDKQGEIDYTTISRRNNSRHQVIDNLSFAIDNRLNKQFDLYGMQHDINIGVDAFQEK
FT                   SDYTNDKYDIGDLNIYNPVYGQNVTLKQNARDINRLKYLGLYLRDRIQLNDQLLLSLSG
FT                   RQDWAQTQTTSLVTGNASKQSDNAFTGSASVMYTLNDIVAPYVSYATSFTPNSGTDVNS
FT                   NPFKPEKGKQVEVGMKLQSPDQRIQGAIAWYDLKRQNVLVTDTANSGYKVQRGEQLTRG
FT                   IETELSAEILEGLKLTAAYTYTIDAEISKDANASNVGKALDNIPEHAYSLSARYKFDPS
FT                   SKLGWYVGGGFRGETYKTVDGLDVHVPGYTVFDTEAGYDAERWGAQLAIRNLFDKDYYA
FT                   GALNENLVTLGNPRQINFTVKFNY"
FT   gene            178684..179481
FT                   /locus_tag="ABBFA_00156"
FT                   /old_locus_tag="CTY05_00156"
FT   CDS_pept        178684..179481
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABBFA_00156"
FT                   /old_locus_tag="CTY05_00156"
FT                   /product="metallo-beta-lactamase/flavodoxin
FT                   domain-containing protein"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="protein motif:CLUSTERS:PRK11921"
FT                   /protein_id="ATY42630.1"
FT                   /translation="MGFEKTTSQILFDNGVHKCISFTSLVKGEGIQANQFLIIDHERAA
FT                   VIDPGGDLTYVPLTMELNKYTRLKNLDYVMASHQDPDIITSMPRWLVYTDAKVVASKLW
FT                   ARFLPHLNSSFMSERMKGNWEDRLIELPDRGQVIQLGESKLVIIPAHFLHSVGNFQFYD
FT                   PVAKILFSGDMGASIVDDASQPLKDFDSHVMKMKAFHQRYMCSNKVIRLWVNMIRQMDI
FT                   EMIVPQHGSPFIGKEMINQFLDWIETLPCGVDLMTEQIFSCPT"
FT   gene            179573..179938
FT                   /locus_tag="ABBFA_00157"
FT                   /old_locus_tag="CTY05_00157"
FT   CDS_pept        179573..179938
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABBFA_00157"
FT                   /old_locus_tag="CTY05_00157"
FT                   /product="Flagellin N-methylase"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="protein motif:Pfam:PF03692.9"
FT                   /protein_id="ATY42631.1"
FT                   /translation="MLSQVATPDECLRCGACCAHFRVSFYWAEAELMEEHLVEPLTPVY
FT                   SCMRGTNQPEPRCQALTGEIGKEVGCSIYAVRSSTCREVQIADEQCNKARLAHQLIPLI
FT                   QVSPADSENDHDYDQVS"
FT   gene            180074..181540
FT                   /gene="guaB_1"
FT                   /locus_tag="ABBFA_00158"
FT                   /old_locus_tag="CTY05_00158"
FT   CDS_pept        180074..181540
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="guaB_1"
FT                   /locus_tag="ABBFA_00158"
FT                   /old_locus_tag="CTY05_00158"
FT                   /product="Inosine-5'-monophosphate dehydrogenase"
FT                   /EC_number="1.1.1.205"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:P0ADG7"
FT                   /protein_id="ATY42632.1"
FT                   /translation="MLTIVQEALTFDDVLLLPAYSTVLPKDVSLKTRLTRGIYLNIPLV
FT                   SAAMDTVTESRMAIAMAQNGGIGILHKNMDIAAQAAEVRRVKKFEAGMVKDPITVSPET
FT                   TVRELIAITSANNISGVPVVKDGKVVGIVTGRDTRFETNLEQPVSNIMTGQDRLVTVRE
FT                   GESKENIQALLQKHRIEKVLVVGESNELKGLITVTDFRKAESYPNSCKDDLGRLRVGAA
FT                   VGTGADTPSRVEALVEAGVDVIVVDTAHGHSAGVIERVRWVKQNFPQVQVIGGNIATGD
FT                   AALALLDAGADAVKVGIGPGSICTTRIVAGIGMPQISAIDSVASALKDQIPLIADGGIR
FT                   FSGDMAKAIGAGASTIMVGSLLAGTEEAPGEVEFFQGRYYKAYRGMGSLGAMAGATGSA
FT                   DRYFQDSKAGAEKLVPEGIEGRVPYKGPMGNIVHQMMGGLRSSMGYTGSAVIEDLRQNA
FT                   KFVKITSAGMSESHVHDVTITKEAPNYRVG"
FT   gene            181690..183027
FT                   /gene="glmM"
FT                   /locus_tag="ABBFA_00159"
FT                   /old_locus_tag="CTY05_00159"
FT   CDS_pept        181690..183027
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glmM"
FT                   /locus_tag="ABBFA_00159"
FT                   /old_locus_tag="CTY05_00159"
FT                   /product="Phosphoglucosamine mutase"
FT                   /EC_number="5.4.2.10"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:P31120"
FT                   /protein_id="ATY42633.1"
FT                   /translation="MSYFGTDGIRGKFGQMPITPEFALKLGFAAGKVLKRTSPKNKPLV
FT                   VLGKDTRLSGYILESALQAGLNAAGVYVHLLGPLPTPAIAHLTRALHAHAGIVISASHN
FT                   PYFDNGIKFFSSEGKKLPDSLQEEINKELEKDLFIEDTANLGKSVRVTDANGRYIEFCK
FT                   STFPYHFDLNNLKIVVDCAHGAAYSVGPSVFRELGAKVVALYNEPDGLNINENCGSTHP
FT                   ESLQKAVVEHGADLGIAFDGDADRVVMVDKFGNLIDGDHILYILATQAKNKPAGVVGTV
FT                   MSNMALEVALEKANVGFVRAKVGDRYVLQALEENGWVTGGEPSGHILTLDKSTTGDAII
FT                   AALQVLTVMVEQNKALHELVNGFKLYPQVLVNVRLEQMLDPYSIPALVAEFNKAEEQLK
FT                   GRGRILIRKSGTEPVIRVMVEGDNEQEVKTLAEHLANAVRSQAQVA"
FT   gene            183038..183694
FT                   /gene="pdxH"
FT                   /locus_tag="ABBFA_00160"
FT                   /old_locus_tag="CTY05_00160"
FT   CDS_pept        183038..183694
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pdxH"
FT                   /locus_tag="ABBFA_00160"
FT                   /old_locus_tag="CTY05_00160"
FT                   /product="Pyridoxine/pyridoxamine 5'-phosphate oxidase"
FT                   /EC_number="1.4.3.5"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:P0AFI7"
FT                   /protein_id="ATY42634.1"
FT                   /translation="MSDVIKDLSELRLSYEQGELYETQVASNPHEQFLGWFNHALAANL
FT                   HEPYAMSLATASASGRPHVRTVLLRGATEAGYDFYTNYDSQKGIDLAENPYAELLFYWP
FT                   SLERQVRVGGHVVKIPEQESTDYYHKRPRDSQIAAHISTPQSGKIESRELLQQRFQDLQ
FT                   QQVQSREVLDKPEFWGGYRLQPDYYEFWQGRPNRLHDRLSYEKIDGQWTLHRLMP"
FT   gene            183695..185395
FT                   /gene="recJ"
FT                   /locus_tag="ABBFA_00161"
FT                   /old_locus_tag="CTY05_00161"
FT   CDS_pept        183695..185395
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recJ"
FT                   /locus_tag="ABBFA_00161"
FT                   /old_locus_tag="CTY05_00161"
FT                   /product="Single-stranded-DNA-specific exonuclease RecJ"
FT                   /EC_number="3.1.-.-"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:P21893"
FT                   /protein_id="ATY42635.1"
FT                   /translation="MTKIQIKQRPLLTRPEQFQGVPPFIAEILARRGVQSEQELELKLK
FT                   NLLAPELKGLDAAVALMDQAIDEQKKIVIVGDYDADGATSTALMMLVLRDMGAQVDYLV
FT                   PDRFKYGYGLTPAIAELAHHTYQPDLLITVDNGISSHAGVDAAHALGMQVIITDHHLTT
FT                   KETPLAEAVVNPNQLGCEFPSKALAGVGVAFYVLANLASLRNRQGKSTSKVTQYLDLVA
FT                   LGTYADVAVLDYNNRILVDAGVKRIQQHQCRVGILALLDIAGREATSIRAQDLGFVLGP
FT                   RINAAGRMESMRIGIECLLADTMETAYPIAQQLNQLNIDRRQIEGEMKQQALSALDSLQ
FT                   LSQQDIPAALVLFEENWHQGVIGIVAGRLKEQFHRPTIVFAPDEDGIHIKGSARSIDGV
FT                   HIRDTIEQVAEQHPELVSHFGGHAAAAGLTIRKENFEAFKTVFNDCVAAMDESIFQATL
FT                   WTDGELPVSALQLDTLNWIEQLGPWGQKFPLPQFEGHFKVIDFRWLKETHLKLRLAIDQ
FT                   YSFDAIAFNAAGRFEFDPMRDHVHLVYEIDRNVFNGNVSLQLRIVHLNQ"
FT   gene            complement(185440..186207)
FT                   /locus_tag="ABBFA_00162"
FT                   /old_locus_tag="CTY05_00162"
FT   CDS_pept        complement(185440..186207)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABBFA_00162"
FT                   /old_locus_tag="CTY05_00162"
FT                   /product="hypothetical protein"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /protein_id="ATY42636.1"
FT                   /translation="MKKLAIASALLSALAVSGTANAYQAEVGGSYNYLDPDNGSSVSKF
FT                   GVDGTYYFNPVQTRNAPLAEAAFLNRASNVNAHVNYGDNSGTKDTQYGVGVEYFVPNSD
FT                   FYLSGDVGRNEREIDNTNIDSKVTTYAAEVGYLPAPGLLLALGVKGYDEKDGKDGADPT
FT                   VRAKYVTQVGQHDVNLEAYGAFGDLDEYKVRGDYYIDKTLSLGVDYYNNDLTDKDEFGI
FT                   NAKKFLNQQVSVEGRVGFGDNDNTYGVRAAYRF"
FT   gene            186763..187695
FT                   /gene="prfB"
FT                   /locus_tag="ABBFA_00163"
FT                   /old_locus_tag="CTY05_00163"
FT   CDS_pept        186763..187695
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prfB"
FT                   /locus_tag="ABBFA_00163"
FT                   /old_locus_tag="CTY05_00163"
FT                   /product="Peptide chain release factor 2"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:P07012"
FT                   /protein_id="ATY42637.1"
FT                   /translation="MAKEKGELENVINVLDGLSTQLEDAKAMLDLAVEADDESLLEDVQ
FT                   SELSTAEEELAKLEFRRMFSNPMDPNPCYVEIQAGSGGTEAQDWASMLLRMYMRWIERH
FT                   GFKAELMEVSDGDVAGIKSATIRVEGEYAYGWLRTESGVHRLVRKSPFDSGNRRHTSFS
FT                   AVFISPEVDDNIEIDINPSDVRTDTYRASGAGGQHINKTDSAVRLTHIPTGIVVACQNQ
FT                   RSQHANRDHAWKQLRAKLYELEMQKRNEAAQALEDSKSDIGWGSQIRSYVLDDSRIKDL
FT                   RTGVENSNTGAVLDGDLDRFIEASLKQGL"
FT   gene            187794..187925
FT                   /locus_tag="ABBFA_00164"
FT                   /old_locus_tag="CTY05_00164"
FT   CDS_pept        187794..187925
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABBFA_00164"
FT                   /old_locus_tag="CTY05_00164"
FT                   /product="hypothetical protein"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /protein_id="ATY42638.1"
FT                   /translation="MNIEKNRYEYRQNTILCFRNAEQSFVRLQDVLSLWILMQLAKP"
FT   gene            187895..188197
FT                   /gene="sdpR"
FT                   /locus_tag="ABBFA_00165"
FT                   /old_locus_tag="CTY05_00165"
FT   CDS_pept        187895..188197
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sdpR"
FT                   /locus_tag="ABBFA_00165"
FT                   /old_locus_tag="CTY05_00165"
FT                   /product="Transcriptional repressor SdpR"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:O32242"
FT                   /protein_id="ATY42639.1"
FT                   /translation="MDIDAISKALANPLRRQILQWLKEPEHYLPVEECGGSFEKGVCAG
FT                   HIERLGKVAQSTMSNHLSVLQQAGLIQVQKYGQWSYFSRNEALIQQYIEHLKQTL"
FT   gene            188226..189284
FT                   /gene="nemA"
FT                   /locus_tag="ABBFA_00166"
FT                   /old_locus_tag="CTY05_00166"
FT   CDS_pept        188226..189284
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nemA"
FT                   /locus_tag="ABBFA_00166"
FT                   /old_locus_tag="CTY05_00166"
FT                   /product="N-ethylmaleimide reductase"
FT                   /EC_number="1.-.-.-"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:P77258"
FT                   /protein_id="ATY42640.1"
FT                   /translation="MAELNTPLTVGDFEIKNRLVMAPLTRARSGESRVPNDLMVEYYQQ
FT                   RANAGLILTEATVIGSKTVGYADTPGLWSQEQAQAWNKIIEAVHAQGSKIVVQLWHVGR
FT                   ISHPELLNGDIPVAPSAIQPAGEVSLLRPKRPYVTPRALSIEEIQEIVAQYKHSAELAK
FT                   AAGFDGVELHAANGYLIDQFLQSNTNQRDDEYGGPVENRARLLLEVVDAFIEVWGAGRV
FT                   GVHIAPRGDSHDMGDENPLATFGYVVDQLSQRNVAFIFSREYEAADSISPQLREKFNGV
FT                   WIANENLTPESAKRILREGQADAVSFGKAYIANPDLLQRLEQGLPLNELQPTTLYAKGA
FT                   EGYTDYPALEAS"
FT   gene            189453..190745
FT                   /gene="waaA"
FT                   /locus_tag="ABBFA_00167"
FT                   /old_locus_tag="CTY05_00167"
FT   CDS_pept        189453..190745
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="waaA"
FT                   /locus_tag="ABBFA_00167"
FT                   /old_locus_tag="CTY05_00167"
FT                   /product="3-deoxy-D-manno-octulosonic acid transferase"
FT                   /EC_number="2.4.99.12"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:P0AC75"
FT                   /protein_id="ATY42641.1"
FT                   /translation="MATPFWYNTALHLLKPFYRWRIKRRAESLELYQQECLERFGPFEA
FT                   PKNVKAIWFHAVSVGETNAAQPLIEYYLKLGQPVLVTNTTKTGQARAKSLFLKEPYLDL
FT                   FQAVYLPVDQKPLLKKFFELYQPKLLALVETELWPNLIDQAKLQHVPCLLLNARLSEKS
FT                   AKGYGKVSGLTAGMLKQLDWVLAQDSATRQRYVELGLDEHKSQVVGNIKFDIHAPEAFI
FT                   KQAAQLRQQWYLENRQVVTIASTHAPEEQQILEALAPYLNSDRELVCIVVPRHPERFDE
FT                   VFEICQNLNLITHRRSMGQSIHASTQVYLADSMGELWLWYALSQVCFVGGSLNEPGGGH
FT                   NILEPMVLNVPTVVGPRYFNFQTIVDEFIDENAVLIAQDAQQVVDIWLACLAEPEATEQ
FT                   LVVQAHKVLQRNQGSLQKHIGVINRYLAEKS"
FT   gene            190742..191449
FT                   /gene="rsmE_1"
FT                   /locus_tag="ABBFA_00168"
FT                   /old_locus_tag="CTY05_00168"
FT   CDS_pept        190742..191449
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rsmE_1"
FT                   /locus_tag="ABBFA_00168"
FT                   /old_locus_tag="CTY05_00168"
FT                   /product="Ribosomal RNA small subunit methyltransferase E"
FT                   /EC_number="2.1.1.193"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:P44627"
FT                   /protein_id="ATY42642.1"
FT                   /translation="MNIVLLESEDVQSDTWSIHSKRQLQHLREHLEITVGQNLKVGIRN
FT                   GARYITEIVSMNEHEVRIRPIREELLPAKLPVHLIVALPRPKVLRRLIMDSVTLGVEKI
FT                   SLIHSYRVDKSYWQTPFLQQIDNYATLGLEQAGDTIVPEIQLYKRFKPFVEDVLPSLIT
FT                   QETPAYVAHPYAEQRMPINISHACSVVVGPEGGFIPYEVDLLIKNGCQAMSLGNRILRT
FT                   ETSISYILGRLFS"
FT   gene            complement(191429..192409)
FT                   /gene="mscS_1"
FT                   /locus_tag="ABBFA_00169"
FT                   /old_locus_tag="CTY05_00169"
FT   CDS_pept        complement(191429..192409)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mscS_1"
FT                   /locus_tag="ABBFA_00169"
FT                   /old_locus_tag="CTY05_00169"
FT                   /product="Small-conductance mechanosensitive channel"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:P0C0S1"
FT                   /protein_id="ATY42643.1"
FT                   /translation="MADEQKSLTDVAKNTGELLQEAGTKTTQTVLAHTEKYHDAYTTID
FT                   KIVDSFWERVPYICIAIVVFLIFWLLTKLFKFFVRKTLENRSYTRQNLVLVLNRVGSTA
FT                   ILFFGFLIALVIMIPGFTPGQLMSALGIGSVAIGFAFKDIFQNLLSGILILLSEPFRIG
FT                   DSIVVNSLEGTVEDIQIRATFLRSPDGRRIVIPNATVYTSALTVNTAYQQRRCEFVVGI
FT                   GYDDDEQKAKQIILDILNNDRNVLSQPAFSVNVTALADFSVNLTVRWWVDTTETDISSS
FT                   ISNIQAQVKQAFNENDIDIPYPIQELKMVSNPPALNPETSAKQTT"
FT   gene            complement(192522..193097)
FT                   /gene="yhaI_1"
FT                   /locus_tag="ABBFA_00170"
FT                   /old_locus_tag="CTY05_00170"
FT   CDS_pept        complement(192522..193097)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yhaI_1"
FT                   /locus_tag="ABBFA_00170"
FT                   /old_locus_tag="CTY05_00170"
FT                   /product="Inner membrane protein YhaI"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:P64592"
FT                   /protein_id="ATY42644.1"
FT                   /translation="MFAETPSSRPPQLPFKDSPFSIHGRFNRMSYLGGYGLIYLVTIVG
FT                   YFILASFLGSFQLSSDLFNFEFYSSLSGISALMVWAFWLFLIYLNIILVVRRLHDLNKS
FT                   GWMGLLLFIPVVQFFFMLYLLLASGTAGTNQYGPVRPSTFIEKLMAWLILIAILISLIS
FT                   TAGFFYYFSGTDTIQTPTQILQKGTEYF"
FT   gene            193392..195341
FT                   /gene="acsA_1"
FT                   /locus_tag="ABBFA_00171"
FT                   /old_locus_tag="CTY05_00171"
FT   CDS_pept        193392..195341
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acsA_1"
FT                   /locus_tag="ABBFA_00171"
FT                   /old_locus_tag="CTY05_00171"
FT                   /product="Acetyl-coenzyme A synthetase"
FT                   /EC_number="6.2.1.1"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:Q89WV5"
FT                   /protein_id="ATY42645.1"
FT                   /translation="MNEIYPVPEEFKKTARTVEADYFKRYQHSIENPDEFWAEQAKIVD
FT                   WIKPFTQVKNTSFDKDNFKIEWFADGELNVSANCLDRHLKEHPHKPAIIWEGDHPSRHK
FT                   IVSYKELHDEVCRFANVLKKYGIGKGDRVVLYMPMVTEAAIAMLACARIGAVHCVVFGG
FT                   FSPDSLASRIEDSQAKLVITADSSLRAGKLLPLKENVDLALALPGTECVENVIVVYRNA
FT                   NPIEMKPGRDLWYHLIIMEVDANCPPEPMKAEDPLFILYTSGSTGKPKGVLHTTGGYLV
FT                   YVASTFKEVFDLKQDDVYWCTADVGWITGHSYLIYGPLANGTTTLMFEGVPQYPTWARL
FT                   GHVVDKHKVSILYTAPTAIRAMMREGDSYVRESNRSSLRLLGSVGEPINPEAWNWYYNV
FT                   VGEGRCPIVDTWWQTETGGILIAPLPGATALKPGSATRPLFGIQPAIVDGEGNELEGAA
FT                   EGNLVIKDSWPGQMRTIWGDPDRFIEAYFSTFKNTYFTGDGARRDEDGYYWITGRVDDV
FT                   LNVSGHRLGTAEIESALVSHESVAEAAVVGMPHDIKGQGICTFVTLQAGVPESEELRKE
FT                   LISWVRKVLGPVASPDALHWAPALPKTRSGKIMRRILRKIAANELDSLGDTSTLAEPAV
FT                   VDQLIATVYPDRQK"
FT   gene            complement(195388..195930)
FT                   /gene="sttH"
FT                   /locus_tag="ABBFA_00172"
FT                   /old_locus_tag="CTY05_00172"
FT   CDS_pept        complement(195388..195930)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sttH"
FT                   /locus_tag="ABBFA_00172"
FT                   /old_locus_tag="CTY05_00172"
FT                   /product="Streptothricin hydrolase"
FT                   /EC_number="3.5.2.19"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:Q1MW86"
FT                   /protein_id="ATY42646.1"
FT                   /translation="MKQALLVIDVQNDYFKNGKMELVGPDQALDKIKQLEQYFNEKGLP
FT                   IIYVQHINPPQASFFQENTEGVLLHPELSAGSNSLIVTKHYPNSFLETNLKELLKAHQI
FT                   EQLVITGMMTHICIDSGTRAAKELGYQPILIGDTTATRDLSHNGKTVKAEDVQTAFLAA
FT                   LGMFASVQNTAEFLAKF"
FT   gene            196036..196449
FT                   /gene="lrpC"
FT                   /locus_tag="ABBFA_00173"
FT                   /old_locus_tag="CTY05_00173"
FT   CDS_pept        196036..196449
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lrpC"
FT                   /locus_tag="ABBFA_00173"
FT                   /old_locus_tag="CTY05_00173"
FT                   /product="HTH-type transcriptional regulator LrpC"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:P96582"
FT                   /protein_id="ATY42647.1"
FT                   /translation="MNIELDPIDLKIIALLKQDSRLTNKEIGQRVHRTGQAVGARIAQL
FT                   MDAGVIKNYTIAVQYRHKQFIHLHLNEQRSFEEIENLVKQYEQIDECFKVMGNACYMIV
FT                   SHFEPAELNAFIEVLSKWCRYSVETVIREVEKA"
FT   gene            complement(196543..197655)
FT                   /gene="ssuD_1"
FT                   /locus_tag="ABBFA_00174"
FT                   /old_locus_tag="CTY05_00174"
FT   CDS_pept        complement(196543..197655)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ssuD_1"
FT                   /locus_tag="ABBFA_00174"
FT                   /old_locus_tag="CTY05_00174"
FT                   /product="Alkanesulfonate monooxygenase"
FT                   /EC_number="1.14.14.5"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:P40402"
FT                   /protein_id="ATY42648.1"
FT                   /translation="MTQLQQSIKFAYWVPNVSGGLVVSNIEQRTDWSYDYNVRLAQAAE
FT                   NNGFEYALTQIRFTAGYGAENQHESVSFSHALLAKTEKLKVIAAILPGPWKPALAAKQL
FT                   ATIDYLTEGRIAINVVSGWFRGEFDAIGEEWPEHDERYVRSEEFIRTLKGIWTTDNYSF
FT                   DGKYYQFQNYTLKPKPLQKPHIEVFQGGSSRAARDMASRVSDWYFTNGNTVEEIQKQVE
FT                   DIRAKAKANNHQVKIGVNAFIIARDTEEEAKAVLQEIIDKANTEAVNAFGDATREAGAA
FT                   SPEQEGNWAKSTFEDLVQYNDGFKTNLIGTPQQIAERIVALKNVGVDLVLSGFLHFIEE
FT                   VEYFGEKVLPLVRQLELQQEKEVEIQAKSA"
FT   gene            complement(197701..198438)
FT                   /locus_tag="ABBFA_00175"
FT                   /old_locus_tag="CTY05_00175"
FT   CDS_pept        complement(197701..198438)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABBFA_00175"
FT                   /old_locus_tag="CTY05_00175"
FT                   /product="NAD(P)H-dependent FAD/FMN reductase"
FT                   /EC_number="1.5.1.45"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:A4IT49"
FT                   /protein_id="ATY42649.1"
FT                   /translation="MTGITSSKPLNIVAVSGGLNTPSKTESLVQAILDELSEAIDIKVH
FT                   FIKLSEIGPLLGGAFYRNQLPQRVQDDLAAVEAADALIVGTPVYRASFTGLFKHFFDFV
FT                   EQTALVDVPVLLAASGGSDRHALVLEHQLRPLFSFFQAQTLPIGVYATDRDFTPEYTVK
FT                   SEQLSDRITLAVARALPILEWAPAKGKRAEVVKPKSQQANQELGINKQIEQEEVLPSAA
FT                   VPNLDAAESRLHHKSGKSLTHVA"
FT   gene            198815..199465
FT                   /gene="exaE"
FT                   /locus_tag="ABBFA_00176"
FT                   /old_locus_tag="CTY05_00176"
FT   CDS_pept        198815..199465
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="exaE"
FT                   /locus_tag="ABBFA_00176"
FT                   /old_locus_tag="CTY05_00176"
FT                   /product="Transcriptional activator protein ExaE"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:A8R3S7"
FT                   /protein_id="ATY42650.1"
FT                   /translation="MNILIVDDHPLFRHALIQAVRYSLPQAQIHETASVDEFYERLENG
FT                   AEPDLVLLDLNLPGASGFSALVYVRAQYPSIPIIVVSAHEEASIIQRAIAHGAMGYIPK
FT                   SAHPSHIGEAIRQVLDGEIWLPPNLPSNINLDPRAADETALAERIQSLTPQQFRVLMMV
FT                   AEGLLNKQIAYELDVSEATIKAHVTAIFRKLGVQNRTQAVLAISALNIEDKKI"
FT   gene            complement(199508..200275)
FT                   /locus_tag="ABBFA_00177"
FT                   /old_locus_tag="CTY05_00177"
FT   CDS_pept        complement(199508..200275)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABBFA_00177"
FT                   /old_locus_tag="CTY05_00177"
FT                   /product="hypothetical protein"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /protein_id="ATY42651.1"
FT                   /translation="MNISDNTPQGQLSSQQFYRQYSANALLPELDWQSIFPHSKLSEAH
FT                   IKALNTIYQCAVPLALNVFHDLNFDVFAPAAYHPQGLGLFDKLAQQEENFLKVLTAESE
FT                   NLDHETRHQIWSMLLRGGAVLVFKAWLGHVKLGENQLDMTQFDELSDLLFIKTPPHQLA
FT                   ERLHVDEKAKLDHIFLMYGNDIFLDRFNSLETAALFVDLGVYDAAFLSLRDDRVAEYLK
FT                   SKGYVTQEQIDDLQCALNPLYCDSLTPKQDCLA"
FT   gene            complement(200670..204167)
FT                   /gene="rpfC"
FT                   /locus_tag="ABBFA_00178"
FT                   /old_locus_tag="CTY05_00178"
FT   CDS_pept        complement(200670..204167)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpfC"
FT                   /locus_tag="ABBFA_00178"
FT                   /old_locus_tag="CTY05_00178"
FT                   /product="Sensory/regulatory protein RpfC"
FT                   /EC_number="2.7.13.3"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:P0C0F6"
FT                   /protein_id="ATY42652.1"
FT                   /translation="MNSWLIIGVLTLYIALLFVCAFFGEKHASRLSTRGRMFLFSLTLG
FT                   VYCSSWTFYGATGAAVREGVIFLPIYLGPLLFVWFGYDIWRRLGRVRQHHAISSIADFV
FT                   AARYGKSGVLASLVTILAVIAIIPYLALQLRAIALSTSVIMEQSSHIHTTTNSVLLLTS
FT                   VLAILAMIFGTRQIANTEQHGGLMLAVAFESFVKLFALLCVALFFIFESPANLSQMTSD
FT                   VNQTFQEVQLFGVPETFWIQTLLAGLAIICLPRQFHVAVVELRDEKHIRGARKWFAVYL
FT                   ILTILAIIPIASWALHAAPKFLTVPDVAVLSLPLSYNQEWLALLAFLGGFSASTGMLLV
FT                   SSVALSIMLSNDLIMPALWRFKLLSRHDKHLPKVLKFSRRISIVAVMLLGFLFFHFFND
FT                   INQLSVFGLLAFSAVAQFAPALIGGLYWRGGSRQGVYAGLIIGFLMWSYTLLFPTILRS
FT                   LPEAYQETAQSILLFGPFGINALRPESLFGFESFAPLTHGVIWSLGLNIVLYIWISKIY
FT                   RPSVAEQIQAESFFYYETKPLPSPHTSTDLTYLPHDAARLKVGDLFALAKRITGEQPTT
FT                   QAFENFCEQNHLTLNPNSIANGMWWRFTEQYLAGIIGAASARTLLTTAMINNGLALGQV
FT                   ANILDQASQWQRFNQNLLMTMIDHMTQGVSVVDKNMCLVAWNNQYLKLFGYPKDLVYVG
FT                   CPIADLIRYNAERGECGPGSVEEHVRKRLHWMKVGSAHEFERIRKDGRVIQMRGNPIAG
FT                   GGFVTTFADITAFRANEAVLEARVKDRTQQLADALTEQQLAREQADMANMSKSRFIAAA
FT                   SHDLLQPMHAARLFSTVLEQSISTEEDRQTLQQLDRALYGAESMLSALLDIARLEGGTI
FT                   QPKRQPYPLHDLLSDLELQFKSIAAQRNILLKVHDVSFWIDTDPQWIRRIIQNFVSNAL
FT                   RYTAKGRVVVGVLRSAQQSGHIRIGVWDTGPGIAEEQRIKLFQEFERCGHLSPWGEQGL
FT                   GLGLAIVQRMTGLLNYPVHVYSELGKGSCFMIEVPIVEPPKVATPAVQAVPLKTKAYRI
FT                   LCLDNDETILEGMSSLLGRWGYQVFKATEPEQALEIIQKENIQVWLIDQHLNHNQLGVD
FT                   FITQNRQEDVPVALITADSHPELPQQLKELNIVLLKKPLKPASLRAWLSGLKIASTTD"
FT   gene            204351..204683
FT                   /gene="yjcH"
FT                   /locus_tag="ABBFA_00179"
FT                   /old_locus_tag="CTY05_00179"
FT   CDS_pept        204351..204683
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yjcH"
FT                   /locus_tag="ABBFA_00179"
FT                   /old_locus_tag="CTY05_00179"
FT                   /product="Inner membrane protein YjcH"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:P0AF54"
FT                   /protein_id="ATY42653.1"
FT                   /translation="MDQSQVEQILRNPKFQKMVKKKSALSWTLTIIMLVLYVGFMLLVG
FT                   YNKEFLMSSFSGGVTTWGIPLGLGIIVLSFLLCGVYSYIANNTLDQLSEEALKEVEAIT
FT                   HEKGLH"
FT   gene            204685..206400
FT                   /gene="actP_1"
FT                   /locus_tag="ABBFA_00180"
FT                   /old_locus_tag="CTY05_00180"
FT   CDS_pept        204685..206400
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="actP_1"
FT                   /locus_tag="ABBFA_00180"
FT                   /old_locus_tag="CTY05_00180"
FT                   /product="Cation/acetate symporter ActP"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:P32705"
FT                   /protein_id="ATY42654.1"
FT                   /translation="MKWNSLKAKALLAAASLYSTVAMASPDLGEAEQQATNWHAIIMFI
FT                   IFVGFTLFITKWAAKQTQSAQDFYTAGGGISGFQNGLAIAGDYMSAASFLGISAMVFSS
FT                   GFDGLLYSLGFMVGWPIVLFLVAERLRNLGKYNLSDVVSFRLEEKPVRTLAAFSSLVVV
FT                   AFYLIAQMVGAGQLIKLLFGLNYNIAVVIVGLLMMAYVIFGGMLATTWVQIIKAVMLLS
FT                   GATFMAFMVMKAVGFSFSNMFTQSIEVFSKVHDVSFEDAAKIMGPGKLAANPIDALSLG
FT                   LALMFGTAGLPHILMRFFTVKDAKEARKSVVVATGFIGYFYLLTFIIGFGAILFVSNNP
FT                   QFLDVAKMAMTGKLELVGGNNMAAVHLSDALGGDLFMGFISAVAFATILAVVAGLTLSG
FT                   ASAISHDLYANVFKKGQTTPASELRMSKIATLGLAIFAMILGILFEKQNVAFMVGLAFS
FT                   VACCANFPILVLSMFWKGLTTRGAVIGGVVGLVTAVVLIILSKAVWVDTLKISDTPINP
FT                   FNGPALFAMPLSFLCCWFFSVTDSSARAKKERASFDAQYVRSMTGIGASGASDH"
FT   gene            206570..207262
FT                   /locus_tag="ABBFA_00181"
FT                   /old_locus_tag="CTY05_00181"
FT   CDS_pept        206570..207262
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABBFA_00181"
FT                   /old_locus_tag="CTY05_00181"
FT                   /product="hypothetical protein"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /protein_id="ATY42655.1"
FT                   /translation="MRSIIEFWSSFRLLPSAWLLLVQFILLILAMLTFDNEAYRTLTWA
FT                   LGVLALLIIAKVIRQTPMFTFLGLAFVSGAIIASVFILLGYSNLTIQIFAHSCEALAYF
FT                   SAAYGLFRYMFADRYLTRDELFAAAAVFTLLAWGFAFLYNICQLLIPNSFQNPNHIHHL
FT                   QTWLDLLFLSFSLQSATGLSDLMPLSPPARVLAMLQMFCGVMYLALIVTRLIALQYIKH
FT                   TPKKNSDK"
FT   gene            207428..209395
FT                   /gene="betT_1"
FT                   /locus_tag="ABBFA_00182"
FT                   /old_locus_tag="CTY05_00182"
FT   CDS_pept        207428..209395
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="betT_1"
FT                   /locus_tag="ABBFA_00182"
FT                   /old_locus_tag="CTY05_00182"
FT                   /product="High-affinity choline transport protein"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:P0ABC9"
FT                   /protein_id="ATY42656.1"
FT                   /translation="MPSKQASWFANVNPNVFLGTVIIIALFLAVVVIAPSSFELLTQQL
FT                   KQWITDSFSWFYVLSVAFFLILLIYIACSAIGRIKLGPDHSQPEYSNGSWFAMLFTAGM
FT                   GIGLMFFGVAEPVMHYVNPPSGEPQTIEAAQQALRVTFFHWGLHAWAIYAVVGLALAYF
FT                   AYRHNLPLKTRSALYPLIGKKIYGPWGDSIDIFATIGTVFGVATSLGFGVTQINSGLHY
FT                   LFGIEQSTTTQVLLIIFVSILASLSVFLGLDKGVKRLSELNLVLALILLVFVFIAGPSI
FT                   YLLQTTIQNTGQYISNLFTMTFNLYAYQPNGWIGGWTILYWAWWISWSPFVGMFIARVS
FT                   RGRTIREFIVGVLLIPTGFTIIWMGFLGNAALFSIIHEHQTTLIQAVQQDSSVALFEFL
FT                   GHLPWSGVMNILATILVVLFFVTSADSGALVTDYLTAKTENSPTWQRLFWTVLMAVLAI
FT                   ILLLVGGLAALQSSIIMSALPFTVVMLLMSWGLIKALHLDVTKMIAIQEARITPRAIHN
FT                   PRSWQQRLGLIMHYPHSEEEVKQYIEKQVSRAFENIQHEFRRRHLEVSISEVEDGMQLR
FT                   VDHHHEINFIYKVVSRETVPPSFLIGRTEAEDGQYFQAEVFLREGGQNYDVMDWTQEDL
FT                   IQDIIDQYERHLHFLNIVRS"
FT   gene            complement(209454..210335)
FT                   /locus_tag="ABBFA_00183"
FT                   /old_locus_tag="CTY05_00183"
FT   CDS_pept        complement(209454..210335)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABBFA_00183"
FT                   /old_locus_tag="CTY05_00183"
FT                   /product="hypothetical protein"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /protein_id="ATY42657.1"
FT                   /translation="MKKLGLATAVLLAMTGAHAYQFEVQGQSEYVDTTANDKNFTGTAQ
FT                   GTYYFKNVDASKGPLAEAAFLNQASNVSVAYNYIKYDEKDTVNVESHTYGVKGEAYLPT
FT                   PYLPVYASASYNHTINDFKDGVSDDNGDRYALEAGAMLLPNFLVAVGYTSVADQISLDA
FT                   FGVNKYGIAKAVGESVAIDEKQDAVTARTKYVGNIDGTNMAIGFEAFGVFAEDNAYGMK
FT                   TDLFVTPKLSVGASFADVSAFNSGYDHVWGGHTQYFITPAVAVGADFVKANAKDGNPRD
FT                   TQTIGLNAKFRF"
FT   gene            211328..213034
FT                   /gene="pleD_1"
FT                   /locus_tag="ABBFA_00184"
FT                   /old_locus_tag="CTY05_00184"
FT   CDS_pept        211328..213034
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pleD_1"
FT                   /locus_tag="ABBFA_00184"
FT                   /old_locus_tag="CTY05_00184"
FT                   /product="Response regulator PleD"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:Q9A5I5"
FT                   /protein_id="ATY42658.1"
FT                   /translation="MSGLRSEHISNRLFFFMLVIILSLLFMAVPLIVSSYQEYLKTKQA
FT                   LVEIKSLRSIAEVANKVSKERAPANKLMSSNAADFLKNQKNLKEYRLSVDRQLNETIHI
FT                   LKEEGYTDLANTLDTKFRDDLKQARAVVDYYVATPEQARSSIQFDNAILAMFGAWDSCR
FT                   EVLQNLMLQLKSKDSQINNYFTLIVVLTDMRDQAGRTASNVIAPVTFKETIPNDNRARS
FT                   LQTQQQARYLWALVDTLQSEQAKTPEYHRLYSRVKTEFLDKGVPIVGQLLDESQKHQAY
FT                   HLNGTELTDQIVDKFTTVIDLQKFLLNKSVLIASQENYLAKKKFFLTLLISSISLAAAL
FT                   LTLIYAKRRVFEPLIQARTLILDLSHSTDYPIDELKPKKGEFISLFEAIDRLQRMLKQR
FT                   DAFEFQLKNIANTDPLTGVSNRLALSEYLKIVESYPQKFSQTCLMIIDIDRFKHVNDQY
FT                   GHIVGDQVIRRIADQLKANVRASDLIVRYGGDEFLILLEQVQFLDARLLAEKIRIAISL
FT                   EEIDLSGTKEKLHVSVSIGFAIGATSWMELLENADRSLLRAKARGRNVVEG"
FT   gene            complement(213068..215902)
FT                   /gene="uvrA"
FT                   /locus_tag="ABBFA_00185"
FT                   /old_locus_tag="CTY05_00185"
FT   CDS_pept        complement(213068..215902)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="uvrA"
FT                   /locus_tag="ABBFA_00185"
FT                   /old_locus_tag="CTY05_00185"
FT                   /product="UvrABC system protein A"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:P0A698"
FT                   /protein_id="ATY42659.1"
FT                   /translation="MSQSHIRIRGARTHNLKNVSLDIPRDKFVVITGLSGSGKSSLAFD
FT                   TLYAEGQRRYVESLSAYARQFLSQMEKPEVDSIEGLSPAIAIEQKSTSHNPRSTVGTIT
FT                   EIYDYLRLLYARVGTPYCPEHDLPMVAQTVSEMVDAVKNLEEGTALMLLAPVVRERKGE
FT                   YSNLFEQLQGQGFVRARVDGEIIDIDTPPELDKKKKHTIEVVVDRFKVRDDLGNRIAES
FT                   FETALRLGGDIAVLSWMNGEHPDRVFSAKHSCPECDRAVAELEPRLFSFNNPFGACPVC
FT                   DGLGTRSHFSPEKLIPNPELAISEGAIRGWDRQRPYYYSMLQKVADHFGFQLDTPWNQL
FT                   DKDTQKKFLQGTGKEKIDLSYIDERGRKHTRVQPFEGILPHLERRYRETESNYVRDDLA
FT                   QYLSNAACDACGGSRLNEISRHVRVKDKTIADITRMSIGDAESYYQGINLEGAKGEIAD
FT                   KIFKEIRERLHFLVSVGLNYLSLARSAETLSGGEAQRIRLASQIGAGLMGVMYVLDEPS
FT                   IGLHQRDNDRLLQTLIRLRDLGNTVLVVEHDEDAIRAADHIIDIGPGAGVHGGVVIAEG
FT                   TYDELAKHADSLTGQYLSGKLKIEVPKQRTQPPKPEEKIKLSGAAGHNLKNVDLTIPLG
FT                   IMTCVTGVSGSGKSTLINRTLLPLAATQLNGATTLTAEKFDSIDGLQHLDKVVDIDQSP
FT                   IGRTPRSNPATYTGLFTPIRELFAQTPEAKARGYSAGRFSFNVKGGRCEACEGDGMIKV
FT                   AMHFLPDMYVPCDACHGKRYNRETLEVGYKGKNISDVLEMTVEDAAEFFSAIPVIHRRL
FT                   ETLTQVGLGYIRLGQAATTLSGGEAQRVKLARELAKRDTGKTLYILDEPTTGLHFHDIA
FT                   KLLDILHELRNKGNTIVVIEHNLDVIKTADWVVDLGPEGGSGGGMIIAEGTPEQVAEVE
FT                   ISHTGRFLKPMLKQ"
FT   gene            216199..216801
FT                   /gene="nemR_1"
FT                   /locus_tag="ABBFA_00186"
FT                   /old_locus_tag="CTY05_00186"
FT   CDS_pept        216199..216801
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nemR_1"
FT                   /locus_tag="ABBFA_00186"
FT                   /old_locus_tag="CTY05_00186"
FT                   /product="HTH-type transcriptional repressor NemR"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:P67430"
FT                   /protein_id="ATY42660.1"
FT                   /translation="MKRLNKSETTRQHILDTSFELVLHKGFVGVGLQEILKACDVPKGS
FT                   FYHYFASKEAFGCALLEQYMANYKVRMEQLWQHSEQSAHARLMALWQAWIDDPVHGSWA
FT                   ENCLIVKLAAEVSDLSEDMRQILNDGVHKLTQRLALLLKEGQQEGSIPKHIEPLKTAQV
FT                   MYQLWLGAALLTKLSQDKAHLHLALETTQQLLKPIEE"
FT   gene            216805..217782
FT                   /gene="qorA"
FT                   /locus_tag="ABBFA_00187"
FT                   /old_locus_tag="CTY05_00187"
FT   CDS_pept        216805..217782
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="qorA"
FT                   /locus_tag="ABBFA_00187"
FT                   /old_locus_tag="CTY05_00187"
FT                   /product="Quinone oxidoreductase 1"
FT                   /EC_number="1.6.5.5"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:P28304"
FT                   /protein_id="ATY42661.1"
FT                   /translation="MRSIIHRNFGEPVDVLEQADMPKPEPKAGEVRIKTIMSPIHNHDV
FT                   WTVRGSYGYKPTLPAIGGSEAVGIVDALGEGVEHVQVGQRIAVAAVHGSWAEYFIAPAQ
FT                   GIIPLNNEIDDETAAQLIGMPISALMLLDFVNVQPGQWLIQNTANGAVGKTVAMIAQAR
FT                   GLPVINLVRRSDAIAEMQALGIQHVVATDQPNWKAQVKQIHGDQPLIAGVDSIGGTASG
FT                   EMLNLLSENSLLVSFGSMTGETMQISSGDLIFKQATVKGFWASVVNKEMPAARKKELIV
FT                   ELLTLATQKKLILPVEGVFSFDEIKTAAKRATQGARQGKVLLKP"
FT   gene            217847..218200
FT                   /locus_tag="ABBFA_00188"
FT                   /old_locus_tag="CTY05_00188"
FT   CDS_pept        217847..218200
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABBFA_00188"
FT                   /old_locus_tag="CTY05_00188"
FT                   /product="hypothetical protein"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /protein_id="ATY42662.1"
FT                   /translation="MIGQILIALIAILHVYILVLEMFLWDKPYGMKAFGNSTEKAKLTK
FT                   VMAQNQGLYNGFLAAGLFWSLLADAPFATSIANFFLGCVLIAGIYGGLTASKKIIYIQA
FT                   VPALIALVAVNFL"
FT   gene            218253..218594
FT                   /gene="ydgC"
FT                   /locus_tag="ABBFA_00189"
FT                   /old_locus_tag="CTY05_00189"
FT   CDS_pept        218253..218594
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydgC"
FT                   /locus_tag="ABBFA_00189"
FT                   /old_locus_tag="CTY05_00189"
FT                   /product="Inner membrane protein YdgC"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:P0ACX0"
FT                   /protein_id="ATY42663.1"
FT                   /translation="MWALFLKCMLGAGVVLIISILSKSKAFYIAGLVPLFPTFALIAHV
FT                   IVFQQKGAEALQKTALFGLWSLIPYAIYLAAVYVLATRMSMWSCLGVATLCWVVAAAGL
FT                   IYGWQLFQS"
FT   gene            complement(218644..219318)
FT                   /gene="tenA"
FT                   /locus_tag="ABBFA_00190"
FT                   /old_locus_tag="CTY05_00190"
FT   CDS_pept        complement(218644..219318)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tenA"
FT                   /locus_tag="ABBFA_00190"
FT                   /old_locus_tag="CTY05_00190"
FT                   /product="Thiaminase-2"
FT                   /EC_number="3.5.99.2"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:P25052"
FT                   /protein_id="ATY42664.1"
FT                   /translation="MLFSQELWQRNLNLYQKILDLPFNQELANGTLDKEAFCHYVIQDA
FT                   QYLVAYGRVLAVAAAKAFDADDIMQFSDAAKIAIVVERSLHDDFMKNFGVTKEEFKNTP
FT                   LTLAGHHYTSFLTATAWSESYPVVLAALLPCFWIYAEVGKDIVSKSVPNNPYQAWIDTY
FT                   AGEEFHTAVRNVIATVDKVAARCDADTLEKMHAAYTMGAKLEWLFWDSAYHQRQWLGLD
FT                   QI"
FT   gene            219581..220663
FT                   /locus_tag="ABBFA_00191"
FT                   /old_locus_tag="CTY05_00191"
FT   CDS_pept        219581..220663
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABBFA_00191"
FT                   /old_locus_tag="CTY05_00191"
FT                   /product="Integral membrane protein TerC family protein"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="protein motif:Pfam:PF03741.10"
FT                   /protein_id="ATY42665.1"
FT                   /translation="MKHFRFSIFFTVVCLALSAYWGFTHGPEAGVSTMLKALTITAILA
FT                   VMEVSLSFDNAVVNASVLRNWDPFWKMIFLTVGILIAVFGMRLIFPVVIVAVTADMGVV
FT                   EVAKMALNDPKTYSERLMAHHAEISAFGGTFLLLVFLNFFFDDEKETHWFRWLESKLAS
FT                   LASVPAMSVFLALIALIVMAGYVDDHQRLAVTMAGIWGIVVYIGVEVLSHLLGGEPEID
FT                   ENGNAVLQDGSGAASGVVKAGLGGFLYLEVLDASFSFDGVIGAFAITSDVVVIMLGLAI
FT                   GAIFVRSMTVYLVEKGTLDAYVFLEHGAHYAIGALAFIMIASGTGVHVPEVVTGLIGVA
FT                   FIVWAVIASIQYSKREQQSP"
FT   gene            220810..222174
FT                   /gene="yajR"
FT                   /locus_tag="ABBFA_00192"
FT                   /old_locus_tag="CTY05_00192"
FT   CDS_pept        220810..222174
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yajR"
FT                   /locus_tag="ABBFA_00192"
FT                   /old_locus_tag="CTY05_00192"
FT                   /product="Inner membrane transport protein YajR"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:P77726"
FT                   /protein_id="ATY42666.1"
FT                   /translation="MMNALERRSTFALSSIFALRMLGLFMIIPVFSVVGQSYQYATPAL
FT                   IGLAVGIYGLSQAILQIPFSLLADRFSRKPLVVFGLLLFAIGGAIAGLSDTIYGVIIGR
FT                   AIAGAGAVSAVVMALLADVTREEQRTKAMAAMGMSIGLSFVVAFSLGPWLTSLVGISGL
FT                   FFVTTIMGLIAIAMLLLVPKVTRHHRNYQQGYMAQLKQVIQMGDLNRLHVSVFALHLLL
FT                   TAMFIYVPSQLIEFARIPLASHGLVYLPLLVISLFFAFPSIIIAEKYRKMRGIFLTAIT
FT                   GIIAGLLLLIFGYQSKYVLLAGLGIFFIAFNVMEALLPSWLSKSAPIQSKATAMGVNAS
FT                   SQFLGAFFGGTLGGQLLMLHNTAIGWSVLAGIAIIWLLISFGLAQPRYLSSIVLPLPQV
FT                   QQVNEWTTQLLAIRGIEEVVVMPDQQVAYIKVDKQSLDDASRRDLTQLFGKEVAI"
FT   gene            222226..222807
FT                   /gene="ssb"
FT                   /locus_tag="ABBFA_00193"
FT                   /old_locus_tag="CTY05_00193"
FT   CDS_pept        222226..222807
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ssb"
FT                   /locus_tag="ABBFA_00193"
FT                   /old_locus_tag="CTY05_00193"
FT                   /product="Single-stranded DNA-binding protein"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:P0AGE0"
FT                   /protein_id="ATY42667.1"
FT                   /translation="MRGVNKVILVGTLGRDPETKTFPNGGSLTQFSIATSEVWTDKNTG
FT                   ERKEQTEWHRIVLHNRLGEIAQQFLRKGSKVYIEGSLRTRQWTDQNGQERYTTEIRGDQ
FT                   MQMLDARQQGEQGFAGGNDFNQPRFNAPQQGGGYQNNNQGGGYGQNNGGYGGQGGFGNG
FT                   GNSPQGGGFAPKAPQQPASAPADLDDDLPF"
FT   gene            complement(222848..223171)
FT                   /locus_tag="ABBFA_00194"
FT                   /old_locus_tag="CTY05_00194"
FT   CDS_pept        complement(222848..223171)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABBFA_00194"
FT                   /old_locus_tag="CTY05_00194"
FT                   /product="Branched-chain amino acid transport protein
FT                   (AzlD)"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="protein motif:Pfam:PF05437.6"
FT                   /protein_id="ATY42668.1"
FT                   /translation="MSQQLLIIVGIALLALGTYSIRFAGFHLGAKFSFSEKYQVLLSNG
FT                   ATVLLCAIAVTTTFFEGQHFAGFARIFGVGLALFLVWKKAPLLLVICLAAAGTALVRLL
FT                   GIE"
FT   gene            complement(223168..223863)
FT                   /locus_tag="ABBFA_00195"
FT                   /old_locus_tag="CTY05_00195"
FT   CDS_pept        complement(223168..223863)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABBFA_00195"
FT                   /old_locus_tag="CTY05_00195"
FT                   /product="AzlC protein"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="protein motif:Pfam:PF03591.8"
FT                   /protein_id="ATY42669.1"
FT                   /translation="MENRSLYHAMTTYALIKKLSKDTTRSIFFVCLATSVVGMSLGSLA
FT                   ASYGLALWIPLCLSIFVLAGTAEFIFIGFLAVGGSPIAAAIAGLLVNLRHLPFGIAVNE
FT                   LIRGKFSQYFGSHIMNDESVLFGMAQPDFETKKAAYWLCGIGIMLSWPLGVTAGYFIGS
FT                   AIPDPKTFGLDAIFPAILIALTFSALKNKVTRKAAFAGSTLALITTPFLASGLPILISL
FT                   FGLIWGRKK"
FT   gene            223932..224480
FT                   /gene="sinR"
FT                   /locus_tag="ABBFA_00196"
FT                   /old_locus_tag="CTY05_00196"
FT   CDS_pept        223932..224480
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sinR"
FT                   /locus_tag="ABBFA_00196"
FT                   /old_locus_tag="CTY05_00196"
FT                   /product="HTH-type transcriptional regulator SinR"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:P06533"
FT                   /protein_id="ATY42670.1"
FT                   /translation="MSQPIEIIAKGLTRERQRAGLSLAEVARRAGVAKSTLSQLEAGQG
FT                   NPSIETLWALCVALNIPFARLMEEPSNQVQVIRCGDGPTVSSEIANYKAILLATCPPHA
FT                   RRDVYLLIVEPGEDRLSEPHPVGSVEHIIVVEGRALVGLIDEAVELGVGDYICYPADQK
FT                   HIFRALETGTKALLISEQN"
FT   gene            224786..226228
FT                   /gene="gabP_1"
FT                   /locus_tag="ABBFA_00197"
FT                   /old_locus_tag="CTY05_00197"
FT   CDS_pept        224786..226228
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gabP_1"
FT                   /locus_tag="ABBFA_00197"
FT                   /old_locus_tag="CTY05_00197"
FT                   /product="GABA permease"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:P25527"
FT                   /protein_id="ATY42671.1"
FT                   /translation="MATHQNGSEANHSQSLKHGLKSRHLTMISIAGVIGGSLFVGSGSI
FT                   IYNTGPVVFLTYALGGLLVWFIMRMLGEMAVLNPDSGSFSTYADRAIGRWAGFSIGWLY
FT                   WCTLAMLMGWEAYVAGKILNNWFPFIPIWVYMTVVIVALVVVNLQNVKNYGEFEFWFAL
FT                   IKVIAIVVFLVIGSLAIMHLWPWGNPAASGISNLTSQGFMPNGGSSVITALLGVMFAYI
FT                   GAEIVTVAAAESANPSKEIRKASNSVVWRIILFYVGSMFVAVCLIPHNNELLKDSTWGT
FT                   YSVTLSALGIPGARHIVNFVVLTSVCSCFNSALYTCSRMLFSLSKRGDAPKSFGSVNSK
FT                   SSPWVGVIVSCFFSVIAVILTATESMNVYDFFMLTTGAATLYVYLTIAYSQLRMRKKLE
FT                   AEGVKIDFKMWMFPYLTYVVIFAIIGAILTMLIEGTYFKEVIYTTALFGIIVFFGLLSE
FT                   KLGWGKDRRATHLTHSHEEKLV"
FT   gene            complement(226289..227833)
FT                   /gene="gabR_1"
FT                   /locus_tag="ABBFA_00198"
FT                   /old_locus_tag="CTY05_00198"
FT   CDS_pept        complement(226289..227833)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gabR_1"
FT                   /locus_tag="ABBFA_00198"
FT                   /old_locus_tag="CTY05_00198"
FT                   /product="HTH-type transcriptional regulatory protein GabR"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:P94426"
FT                   /protein_id="ATY42672.1"
FT                   /translation="MPTDESHFLTVGESQLRSLLGDHLLQRLQQDTEGKLHQRLFRCLR
FT                   GAIIDGVIQPKTRLPASRDLASEIHVSRNTVLSAYEQLQAEGYLEARTGHGTWVAEKLP
FT                   ESFLNTQNKKKVVSSPNIQSSYALSQRGSNLLGYAAASPHQWGAFVPGAPDVTEFPHHI
FT                   FSRIQARLSREPDINRLIYSNAGGCIELRSALADYLRVARSVQCDADQIIITEGIHQAI
FT                   DLVSRALSDMGDKVWIEDPAYWGMRNTLRINGLDIQPMPVDAEGIIPEENPAVPPKLIF
FT                   VTPSHQYPLGSHLSLDRRRQLIQIARQHNSWIVEDDYDSEFRFSGQPYPSLQGLENNAP
FT                   VLYMGTFSKTIYPSLRIGYLVVPKPLFSPLRIVAAELYRGGHLLEQKALAEFIREGHYE
FT                   AHIRRMRLLYGKRRDYLVSLIQRYLGPEFIHEYDEAAGLHLVLKLPNSCDDVAIAATAL
FT                   ERGVKVRPLSQYYMQSHAHAERGLLMGFACVNEKDMVMAFGVLLQCLREAGVPTLN"
FT   gene            227945..229237
FT                   /gene="puuE"
FT                   /locus_tag="ABBFA_00199"
FT                   /old_locus_tag="CTY05_00199"
FT   CDS_pept        227945..229237
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="puuE"
FT                   /locus_tag="ABBFA_00199"
FT                   /old_locus_tag="CTY05_00199"
FT                   /product="4-aminobutyrate aminotransferase PuuE"
FT                   /EC_number="2.6.1.19"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:P50457"
FT                   /protein_id="ATY42673.1"
FT                   /translation="MDNQHSALNVRKQQATPRGVGVMCQWYAEKAENATLWDKEGNQFI
FT                   DFAGGIAVLNTGHRHPKVIAAVTEQLTKFTHTAYQVTPYESYVALAERINERAPIAGPA
FT                   KSAFFTTGAEAVENAVKIARCYTGRHGIITFGNGFHGRSFMTMAMTGKTAPYKRDFGVM
FT                   PAGVFHARYPVPAKGISVDAAIESVEDIFSEDIAPHDVAAIVLEPVQGEGGFNVVPAEF
FT                   LKRLRAICDKHGILLVADEVQSGFARTGKLFAMNHYETKADLITMAKSLGGGFPISGVV
FT                   GRAEVMDAPNPGGLGGTYAGSPIAVAAAHAVIDAIEEENLCDRANELGAELVATLKDIQ
FT                   QATGDVVTDIRALGSMVAVELETAEQAKVVQNYAMENGLLLLTCGKYGNVIRFLYPLTI
FT                   PAEQFRQGLDILKQGFATLKAGSAKAMEQSA"
FT   gene            229234..230682
FT                   /gene="gabD_1"
FT                   /locus_tag="ABBFA_00200"
FT                   /old_locus_tag="CTY05_00200"
FT   CDS_pept        229234..230682
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gabD_1"
FT                   /locus_tag="ABBFA_00200"
FT                   /old_locus_tag="CTY05_00200"
FT                   /product="Succinate-semialdehyde dehydrogenase [NADP(+)]
FT                   GabD"
FT                   /EC_number="1.2.1.79"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:P25526"
FT                   /protein_id="ATY42674.1"
FT                   /translation="MIQNNLQYLLKHPDISLEAPASNDYIEVNDAATGETLAWVKTYDR
FT                   AGVEAAINRSAKAQAAWKKQTALARADVLLAWYNLMLEHKENLAQILTAEQGKPLAEAR
FT                   GEIGYAASFIRWFAEQARRIDGEVLTPTLPNQRLLVIKQAIGVTAAITPWNFPAAMITR
FT                   KAGPAIAAGCSMLVKPAEQTPLTAYALEVLALQAGLPADVLINISGDAVEVGKTLCESD
FT                   IVRKLSFTGSTQVGRILMQQCAPTIKKLSLELGGNAPVVVFDDANLEQAVQGIMASKYR
FT                   NSGQTCVCANRIYVQDGIYDVLAERLVEAVSKLKVGDGRQEGSTQGPLIDEDAIAKVQS
FT                   HIADATEKGATVRIGGQRSALGGTFFEPTVLTGVTQDMKVSKEETFGPLAPLFRFKTED
FT                   EAVAMANDTEFGLAAYLFTQSTARQWRVGEALEYGMVGINTGAISNEVAPFGGVKQSGL
FT                   GREGSKFGIEEYVEMKYLCVDLSE"
FT   gene            complement(230787..231761)
FT                   /gene="dmlR_2"
FT                   /locus_tag="ABBFA_00201"
FT                   /old_locus_tag="CTY05_00201"
FT   CDS_pept        complement(230787..231761)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dmlR_2"
FT                   /locus_tag="ABBFA_00201"
FT                   /old_locus_tag="CTY05_00201"
FT                   /product="HTH-type transcriptional regulator DmlR"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:P76250"
FT                   /protein_id="ATY42675.1"
FT                   /translation="MLKHSNLEFKWVEQTLISSFDDFYYFYLVVKHGGFSAASEAENIS
FT                   KSKLSRRIIDLENKFNVSLIQRTTRHFKVTDLGQEFYEECCKVIAQVECAENVLLKQKS
FT                   EPQGLVKVSCPPLMMHFQIRKILNQFLKTYPKVEISLELTSRRVDILHDDIDLAIRTNF
FT                   EPNEDSNLIVRDVIKTDHCLVASPELLQGRTIKHYSELQDFPSISLGTQKQNYIWHLCN
FT                   IRNGESVDVPYQPRIKSNDLAGVYYAVMDGLGIADLPFLTVESEIRKGTLVHILPDWKS
FT                   NIGMLQLVYVSRKGQRLVVEKLIETLIDELRRLPESHEGYLPT"
FT   gene            complement(231782..232408)
FT                   /locus_tag="ABBFA_00202"
FT                   /old_locus_tag="CTY05_00202"
FT   CDS_pept        complement(231782..232408)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABBFA_00202"
FT                   /old_locus_tag="CTY05_00202"
FT                   /product="nicotinamidase/pyrazinamidase"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="protein motif:CLUSTERS:PRK11609"
FT                   /protein_id="ATY42676.1"
FT                   /translation="MAQDYVRLDKDNAAVLLVDHQAGLLSLVRDIDPDKFKNNVLAVAN
FT                   AAKYFNLPTILTTSFETGPNGPLVPELKEIHPDAPFIPRPGQINAWDNEDFVKAVKATG
FT                   KKQLIIAGVVTEVCVAFPALSALAEGFEVFVITDASGTFNELTRDAAWDRMSKAGAQLM
FT                   TWFGMACELHRDWRNDIEGLGTLFSNHIPDYRNLISSYNHNTSQK"
FT   gene            232685..233557
FT                   /gene="yhhW_1"
FT                   /locus_tag="ABBFA_00203"
FT                   /old_locus_tag="CTY05_00203"
FT   CDS_pept        232685..233557
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yhhW_1"
FT                   /locus_tag="ABBFA_00203"
FT                   /old_locus_tag="CTY05_00203"
FT                   /product="Quercetin 2,3-dioxygenase"
FT                   /EC_number="1.13.11.24"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:P46852"
FT                   /protein_id="ATY42677.1"
FT                   /translation="MKKFLGAYQNNHMHWVGDGFPVYNLFSYDRLGQTLSPFLLLDYAA
FT                   PYNFSPTTEQQGVGSHPHRGFETVTIAYQGEVTHKDSSGGGGTIKTGDVQWMTAGAGVL
FT                   HEEFHSPEFAEHGGLFEMVQLWVNLPSHSKMTPGKYQAIEAKDIPDIALDEHGSHLRVI
FT                   AGEYADAKGAASTFSPLNVWDGKLVKGQKHTLYVPEGHTTLVVVLEGAVVVNDTNRLEG
FT                   KTVAILSREGVEFSLNAEEDTKFLVLTGQPLNEPIEGYGPFVMNTKAEIMEAINDFNRG
FT                   KFGSIMQEG"
FT   gene            233958..235295
FT                   /locus_tag="ABBFA_00204"
FT                   /old_locus_tag="CTY05_00204"
FT   CDS_pept        233958..235295
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABBFA_00204"
FT                   /old_locus_tag="CTY05_00204"
FT                   /product="hypothetical protein"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="protein motif:CLUSTERS:PRK07233"
FT                   /protein_id="ATY42678.1"
FT                   /translation="MIIKKILEKWDIILDIAIIGSGMAGLAAARILKDAGHTITIFEAL
FT                   PGRGMDSHSIEFDGGIIDAPLRVMNPHLWKNTLSLAAHLGIKTFPVRTYMSCSWLFEDR
FT                   TETWLTTSRSRIGNFPIINNRKGIQQYGWRLVKGMLQLKTAIHQFFKSKNQDITLAEFI
FT                   NQNDIEEVFWHGVVMPVLYTICTCNPKTIGDWPAKNLLEFLRHLTDGDMLLRMKGGTPA
FT                   FVDSLIKGIDIHSGSAIKKVELQGEKVLVENEKGDQGTFDRVIVATPTSKLEEFLNPEQ
FT                   FAEDMNLLKQFRFEQGDLVIHTDATVMPPRRKDWSVLSYMMDRKFTRQQFTVWMNAVEP
FT                   SLVGKNPVFQTWRPVVDIDPKKVISKVTLTRAVVDSQTIALNKELQQRHLEPNRKVFYC
FT                   GSWSCDGLPILESAVTSAMHIAEILGAPLPFVGLKPKVEVAPELGY"
FT   gene            235273..236127
FT                   /gene="eryG"
FT                   /locus_tag="ABBFA_00205"
FT                   /old_locus_tag="CTY05_00205"
FT   CDS_pept        235273..236127
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="eryG"
FT                   /locus_tag="ABBFA_00205"
FT                   /old_locus_tag="CTY05_00205"
FT                   /product="Erythromycin 3''-O-methyltransferase"
FT                   /EC_number="2.1.1.254"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:A4F7P5"
FT                   /protein_id="ATY42679.1"
FT                   /translation="MPLNSVTKIVKAKVRAALSRFIPHKYAIDASSLGDSEELAWTNLG
FT                   FWKNTQTYREACRQLADHLAQAVNLNSKDHLLDLGCGQGASLLHWLQHYHPKSLSAVEL
FT                   QASCVNKIQKFIPEISQIFCGSFLNLKQFEFKQRFDVVLCIDAAYHSHLNSFLDSVTPV
FT                   LNSKGRLGFHYLMRADSCHNMTMLQEQKHRYLLKAADVTWDALLTEEILRTTLEQQGFT
FT                   DIKIEDLSEQVLLGFSQYIQNQQAQSHNRGLANFKIQMTAKLCQQLYQNGYVRYIQITA
FT                   IKK"
FT   gene            236136..236558
FT                   /locus_tag="ABBFA_00206"
FT                   /old_locus_tag="CTY05_00206"
FT   CDS_pept        236136..236558
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABBFA_00206"
FT                   /old_locus_tag="CTY05_00206"
FT                   /product="Glutathione-dependent formaldehyde-activating
FT                   enzyme"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="protein motif:Pfam:PF04828.8"
FT                   /protein_id="ATY42680.1"
FT                   /translation="MSVKYQGSCLCGAVSYQSDAEPRYSFNCHCRDCQKATGSAYAPIA
FT                   FFHQSELKISGELKYFETLGSSGRPIKRAFCPTCGSQLFGLPELVPEMISIRAGTLDDP
FT                   SLYHPKAEVFVSQTYAWDMLNPNLKHFEKMIEKSKK"
FT   gene            complement(236562..236732)
FT                   /locus_tag="ABBFA_00207"
FT                   /old_locus_tag="CTY05_00207"
FT   CDS_pept        complement(236562..236732)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABBFA_00207"
FT                   /old_locus_tag="CTY05_00207"
FT                   /product="hypothetical protein"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /protein_id="ATY42681.1"
FT                   /translation="MSNLPSNLFQPLVIILACLIIFVSKMPQLKFRKTILFLALGSLTL
FT                   ICALAIFGFFN"
FT   gene            complement(237949..239103)
FT                   /gene="pvuIIM"
FT                   /locus_tag="ABBFA_00208"
FT                   /old_locus_tag="CTY05_00208"
FT   CDS_pept        complement(237949..239103)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pvuIIM"
FT                   /locus_tag="ABBFA_00208"
FT                   /old_locus_tag="CTY05_00208"
FT                   /product="Modification methylase PvuII"
FT                   /EC_number="2.1.1.113"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:P11409"
FT                   /protein_id="ATY42682.1"
FT                   /translation="MSNNSPKALVSERRKYKVLNTQQAKGIAENHLKSIGFNAIAISYG
FT                   LPEIDDRYHVWRVPVLREKGRIGEVVIDAYTSNVDISKSTDRQVLETATPIHTNKKLTK
FT                   KEITLSELENMVIEGNSIESLKYLPEDSVNLIFTSPPYYNAKPEYSEYSTYEEYLELMR
FT                   QVIKGCHRVLSEGRFFVLNISPVLIRRASRSESSKRIAVPFDFHKLFIEEGFEFIDDIH
FT                   WVKPEGAGWAFGRGRRFAADRNPLQYKPVPVTEYILVYRKKTDRLIDWNIRKHPDQKAV
FT                   EESKVEDGYETTNLWRINPSRSKDHPATFPVELAEKVIKYYSFKNDVVLDPFGGSGTTG
FT                   IAALNLNRRFVMMELESKYIQVMKKRFSSFDLFTPISFIKNKDL"
FT   gene            239224..240282
FT                   /locus_tag="ABBFA_00209"
FT                   /old_locus_tag="CTY05_00209"
FT   CDS_pept        239224..240282
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABBFA_00209"
FT                   /old_locus_tag="CTY05_00209"
FT                   /product="CfrBI restriction endonuclease"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="protein motif:Pfam:PF09516.4"
FT                   /protein_id="ATY42683.1"
FT                   /translation="MNLIEIPEELSGLAKLSKQELVEELGTEVFRDVLLNIFLGKNVRN
FT                   FTEALTRNRLLQSNIALWKFFCEQKKLGISPLDLINIAKEKLLNAKLSPKDRAVYEWLV
FT                   AMTNKQTQNVLRKSHDKEFEDLTQATLEMLDKELLECHSYVSQGVKLGEEISFTFKEMC
FT                   WISLVLGSQTLTIRGSEKSLHGKYFEKLILGSIFQIFGLKLLEIEDISQNGFWLSSQKE
FT                   DRREADGTIVNDAVGIRVDIGFIGPGNSEITLDKVSRFTKFDEISGKKYEMSTIVIVDT
FT                   LGEKSKARELAKAIEGEIICMSDPNWVFTLAKQISEKLSIKDPLKDILIEDLENYLSEK
FT                   LKLIDLDQLINY"
FT   gene            241226..241918
FT                   /locus_tag="ABBFA_00210"
FT                   /old_locus_tag="CTY05_00210"
FT   CDS_pept        241226..241918
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABBFA_00210"
FT                   /old_locus_tag="CTY05_00210"
FT                   /product="Miro-like protein"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="protein motif:Pfam:PF08477.7"
FT                   /protein_id="ATY42684.1"
FT                   /translation="MVAPLFLAAWLGGAALTGIASYLAYENWDAIKKKVSGKSIVILGQ
FT                   RATGKTTLLNYLLKGEITFKNEATIGVKKVKISKRKLSDLGWDVRLNSIQNDYSGVTSN
FT                   YEQWLKALKNADIFIYLFKADEWILDEGAVESQLEKDIKNIQKELKGKNIPMFIIGTHL
FT                   DLLEGIEFNTQKEKIKLIDELQNEVFFKNIKSRLNVSNSKAYLHFGSLKDEDGLDEIIH
FT                   FIIGQMGE"
FT   gene            241921..242424
FT                   /locus_tag="ABBFA_00211"
FT                   /old_locus_tag="CTY05_00211"
FT   CDS_pept        241921..242424
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABBFA_00211"
FT                   /old_locus_tag="CTY05_00211"
FT                   /product="hypothetical protein"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /protein_id="ATY42685.1"
FT                   /translation="MKVYLFAQALDNDSSDDWYEYTNNSLKEIIEESDQSQLNNLIFEL
FT                   TNEGKREITNNVECYYKLTYNNFLNFILLIENQQKDKIGRVAKTALIIKDYNNIALDFE
FT                   KILTLFWTRTNRNLVTSISLGKQCDKIFDMIKKKREKQRWLVSLALVSFSIILVLFFLK
FT                   LRQG"
FT   gene            242428..243270
FT                   /locus_tag="ABBFA_00212"
FT                   /old_locus_tag="CTY05_00212"
FT   CDS_pept        242428..243270
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABBFA_00212"
FT                   /old_locus_tag="CTY05_00212"
FT                   /product="hypothetical protein"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /protein_id="ATY42686.1"
FT                   /translation="MSLKSFPNNIDDRRVVWCLSQDTVDAALNDSSSLELLLTPNVTVV
FT                   QLPLSRIAKKKSVKLCELEKLGLLKVDQVLVCSDEGVNLEEKYLNLEEVIEDFLTYNLK
FT                   KANAYARFFAALGAISFEFEHKKFDFSKSKADFSVSLDGVASRVTKANIDLTAKVEKTL
FT                   NQIASIMKGYTQNECATEQRILLAEKILKEYNLENDEICRHELATFKDGVARLSDLNIS
FT                   MSSTSDNSRSINILVDVGLNFPNIETEGKNSSLISFKSKLELASIVKNSFDFNLKAKF"
FT   gene            243579..244490
FT                   /locus_tag="ABBFA_00213"
FT                   /old_locus_tag="CTY05_00213"
FT   CDS_pept        243579..244490
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABBFA_00213"
FT                   /old_locus_tag="CTY05_00213"
FT                   /product="hypothetical protein"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /protein_id="ATY42687.1"
FT                   /translation="MVKSLKAHERLAERLANIITRLNRGEYLDSNELTLDFGVTKKTIQ
FT                   RDIERLSIAGLPLVIDEKTRKFYLGANYVGKISPQDIQNFAQLSGITGLYPNLDLSFLR
FT                   ELLDSRSSEVYAAKGYFFENTTHFSELFKLIREAIQDRKQITFQYNSKLRTVQPYKLIH
FT                   HHGSWYLAAVSNDQLQLRAYRLSRIGKDCQIQYHLDHFEPDIEIIKQLKNEESIWFGKE
FT                   KREIVLSVQHQAAEHFEQRQLFPEQQIMKKNDDGSLIISSRIAHQDQIKSLIRFWIPHV
FT                   KVISPIELQQSVESDLKSYLET"
FT   gene            244564..246648
FT                   /gene="mcrB"
FT                   /locus_tag="ABBFA_00214"
FT                   /old_locus_tag="CTY05_00214"
FT   CDS_pept        244564..246648
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mcrB"
FT                   /locus_tag="ABBFA_00214"
FT                   /old_locus_tag="CTY05_00214"
FT                   /product="5-methylcytosine-specific restriction enzyme B"
FT                   /EC_number="3.1.21.-"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:P15005"
FT                   /protein_id="ATY42688.1"
FT                   /translation="MIIYSLSIQSTGNSVKVELLKELYKELINIDQLKGWYGSYKSRVS
FT                   EVEEMREKMTKGYKLNPQSDEKFLLSLLKIQKNGIASKGQSNISEVAYNELINNEDFLG
FT                   TLENLIKVPTYENYINFRKVSKTILTSVGSNNFPLIFNRVAAACNLDLSTVVDESKFHQ
FT                   LIKYLDKEKILAIPQEVKDKNWYAQNIFLVSKFREILSDLKGIVEIDKYWINIFIWEIY
FT                   VKKVEISKQKISISNKVDADEVVTETNRYDEKKMQKIVQPLNRILFGAAGTGKTYHSIN
FT                   HALSILDDETLEELEKVERIELKNRFDRYKEKGNIKFVTFHQSFSYEDFIEGIRAEVGN
FT                   GGLSYSIKPGVFKELCEKATINKKATDESIKRAISELTEKAKNEEITFYTKKGAEFKVK
FT                   SNSSGTLIATTSKDTEVTLAKSYITNYLLNQSDEIIDQRSYEWAIAKSLRAVIDYRENT
FT                   RKENNERFILIIDEINRGNISRIFGELITLIEDSKRQGNDEELSTILPYSKEEFSIPNN
FT                   LYIIGTMNSSDRSLTGLDVALRRRFEFIEMPPKPELLKDQEENDIEIDGINIVKLLTVM
FT                   NQRIEILLDRDHCIGHANFMPLKVEPRIEKLSKIFQQKIIPQLQEYFFDDWEKIDAVLN
FT                   GNGMLHKKYEPSSQNKLFKDQSLINRNIWEIKAEAFGDVKKYIAIYDETAEVGNELNGY
FT                   "
FT   gene            246651..247976
FT                   /locus_tag="ABBFA_00215"
FT                   /old_locus_tag="CTY05_00215"
FT   CDS_pept        246651..247976
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABBFA_00215"
FT                   /old_locus_tag="CTY05_00215"
FT                   /product="5-methylcytosine-specific restriction enzyme
FT                   subunit McrC"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="protein motif:CLUSTERS:PRK09736"
FT                   /protein_id="ATY42689.1"
FT                   /translation="MSNITIREYAYLRVSQNPPLENQKMDFAEISQSGFDYLFQLNQEL
FT                   LRNGQRILKSGRTATEIQVQNFVGVIETPCGTEIEILPKHADSVEDGVDARAILIKILK
FT                   QVLQLPQRDTGLASIEKFKVPLTDWFFAQFLEALQKLYRTGVRFDYQRVEAEENFLRGQ
FT                   LDIAQQMRKPLTRQHQLSIKHDIFTSNRAENRLIRSCIDVVCKRAKTADLWRTSHEFHL
FT                   LFSEVPQSTNYRQDFKKWKNNRLMSHYSNIKYWCELILGNEIPFAVKGMDRARSILFPM
FT                   EKLFEKYVEIQLSKQLAKGAKLEAQKSSKYLAQYNSKYIFNLIPDLAIQYYCEQSKSKK
FT                   YLILDTKWKLINSNNIEDKFGLKQSDMYQMFAYNHMYQGHTSDIVLIYPKNKNFQIALE
FT                   PFEFNIHKLLKTGLQPKIWVVPFDLERSELILDNLTIAGLHS"
FT   gene            complement(248025..248495)
FT                   /locus_tag="ABBFA_00216"
FT                   /old_locus_tag="CTY05_00216"
FT   CDS_pept        complement(248025..248495)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABBFA_00216"
FT                   /old_locus_tag="CTY05_00216"
FT                   /product="hypothetical protein"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /protein_id="ATY42690.1"
FT                   /translation="MNRLLTSAITLALISTTSLAAPDKQPLEQINFVKKLYMMAVSDRY
FT                   LGVDILKQNSSSELKQLLSHRDTIALRHNGEMCEWVRNVLIPGNDYDVRVNQMKISALS
FT                   NGLIRAQGKNFGDSFQVDFKVQCDGKNCQIDDIYIPDSYKKEVMSIVKNNQC"
FT   gene            complement(248522..248920)
FT                   /locus_tag="ABBFA_00217"
FT                   /old_locus_tag="CTY05_00217"
FT   CDS_pept        complement(248522..248920)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABBFA_00217"
FT                   /old_locus_tag="CTY05_00217"
FT                   /product="hypothetical protein"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /protein_id="ATY42691.1"
FT                   /translation="MKILIALILTTIPFATYAMCENERSNGTTISINECYKKEAQKSDK
FT                   KIMQVYTNYKNTLNTTEQKNLLEVQRSWISYKMKQCNFEVASYGTIAGQLHAQCMINMN
FT                   NRRINELKYMQDCGLESSSNFCMNYRPA"
FT   gene            complement(249453..250232)
FT                   /locus_tag="ABBFA_00218"
FT                   /old_locus_tag="CTY05_00218"
FT   CDS_pept        complement(249453..250232)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABBFA_00218"
FT                   /old_locus_tag="CTY05_00218"
FT                   /product="hypothetical protein"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /protein_id="ATY42692.1"
FT                   /translation="MPLHEQAVYEKDGLWITITPQELRDPEKLALARSEQLYDSEDRNY
FT                   ELFIRNREDLPHFYRKGVVRHNLDKQKDSQEHDRTISNLLSYLNTNPSIKLKSYFFRNF
FT                   TDKKLHTIKTIKDYEWKDEVSFAVSENGYVRFDLLGRPTSLNCTNYSPFVAIEVVDTHF
FT                   SSKASFLALLELSRKLPFVIGYFFVKSAPYYNAPKKAEGRKLPFVRVTCYIFDGDFWIR
FT                   DERVSDIVSNEIKNNPDAYYEYIFEKVKTEFMIKISK"
FT   gene            250539..251921
FT                   /locus_tag="ABBFA_00219"
FT                   /old_locus_tag="CTY05_00219"
FT   CDS_pept        250539..251921
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABBFA_00219"
FT                   /old_locus_tag="CTY05_00219"
FT                   /product="hypothetical protein"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /protein_id="ATY42693.1"
FT                   /translation="MRVEKKFKKSGYFWLPGHENKKIPGVLTIENDGEIELEIVGHFNE
FT                   DFKILEEDNLDRILGNIEEDGFVTLEDCFYINKNYTFGGISKSKIFVHIVLSGATWGKD
FT                   EIVTFNTFSFSVDCLDEWIGISGIEVQHDLEHNTTTIIYNPPKPISFSLKNDMKIEIHF
FT                   DYNLPGSPNLTTAKITQNTYFKIISENLYGLEEFITIAHQITNFMSFAMDGVVALKNVS
FT                   ATSTEISSTRRNGRIYNVPILIYFQSISYVKEIPNKKPHNMIFTFNTIRNNAEKIFNNW
FT                   LNAYESLSPAINLYFSTKVNSLQFLEGKFLALAQGLETYHRRISKETIMGQHLYEELVK
FT                   KILEGCPDEHKDWLKGRLLHGNEINLGKRIKNIIEPFKELLGTSKERSKLIRNIVDTRN
FT                   YLTHYSENLESFSVEGENLWELCQKLELIFTLHFLKIIGFTEEEIKLACKKNLPLRQKF
FT                   NK"
FT   gene            251971..253128
FT                   /locus_tag="ABBFA_00220"
FT                   /old_locus_tag="CTY05_00220"
FT   CDS_pept        251971..253128
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABBFA_00220"
FT                   /old_locus_tag="CTY05_00220"
FT                   /product="hypothetical protein"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /protein_id="ATY42694.1"
FT                   /translation="MKSFFINLQPLNKEDLIQKLSAKKNDKKFLYFKHWVLKNEIKPVD
FT                   LYCYLYAKYGSPKGLLTLLRNKELGSANLIQWDWMLKGDLGTVHIQGHNFRTEVFIAHN
FT                   LGSDCFEVEDFLEQIKADFKNYGKEISNIKKSLEKWTEFVNPFFIIKASVSQNFSKLKE
FT                   LQLDLEQDKVSNIFELDDDQKWTEIMNKYYFAIGLIHGLRSMLPVLAESFINCVIFILC
FT                   KPEVKSSSRLYDSIIRQQIDIRIQSLHLNCNYFISPIDYNSEECKNFHTLMNERNDILH
FT                   GNINVKKQSFGEVYFNKNMAIYDTYQDHWEKSIGILIKSVKLDTIFRDLKVVEDFIEYI
FT                   YSKLEPQVSSDLKSLLDKAYLGFNPKTGRIGILFQDHFADFNVKT"
FT   gene            complement(253371..254294)
FT                   /locus_tag="ABBFA_00221"
FT                   /old_locus_tag="CTY05_00221"
FT   CDS_pept        complement(253371..254294)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABBFA_00221"
FT                   /old_locus_tag="CTY05_00221"
FT                   /product="Alpha/beta hydrolase family protein"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="protein motif:Pfam:PF12697.1"
FT                   /protein_id="ATY42695.1"
FT                   /translation="MKTVTFKNKSIDVSATIRFPKDFDENKKYAAIVCAHPISSCKEQT
FT                   AGSIYGEKLTEAGFITLAFDASYQGASGGEPRFLEDPAARVEDFRCAADYLTTLSYVDE
FT                   NRIGVLGVCGGGAYAVNAAMTERRFKAVATVVAANYGRIVREGDQAPNAAIKTLEAIAA
FT                   QRTAEARGAEPFITQYIPNSQQEREQAGIHDIDIKEAVDYYKTPRGQAEGSPNKLRFSG
FT                   LAAAFGFDAFHLAEHLLTQPLQVVIGEIPGGFGSYRDGYELYSKAASKDKNLFVVKGAS
FT                   HYELYDQPEPVAQALEKIIPFFKKHI"
FT   gene            254405..255304
FT                   /gene="dmlR_3"
FT                   /locus_tag="ABBFA_00222"
FT                   /old_locus_tag="CTY05_00222"
FT   CDS_pept        254405..255304
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dmlR_3"
FT                   /locus_tag="ABBFA_00222"
FT                   /old_locus_tag="CTY05_00222"
FT                   /product="HTH-type transcriptional regulator DmlR"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:P76250"
FT                   /protein_id="ATY42696.1"
FT                   /translation="MKENLNDLHTFIVVAQERSFTRAAAKLRTSQSAISQTLRNLEDRI
FT                   GIKLLSRTTRSVAPTEAGEYLLSLIQPAIEEIEHGMNQLSALKNDPAGTLRISADEYGI
FT                   QTVLWPAVEKVIQQFPKISVEITSDYGLVDIVDGRFDAGLRRGGLVSKDMIALQISDPI
FT                   QMLTVATKEYLERYGHPKQPKNLVEHQCINLRLPTHGELYRWQFTKGNKTQSVNVNAKI
FT                   VFTTLSPVLQAVRSGVGIAYLPIDMVQPYIESGELEETLKDWRHSYEPYHLYYPHRREQ
FT                   APLLNILINALKENFNKA"
FT   gene            complement(255355..256434)
FT                   /gene="emrA_1"
FT                   /locus_tag="ABBFA_00223"
FT                   /old_locus_tag="CTY05_00223"
FT   CDS_pept        complement(255355..256434)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="emrA_1"
FT                   /locus_tag="ABBFA_00223"
FT                   /old_locus_tag="CTY05_00223"
FT                   /product="Multidrug export protein EmrA"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:P27303"
FT                   /protein_id="ATY42697.1"
FT                   /translation="MAEQAQTLGSSAQFSSKLIKPKKSTLIIMAIVLLVGVLFIFRAWH
FT                   LPPFALNSEQTDNSYIKGQTTILSSQINGYVKRVLVKDFDHVKKGQPLLIIDAQTYDQK
FT                   VVQAQSMVEQAKNNLANQQQTIAQRQADIASAQAKVDQIQAEYDLSVAESKRYSQLGSS
FT                   GAASQSEQDKAFANERNNLALLKQALANLSVAKEALKTAQVAKVGLQAEVNNAQAQLDQ
FT                   AKTTKNYSVIYAPMDGQLGEVNPRVGQYVSVGSQLLFLIPQKTWVIANFKETQMKNMRI
FT                   GQKATFTVDALGHQKFTGHVEEISPAAGSEFSVIKPDNATGNFTKVVQRIAVRIAIDPN
FT                   QKDLNRLSPGMSVITTVMN"
FT   gene            complement(256436..258082)
FT                   /locus_tag="ABBFA_00224"
FT                   /old_locus_tag="CTY05_00224"
FT   CDS_pept        complement(256436..258082)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABBFA_00224"
FT                   /old_locus_tag="CTY05_00224"
FT                   /product="Major Facilitator Superfamily protein"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="protein motif:Pfam:PF07690.10"
FT                   /protein_id="ATY42698.1"
FT                   /translation="MQRTPKYLEPMPNWTETERPALIGSPASIEHPNHLRVVYLFIGVF
FT                   IALSASLGNGLIISNALLFQGEFGLTPSEAAWLPAAFVIGNTAANLYVIKIRQQFGLRL
FT                   FAEISLVLCCICIGLHLLVNSYEMALAVRFFAGIVAAPLTSMSAHYVIQSFKKPSALKG
FT                   IYVILGLQQFGLPLAWMISPGITHGEGWTDLAYFELGLYLCCLAMVVSLKLPRSIRAAV
FT                   LEKADIFPLLFIFPAIALFSAVLVQGPIVWWFNNTWIAYALSLGFVLLVIGLVIEHHRQ
FT                   HPLIVTQWLVMKSTLTFMIGAFSIRILMSEQNYAVGHFLQAMGLLPEQLVGLYSMIGLG
FT                   VIAGSVASILTFKQHLLMQQLLVAELLILIGCGLDLGLTHDIRPHNLYLSQFLIGCAGG
FT                   IFMGPLVLIGYFRVLQHSQWSVVTFAVLLGVTQNLGGLIGTSFFSTYQQHQTRLHQNAI
FT                   YTNLDTTNATVESRLQLYSSQAQKNSTDANFQQNYAQKSLNQVVTREAQVLAFNDVIKI
FT                   NALLATLVFIFGVTSLLWTRYSARKQSLVSN"
FT   gene            complement(258224..258868)
FT                   /gene="yfiR"
FT                   /locus_tag="ABBFA_00225"
FT                   /old_locus_tag="CTY05_00225"
FT   CDS_pept        complement(258224..258868)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yfiR"
FT                   /locus_tag="ABBFA_00225"
FT                   /old_locus_tag="CTY05_00225"
FT                   /product="putative HTH-type transcriptional regulator YfiR"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:O31560"
FT                   /protein_id="ATY42699.1"
FT                   /translation="MTESTIVKRKRSPSLEKTQATKEAILKVARIHFAEVGFAKAKVSD
FT                   IAKNANIANGTIYSYFKTKEELFEGVIEDILQQDLRLIRATDLQETQTVYSFLLEHLDK
FT                   IVSTVEKSGRDGISRLVLKEGENFPNIKQIYFQRVLSPYLVEFEKLIQIAIERKEIAPV
FT                   NAKEFSLLLIAPTWMGVLYNGMLQDIETTNINNLFRTTLYALFHTNFHKLE"
FT   gene            259020..259463
FT                   /locus_tag="ABBFA_00226"
FT                   /old_locus_tag="CTY05_00226"
FT   CDS_pept        259020..259463
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABBFA_00226"
FT                   /old_locus_tag="CTY05_00226"
FT                   /product="hypothetical protein"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /protein_id="ATY42700.1"
FT                   /translation="METIKEILSIVALPDILKTILQWLVGLVLIDGLLQKLTKKKFSLE
FT                   IFVKFVLEALREGVRLREDIQPLNINRSIKKFFSYFICGVWAYGCLIFIALLISSIIMF
FT                   VLRKNDLTFDKVALVWGVILMYGWAARFAYVETRIAFKNAKSI"
FT   gene            complement(259539..261644)
FT                   /locus_tag="ABBFA_00227"
FT                   /old_locus_tag="CTY05_00227"
FT   CDS_pept        complement(259539..261644)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABBFA_00227"
FT                   /old_locus_tag="CTY05_00227"
FT                   /product="hypothetical protein"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /protein_id="ATY42701.1"
FT                   /translation="MSILPKSQEIVLTAKQRISDSLNFLSPGHSLIQGGTGIGKSTFVM
FT                   KYLAQNNQIVMLCPLVAQVEQLQQIYGDNGAYVFIHGNQSISKNEIPAVIRKHLVMTYD
FT                   QFAKFEPYLSSKAIIVVDEVQKLYSVGTYREKPIQYILEVVKNQKFERIVFLTATLTSH
FT                   LFEKLNIQISQYYKFTQTSQHQRSISIVNPTTFNSRYWVYDVLKRLKKLQKKQCKKVIV
FT                   IRVNDIEIAKQVKEIYKKEGFNTQLINSKEMSNPDCQELLSLERINTEYDAVICTSILD
FT                   EAINLKNGNEEIDSIHIVGDSTHPEEVVQFIGRLRVANPPVYIHLPTPINNTKINFSKQ
FT                   HTKYIAQNDNTYQKVSLFLKEIRVFLNAERFTGFEDIVSTKIDKTKIMNGLTNGLIGCK
FT                   GFWSDNQTIGLNIASIVARFYRLDTQQCYSNVNYLKQRLLQFLPDANVTVIKNDNPLPQ
FT                   EIEDAFSESEKTLEEQRKDTVIQVRRSLLLTLHKVKTFKEFKKKIDHLPIHESPEFEDD
FT                   ENPIRMEIYKEAMQLSERLDNLKDVCLSIKRDHTDKIIKLSHEYQSNPIVISVMQQLRT
FT                   AYQRKEFKEQIHSYDEITQLMNKGLQKIADKKSIMESLKRYPNKYVEVTADTTLQFKAG
FT                   KSILFLQKYCFIRVLNFKKPYQLKKVQFKGLTAFGYGFNEFSVRSKKTMLLEEKRYNAR
FT                   TGQLVEE"
FT   gene            complement(261715..262911)
FT                   /gene="xerC_1"
FT                   /locus_tag="ABBFA_00228"
FT                   /old_locus_tag="CTY05_00228"
FT   CDS_pept        complement(261715..262911)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="xerC_1"
FT                   /locus_tag="ABBFA_00228"
FT                   /old_locus_tag="CTY05_00228"
FT                   /product="Tyrosine recombinase XerC"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:P39776"
FT                   /protein_id="ATY42702.1"
FT                   /translation="MVNFLEKNTQLNQFESGKEFDIRKYRPDLKVTGLRFVVTVQHVRT
FT                   LARLTFQGKKISKSLGTFSHADFDQNLEKLISQMQRFHQRIAQGLAPFEDEVKPANTLR
FT                   EFALTIYMPSAEMRKKSYKDDEAKLRMHILPVIGDYPFEDINAGMLNKLLTELRSKGLT
FT                   NASINRVRALLSVMFNMAINHDLIQVNPVSKVSKFKENNQIERYLNAQEIKRLMDVLNA
FT                   PHQHGIDNLIIVAIVKFLLLTGVRKREAMDMKWTDVDLTTGVWLLGENKSGKARRITLN
FT                   QDALAILHSLPQQHAFIFANPMTGQPFNDMRKTFQSIMKAASIRNIRIHDLRHNFASIA
FT                   VNSGQSLYVVQHLLGHASPQTTQRYAHLQSSTLKQASEDVAAAIRAQSSHHNPTANVA"
FT   gene            complement(263142..263840)
FT                   /locus_tag="ABBFA_00229"
FT                   /old_locus_tag="CTY05_00229"
FT   CDS_pept        complement(263142..263840)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABBFA_00229"
FT                   /old_locus_tag="CTY05_00229"
FT                   /product="hypothetical protein"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /protein_id="ATY42703.1"
FT                   /translation="MNTFNKFASFDSDEEVLAAQHFNYFKNEQNCDNLMYTIGKEIGPI
FT                   ARTKNDMNFAKFILKAKKNIKQIKLKNVEPTVSIKIDSTKENERFFISLLSSQIRLACM
FT                   LYFLELRHEKGEAFAVIGDDTKTWFDAQCPHYNGEVKYLDNIFQMLNYVKPDYIMFFND
FT                   FYKEHKESSEDFESGLGLILLDKNGNPLQKVNLKFFDLRNAPTHAFRLNSPSPKDDFDM
FT                   AESFDRPLFN"
FT   gene            264279..264761
FT                   /locus_tag="ABBFA_00230"
FT                   /old_locus_tag="CTY05_00230"
FT   CDS_pept        264279..264761
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABBFA_00230"
FT                   /old_locus_tag="CTY05_00230"
FT                   /product="hypothetical protein"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /protein_id="ATY42704.1"
FT                   /translation="MSVYLPKKVYDALKAKPDLTIEEVMKIQNSPYSTAARYRQKFKEL
FT                   HDGGYLRQVHHQINKTKIERWRRINHQFQQMTDLLTELLNTSGFESTGHLREIYYGRFS
FT                   RVKGIETQSRRNFNRYFKRAREEIDFSKFKLKIYKSSITRVGFYTAENPEFKPSDC"
FT   gene            complement(264868..265146)
FT                   /locus_tag="ABBFA_00231"
FT                   /old_locus_tag="CTY05_00231"
FT   CDS_pept        complement(264868..265146)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABBFA_00231"
FT                   /old_locus_tag="CTY05_00231"
FT                   /product="hypothetical protein"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /protein_id="ATY42705.1"
FT                   /translation="MTRHILFALGQVVATKNAVEFMTQKCITPFDLLHRHQHGDWGDLN
FT                   KPDHEANEQALIENFRILSSYNFDNEIIWVITEADRTLTTILLPSDY"
FT   gene            complement(265207..265551)
FT                   /locus_tag="ABBFA_00232"
FT                   /old_locus_tag="CTY05_00232"
FT   CDS_pept        complement(265207..265551)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABBFA_00232"
FT                   /old_locus_tag="CTY05_00232"
FT                   /product="hypothetical protein"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /protein_id="ATY42706.1"
FT                   /translation="MMKCIKTKDDLLHLDNEAIKDSISNHMLTLEQQYDEPYQATLHGW
FT                   FIICDNESDLSEPLAHLTFSLSEKLHLGEVEYVDKKEEWYEIYVLLNDNEGILIYVPND
FT                   IFHNHSLTAI"
FT   gene            complement(265535..266065)
FT                   /locus_tag="ABBFA_00233"
FT                   /old_locus_tag="CTY05_00233"
FT   CDS_pept        complement(265535..266065)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABBFA_00233"
FT                   /old_locus_tag="CTY05_00233"
FT                   /product="hypothetical protein"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /protein_id="ATY42707.1"
FT                   /translation="MQQRVFDKMNQTLIKTFICNKLSDRSKGQLHYQLWQDNDDLSLGI
FT                   ALSHNESSGGFSSELIKVDDILRMIKVLLQSGKPFHATALKGLFIGKSVNNYSFLGAAL
FT                   VDQQVIRLHPQTARLLEVIEEYELWPLRLEEIVGKTDVQETMETKIPAKRGPKPKNQSI
FT                   EAELEEQAHDEVH"
FT   gene            complement(266143..266592)
FT                   /locus_tag="ABBFA_00234"
FT                   /old_locus_tag="CTY05_00234"
FT   CDS_pept        complement(266143..266592)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABBFA_00234"
FT                   /old_locus_tag="CTY05_00234"
FT                   /product="hypothetical protein"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /protein_id="ATY42708.1"
FT                   /translation="MKKILLVSLLTFTGFAHAAPNVWQSSYAQGFIEYSIQDTKGNTLW
FT                   VVCNDGAGDDYDHSAHLQTKKNRYENTDSKYPLSFLLDGKTSVAPAGSTKWRNGANAWY
FT                   DFSHGIAKAKKIDVFVNNKKVTTFSPNPHSIKTVAKDIASCEAMF"
FT   gene            complement(266650..266976)
FT                   /locus_tag="ABBFA_00235"
FT                   /old_locus_tag="CTY05_00235"
FT   CDS_pept        complement(266650..266976)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABBFA_00235"
FT                   /old_locus_tag="CTY05_00235"
FT                   /product="hypothetical protein"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /protein_id="ATY42709.1"
FT                   /translation="MKTFKMVRLLTCGLLSLLMCSVATAKTEKITLKQPIDFGGEAVIF
FT                   NTTKGEVILNMYALPERVAKQIKPFKKGQCLEVQSKHGFFQDTGDGQYIQSIRPCKRTQ
FT                   SKAK"
FT   gene            complement(267021..267560)
FT                   /locus_tag="ABBFA_00236"
FT                   /old_locus_tag="CTY05_00236"
FT   CDS_pept        complement(267021..267560)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABBFA_00236"
FT                   /old_locus_tag="CTY05_00236"
FT                   /product="hypothetical protein"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /protein_id="ATY42710.1"
FT                   /translation="MGFSNLLSSALTAVATFSGNPDVQQVANSANELVVSYQAQQQQEM
FT                   AQRIMSSPDGIIPVTEKGKTIWRALKYNAAGEITGFADFNTKEEYLVLKQQELRAQQTL
FT                   EQQRKAEQATQRQYMTQTKRAGDVSIADIDAYGQMLGTMQQASMGALMNCSQYVEASPQ
FT                   WNACAQREVQKVEQRR"
FT   gene            267679..267933
FT                   /locus_tag="ABBFA_00237"
FT                   /old_locus_tag="CTY05_00237"
FT   CDS_pept        267679..267933
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABBFA_00237"
FT                   /old_locus_tag="CTY05_00237"
FT                   /product="helix-turn-helix protein"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="protein motif:Pfam:PF01381.16"
FT                   /protein_id="ATY42711.1"
FT                   /translation="MTASINTPEMQALTKWLKQMREEQHLTMRALAERMGKPHSYIQKV
FT                   EQGERRLDVVEYVWYCRILEITPEEGLEQIRQAIPASRN"
FT   gene            complement(267963..268190)
FT                   /locus_tag="ABBFA_00238"
FT                   /old_locus_tag="CTY05_00238"
FT   CDS_pept        complement(267963..268190)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABBFA_00238"
FT                   /old_locus_tag="CTY05_00238"
FT                   /product="Helix-turn-helix domain protein"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="protein motif:Pfam:PF12844.1"
FT                   /protein_id="ATY42712.1"
FT                   /translation="MKALKEWLKQQRELNNLTQQQLAHKLGKPLQYIEDVEQGDYRLEV
FT                   IEFIYYCQALNIDPHQGIRLIDLDPQEQNK"
FT   gene            complement(268206..268364)
FT                   /locus_tag="ABBFA_00239"
FT                   /old_locus_tag="CTY05_00239"
FT   CDS_pept        complement(268206..268364)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABBFA_00239"
FT                   /old_locus_tag="CTY05_00239"
FT                   /product="hypothetical protein"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /protein_id="ATY42713.1"
FT                   /translation="MKKYFPELETVSDILASIPHPQIQSIAHAIRICNDQDTHVLTKLH
FT                   AVVGVII"
FT   gene            complement(268665..269123)
FT                   /gene="lrp_1"
FT                   /locus_tag="ABBFA_00240"
FT                   /old_locus_tag="CTY05_00240"
FT   CDS_pept        complement(268665..269123)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lrp_1"
FT                   /locus_tag="ABBFA_00240"
FT                   /old_locus_tag="CTY05_00240"
FT                   /product="Leucine-responsive regulatory protein"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:P0ACJ0"
FT                   /protein_id="ATY42714.1"
FT                   /translation="MQLDKIDRNILAILQKDGRLPNNELAEQVGLSASPCLRRVKLLEE
FT                   TGVIQKYVALLDAEKVGKGLTLFTRIWLVGQDAETVDQFTEVILNLPEVVECHLMAGDC
FT                   DFLLRVVTRDLEDYRKFQIKHLTRKNGVQSIKTEIPMQNIKLTTEIPL"
FT   gene            269260..269991
FT                   /gene="ygaZ_1"
FT                   /locus_tag="ABBFA_00241"
FT                   /old_locus_tag="CTY05_00241"
FT   CDS_pept        269260..269991
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ygaZ_1"
FT                   /locus_tag="ABBFA_00241"
FT                   /old_locus_tag="CTY05_00241"
FT                   /product="Inner membrane protein YgaZ"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:P76630"
FT                   /protein_id="ATY42715.1"
FT                   /translation="MNGYIRNARSPKVLNVTYEMKRGIKASIPVVLSFIPFALLFGTQA
FT                   TQKGLSHLEIPLMTGLNFGGGSEFAAISVWTSTPQFWLIVGISVLVNIRHILMGAAFAP
FT                   YMQHVSKYKALALLFFMCDESWAMALADAKKRQAISISITYYISLALCLYSTWIICTTL
FT                   GSFIGNWFGNIERFGFDMAFTAVFLVLIKGMWSGVKKNYCWAVSLLVACLVAHYSSGAW
FT                   YVLAGTSAGLITAWIGAKHNA"
FT   gene            269984..270286
FT                   /locus_tag="ABBFA_00242"
FT                   /old_locus_tag="CTY05_00242"
FT   CDS_pept        269984..270286
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABBFA_00242"
FT                   /old_locus_tag="CTY05_00242"
FT                   /product="Branched-chain amino acid transport protein
FT                   (AzlD)"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="protein motif:Pfam:PF05437.6"
FT                   /protein_id="ATY42716.1"
FT                   /translation="MLEWSHVVIILGMAITTYLTRIIGFFLLRNRKLSTRTQFVLDNIA
FT                   GCVMLSIIAPVFVSGEPATLLGLIATLLASMWFSLLPTVLIGVVITGLGRYVLGG"
FT   gene            complement(270668..270743)
FT                   /locus_tag="ABBFA_00243"
FT                   /old_locus_tag="CTY05_00243"
FT   tRNA            complement(270668..270743)
FT                   /locus_tag="ABBFA_00243"
FT                   /old_locus_tag="CTY05_00243"
FT                   /product="tRNA-Thr"
FT                   /note="tRNA-Thr(tgt)"
FT                   /inference="COORDINATES:profile:Aragorn:1.2"
FT   gene            complement(270868..272112)
FT                   /gene="ynfM_1"
FT                   /locus_tag="ABBFA_00244"
FT                   /old_locus_tag="CTY05_00244"
FT   CDS_pept        complement(270868..272112)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ynfM_1"
FT                   /locus_tag="ABBFA_00244"
FT                   /old_locus_tag="CTY05_00244"
FT                   /product="Inner membrane transport protein YnfM"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:P43531"
FT                   /protein_id="ATY42717.1"
FT                   /translation="MNSSSTPSTLSTEATSVLSREWIHKGTKAYKHAGFALFLVGFASF
FT                   SLIYCVQPLLPAFSQSFQISPASSSLALSLTTAFLAISIVLSSAFSQALGRRGVIFTSM
FT                   LCAALLNIVSMLTPNWHSLLIARALEGLLLGGVPAVTMAWIAEEIAPEHLGKTMGLYIA
FT                   GTAFGGMMGRVGMGILVEYFSWRTALGLLGAICFICSIAFLKLLPASRNFVQKKGLNLG
FT                   FHIQMWRAHLSNTKLLRLFAIGFLLTSVFVTLFNYATFRLSGAPYSLSQTQISLIFLSY
FT                   SFGMVSSSLAGSLADRFGKKTMMMSGFALMILGSLMTLLSSLFGIIIGIAFITTGFFIT
FT                   HSLTSSSVGAESKQAKAHASSLYLLFYYMGSSIVGSAGGWFWLHGGWSAIVGLTVFLSL
FT                   IGIFLAVYTSHAKAH"
FT   gene            272251..273171
FT                   /gene="hcaR_2"
FT                   /locus_tag="ABBFA_00245"
FT                   /old_locus_tag="CTY05_00245"
FT   CDS_pept        272251..273171
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hcaR_2"
FT                   /locus_tag="ABBFA_00245"
FT                   /old_locus_tag="CTY05_00245"
FT                   /product="Hca operon transcriptional activator"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:Q47141"
FT                   /protein_id="ATY42718.1"
FT                   /translation="MELRHIRYFLAVAEEKNFTKAAQRLNMSQPPLSMQIRDLEEELGA
FT                   DLFIRSPHGVELTEAGLAFLNAIQPVQQRVEDAASLVKQVANGEVGQLRLGFTGTSMLN
FT                   PLIPKCVRYFQQQYPKVNLKLEEANTLLLIDSLLEDRLDVAIIRSPRNMPDSLILQELL
FT                   AEPLIAALPSESFQLDDVSQEIDLTALRELDFIVSPPSVSAGLFDAIKQACHERGFEPK
FT                   IGQNAPQIVSILSLVSANLGVSLVPESTKQLQIQGVAYRSLKALVPTVGLGLAYKKHAP
FT                   SQMAINFASVVQVACHHANEINEIG"
FT   gene            complement(273168..274055)
FT                   /locus_tag="ABBFA_00246"
FT                   /old_locus_tag="CTY05_00246"
FT   CDS_pept        complement(273168..274055)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABBFA_00246"
FT                   /old_locus_tag="CTY05_00246"
FT                   /product="EamA-like transporter family protein"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="protein motif:Pfam:PF00892.14"
FT                   /protein_id="ATY42719.1"
FT                   /translation="MNNLIIGTLFALCAAALNASIGVISKLLMHSGLNPQDIAFLKTII
FT                   AFFFLSVFLFKVPVSQKIAFISSTPSKLSVFAQIAICAFLGIFSLFFFETIAYNHGAAA
FT                   NVVVVLMASAAISALFFGRFILKESIYIHSLIGTLLAVAGISIISWKGENSLLMLINAS
FT                   IAGTGYGLFSVLVKKFKLNGGLFLTKYLLLFGSVYLAVPFLVNLHSITFNSDIILGLIG
FT                   LAVLPTILGFFCTTKALSYMSAAKVQVTELSEPIFAALMAWVFIHEQPTLSFLYGAIFI
FT                   ISGIFLMNRAPKSN"
FT   gene            274284..275027
FT                   /locus_tag="ABBFA_00247"
FT                   /old_locus_tag="CTY05_00247"
FT   CDS_pept        274284..275027
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABBFA_00247"
FT                   /old_locus_tag="CTY05_00247"
FT                   /product="hypothetical protein"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /protein_id="ATY42720.1"
FT                   /translation="MIKSIITGCAVLTLSALAVTHAEFSYEQELQQGCNKVKQYASLGK
FT                   KFYDQKQYKKALENFQNQASWTAFCKANADETTVKFTDRDIEVANNNVGLAYAKLGQPL
FT                   WARAWFMLDEKSKSSQFNLKQLPQPKASNVLSGEYVRYSGFGEWDHITVSRKQGQYAIS
FT                   YSGVYMGLRSLIYGPNMGEFDTKMPANAKQTIYKDQDCHIQLDFRTNAKLGNYIQVKQS
FT                   EGESGCGFGHNVYADGTYLKVESEK"
FT   gene            275052..275444
FT                   /locus_tag="ABBFA_00248"
FT                   /old_locus_tag="CTY05_00248"
FT   CDS_pept        275052..275444
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABBFA_00248"
FT                   /old_locus_tag="CTY05_00248"
FT                   /product="hypothetical protein"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /protein_id="ATY42721.1"
FT                   /translation="MKNIFAPLLLVSTVIFSAHIYAEPTSTCKEVKFQKADQAWSGHYY
FT                   LHGVMEVGSELLLQPDGKFQWMLAVGALDQYAEGTWWKNGDCIGLKPEAKFKKDLSIFP
FT                   ESLTISDKSLDAIWQGGRQQGTYSKD"
FT   gene            complement(275490..276491)
FT                   /gene="yhdN"
FT                   /locus_tag="ABBFA_00249"
FT                   /old_locus_tag="CTY05_00249"
FT   CDS_pept        complement(275490..276491)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yhdN"
FT                   /locus_tag="ABBFA_00249"
FT                   /old_locus_tag="CTY05_00249"
FT                   /product="General stress protein 69"
FT                   /EC_number="1.1.1.-"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:P80874"
FT                   /protein_id="ATY42722.1"
FT                   /translation="MKYRTLGQTGEKVSALGLGCMGMSFAYGASDDTQSIATLEKALDL
FT                   GINFWDTADMYGNGANEVLLSKVLEKHRDKVFLATKFGFRYKEDNLNPKNSLESYIDGS
FT                   PEWIKVAVENSLRRLNTDVIDLYYAHRIDPNVPVEDTIGAMADLVKQGKVRYLGLSEAS
FT                   AETIRKAHAIHPIAAVQHEYSLLTREFEQTHLQTIRELGISLVPYSPLSRGLITNTLDV
FT                   NNLDENDFRRQLPRYQGDNWKNNQSLAQAFSEFAQSKNATAAQLALAWIFAQGDDIIPI
FT                   PGTRKIERLVENAGAVDLHLTAADLAEIEAIIARYPNMGARYNAQQLAAVNH"
FT   gene            complement(276603..277505)
FT                   /gene="adaA"
FT                   /locus_tag="ABBFA_00250"
FT                   /old_locus_tag="CTY05_00250"
FT   CDS_pept        complement(276603..277505)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="adaA"
FT                   /locus_tag="ABBFA_00250"
FT                   /old_locus_tag="CTY05_00250"
FT                   /product="Bifunctional transcriptional activator/DNA repair
FT                   enzyme AdaA"
FT                   /EC_number="2.1.1.-"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:P19219"
FT                   /protein_id="ATY42723.1"
FT                   /translation="METIHDFYRRFSLTRDSDYSVPSTSFGHFNVFQRDACSFLTPYSR
FT                   RDYYKISLVLGTGELHYANRWIRVDRPALLFSNPMVPYAWEINSPEQAGWFCLFTEEFV
FT                   NQESRQSFLKDSPLFKVDGDPLYFLNDQQVEEISFIFKKMMNEINSDYIHKYNVLRNYL
FT                   HLIVHEAMKMQPTQQFEKHSNASVRICHLFFELLERQFPIDSPHFQLKLKTANDFAYGL
FT                   SVHVNHLNRAVKEATGKTTSEHISSRITQEAKALLQHTSWNISEIAYSLGFEYSAYFTN
FT                   FFKKNTGFSPKKFREDCVA"
FT   gene            278462..279013
FT                   /locus_tag="ABBFA_00251"
FT                   /old_locus_tag="CTY05_00251"
FT   CDS_pept        278462..279013
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABBFA_00251"
FT                   /old_locus_tag="CTY05_00251"
FT                   /product="Bacterial regulatory protein, tetR family"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="protein motif:Pfam:PF00440.17"
FT                   /protein_id="ATY42724.1"
FT                   /translation="MKNLDASRRALHVIDTATDLFKQYGFNKVGVDQIIAESQINKGTF
FT                   YSYFHSKERFIERCLVAQKEQLQEKVSVVSELYQNADLSDQLRQIYLLHADLKSAYYLL
FT                   FKAIFEIKKLYPNAYQTALRYRRWLKNEILCLLMETKKTVSYSEAEIFVFMMDGAILGL
FT                   LSSDEERERDALLEYFLERV"
FT   gene            complement(279068..279484)
FT                   /gene="ahpD"
FT                   /locus_tag="ABBFA_00252"
FT                   /old_locus_tag="CTY05_00252"
FT   CDS_pept        complement(279068..279484)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ahpD"
FT                   /locus_tag="ABBFA_00252"
FT                   /old_locus_tag="CTY05_00252"
FT                   /product="Alkyl hydroperoxide reductase AhpD"
FT                   /EC_number="1.11.1.15"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="protein motif:HAMAP:MF_01676"
FT                   /protein_id="ATY42725.1"
FT                   /translation="MEYKEVSKKTIGHLYSAHSSIRSSDLDPKLIALAELYVSQINGCA
FT                   YCCAFHSKELRDFGIAQEVIDQIPGYKHSKAFSEKQKVVLEFASAITSLNDPKQIEATR
FT                   ESLAQHFSEKEIVDLTASISLMGALNRLRITLGD"
FT   gene            279596..279910
FT                   /gene="yybR_1"
FT                   /locus_tag="ABBFA_00253"
FT                   /old_locus_tag="CTY05_00253"
FT   CDS_pept        279596..279910
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yybR_1"
FT                   /locus_tag="ABBFA_00253"
FT                   /old_locus_tag="CTY05_00253"
FT                   /product="putative HTH-type transcriptional regulator YybR"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:P37486"
FT                   /protein_id="ATY42726.1"
FT                   /translation="MKDNISGCTVEEAMTVLGGRWRMLIISFLLERTMRFNELRRAIPN
FT                   ISQRMLTLELRFLEEEGFILREVYAEVPVKVEYSLTEEGRKLEKLVDVLKEIGGWLKSR
FT                   "
FT   gene            complement(280015..280539)
FT                   /locus_tag="ABBFA_00254"
FT                   /old_locus_tag="CTY05_00254"
FT   CDS_pept        complement(280015..280539)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABBFA_00254"
FT                   /old_locus_tag="CTY05_00254"
FT                   /product="hypothetical protein"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /protein_id="ATY42727.1"
FT                   /translation="MKFLTYIFLIVLLCGCGFKPQFRPTKMYSGNENKNESDFSLIYID
FT                   WMETAQTYKKVGQTEITEINNIKVAERVPTMGSKYMLQVLPGEQNVSIFLFFIKEYIGM
FT                   DMYKTESVTLKLPPFNTQPNKIYVLCPQKSNGLNFKVKIYPYTRQEILEKKGMTDFIVR
FT                   PCRTMDKLSIQ"
FT   gene            complement(280702..280920)
FT                   /locus_tag="ABBFA_00255"
FT                   /old_locus_tag="CTY05_00255"
FT   CDS_pept        complement(280702..280920)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABBFA_00255"
FT                   /old_locus_tag="CTY05_00255"
FT                   /product="hypothetical protein"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /protein_id="ATY42728.1"
FT                   /translation="MRHELREIFIKGCDEKIQKKGDNVGLSFYAFFKNKNDNPELLMEA
FT                   AHWWIMEHKLDHFEKAVKIKQLVLSER"
FT   gene            complement(280948..281283)
FT                   /gene="hxlR_1"
FT                   /locus_tag="ABBFA_00256"
FT                   /old_locus_tag="CTY05_00256"
FT   CDS_pept        complement(280948..281283)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hxlR_1"
FT                   /locus_tag="ABBFA_00256"
FT                   /old_locus_tag="CTY05_00256"
FT                   /product="HTH-type transcriptional activator HxlR"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:P42406"
FT                   /protein_id="ATY42729.1"
FT                   /translation="MTDCLPSNTPLEETGFGYTLSLINGKYKMIIMYWLYGKTVMRFNE
FT                   LQRCIGNISFRTLSNTLKELERDELIIRKEYPQIPPKVEYRLSERGQSLIPLLDMMCQW
FT                   GERNMNS"
FT   gene            281401..281958
FT                   /gene="ywrO"
FT                   /locus_tag="ABBFA_00257"
FT                   /old_locus_tag="CTY05_00257"
FT   CDS_pept        281401..281958
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ywrO"
FT                   /locus_tag="ABBFA_00257"
FT                   /old_locus_tag="CTY05_00257"
FT                   /product="General stress protein 14"
FT                   /EC_number="1.6.99.-"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:P80871"
FT                   /protein_id="ATY42730.1"
FT                   /translation="MKKTLVIVAHPHIDQSVINKRWVEELEKYPDQFTVHQIYQAYPDG
FT                   VIDVAKEQALVEEHENLVFQFPVYWFNCPPLLKQWLDEVLAYGWAYGSTGDKLKNKKFM
FT                   LAVSAGAQEKVYSEQGEYKLSLEQIFSSFELTALYIGAVYQPLYAFYGLDTNPSPDDAI
FT                   PTHQEIDNSAVQYVQKLLALSE"
FT   gene            complement(281989..282822)
FT                   /gene="araC_1"
FT                   /locus_tag="ABBFA_00258"
FT                   /old_locus_tag="CTY05_00258"
FT   CDS_pept        complement(281989..282822)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="araC_1"
FT                   /locus_tag="ABBFA_00258"
FT                   /old_locus_tag="CTY05_00258"
FT                   /product="Arabinose operon regulatory protein"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:P0A9E0"
FT                   /protein_id="ATY42731.1"
FT                   /translation="MQNDLDLLYRKSKSYVWGNSNLSDVLNQPLSLAYCSLIFIKQGSA
FT                   DINILFKNYHLKSGDFLFLSEDSLAILQKRSADFSCDYCIFNRDFAAEVASVLPNSLFT
FT                   YLHLFPHFSPEMSYQSLIKTWINQTTFILQSTSEYQRILLCNHLQNFFLVLSETVNREK
FT                   LLSKNEYSRKEKICWQFWEMISLHCKEHRDVNFYAKALNITPYYLSKLSKQFFNDNAKT
FT                   LIDRQVILKLKELLRTPSNSIQSIADQLNFEDTSYMCRYFKKHTGFTLLQYRKSA"
FT   gene            282961..283503
FT                   /gene="ydaF"
FT                   /locus_tag="ABBFA_00259"
FT                   /old_locus_tag="CTY05_00259"
FT   CDS_pept        282961..283503
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydaF"
FT                   /locus_tag="ABBFA_00259"
FT                   /old_locus_tag="CTY05_00259"
FT                   /product="Putative ribosomal N-acetyltransferase YdaF"
FT                   /EC_number="2.3.1.-"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:P96579"
FT                   /protein_id="ATY42732.1"
FT                   /translation="MILTTERLILRPWQDSDASSLYEYASDDRVGPTAGWPVHESEAQS
FT                   LEYIQTVFAKEEVYAVAKKEDNRAIGMVGLLIGKESNFKIADNEAEVAYWIGVPFWGQG
FT                   LIPEAVKAVMKHAYEDLKLKALWCGYFADNEKSFKAQAKCGFKHHHTEESKFNKFLGDY
FT                   RTEHISYLSYEDWKREI"
FT   gene            complement(283678..283767)
FT                   /locus_tag="ABBFA_00260"
FT                   /old_locus_tag="CTY05_00260"
FT   tRNA            complement(283678..283767)
FT                   /locus_tag="ABBFA_00260"
FT                   /old_locus_tag="CTY05_00260"
FT                   /product="tRNA-Ser"
FT                   /note="tRNA-Ser(gga)"
FT                   /inference="COORDINATES:profile:Aragorn:1.2"
FT   gene            283886..285763
FT                   /locus_tag="ABBFA_00261"
FT                   /old_locus_tag="CTY05_00261"
FT   CDS_pept        283886..285763
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABBFA_00261"
FT                   /old_locus_tag="CTY05_00261"
FT                   /product="potassium transport protein Kup"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="protein motif:CLUSTERS:PRK10745"
FT                   /protein_id="ATY42733.1"
FT                   /translation="MQNTAKKATLPATALAALGVVFGDIGTSPLYALKESFHAAHGLGI
FT                   QPENVLGILSIIFWCLMLIISIKYVAIVMRADNNGEGGIMALLALNLRKAKIADNKKIY
FT                   MIAIGFIGASLFFGDGIITPAISVLSAVEGLSIATDVFDPFIMPIAIAIIVTLFLVQKH
FT                   GTAFVGKFFGPITLVWFLSLGILGIHSVIQTPVVLGMFSPHWAIQFIYHHPIMTFFVMG
FT                   AVVLTVTGGEALYADMGHFGPVPIRLAWFFVVLPCLVLNYAGQGALLLRDPAAIENPFY
FT                   LLVPQWALYPMIIMATMATVIASQAVISGVFSLARQAIQLGYLPRLSIKHTSESEEGQI
FT                   YVPFLNWLLLIAIIILILIFKTSSNLASAYGLAVTLTMLCDTILVAVFIYSAWKWSLPK
FT                   VLLLIIPFFILESVLVGATSLKILSGGWVPLLIGAIAVTILMTWKRGRELTFAKLEHDT
FT                   LSLDLFVKSIGNSVHWVPGDAVFMTGTPNVVPHAMLHNIKHNKVLHQRNILVTVVIEDV
FT                   PFVAPEERITTETLAEHFFRIKIFYGFKDEMNVPKALLQAYEQLGLEYDLMHISFFISR
FT                   DRIVHSVGDGMSPWREKLFISMQRNTSPVSDFYQIPTNRVVELGSQIEI"
FT   gene            complement(285819..286262)
FT                   /locus_tag="ABBFA_00262"
FT                   /old_locus_tag="CTY05_00262"
FT   CDS_pept        complement(285819..286262)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABBFA_00262"
FT                   /old_locus_tag="CTY05_00262"
FT                   /product="hypothetical protein"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /protein_id="ATY42734.1"
FT                   /translation="MIHSKIIGIGVITGLCSMAALAEPAVQPGDTLESLSKVKVTTTVN
FT                   GQPGSISDLVNSGQVQQVSAAPTSAAPTGAPIPADVPPAPPAGGEMAPSAAPTDAVPPA
FT                   PNQAAPAPQDPNTPPPAANPNQSADPMAKDGALPADAPMPQAQ"
FT   gene            286494..287597
FT                   /gene="nucA"
FT                   /locus_tag="ABBFA_00263"
FT                   /old_locus_tag="CTY05_00263"
FT   CDS_pept        286494..287597
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nucA"
FT                   /locus_tag="ABBFA_00263"
FT                   /old_locus_tag="CTY05_00263"
FT                   /product="Nuclease precursor"
FT                   /EC_number="3.1.30.-"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:P38446"
FT                   /protein_id="ATY42735.1"
FT                   /translation="MDSGIDRNMASKKRSKGTNSFSLSEHFGKIILACIAAGSFAIAFG
FT                   SEKISQWFSPLSTNSTCLNQFYREVPPALNKESLKKDSYPLCFNGFNVLYSGISKTPLW
FT                   SAEHLDAERLSVKIKREDNFHEETRVPQKHRALLSDYRGSGYDRGHMAPNGDMPNKESQ
FT                   SDSFSLSNMVPQAPKNNQEVWRKLEEATRAIVTKQKQDVYVVTGPVFEGKRLKTIGQGV
FT                   IVPTAVYKAVYMPKTGAIGAYYAPNNNSQQVKVVSVCYIEEKLGINLFPQLTEQQKRNV
FT                   YRLPLTASQVKPNQKLDYLHWDGESQCEQDLSAEQIQALQDQFKKQKTGSSEPMEAKVP
FT                   SIDEETRNAIVKQLVEALVNYFLQIMK"
FT   gene            287694..288293
FT                   /gene="eamB_1"
FT                   /locus_tag="ABBFA_00264"
FT                   /old_locus_tag="CTY05_00264"
FT   CDS_pept        287694..288293
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="eamB_1"
FT                   /locus_tag="ABBFA_00264"
FT                   /old_locus_tag="CTY05_00264"
FT                   /product="Cysteine/O-acetylserine efflux protein"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:P38101"
FT                   /protein_id="ATY42736.1"
FT                   /translation="MFASMFLFSFAMSITPGPVNTVILSTSLNHGLKRSLPYISGATIG
FT                   FTLLLIFMAFGLQSVLTQFPVVLKILAVCGTLFVCYIGIKIILSAANISISSAPVGHML
FT                   IPNFKDGFLLQWLNPKAWLACVSGITMFTSIENPQSLPIFIIIYFFTCYACLFFWGLCG
FT                   DKFSVVLNQGNRLKYFNILMGAFLILSALLILIDFF"
FT   gene            288339..288581
FT                   /locus_tag="ABBFA_00265"
FT                   /old_locus_tag="CTY05_00265"
FT   CDS_pept        288339..288581
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABBFA_00265"
FT                   /old_locus_tag="CTY05_00265"
FT                   /product="hypothetical protein"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /protein_id="ATY42737.1"
FT                   /translation="MFKPFEKGTESSSIEDLTLENDVDCVSIYGNLQITKDKVGLEQAK
FT                   ALQSFFNDVVAALEKEELPEKIERPAEQEINNPFL"
FT   gene            complement(288790..289479)
FT                   /gene="aqpZ2"
FT                   /locus_tag="ABBFA_00266"
FT                   /old_locus_tag="CTY05_00266"
FT   CDS_pept        complement(288790..289479)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aqpZ2"
FT                   /locus_tag="ABBFA_00266"
FT                   /old_locus_tag="CTY05_00266"
FT                   /product="Aquaporin Z 2"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:Q8UJW4"
FT                   /protein_id="ATY42738.1"
FT                   /translation="MNKYFAEFLGTFWLVFGGCGSAVLAAAFPELGIGFAGVALAFGLT
FT                   VLTGAYALGHISGGHFNPAVSVGLWVGGRFDVKDLIPYIVAQVVGATAAAFVLYIIAQG
FT                   QAGFSGVGGFATNGFGDLSPNKFGLGSAFIIEVVLTAFFLIIILGATDRRAPAGFAPIA
FT                   IGLGLTLIHLISIPVTNTSVNPARSTGVAFFAETAALSQLWLFWIAPILGAVIGAIIYK
FT                   VVAGDKD"
FT   gene            complement(289612..290616)
FT                   /gene="virS_1"
FT                   /locus_tag="ABBFA_00267"
FT                   /old_locus_tag="CTY05_00267"
FT   CDS_pept        complement(289612..290616)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="virS_1"
FT                   /locus_tag="ABBFA_00267"
FT                   /old_locus_tag="CTY05_00267"
FT                   /product="HTH-type transcriptional regulator VirS"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:Q06861"
FT                   /protein_id="ATY42739.1"
FT                   /translation="MPQLKNYTGSVYGGLGHLLKAYCEANELAIPEQLEQIQNLERFDY
FT                   VVWRDLLEVIYKLDPKPGLGLEIAKYVQPKHLGIIAYLALSCDNLGEALIRYHDFHRLI
FT                   YDGSPLVVELQGRYGSIRWEATELHPTQLTDEIAIALVIQFLRLFMSHEDVQLHEVRFL
FT                   NAAPKNIRVYEQYFQCPVRFSQPRTELLIPITEIHKPLSSADHTLQQLLVQQAQALLEQ
FT                   LPNSTQLDQRLQHSILTGLQKNQYQIEYIAAQLGLSVRQLQRHLQQQNTTFQERVQQVR
FT                   FMLATEYLKDPHLSLQEIALLLCYSEQSAFQRAFKHWTKQTPQQWRDQFLNKE"
FT   gene            290726..291364
FT                   /locus_tag="ABBFA_00268"
FT                   /old_locus_tag="CTY05_00268"
FT   CDS_pept        290726..291364
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABBFA_00268"
FT                   /old_locus_tag="CTY05_00268"
FT                   /product="hypothetical protein"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /protein_id="ATY42740.1"
FT                   /translation="MLKGFIAGIAVANAFEWVAHKYILHGVHRAGQPRYSPVPKSMESH
FT                   WAHHREVRKQQFHDDCYVEGVGNWRTKNELISLAVVATVSSAIFYPFSKGMALAAWYSA
FT                   GNYYYIHRRAHLEPEWAKRKIPWHYDHHMNSNQDANWCVTKPWFDYVMGTRVVSSADLK
FT                   EQNPLGIRLPTALARPLSQAVEKIFPAKWVEKKEQPKLVSDVNAIEGAA"
FT   gene            complement(291406..292164)
FT                   /gene="hisF"
FT                   /locus_tag="ABBFA_00269"
FT                   /old_locus_tag="CTY05_00269"
FT   CDS_pept        complement(291406..292164)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisF"
FT                   /locus_tag="ABBFA_00269"
FT                   /old_locus_tag="CTY05_00269"
FT                   /product="Imidazole glycerol phosphate synthase subunit
FT                   HisF"
FT                   /EC_number="4.1.3.-"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:C3MBC1"
FT                   /protein_id="ATY42741.1"
FT                   /translation="MLAKRIIPCLDVDNGRVVKGVQFLDIRDAGDPVEVARRYNEQGAD
FT                   EITFLDITATHHGRDTTYRTVERMAETVFVPLTVGGGVRKVEDIRALLNAGADKVSINS
FT                   AAVFNPEFVQEASQHFGAQCIVVAIDAKKTGDNKWEIFTHGGRKPTGIDAIEWAVKMAD
FT                   YGAGELLITSMDADGTKAGYDIALMRAINDRVTIPTIASGGVGNLQHLADGILQGGADA
FT                   VLAASIFHFGQYTIPEAKQYLAEQGIEMRL"
FT   gene            292277..293227
FT                   /gene="thrB"
FT                   /locus_tag="ABBFA_00270"
FT                   /old_locus_tag="CTY05_00270"
FT   CDS_pept        292277..293227
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thrB"
FT                   /locus_tag="ABBFA_00270"
FT                   /old_locus_tag="CTY05_00270"
FT                   /product="Homoserine kinase"
FT                   /EC_number="2.7.1.39"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:Q8UHA8"
FT                   /protein_id="ATY42742.1"
FT                   /translation="MSVYTPLSLDEVRTFAAPYGLEVLELNPIQGGIQNTNYFLVDVNR
FT                   KQYVLTVFEELDAQGAGELIPVLEQLGTHDVPVAVPLKHSGQAVHFIAGKPAQIAPRLM
FT                   GHHPMQTTVAQVAAIADAQAKLHVALQDFPLEREYRRDHQYWTGVAEQLKPNMTQDDQT
FT                   LLEQVYQAFNAKTAQYSNRPTGFIHSDLFRDNTLFEGEQLQGILDFYELNQDELLFDIA
FT                   ITINDFCTEYPAAHLNSDKVDAYLEAYQKVRALTSDELECLDVFLAMAACRFWSMRLQV
FT                   AQKNKEEGRTGDDILQKDPQEMRAMMQDRLSHVKA"
FT   gene            293240..293869
FT                   /locus_tag="ABBFA_00271"
FT                   /old_locus_tag="CTY05_00271"
FT   CDS_pept        293240..293869
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABBFA_00271"
FT                   /old_locus_tag="CTY05_00271"
FT                   /product="Cold-shock DNA-binding domain protein"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="protein motif:Pfam:PF00313.16"
FT                   /protein_id="ATY42743.1"
FT                   /translation="MRDQGRLVEWFDEKGYGFIQPDDAEKERVFLHIKDFARPGPRPII
FT                   GCALEYLVILDERGRFRAQQVTYLKASQTRKALKPAKTQSSFQASPWSAMQMGIVFYFV
FT                   LMGIMSFIHILPAYTLLCVLMMNALSYWLYSQDKEAAQLGNRRVPEQTLHIVSFLGGWP
FT                   AAWWAQQKLRHKTQKQPFRKIYFCTIFFHLLLILWLISPLNVLRGS"
FT   gene            293906..294301
FT                   /locus_tag="ABBFA_00272"
FT                   /old_locus_tag="CTY05_00272"
FT   CDS_pept        293906..294301
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABBFA_00272"
FT                   /old_locus_tag="CTY05_00272"
FT                   /product="hypothetical protein"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /protein_id="ATY42744.1"
FT                   /translation="MNSSIDQDPNRTLTLILYVLYIVAIFTGGLLAIIALIINYVKRSD
FT                   VQGSIFASHFTWQIRTFWWYLAWNIIAFLPFIFLFFTGENTDLFAGVAISSTVFCVGVI
FT                   AAAWIWIVYRAIRGLIALNDNRPMYQP"
FT   gene            complement(294335..295237)
FT                   /locus_tag="ABBFA_00273"
FT                   /old_locus_tag="CTY05_00273"
FT   CDS_pept        complement(294335..295237)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABBFA_00273"
FT                   /old_locus_tag="CTY05_00273"
FT                   /product="putative DMT superfamily transporter inner
FT                   membrane protein"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="protein motif:CLUSTERS:PRK11272"
FT                   /protein_id="ATY42745.1"
FT                   /translation="MSPTYLSSSKVPQLALILITVIWGGTFLTVQYALNFSSPMFFVGC
FT                   RFAVAALTLLLISLKSMKGVTLKDLGAGSVIGLVIAAGYGTQTIGLQTIPSSESAFLTA
FT                   LYVPLVPILMWLIFRKTPHIMTWVGAALAFTGLVLLTGNGFKQISLSFGQLLTVLGAFA
FT                   IALEIIFISYFAGKVNLRRVTIIQLGVASLLSFAIMPIVGEHTIPAFSWSLVLIAVALG
FT                   LASALIQFVMNWAQRVVDPSRAAIIYAGEPVWAGIIGRIAGERLPVIALFGGALVVLGV
FT                   LVSELKIKLPIKKNKRVRE"
FT   gene            295336..295887
FT                   /locus_tag="ABBFA_00274"
FT                   /old_locus_tag="CTY05_00274"
FT   CDS_pept        295336..295887
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABBFA_00274"
FT                   /old_locus_tag="CTY05_00274"
FT                   /product="anaerobic benzoate catabolism transcriptional
FT                   regulator"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="protein motif:CLUSTERS:PRK08154"
FT                   /protein_id="ATY42746.1"
FT                   /translation="MSQSSSVLQHVGTNIRSLRDEHSLSQQDLADRAGVSRRTIAALET
FT                   GQVNISLAKLDAIAAVLGVDFRTIVSAPELKEHALVNALAWQGQKEESKATFLASVPSR
FT                   SQVELWTWSLAVGESYVAEADAEGWQELIYVLEGELTIQFTDSSKTIAAGSSFIFASSV
FT                   TYTYINSGSQVLKFIRNVVY"
FT   gene            complement(295955..296686)
FT                   /gene="hisA"
FT                   /locus_tag="ABBFA_00275"
FT                   /old_locus_tag="CTY05_00275"
FT   CDS_pept        complement(295955..296686)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisA"
FT                   /locus_tag="ABBFA_00275"
FT                   /old_locus_tag="CTY05_00275"
FT                   /product="1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino]
FT                   imidazole-4-carboxamide isomerase"
FT                   /EC_number="5.3.1.16"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:Q4KJS5"
FT                   /protein_id="ATY42747.1"
FT                   /translation="MLIIPAIDLKDGKCVRLKQGRMEDDTVFSDDPVATAQHWVNEGAR
FT                   RLHLVDLNGAFAGTPIHKPVVEAIAKAQPELPIQIGGGIRSLETIEHYLEAGVTFVIIG
FT                   TKAVQEPEFVEEACKRFAGHIIVGIDAMNGMVATDGWANVTDVKATDLAKRFADAGVSS
FT                   IVYTDIARDGMMQGVNVEQTVNLAQYSGLPVIASGGVTNLDDVRNLKGQPGILGAITGR
FT                   AIYEGTLNLREAQLLLDENRL"
FT   gene            complement(296781..297422)
FT                   /locus_tag="ABBFA_00276"
FT                   /old_locus_tag="CTY05_00276"
FT   CDS_pept        complement(296781..297422)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABBFA_00276"
FT                   /old_locus_tag="CTY05_00276"
FT                   /product="DNA polymerase I"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="protein motif:CLUSTERS:PRK05755"
FT                   /protein_id="ATY42748.1"
FT                   /translation="MSEASALLDKTSIQQLPPFENLNHQNIVVIENGEQCKTIEEELKA
FT                   ATFLGFDSESKPTFQVGEVSTGPHLIQLATEHKAYLFHVNLSTLKFLQPILSNPKQIKV
FT                   GFGLKNDKHIFHKKGIELESCVDLAKGFSHFGFKQQMGVQKAVALLLGQYLAKSKKVGT
FT                   SNWARKPLTSQQISYAAADAYAALLVFLELKKRKVLPIHISEKIQTALQR"
FT   gene            complement(297509..298057)
FT                   /gene="yhaI_2"
FT                   /locus_tag="ABBFA_00277"
FT                   /old_locus_tag="CTY05_00277"
FT   CDS_pept        complement(297509..298057)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yhaI_2"
FT                   /locus_tag="ABBFA_00277"
FT                   /old_locus_tag="CTY05_00277"
FT                   /product="Inner membrane protein YhaI"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:P64592"
FT                   /protein_id="ATY42749.1"
FT                   /translation="MNSPFENQPISQDSPFKANGRFGRLSYAAWTFLFTLVLVTAILLI
FT                   MFTFGFTNPEGAPDFSTPGLICIAILYIVGIYINFVFTIRRLHDRNNTGWLSLLMLVPI
FT                   VNIGLAIYLFCAKGTEGPNDYGPKRPTPSWERVLGWIYIVLIPLALIFGVIAVIMAPTY
FT                   EGYVEKSESIVIGSPSQSE"
FT   gene            complement(298211..298828)
FT                   /gene="hisH1"
FT                   /locus_tag="ABBFA_00278"
FT                   /old_locus_tag="CTY05_00278"
FT   CDS_pept        complement(298211..298828)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisH1"
FT                   /locus_tag="ABBFA_00278"
FT                   /old_locus_tag="CTY05_00278"
FT                   /product="Imidazole glycerol phosphate synthase subunit
FT                   HisH 1"
FT                   /EC_number="2.4.2.-"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:Q0P8U2"
FT                   /protein_id="ATY42750.1"
FT                   /translation="MTRIALLDYGMGNLHSAAKALEYVGATVDVTNDPKLIAQADKIVF
FT                   PGVGAMRDCMQGMREAGIDEVVRKAAFNKPVLAICVGMQALLQSSEENGGVDALGIFDG
FT                   IVKHFPQMEGLKVPHMGWNQVHQMDPSHPMWNNIEQDARFYFVHSYYVEPKDENLVAAT
FT                   CEYGVNFCTAIHKDNLFATQFHPEKSHTAGLQLLKNFVEWNI"
FT   gene            complement(298828..299421)
FT                   /gene="hisB"
FT                   /locus_tag="ABBFA_00279"
FT                   /old_locus_tag="CTY05_00279"
FT   CDS_pept        complement(298828..299421)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisB"
FT                   /locus_tag="ABBFA_00279"
FT                   /old_locus_tag="CTY05_00279"
FT                   /product="Imidazoleglycerol-phosphate dehydratase"
FT                   /EC_number="4.2.1.19"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:Q92TB0"
FT                   /protein_id="ATY42751.1"
FT                   /translation="MTQRISEVVRNTNETKIRVRLNLDGTGQGTLNTGVPFLDHMIDQI
FT                   KRHGLFDIDIHCDGDLEIDDHHTVEDCGITLGQAFAQALGDKKGLRRYGHFYAPLDEAL
FT                   SRVVVDLSGRPGLFMDIPFTRARIGTFDVDLFSEFFQGFVNHALMTLHIDNLKGKNSHH
FT                   QIESVFKALARALRMACEIDPRAENTIASTKGSL"
FT   gene            299524..299907
FT                   /locus_tag="ABBFA_00280"
FT                   /old_locus_tag="CTY05_00280"
FT   CDS_pept        299524..299907
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABBFA_00280"
FT                   /old_locus_tag="CTY05_00280"
FT                   /product="hypothetical protein"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /protein_id="ATY42752.1"
FT                   /translation="MPITVHAYSSLDNSEIRDQLERLYDTSPEFGDGHDAIEQLEQDLQ
FT                   QYTTLYTAEFNTKIIGAIWCSGQGESKVLEYIVVHPANRGRGVAERLVEEACRIEEAKG
FT                   VKIFEPGCGAIHRCLAHIGKLHS"
FT   gene            300013..300088
FT                   /locus_tag="ABBFA_00281"
FT                   /old_locus_tag="CTY05_00281"
FT   tRNA            300013..300088
FT                   /locus_tag="ABBFA_00281"
FT                   /old_locus_tag="CTY05_00281"
FT                   /product="tRNA-Phe"
FT                   /note="tRNA-Phe(gaa)"
FT                   /inference="COORDINATES:profile:Aragorn:1.2"
FT   gene            300215..300290
FT                   /locus_tag="ABBFA_00282"
FT                   /old_locus_tag="CTY05_00282"
FT   tRNA            300215..300290
FT                   /locus_tag="ABBFA_00282"
FT                   /old_locus_tag="CTY05_00282"
FT                   /product="tRNA-Phe"
FT                   /note="tRNA-Phe(gaa)"
FT                   /inference="COORDINATES:profile:Aragorn:1.2"
FT   gene            complement(300462..300893)
FT                   /gene="ypeA"
FT                   /locus_tag="ABBFA_00283"
FT                   /old_locus_tag="CTY05_00283"
FT   CDS_pept        complement(300462..300893)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ypeA"
FT                   /locus_tag="ABBFA_00283"
FT                   /old_locus_tag="CTY05_00283"
FT                   /product="Acetyltransferase YpeA"
FT                   /EC_number="2.3.1.-"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:P63422"
FT                   /protein_id="ATY42753.1"
FT                   /translation="MFIIRQFTNADLDDVVNLWESCGLTRPWNNPETDIFRKVSQQDDL
FT                   FLVAIKDEQLIGTLMGGYDGHRGWINYLAVHPHQQRLGIATALVQQLEKRLMARGCPKL
FT                   QLLVRKDNLNVLNFYEQLGYDEVEAVCLGKRLISDNPHD"
FT   gene            complement(301024..302538)
FT                   /gene="cat1"
FT                   /locus_tag="ABBFA_00284"
FT                   /old_locus_tag="CTY05_00284"
FT   CDS_pept        complement(301024..302538)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cat1"
FT                   /locus_tag="ABBFA_00284"
FT                   /old_locus_tag="CTY05_00284"
FT                   /product="Succinyl-CoA:coenzyme A transferase"
FT                   /EC_number="2.8.3.-"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:P38946"
FT                   /protein_id="ATY42754.1"
FT                   /translation="MSLSRIRLASLHDKVISAEQAAQFIENGMTVGMSGFTRAGEAKAV
FT                   PQALVELAKKNPLKITLITGASLGNDLDKQLTEAGVLSRRMPFQVDNTLRRAINNGEVM
FT                   FIDQHLSETVEQMRNQQLKRPDVAVIEAIAITEDGGIIPTTSVGNSASFAIFAEKVIVE
FT                   INTSLSESFEGLHDIYIPTYRPTRTPIPLTKVDERIGTTAIQIDPSKIVGIVFNDTHDS
FT                   PSTVTPPDDETQGIANHLIAFFEKEVAEGRLPKNLGPLQAGIGSIANAVLTGLKDSNFE
FT                   DLIMYSEVLQDCTFELIDAGKMKFASGSSITLSAKCGEKVFGNIEAYKDKLVLRPQEIS
FT                   NHPELVRRLGIIGINTALEFDIYGNVNSTHVCGTKMMNGIGGSGDFARNAHLAIFVTKS
FT                   IAKGGDISSIVPMVSHVDHSEHDVDILVTEQGLADLRGLAPRERARAIIDNCVHPLYRD
FT                   ALNDYFDRACAKGGHTPHLLREALSWHANFEETGQMLQPTPVAKSA"
FT   gene            complement(302730..304187)
FT                   /gene="envZ"
FT                   /locus_tag="ABBFA_00285"
FT                   /old_locus_tag="CTY05_00285"
FT   CDS_pept        complement(302730..304187)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="envZ"
FT                   /locus_tag="ABBFA_00285"
FT                   /old_locus_tag="CTY05_00285"
FT                   /product="Osmolarity sensor protein EnvZ"
FT                   /EC_number="2.7.13.3"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:P0AEJ5"
FT                   /protein_id="ATY42755.1"
FT                   /translation="MSLEPIPPQTFTDYVAYSERKRTRWERFLDKIKPRSAAMRTTILV
FT                   LLVVLFSLFMSLWFFWRTLYLPEIQQHARYLAVELELVNNPNIRIFHRDSEVDVDTWLR
FT                   NRVGIEYVTNPKEYPSVRDKIIAEFFTNQVEQKLANEIGAKDVTVYFQFKPSPRIWIQT
FT                   PEMHGNWVREPLKTYANYSPELLVGWVVGVPLVSAIIILILVRQMNRPLRRLQNAANEY
FT                   SKSGTAPYLDTNHGPLEIRQVNQAFNRMVYTLEQTERERRIMLAGISHDLRTPLTRIRL
FT                   TAEMLPDEFLREGLVYDVDDMDAILNQFISYMRDGSDEELKDTNINILLQELVVQFKPL
FT                   DIRFNMQDVPIIPARSLSLKRLIANLINNAKRYGAEPIELSAKVENEHILITVADHGEG
FT                   IPEDQIEELMQPFVRGNSARTIQGSGLGLAIVKRIVDIHQGEIQIHNREQGGLEVIISL
FT                   PIPKPAPEENTTHNPLEKIKQTLSERF"
FT   gene            complement(304205..304969)
FT                   /gene="ompR"
FT                   /locus_tag="ABBFA_00286"
FT                   /old_locus_tag="CTY05_00286"
FT   CDS_pept        complement(304205..304969)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ompR"
FT                   /locus_tag="ABBFA_00286"
FT                   /old_locus_tag="CTY05_00286"
FT                   /product="Transcriptional regulatory protein OmpR"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:P0AA16"
FT                   /protein_id="ATY42756.1"
FT                   /translation="MSLVVPAEHPETVHNETDRVERILVVDDDVRLRTLLQRFLEDKGF
FT                   VVKTAHDASQMDRLLQRELFSLIVLDFMLPVEDGLSICRRLRQSNIDTPIIMLTARGSD
FT                   SDRIAGLEAGADDYLPKPFNPNELLARIRAVLRRQVREVPGAPSQQVEVVSFGPWSLDL
FT                   STRTLTREGQIVTLTTGEFAVLKALVQHPREPLTRDKLMNLARGREWGAMERSIDVQVS
FT                   RLRRLIEDNPARARYIQTVWGVGYVFVPDGAE"
FT   gene            305625..307973
FT                   /gene="yugI"
FT                   /locus_tag="ABBFA_00287"
FT                   /old_locus_tag="CTY05_00287"
FT   CDS_pept        305625..307973
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yugI"
FT                   /locus_tag="ABBFA_00287"
FT                   /old_locus_tag="CTY05_00287"
FT                   /product="General stress protein 13"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:P80870"
FT                   /protein_id="ATY42757.1"
FT                   /translation="MTDLVQQLASELAVRPNQVEAAIRLIDEGASVPFIARYRKEVTQG
FT                   LDDTQLRQLDTRLAYLRDLYERREKVIQSLQEQNKLNDDLLARVNAAETKNALEEIYAP
FT                   YRPKRTSKSFKAKEAGLGPIAEKIISEQIDPTEALAGFSHEDYPDVESQLDAIQHILID
FT                   DWAQNIPLTTELKATFAKTAVLKSTVASEEKKEVGKKFRDYFEFSEGVNKLPSHRLLAM
FT                   LRGRQENVLGLKVDGEDDAPLARIETEYNLDQVQPQTRQDFLKQTAKLFWLGKVRPQIE
FT                   HSLLTEKRLAAEAEAMQVFAENLRHLLLSAPAGSRTTLGVDPGIRTGVKLAVVSEAGDV
FT                   LAHSTIYPFAPKEDKEGSIAELARLCREYNVELIAIGNGTASRETEAVVAEMMAANTDL
FT                   KLTRVTVSEAGASVYSASELAAAELPELDVSIRGAVSIARRLQDPLAELVKIDPKSIGV
FT                   GQYQHDVNQTGLAKTLDAVVEDCVNAVGVDVNTASPAILAYIAGLNKAIAQQIVEYRKE
FT                   HGRFDTRQALKNVPRLGERTFEQAAGFLRIQNGSEPLDASAVHPESYGLVEKIVAAKAT
FT                   TVKDIIGNTEIIRQVKAEEFVDDKFGLPTIQDVLAELEKPGRDPRPEFRTAKFREDITE
FT                   VAQLTEGMQLEGVVTNVTNFGAFVDIGVHQDGLVHISELANEFVSDPHKVVKPGQIVQV
FT                   RVMQVDVERNRVNLSMRAEGAAPVKAQRPPRREQNNEQRSERKPQGKRPQPRKDQVERP
FT                   QRSKQEKPQEQKIGGFGALLLQAGIKGSK"
FT   gene            308275..310464
FT                   /gene="bicA_1"
FT                   /locus_tag="ABBFA_00288"
FT                   /old_locus_tag="CTY05_00288"
FT   CDS_pept        308275..310464
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bicA_1"
FT                   /locus_tag="ABBFA_00288"
FT                   /old_locus_tag="CTY05_00288"
FT                   /product="Bicarbonate transporter BicA"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:Q14SY0"
FT                   /protein_id="ATY42758.1"
FT                   /translation="MPALELKNRFHVNDLLSGVVVFLVALPLCLGIALASGAPIISGII
FT                   AGIVGGIIVGLLSGSHISVSGPAAGLTAVILVQLDQLGGNYAAFLLCIVFAGILQILFG
FT                   VFKLGFFANFIPNNVILGLLAAIGAILIVTQLPYLFGLTDFSWKEVWTATPDTFIQKFD
FT                   AGAALIGLLSLFLILAWDSSPLKKLALPSALIAVVLAAVFNFVLISIGSSWAVQSNNLI
FT                   QLPNILQAPEEVLVFPDFSYLAEPLIYTGAITLAIVASLETLLNLEAADKLDPQKRSSP
FT                   PNRELWAQGAGNIVSGLIGGMPVTSVIVRSSVNANTGARSKCSTIIHGVLLLLAILFFV
FT                   PLMNMIPLSALAAILIVTGFKLTHPKLFKQLYQKGWRQFLPFIITLVAILLTDLLTGIL
FT                   VGLFTSSAFILYGNFNKGVRVYKEKHLHGIVTRIELPSQVTFLNRSALISALEHIHKDQ
FT                   QLIIDATQCDSIDPDIYQVIQDYQNETAVKRQVDLKLIGFKQHYEEVDDAVLDIYISTR
FT                   DLQRKLSPQQVITLLKEGNERFVKNERLQRDIYRQIRVTADEGQHPIAAVLGCMDSRAP
FT                   TEMIFDVGIGDLFSLRIAGNIAGQKVLGSLEFACQAKGSKVILVLGHTDCGAVTSACQL
FT                   RLQQKQISDVKEMPHIQYVLGPLMHSVESVYDIMQPRELNKTFVNQVTAMNVHYNIQYI
FT                   INNSTVLKDLLDRGEIAIVGAIYDVKTGHVEFLDA"
FT   gene            complement(310532..311422)
FT                   /gene="acr1"
FT                   /locus_tag="ABBFA_00289"
FT                   /old_locus_tag="CTY05_00289"
FT   CDS_pept        complement(310532..311422)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acr1"
FT                   /locus_tag="ABBFA_00289"
FT                   /old_locus_tag="CTY05_00289"
FT                   /product="Fatty acyl-CoA reductase"
FT                   /EC_number="1.2.1.-"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:Q6F7B8"
FT                   /protein_id="ATY42759.1"
FT                   /translation="MNKKLEALFQEKVQGKVILVTGASSGIGLTISNKLADAGAHVLLV
FT                   ARTQETLEEVKADIESRGGQASIFPCDLNDMEMIDQVSKEILASVDHIDILINNAGRSI
FT                   RRAVHESYDRFHDFERTMQLNYFGAVRLVLNILPHMIQRKDGQIINISSIGVLANATRF
FT                   SAYVASKAALDAFSRCLSAEVHAHKIAITSIYMPLVRTPMIAPTKIYKYVPTLSPEQAA
FT                   DLIAYAIVKRPKRIATNLGRLASMTYSVAPGINNMFMSIGFRLFPSSDAAKGKKAEKLN
FT                   WVQKAYARIFPGEHW"
FT   gene            complement(311696..312973)
FT                   /gene="mdeA"
FT                   /locus_tag="ABBFA_00290"
FT                   /old_locus_tag="CTY05_00290"
FT   CDS_pept        complement(311696..312973)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mdeA"
FT                   /locus_tag="ABBFA_00290"
FT                   /old_locus_tag="CTY05_00290"
FT                   /product="Methionine gamma-lyase"
FT                   /EC_number="4.4.1.11"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:P13254"
FT                   /protein_id="ATY42760.1"
FT                   /translation="MTYKDETLAIHAGYTPEATTKAVAVPIYQTTSYAFDNTQHGADLF
FT                   DLKVQGNIYTRIMNPTTAVLEQRLAALEGGIGALALASGMAAITYAIQTITEAGDNIAS
FT                   VSTLYGGTYNLFAHTLPKQGIEVRFFDYQKPKSLRNLIDDKTKLVFVESIGNPLGNIID
FT                   LEEISKIAHEYGVPVVVDNTVATPALLKPFQYGADIVIHSLTKYIGGHGNSIGGAIIDS
FT                   GKFPWGKYPERFKVLNTPDPSYHGVNYVEALGEAAYIARARVVPLRNTGAAISPLSVFL
FT                   ILQGLETLNLRMERHTENAQRIAEYLQNHPKVKWVNYAGLKDHPQHQLAQKYVKGKPSA
FT                   ILSFGVQDGREGGTRFIDALQLFTRLVNIGDAKSLACYPATTTHRQLNEQELKAAGVSE
FT                   DMVRLSIGIEHVDDLIADLEQALSSV"
FT   gene            313271..314932
FT                   /locus_tag="ABBFA_00291"
FT                   /old_locus_tag="CTY05_00291"
FT   CDS_pept        313271..314932
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABBFA_00291"
FT                   /old_locus_tag="CTY05_00291"
FT                   /product="putative ABC transporter ATP-binding protein"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:P45127"
FT                   /protein_id="ATY42761.1"
FT                   /translation="MAQYIYTMNRVSKMVPPKREILKDISLSFFPGAKIGVLGLNGAGK
FT                   STLLRIMAGVDKDFSGEARAQPGIKIGYLEQEPPLDPTKDVRGNVEDGVREALDALERL
FT                   DQVFAEYADPDADFDALAKEQEKLESIIHAWDAHNLNNQLEIAADALNLPAWDADVTKL
FT                   SGGERRRVALCRLLLSKPDMLLLDEPTNHLDAESVSWLERFLKDFPGTIVAITHDRYFL
FT                   DNVAEWILELDRGHGIPYQGNYTSWLEQKNARLEQEQKQEESFAKALKKELEWVRQNAK
FT                   GQQKKNKARMERFEELNSREFQQRNETSEIYIPPGPRLGNKVVEVENISKSFGDRLLYE
FT                   NLSFTVPPAAIVGIVGPNGAGKTTLFRMMTGEQKPDTGTVTLGDSVKVAYVGQIRDTLD
FT                   DNKTVWEEVSGGLDILKVGDYEIASRAYIGRFNFKGQDQQKRVGELSGGERNRLQLAKI
FT                   LQQGANVILLDEPSNDLDVETLRALEDAILVFPGTVMVVSHDRWFLDRIATHILSFEDE
FT                   QPEFYTGNYTEFEAYRRAKLGDDAQPHRKKYKKISG"
FT   gene            315111..315704
FT                   /locus_tag="ABBFA_00292"
FT                   /old_locus_tag="CTY05_00292"
FT   CDS_pept        315111..315704
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABBFA_00292"
FT                   /old_locus_tag="CTY05_00292"
FT                   /product="hypothetical protein"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /protein_id="ATY42762.1"
FT                   /translation="MKKIKLYTIALGVAVATQLTGCLSVKSYVDPAYKSVTYSDIKRPV
FT                   QPIPVVLTTEFQRNGTVIPKASKELQSAVERSLRATGIFSPTAQPNGGTQAKLYVTANN
FT                   VADLGEAAGKGVLTGLTFGAVGNAIADKYEFKFNYVDVQGKQISQRYPHMILTTVGNKK
FT                   APIENVQPMSINEAFNKVVDDVVIRFSSDLQKQQ"
FT   gene            complement(315804..316496)
FT                   /locus_tag="ABBFA_00293"
FT                   /old_locus_tag="CTY05_00293"
FT   CDS_pept        complement(315804..316496)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABBFA_00293"
FT                   /old_locus_tag="CTY05_00293"
FT                   /product="hypothetical protein"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="protein motif:CLUSTERS:PRK10215"
FT                   /protein_id="ATY42763.1"
FT                   /translation="MYKTLTTCLLVTCLGLSGCATSILSTALPNETTEVQTTILKTDQI
FT                   IALGQAVKNQQEQGVVFIGQDFNYLMTEGSSEFLNIIKNIPVNQRTLIIPSPLLLEMDD
FT                   PTHFHGELKFQYNIPTSKLSDQQKENLKNLGFKNHFMVMENQTQLLYPYAIIRFKGQIY
FT                   QTSPTLKVQQTIPTPYPIALQQKDEITKKHPFKRVTRMALYPLAMAFDIVTVAPSLILS
FT                   DLRGDFTK"
FT   gene            316666..317043
FT                   /locus_tag="ABBFA_00294"
FT                   /old_locus_tag="CTY05_00294"
FT   CDS_pept        316666..317043
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABBFA_00294"
FT                   /old_locus_tag="CTY05_00294"
FT                   /product="hypothetical protein"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /protein_id="ATY42764.1"
FT                   /translation="MSVLFCLLIFQSLWNIAAAFCAHENQEKALHHFGHHAALNVYQTS
FT                   SHTHVEHTETLDAAHKAPLNLQDHHDHLPTCFHVVMTEVAKQAQTPVLHVHELSQIYHW
FT                   SNSYQSPHLNALKPPPVLTPL"
FT   gene            317203..318513
FT                   /gene="czcC"
FT                   /locus_tag="ABBFA_00295"
FT                   /old_locus_tag="CTY05_00295"
FT   CDS_pept        317203..318513
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="czcC"
FT                   /locus_tag="ABBFA_00295"
FT                   /old_locus_tag="CTY05_00295"
FT                   /product="Cobalt-zinc-cadmium resistance protein CzcC
FT                   precursor"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:P13509"
FT                   /protein_id="ATY42765.1"
FT                   /translation="MLLAGQMANAATDFQQGSYTQKAAFSFEQALARAQSYQIQQGVWQ
FT                   AQQQMAEAQLKQSRLWANPSLSIEQTGLQSDQEKELAIGISQPLDIFGQRKAAQHLAKV
FT                   EMSKVDLAEQRYKAELELIVKYFWSQVALLELEKSLIGEQLAVSQENLSASEKRYQAGS
FT                   IAQVDVDRVRMSHLENQRLYQQVDLKLQVAKQQLANLWGGDSNQFQLSQSSNQLWVLAA
FT                   DVESGQDRQNNLLERSFQLDALAQQATIQQLKAKARPQPTVTLGVNNTRSPEQRTENQI
FT                   RLGVEIPLNLFNRQQYGIKIAQAKQELSQRQQSFYRQQNQADIETLMSELKGLHIQFKQ
FT                   LNDQQVPLAVQVQQKTLQGFRLGKFAVTDVQQATMQLQDVRLRKVELLKQAWQNSIEIQ
FT                   SLRLGLEPEQIMAKDALMQLNQRAWQQAQTFPTQAGE"
FT   gene            318516..319733
FT                   /gene="czcB"
FT                   /locus_tag="ABBFA_00296"
FT                   /old_locus_tag="CTY05_00296"
FT   CDS_pept        318516..319733
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="czcB"
FT                   /locus_tag="ABBFA_00296"
FT                   /old_locus_tag="CTY05_00296"
FT                   /product="Cobalt-zinc-cadmium resistance protein CzcB"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:P13510"
FT                   /protein_id="ATY42766.1"
FT                   /translation="MSANLKKNSQWLWVGVIAAITAILIGLLVLNSKNKSNSSEPSEGH
FT                   GHAEEEGEEHHDEGEKPLLLTAQQMQEQNLKIEQAELGEVPQLQTYPAKLVVNTDRQAH
FT                   VSPSFSGRVEAVYVELGQQVKKGQALASLLVPDLVDQQANLQIAQSNLELARQDYERER
FT                   SLWSQGISAKQDYQRAYNAYQQAQIQVKASRSRLSAFGAGSGSAGRYTLTAPIAGIVSN
FT                   KDIVVGENVQLADQLFIINQLDQLWLEFILPSNANINVQPNQQIEFKSLQTGNTFSAQV
FT                   QSLITEADAQTGRLQVRAKVLANSSELRPNLMVNVELNAGSTQKVTRVKAQAVQQVEGK
FT                   DVIFTPKIVKTGFEFEPVTVQLGQRSKDGQWVEVVKGINPSQRYIAEGSFLLKSELEKG
FT                   EAEHGH"
FT   gene            319723..322881
FT                   /gene="czcA_2"
FT                   /locus_tag="ABBFA_00297"
FT                   /old_locus_tag="CTY05_00297"
FT   CDS_pept        319723..322881
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="czcA_2"
FT                   /locus_tag="ABBFA_00297"
FT                   /old_locus_tag="CTY05_00297"
FT                   /product="Cobalt-zinc-cadmium resistance protein CzcA"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:P13511"
FT                   /protein_id="ATY42767.1"
FT                   /translation="MDINKPELPKPEGLFDRVIQFAIQNAIWVMLFVLAWIGVGIWSYQ
FT                   KLPIDAVPDITNTQVQINTQANGYTALEVEQRITYPIENAMAGIPNLEQTRSISRYGLS
FT                   QVTIIFKDGTDIYWARQLINQRLQEADGQLPESVDPIMSPVSTGLGEIYQWVVKAKSGA
FT                   KKADGTAYTAMDLREIQDWIVRPQLQRVKGVAEINSIGGYNKTYIVSPDLKRLQQLQIS
FT                   INEFQTALQENNENRGAGFIEENGEQLTVRVPGMLSSVEDIQNITVSTKNGLPIRVADV
FT                   ANVSIGHDLRTGAATYNGEETVLGIAMMMMGENSRTVAQAVDTKIKEIQSTLPKGVEIE
FT                   TVYDRTSLVNKAIATVQKNLVEGAILVIVILFIFLGNFRAALITACVIPLSMLFTLTGM
FT                   AEQNISANLMSLGALDFGIIVDGAVVIVENCIRRLAEAQHALHRPLTRSERFKEVFLAA
FT                   KQARRPLIFGQMIILVVYLPIFALSGVEAKMFHPMAMTVVMALLGAMILSVTFVPAAVA
FT                   LFVTGEVKEKETRWMQLLKQKYQNILDQAYQLKIVVVSFALSILVLTGVLATQMGSEFA
FT                   PQLSEGDFALQQMRSPSTGLEQSLRMQENTEKLILKNFPEVKAVFARTGTAEVATDVMP
FT                   PNISDAVILLKPHDQWPNPKETLSELRSRMEAFLATLPGNNSEFSQPIELRFNELISGI
FT                   RSDIGVKIFGDDMQVLNEQAQALAQKVQKISGATAVKVEQTSGLPVLSVEINRPLAAQY
FT                   GLSAKAIQDIVAASVGGQNVGQILQGDRRFDFEIRLEDQQRTIQNLAQLPIQLPNGGLI
FT                   QLQDVAKVERTSGLNQVGRENGKRRVIITANVEGRDLGSFVQELRATLAKEQLPAGYWL
FT                   EYGGQFENLASAAARMKIVVPLALAMIFILLMAVFHNVKESLLVFSGVPFALSGGLIAL
FT                   WLRDIPLSMSAGVGFIALSGVAVLNGLVMLSFIKELREKFDIQTATWNGAILRLRPVLM
FT                   TACVASLGFIPMALATGTGAEVQRPLATVVIGGIISSTILTLVLLPVIYRWMNEDKTKS
FT                   VEHS"
FT   gene            323014..323970
FT                   /gene="czcD_1"
FT                   /locus_tag="ABBFA_00298"
FT                   /old_locus_tag="CTY05_00298"
FT   CDS_pept        323014..323970
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="czcD_1"
FT                   /locus_tag="ABBFA_00298"
FT                   /old_locus_tag="CTY05_00298"
FT                   /product="Cobalt-zinc-cadmium resistance protein CzcD"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:P13512"
FT                   /protein_id="ATY42768.1"
FT                   /translation="MGGHHGHDHSHAVVTEGNAKKLTIALALTTTFLIVEVIAGLITQS
FT                   LALLSDAAHMFTDAAALAIALVAIQISKRPADNKRTFGYQRFEILAALFNALMLFVVAI
FT                   YILYEAYIRFSQPPEIQSVGMLIVATIGLVINLISMKILMSSANNSLNVKGAYLEVLSD
FT                   ALGSVGVIIGAIIIYFTNWYWIDTLIAVLIGFWVLPRTWVLLKQSINILLEGVPEEVDI
FT                   EKLRADLLSLNGVESIHQLKVWAITSKNIHLTVHLFAPEADRNKLYQDAVEMLSHEHGI
FT                   GEVTLQIEDDAEINCQHIAQHASHEHNDNDKTHSHQH"
FT   gene            complement(323989..324327)
FT                   /locus_tag="ABBFA_00299"
FT                   /old_locus_tag="CTY05_00299"
FT   CDS_pept        complement(323989..324327)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABBFA_00299"
FT                   /old_locus_tag="CTY05_00299"
FT                   /product="hypothetical protein"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /protein_id="ATY42769.1"
FT                   /translation="MQYRCPQCQSVKIMPVSQGVNSAKPVVPKSLVILVPAIFVLLLLV
FT                   VISIFMWIFGNGAGSSLQIATVVAFVVTVGAGFMFWRDLPDFKLSMQAFMQSQKHWKCR
FT                   DCNHEWEI"
FT   gene            324601..325548
FT                   /locus_tag="ABBFA_00300"
FT                   /old_locus_tag="CTY05_00300"
FT   CDS_pept        324601..325548
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABBFA_00300"
FT                   /old_locus_tag="CTY05_00300"
FT                   /product="hypothetical protein"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /protein_id="ATY42770.1"
FT                   /translation="MGQEDDNKSKPTTTSTVSGNPDPIKLSFSRRLLHKTLQHAQDAVG
FT                   FASDTTRNLAEVADAALDALDQVTSHTKRGVVGMTNLAAGTVRDMVSETSETARQVALI
FT                   MARTFLGKSTLNLYLPEMLLNSQIRKRIDRSEIDDIKVQCGNDRFQVEIDGHYHRFLYR
FT                   LSLDFRVLECRIGQEKFLRLRQMDESLDVQIRHGGTLSNWAVRRIGRVGFEVINMLPIP
FT                   SLINHLIRDIPGIQRDGHRMWFIDLEQAGFIDFINNRSWMVEKLLNLTDFSILPGLNIL
FT                   RESRELVQQLVDQFEIKGLRVQSGRLEVQVGIAN"
FT   gene            complement(325641..325716)
FT                   /locus_tag="ABBFA_00301"
FT                   /old_locus_tag="CTY05_00301"
FT   tRNA            complement(325641..325716)
FT                   /locus_tag="ABBFA_00301"
FT                   /old_locus_tag="CTY05_00301"
FT                   /product="tRNA-Glu"
FT                   /note="tRNA-Glu(ttc)"
FT                   /inference="COORDINATES:profile:Aragorn:1.2"
FT   gene            complement(325745..325820)
FT                   /locus_tag="ABBFA_00302"
FT                   /old_locus_tag="CTY05_00302"
FT   tRNA            complement(325745..325820)
FT                   /locus_tag="ABBFA_00302"
FT                   /old_locus_tag="CTY05_00302"
FT                   /product="tRNA-Glu"
FT                   /note="tRNA-Glu(ttc)"
FT                   /inference="COORDINATES:profile:Aragorn:1.2"
FT   gene            complement(325955..326839)
FT                   /locus_tag="ABBFA_00303"
FT                   /old_locus_tag="CTY05_00303"
FT   CDS_pept        complement(325955..326839)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABBFA_00303"
FT                   /old_locus_tag="CTY05_00303"
FT                   /product="PGAP1-like protein"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="protein motif:Pfam:PF07819.7"
FT                   /protein_id="ATY42771.1"
FT                   /translation="MKIIFIHGMNQQNYTAHRLKEHWLKVFKLGLKQLHCRVNLRDLHI
FT                   HMPFYGDLMTKYQLSNQLDLNTLLPKTFNFHLPIHLHHQPSTPKEHTPFIPHLPLSPDQ
FT                   PAQSLSERLYLTSQLVKDRVLKEMVVLLNNFPKLHESLIQQFLIETYMYLSNPDFMYEV
FT                   HQRILKQMHDDEDCIVVAHSLGSVIAYHLLSDPSYQFSVQRFITLASPLSFRVIQSKLP
FT                   TPIERPKCLKGDWYNFYSKDDFLTAFPLSEAPFNFTPPIINQEIFTFANQPHEIVGYLQ
FT                   HHAVVKTIIEPFQ"
FT   gene            complement(326958..328376)
FT                   /gene="rocC_1"
FT                   /locus_tag="ABBFA_00304"
FT                   /old_locus_tag="CTY05_00304"
FT   CDS_pept        complement(326958..328376)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rocC_1"
FT                   /locus_tag="ABBFA_00304"
FT                   /old_locus_tag="CTY05_00304"
FT                   /product="Amino-acid permease RocC"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:P39636"
FT                   /protein_id="ATY42772.1"
FT                   /translation="MQPSDKQLDAQHQNSTAPLKRAMSTRHLVMLSLGGAIGTGLFLGS
FT                   GEVISQTGPIGAIIAYILGGAIAYMVMLCLGELAVHMPVSGSFGAYARKYISPSTGYMI
FT                   SWMYWLTWTATLGTEFTAAALLMQEWFPQISMWIWTLIFAVTIFGLNISSTRVFAESEF
FT                   WLALVKVITVIAFIVLGLLAIFGLIPFHGAQTAPLFSNLTAQGWFPHGFLPIFTTMLIV
FT                   NFAFSGTELIGVAAGETKDPAQNVPKAINAAIWRLLIFFVGTIIVISALLPFQLAGLGG
FT                   DNVSNSPFVTVFNYIGIPYADDIIRFVIITALLSAANSGLYAASRMMWSLSEQKLLPGV
FT                   FATLSKSGTPIVALVVTMFGAIPGLLSEQFAPETIFKNLLGVAAFTMVIVWMSICLSQF
FT                   NFRRQWYRSGHTVSDLKYAAPLFPIVPILGFLFCFITCLSMAADPEMRAGFIGCLIFTA
FT                   LCYLSYFIFYRNKA"
FT   gene            complement(328507..328582)
FT                   /locus_tag="ABBFA_00305"
FT                   /old_locus_tag="CTY05_00305"
FT   tRNA            complement(328507..328582)
FT                   /locus_tag="ABBFA_00305"
FT                   /old_locus_tag="CTY05_00305"
FT                   /product="tRNA-Glu"
FT                   /note="tRNA-Glu(ttc)"
FT                   /inference="COORDINATES:profile:Aragorn:1.2"
FT   gene            complement(328608..328683)
FT                   /locus_tag="ABBFA_00306"
FT                   /old_locus_tag="CTY05_00306"
FT   tRNA            complement(328608..328683)
FT                   /locus_tag="ABBFA_00306"
FT                   /old_locus_tag="CTY05_00306"
FT                   /product="tRNA-Ala"
FT                   /note="tRNA-Ala(ggc)"
FT                   /inference="COORDINATES:profile:Aragorn:1.2"
FT   gene            complement(328741..330249)
FT                   /gene="gltX"
FT                   /locus_tag="ABBFA_00307"
FT                   /old_locus_tag="CTY05_00307"
FT   CDS_pept        complement(328741..330249)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gltX"
FT                   /locus_tag="ABBFA_00307"
FT                   /old_locus_tag="CTY05_00307"
FT                   /product="Glutamate--tRNA ligase"
FT                   /EC_number="6.1.1.17"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:P27000"
FT                   /protein_id="ATY42773.1"
FT                   /translation="MKVRTRIAPSPTGFPHVGTAYIALFNMCFAKQHGGEFILRIEDTD
FT                   QLRSTPESEKMILDSLRWLGLNWSEGPDVGGPHAPYRQSERMGIYKQYALELVEKGHAF
FT                   YCFATAEELDQMRAEQQARGETPKYDGRGLKLSQEEVARRLEAGEPHVIRMKVPEEGVC
FT                   KFNDLLRGEVEIPWAQVDMQVLLKTDGLPTYHLANVVDDHLMEITHVLRGEEWLPSAPK
FT                   HQLLYQYFGWEMPTLCHMPLLRNPDKSKLSKRKNPTSINYYRDIGVLPEALLNYLGRMG
FT                   WSMPDEREVFTLQDMMDNFDIQRVSLGGPIFDVEKLNWLNGQWIKGLTPGQLLDRLLTW
FT                   KSDRSTLEDIAAAIQPRINLLSEAVNWAGFYFNHMPQITAEMFESKKLTQEQVRQSLQF
FT                   AIWRLESQFTWNNDTVSQTLMDLANQMGIKLRDFMPTFFIAIAGSTSSTPVMQSMVTLG
FT                   PDLTFARLRHALEIVGAPSKKEVKNWEKLNESLKLPKNEATSEA"
FT   gene            complement(330366..330665)
FT                   /locus_tag="ABBFA_00308"
FT                   /old_locus_tag="CTY05_00308"
FT   CDS_pept        complement(330366..330665)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABBFA_00308"
FT                   /old_locus_tag="CTY05_00308"
FT                   /product="hypothetical protein"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /protein_id="ATY42774.1"
FT                   /translation="MKIHYGKALSLGLVLSFASQLSTAAVLKDTPSKSLSDKQSSLIEK
FT                   ALDQQKRNTIVLPSTDDELKVLNTIRVTPTQNFLAAQHERFSRFVQAIFQPHTS"
FT   gene            331062..332063
FT                   /gene="sbp_1"
FT                   /locus_tag="ABBFA_00309"
FT                   /old_locus_tag="CTY05_00309"
FT   CDS_pept        331062..332063
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sbp_1"
FT                   /locus_tag="ABBFA_00309"
FT                   /old_locus_tag="CTY05_00309"
FT                   /product="Sulfate-binding protein precursor"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:P0AG78"
FT                   /protein_id="ATY42775.1"
FT                   /translation="MKRIAIIAVATYMGLAVSAVQAATTFLNVSYDPTREFYQEYNQAF
FT                   GKFWKQRTGQDVDFKQSHGGSGKQARAVATGLEADVVTLALANDIDEIVKAGFIQPNWQ
FT                   KEFPNNSAPYTSTVVFLVRKGNPKNIRDWNDLTKPGVEIITPNPKTGGAPRWIYLSAWG
FT                   YALKQPGGNDAKAKELVKKLYHNVKVLDSGARGSLTTFAERGIGDVLLSWENEALLATK
FT                   GLDKDKYEIVYPSISILAEPSVAIVDKTVDKDGNRTLAKGYLNFLYSPLGQELAAKHYF
FT                   RPRNPQVAAKYAAQFPKIKLFTINDVFGGWAKAQKTHFANGAIFDQIYDVKQ"
FT   gene            332286..333209
FT                   /gene="rsmH"
FT                   /locus_tag="ABBFA_00310"
FT                   /old_locus_tag="CTY05_00310"
FT   CDS_pept        332286..333209
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rsmH"
FT                   /locus_tag="ABBFA_00310"
FT                   /old_locus_tag="CTY05_00310"
FT                   /product="Ribosomal RNA small subunit methyltransferase H"
FT                   /EC_number="2.1.1.199"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:P45057"
FT                   /protein_id="ATY42776.1"
FT                   /translation="MSHISVLLFETVESLLADRTTGVYIDATFGRGGHTRLLLSKLDEN
FT                   ARVYAFDKDPQALEVAAALAQEDPRFTIIHASFADIKEKMQEIGVQSVDGIMADLGVSS
FT                   PQLDQAERGFSFMQDGPLDMRMDNSKGLTAAEWLLEVEEEDLANIIYQYGEERYSRRIA
FT                   RAIKQAGKLDTTAQLAEIVKTAHPKWEKHKHPATRTFQAIRIAINKELDDIEVFLPQAV
FT                   DLLKPKGRLSVISFHSLEDRLIKQFIQKESTLAEDSGWGMPQQQVDTRRLKKISRVRAS
FT                   EEEVKANPRSRSAWLRVAERLEQKGA"
FT   gene            333209..333541
FT                   /locus_tag="ABBFA_00311"
FT                   /old_locus_tag="CTY05_00311"
FT   CDS_pept        333209..333541
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABBFA_00311"
FT                   /old_locus_tag="CTY05_00311"
FT                   /product="cell division protein FtsL"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="protein motif:CLUSTERS:PRK10772"
FT                   /protein_id="ATY42777.1"
FT                   /translation="MKSSDEIETTENKVVKKVVVYAVMVALVFISAMMVVFQVFEYRHD
FT                   YRELSSYMRERDDLNAEWGRLLIEQQTFGATAQIGTRAVTQLRMFSPPAAETVVISLPM
FT                   TSEQNK"
FT   gene            333553..335385
FT                   /gene="ftsI"
FT                   /locus_tag="ABBFA_00312"
FT                   /old_locus_tag="CTY05_00312"
FT   CDS_pept        333553..335385
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsI"
FT                   /locus_tag="ABBFA_00312"
FT                   /old_locus_tag="CTY05_00312"
FT                   /product="Peptidoglycan synthase FtsI precursor"
FT                   /EC_number="2.4.1.129"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:P0AD68"
FT                   /protein_id="ATY42778.1"
FT                   /translation="MVDKRTKQTRKKQQSISEKPSLAFDMWRFYLLWAVVLLCFVVLIA
FT                   RAFYVQVINKDFLQNKANANILRTERIEAMRGVISDRHGVPLAISSPIMKIVIDPRDYF
FT                   ETKHLYDQITAELKQDPNNRKLKRQLPDKNLNLDELADVVGVDRADLKKQMNARPRSRY
FT                   LVLKKEVPPQQADLIMKGNFQGVYAEKTYKRYYPQPQPNAQIIGLTNSEGQGIEGLEMQ
FT                   LNKQLSGVDGEQKIIRDKRGNRLKVSEVIREGEPGENITLSIDSRLQYIMYRELTAAGV
FT                   ANNARSATAIAVDVKTGEILAMTSWPSYNPNDKNGLSNKDAMRNRGAIDMFEPGSTMKP
FT                   FTISAALETGQYTPNTIVNTSPGSMRLGWHTIRDTHNYGALTVSGVIIKSSNVGSAKIA
FT                   LSLPKETLPSFFNRVGFGKRSAVRFPGESSGLVLPVNKLNSSQIGTMAYGYGLNATILQ
FT                   LAQGYAMLANHGVKMPLSLHKLDQPPKGEQVLNPKIADQVLLMLEQVTMPGGTAKQANI
FT                   PGYRVGGKTGTAHKLRADGKGYSNNEYRALFAGVAPISDPRLAVIVVVENPQGRYYGGL
FT                   VAAPVFARIMQESLRLMNVPLDKPLNTPENPIRR"
FT   gene            335389..336891
FT                   /gene="murE"
FT                   /locus_tag="ABBFA_00313"
FT                   /old_locus_tag="CTY05_00313"
FT   CDS_pept        335389..336891
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murE"
FT                   /locus_tag="ABBFA_00313"
FT                   /old_locus_tag="CTY05_00313"
FT                   /product="UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,
FT                   6-diaminopimelate ligase"
FT                   /EC_number="6.3.2.13"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:P22188"
FT                   /protein_id="ATY42779.1"
FT                   /translation="MTVSFQEIHPIEIDAQWPQQPFHGFSLDSRKVETGQIFIALTSYS
FT                   QPEKTRTFFAEAALANGALAVISETELGVANEWVCPDVRQRMGEWQKRYLQQADVVKPL
FT                   RIIAVTGTNGKTTISRLIAELISSQQQRCAVMGTTGNGILPNLTPSTHTTLDALQLQNA
FT                   LHDYAKQGATFASLEASSHGLEQGRLNGCDIEIAVYSNLSRDHLDYHGTLEAYAEAKAR
FT                   LFQFNSLKVAVINLDDAHADLMIESAQNNPAQPKILTYSLTQNTADYYITDLNYSLAGA
FT                   TFNLVSQQGSFAVESPLLGHFNVENLIAALIAAEQAGFDLQALVNFVPKLIGAPGRMQV
FT                   IRDDERLFVVDYAHTPDALIQVLKTLKRHVSNQLWAVFGCGGDRDRGKRPLMTQAALDG
FT                   ANPVILTSDNPRTEDPEQIFADMKQGIDFSGHRMHEIHDRREAIKFVAEQAQAGDIVVI
FT                   AGKGHENYQEINGVRHWFDDVVEVRSAIDAQHHTVDAAYPAQ"
FT   gene            336900..338300
FT                   /gene="murF"
FT                   /locus_tag="ABBFA_00314"
FT                   /old_locus_tag="CTY05_00314"
FT   CDS_pept        336900..338300
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murF"
FT                   /locus_tag="ABBFA_00314"
FT                   /old_locus_tag="CTY05_00314"
FT                   /product="UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D-alanine
FT                   ligase"
FT                   /EC_number="6.3.2.10"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:P11880"
FT                   /protein_id="ATY42780.1"
FT                   /translation="MHTSTTSTVPLEPWTAQQLQQATQGYWHKDQIPQTEIKRILTDSR
FT                   HAESGDAFLALKGERFDAHNFVAQVVANGCQVAIVERPIDAEIAQLVVADTRLALGQLG
FT                   AYRREQNAQLKVIALTGSSGKTTTKEMLGSILSRLAPTLITRGNLNNDLGVPMMLLELR
FT                   KEHQYAVMELGANHQGEIDYTSKIVQPHVAGILNIGTAHLGEFGGRDGICRAKSEIYRH
FT                   ILPQGVAIVPQQDDFTAEIREAAKSHQIMSFGEGGDVFATEIELLPQSANFQLHTPQGS
FT                   SFVRLPFAGEHNVQNATAAVAFALALGVSLEDIVKGLEQAQGAKGRLNFIQKAPHLFID
FT                   DTYNANPTSMRAAAQVLLQQNGIKVMVMGDIGELGDSSWQEHHDLGRDLAELPLDHIVA
FT                   VGQFASAALEGAGLHSTKLKAFQTQAEALPFLINLIQTHQPQSMSFLFKGSRFTHMETL
FT                   MADLMEKL"
FT   gene            338301..339419
FT                   /gene="mraY"
FT                   /locus_tag="ABBFA_00315"
FT                   /old_locus_tag="CTY05_00315"
FT   CDS_pept        338301..339419
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mraY"
FT                   /locus_tag="ABBFA_00315"
FT                   /old_locus_tag="CTY05_00315"
FT                   /product="Phospho-N-acetylmuramoyl-pentapeptide-transferase"
FT                   /EC_number="2.7.8.13"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:P0A6W3"
FT                   /protein_id="ATY42781.1"
FT                   /translation="MLLWLFEQLAGYHSSFQVVRYLTLRSLLSVLTSLTIGLVLGPIMI
FT                   RKLQALKYGQAVSSFAPENHAKKMGTPTMGGILILLSIGISTLLWADLSNPYVWIVLGV
FT                   MVVFGAVGWADDWIKIRYKDNAGLPARKKFFWTSVASLGAGIALYLIATQQSNAEYTAN
FT                   MLDLLIPFFKNLSIPLSIVPLGLAFIVFTYLVINGASNAVNLTDGLDGLAIMPVVMVAT
FT                   GLGVFAYLSGDIRFANYLHIPYVKYTSELVVICSAMIGAGLAFLWYNAHPAQVFMGDVG
FT                   ALALGAMLGTIAVMVRQEIVFAIMGGVFVMEAVSVFLQIGSLRMRNKRVFLMAPLHHHY
FT                   EKQGWKETQVVIRFWIITIMLVVLGLMTLKLR"
FT   gene            339480..339812
FT                   /locus_tag="ABBFA_00316"
FT                   /old_locus_tag="CTY05_00316"
FT   CDS_pept        339480..339812
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABBFA_00316"
FT                   /old_locus_tag="CTY05_00316"
FT                   /product="hypothetical protein"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /protein_id="ATY42782.1"
FT                   /translation="MTKVAGLDQLSVINQKVVGEGEVLPQVVLKDGSQVQTGTVATMLH
FT                   NIELYNAGQRGQIEEELKIAIPTLVKVGLFDLFEVDEWIKGTNAGRTFVGIHAKAYLQQ
FT                   KEQENN"
FT   gene            339815..340639
FT                   /gene="rlmA"
FT                   /locus_tag="ABBFA_00317"
FT                   /old_locus_tag="CTY05_00317"
FT   CDS_pept        339815..340639
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rlmA"
FT                   /locus_tag="ABBFA_00317"
FT                   /old_locus_tag="CTY05_00317"
FT                   /product="23S rRNA (guanine(745)-N(1))-methyltransferase"
FT                   /EC_number="2.1.1.187"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:P36999"
FT                   /protein_id="ATY42783.1"
FT                   /translation="MTTQNLMCPVCRQRLELVSKTWRCEQGHSYDIAKQGYVNLHVVQH
FT                   KHSKNPGDTPESVDARRAFLQGGYYQPLQQAVVHLLKDLKAKMVLDIGCGEGYYTSAMQ
FT                   QVVEQCIGVDIAKNAVQRAAKLNDKVTWVVGTGATLPVIDQSLDVCTSLFSPIPQMEIL
FT                   RVLKDDGYLIVVTPATDHLYAMREALFEQVNPHTPQKFVEQLQDLFELKEQQVIDAPLV
FT                   LDQQALKNLIAMTPYAYKASPERRMQLEQKAHLQVTASFQIYLFQKRNKKAI"
FT   gene            complement(340657..343212)
FT                   /gene="mrcA"
FT                   /locus_tag="ABBFA_00318"
FT                   /old_locus_tag="CTY05_00318"
FT   CDS_pept        complement(340657..343212)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mrcA"
FT                   /locus_tag="ABBFA_00318"
FT                   /old_locus_tag="CTY05_00318"
FT                   /product="Penicillin-binding protein 1A"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:P02918"
FT                   /protein_id="ATY42784.1"
FT                   /translation="MKKLSSLGFVRPIFLIIIIILVSLPMGFYGMYLYIAPALPEMSSL
FT                   KKAPLLKPLQVYTADNQLIAEYGGKLSIPVEYKQIPPNFIHAFLAAEDSSFFEHSGISF
FT                   KGLGRALSESVTGSDVQTGGSTITMQVAKNYYLSPERTLKRKLTEIFLARKIEQNLSKE
FT                   DILSLYVNKIFLGKNAYGIAAAAKIYYNKSINELSIAQMAMIAGLPKAPSKYNPVVNPE
FT                   RALERRNWILGRMLQLGYISQTEYQKAVAEPINLNMPNRDLNNIHPYAGEMVRSELVKH
FT                   FGEQAIDSGYKVYTTINAKRQAIAEKAVQDGLEAYDRRHGWRGAEAHDKPLSEFRAYAN
FT                   TYPAQVTKVNSSSFEALMQDGSTVTVQWSGMSWARPYRNANSVGAAPSRASQIVKVKDI
FT                   VRLRPNEAKTAWSLVQVPKVQGQLIAINPNDGSIEAIVGGYNFYQSKFNRALQGWRQPG
FT                   STIKPFLYALALERGMTPYSMVNDSPITIGKWTPKNSDGRYLGMIPLRRALYLSRNTVS
FT                   VRLLQTVGIERTRQLFMDFGLQEDQIPRNYTIALGTPQVLPIQMATGYATFANGGYRVQ
FT                   PHFIQRIEDAYGKVIYEAKPEYACIPCINAPETTDDTQVTTPDDQVVEVTNKELEQKEK
FT                   TTKQLNLKQTDKNNSQYRQAQRILKSSSAYDMANILRDVIEHGTGRAALKIGRSDLGGK
FT                   TGTTNDAKDAWFAGFNGKLVTVTWVGFDQPTTLGRREYGGIAALPIWINFMGQALQGTP
FT                   AAWVRLEKDAQAPISRDKQEVTTEVGDKKTYRAAPPLARPLYRPAPPQPKTTNNDFDDL
FT                   PGEEIVIPSKTTPPTMKPSQGAAPKREKDELENLINQIE"
FT   gene            343374..344432
FT                   /locus_tag="ABBFA_00319"
FT                   /old_locus_tag="CTY05_00319"
FT   CDS_pept        343374..344432
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABBFA_00319"
FT                   /old_locus_tag="CTY05_00319"
FT                   /product="Competence protein A"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="protein motif:Pfam:PF11104.2"
FT                   /protein_id="ATY42785.1"
FT                   /translation="MLRLYRKPNKGLMGVDISSTSVKLLELSVKNGKYWVESYALMPLP
FT                   ENSVVEKNILNPEAVAEALERAMNLANPQTTHAAIAVPTSTVIHKTIEMDADMSDDERE
FT                   VQIRVDAEQYIPFPLDEVSLDFEVLPDRLANPNRVNVLLVATRTENVETRVEVLELADL
FT                   NPKLADVESYAVERAFSVFADSLPMGANTIGILDIGHTMTTLSVMQNGKIIYTREQVFG
FT                   GKQLTLEIQSRYGLSLEEASRAKKDRSLPDDYEIEVLDPFLDAVVQQAARSLQFFFSSS
FT                   QFNEIDHILLAGGNANIPGLAKLLQQKLGYRVTIANPFLQMGFSPQVDVQKIENDASSL
FT                   MVACGLALRSFD"
FT   gene            344432..345073
FT                   /locus_tag="ABBFA_00320"
FT                   /old_locus_tag="CTY05_00320"
FT   CDS_pept        344432..345073
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABBFA_00320"
FT                   /old_locus_tag="CTY05_00320"
FT                   /product="Fimbrial assembly protein (PilN)"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="protein motif:Pfam:PF05137.7"
FT                   /protein_id="ATY42786.1"
FT                   /translation="MATINLLPWREELREQRKKQFITLCFGVVVLGITTVFGGWFYFDH
FT                   KLDDQEQANQLIMSTNQNLDQQLKTLNGLQEQRDAIIERMKLIQGLQSQRPVVVRLVDE
FT                   LVRVTPSAMYLTKFSRTGDKFTIEGKAESPNTVAELLRNLEASPWYRNAFMNSFLANEE
FT                   KKDKSASSLLPRVEDHYGSFVVTVDLGEMGVTTTDDSAKPSTGESVGVAK"
FT   gene            345070..345810
FT                   /locus_tag="ABBFA_00321"
FT                   /old_locus_tag="CTY05_00321"
FT   CDS_pept        345070..345810
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABBFA_00321"
FT                   /old_locus_tag="CTY05_00321"
FT                   /product="Pilus assembly protein, PilO"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="protein motif:Pfam:PF04350.7"
FT                   /protein_id="ATY42787.1"
FT                   /translation="MSQDELQELSLEQLSAKKKKFNLDKFLQQFNTLDMNNYGSWPISV
FT                   KITCWIFIFFAVLALGYFIVIQPKLQAIDNAQAQESNLLNEFREKDSKLRNLQQYQVQL
FT                   QEMQANFNQQLEQLPKETEIPSLVEDINLTGVNSGLKFKNIRLEDEVKQEIFIEQPIAI
FT                   EATGDYHAFGAFVSSIAALPRIVTMHDFTVDVSPAKDNKSDIPVLNYSIKAKTYRYVGA
FT                   TDTSEQTGKAPAASASTNTTVQPK"
FT   gene            345821..346348
FT                   /locus_tag="ABBFA_00322"
FT                   /old_locus_tag="CTY05_00322"
FT   CDS_pept        345821..346348
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABBFA_00322"
FT                   /old_locus_tag="CTY05_00322"
FT                   /product="Pilus assembly protein, PilP"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="protein motif:Pfam:PF04351.7"
FT                   /protein_id="ATY42788.1"
FT                   /translation="MKIKQITLCVLASVVLVGCDSRIDAVNQEMANIRNQPPLPIEPAP
FT                   IFTPVPQFNYAAHQLKSPFMPSSLAAELKIMAGKRVYPNFSRAPQPLESYALEALNMKG
FT                   SMRNNRGQILALIQTPDQQIERVQVGNYMGMNQGRITHISPTQIDLVEIVPDGREGYVE
FT                   RPRTLVLIGPAP"
FT   gene            346411..348576
FT                   /gene="pilQ"
FT                   /locus_tag="ABBFA_00323"
FT                   /old_locus_tag="CTY05_00323"
FT   CDS_pept        346411..348576
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pilQ"
FT                   /locus_tag="ABBFA_00323"
FT                   /old_locus_tag="CTY05_00323"
FT                   /product="PilQ"
FT                   /note="Type IV pilus biogenesis and competence protein PilQ
FT                   precursor"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:Q9JVW4"
FT                   /protein_id="ATY42789.1"
FT                   /translation="MNHVFRQFSMGAVAIAIMQAASAQVSMTNIVPMQIAGQGTEIRVM
FT                   FNGLPPQPQAYQLENPSRLILDFDKVQQGLKQSKISVATNEASSVDVTSDDQRSRLTVN
FT                   LKDAGAFTTRVEGNTFILKINSAQTSNKPLPVVSAQPQGVSNIGFQRGSQGEGLVVVDL
FT                   LGSNTPVDVQQQGSKVVIRTIGTKIPTHLARRLNVNDFATPVSSIDAYNDKGVGVITIQ
FT                   SSGSYEYMAYQAENKLTISLKRPQDKNVTSLYKTPNYSGNKLSLDFQDIEVRRVLQLLA
FT                   DFTGINMVAADSVQGNITLRLKDVPWDQALDIILKTKNLDKRRNGNVIWIAPVAELIKA
FT                   EEEEAKAVAQSVKLAPLQTEYIQLKYAKAGDIMGLITQGSNNSNGLQHTSGGGTSTSTN
FT                   LNTGVDSLGNNVGSLLSPRGTITQDDRTNTLIINDTAQSIDQIRKMIDLLDVQVKQVMV
FT                   EARIVRASTSFTKELGVKWGILSQGITNNNNLLVGGSETTLWNLREPKKDETTGGYKYT
FT                   IERPDNLNVDLGVSNPAGSIAFGLISMSDFMLDLELSALQADGYGEVISTPKVMTADKQ
FT                   TAKVATGQQVPYQSTTNSAAGSTATTSFKDALLSLNVTPSITPDGKIQMKLDISKDSVA
FT                   GAAPNGELILNKNNINTNVLVDNGETVILGGVFEQTTMNSQTKVPFFGDIPVVGRLFRK
FT                   DVKSDDKQELLIFVTPRIVNDTLARNH"
FT   gene            348588..349157
FT                   /gene="aroK"
FT                   /locus_tag="ABBFA_00324"
FT                   /old_locus_tag="CTY05_00324"
FT   CDS_pept        348588..349157
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroK"
FT                   /locus_tag="ABBFA_00324"
FT                   /old_locus_tag="CTY05_00324"
FT                   /product="Shikimate kinase 1"
FT                   /EC_number="2.7.1.71"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:P0A6D7"
FT                   /protein_id="ATY42790.1"
FT                   /translation="MKAIEIGGALPSKAFETLPNIYLVGPMGAGKTTVGRHLAELLGRE
FT                   FLDSDHEIERKTGATIPWIFEKEGEVGFRTRETVVLNELTSRKALVLATGGGAITQAPN
FT                   REFLKQRGIVVYLYTPVELQLQRTYRDKNRPLLQVENPEQKLRDLLKIRDPLYREVAHY
FT                   TIETNQGAARDLAQKILQLILSNKLK"
FT   gene            349186..350268
FT                   /gene="aroB"
FT                   /locus_tag="ABBFA_00325"
FT                   /old_locus_tag="CTY05_00325"
FT   CDS_pept        349186..350268
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroB"
FT                   /locus_tag="ABBFA_00325"
FT                   /old_locus_tag="CTY05_00325"
FT                   /product="3-dehydroquinate synthase"
FT                   /EC_number="4.2.3.4"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:Q9KNV2"
FT                   /protein_id="ATY42791.1"
FT                   /translation="MQTLHVELGERRYPIFIGSQLDPKQLLEPYIHGQQVMIVSNVTVA
FT                   PLYLSHYQEALESLGKTVATCILPDGEKYKDIQHLNLIFDALLEAGFNRDCTVLALGGG
FT                   VIGDMAGFASACFQRGVYFVQVPTTLLSQVDSSVGGKTGINHPLGKNMLGAFQQPQVVL
FT                   ADMAQLNTLPERELSAGLAEVIKYALLGDEDFLVWLEENMDGLVARDADLLAEAVYRSC
FT                   AHKARIVANDEKEQGERALLNLGHTFGHAIESYLGYGTWLHGEAVATGMVMAADLSQRL
FT                   GWISNEDVARTKKIIQRANLPISCPQIPLDDFLGYMAHDKKVLNGQLRLVLLKQLGQAV
FT                   ITKDFDVELMKQAILANQHG"
FT   gene            350284..351159
FT                   /locus_tag="ABBFA_00326"
FT                   /old_locus_tag="CTY05_00326"
FT   CDS_pept        350284..351159
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABBFA_00326"
FT                   /old_locus_tag="CTY05_00326"
FT                   /product="hypothetical protein"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /protein_id="ATY42792.1"
FT                   /translation="MTVSRTLWQNVQQYIWLVGGIVCLFLAFIFWVITDNKKLVEVEKS
FT                   ADSDAPVQIQPEKVATTPNLGALADEVRPLDLTTRTVASGEHEPEFRGTKFINENKKQW
FT                   TLELFRASDEDIIKNFLKSRTDRNKFIYFRLSGEQQAEQYVLAYGTFKRSEDAVQQLTQ
FT                   INLQLPDSVKPQPQQFSSYAPLVNDLGADEMKGGNNQLYEVRLRPAALPRIDESLLMSV
FT                   PASSTLNTQPKPTSTNSATKTTIVRRDAAGNVVDVQQSNSNIDQPNKPAQTRINENQPK
FT                   NATNEGTRGN"
FT   gene            351615..356096
FT                   /gene="gltB"
FT                   /locus_tag="ABBFA_00327"
FT                   /old_locus_tag="CTY05_00327"
FT   CDS_pept        351615..356096
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gltB"
FT                   /locus_tag="ABBFA_00327"
FT                   /old_locus_tag="CTY05_00327"
FT                   /product="Glutamate synthase [NADPH] large chain precursor"
FT                   /EC_number="1.4.1.13"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:P09831"
FT                   /protein_id="ATY42793.1"
FT                   /translation="MHMPSPNTVAPAQGLYQPDEFKDNCGFGLIAHMKGESSHHLVETA
FT                   IHSLSCMTHRGGIAADGKTGDGCGLLLAMPKQFFRDEAKKLSDITLSEIFAVGTVFLNI
FT                   DPALAQHSKNILTKEIESEGLRVLAWRIVPTNNDALGEIALQSLPAFEQVIVNCPMGVT
FT                   EVEFNRKLFLARRRAEQQLQNDPLFYVTTLCSTVISYKGLMMPAAIAEFYTDLADERLK
FT                   SHIVVFHQRFSTNTLPRWPLAQPFRYLAHNGEINTITANRNWALARTPKFENPLLPGLT
FT                   ELNPIVNRTGSDSSSLDNMLEILVGGGMDLFRALRMLVPPAWQNVETLDADLRAFYEFN
FT                   SKHMEAWDGPAGLVIQDGRHAICMLDRNGLRPARWVITKNDYITLASEIGVWGYEPEDV
FT                   VSKGRVGPGQILVVDTLTGKVLDTKDVSNHLKNMRPYREWLRDHAIRLNANPELEEQLV
FT                   DKGLTGDALKAAQKMFMVTFEERDQLLRPIAESGQEAVGSMGDDTPMAVLSRQVRHVTD
FT                   YFRQQFAQVTNPPIDPLRESIVMSLETCLGREQNVFEQGPEHADRIIISSPVLSNSKMQ
FT                   QIRSIERAGYEAVDIDLNYAETEGLQAAITRICEESAQAVRDGKTLIVLTDKNIRQGYL
FT                   PANAALATGAVHHHLIKTGLRTDANIMVETGFARDPHQFAVLLGFGATAIYPYLAYDVI
FT                   NDLIAKGELLGDPIHAQANFRKGIEKGLLKVLSKMGISTVASYRGGQLFEAVGLSSEVV
FT                   DQCFLGVPSRIQGATFVDLENDQKKLAVTAWSNRKPIDQGGLLKFVFGKEYHAFNPDVI
FT                   NSLHKAVRSGKYEDFKEYAELVNNRPIATIRDLFKLKTTNPIPVEQVESVEAILPRFDS
FT                   AGMSLGALSPEAHEAIAIAMNTIGGRSNSGEGGEDPARYGTIRNSKIKQIASGRFGVTP
FT                   AYLTSAEVLQIKVAQGAKPGEGGQLPGGKVNGLIARLRYSVPGVTLISPPPHHDIYSIE
FT                   DLSQLIFDLKQVNPKAMVSVKLVSEPGVGTIAAGVAKAYADFITISGYDGGTAASPLSS
FT                   IHHAGSPWELGLSEAHQALRVNDLRGKVRVQTDGGLKTGLDVIKAAILGAESFGFGSTP
FT                   MIALGCKYLRICHLNNCATGVATQQDHLRQEHYIGEPQMLINFFHFIAEETREWLAALG
FT                   VASLKDLIGRVDLLEVLPGETEKHAHLDLSALLTSHPAAEGKAQYCEVEGNAPFDKGVL
FT                   AERMVEEMLPAIESSAGGQFNFNVVNCDRSIGARVSGEIARRYGNLGMEAHPVVMNLTG
FT                   TAGQSLGVWNAGGLHIRLEGDANDYVGKGMAGGRISIFPPKGSPFQTQNTAIIGNTCLY
FT                   GATGGKLFAAGTAGERFAVRNSGAFAVIEGAGDHCCEYMTGGVVTVLGKVGHNFGAGMT
FT                   GGFAYVLDLDNDFVDYYNHELIDLTRISTESMEDHKEFLLRIIDEHIKETGSAWAYKIR
FT                   NEFDFYSRKFWLVKPKAANLQSLLKTTQADPQ"
FT   gene            356166..357587
FT                   /gene="gltD"
FT                   /locus_tag="ABBFA_00328"
FT                   /old_locus_tag="CTY05_00328"
FT   CDS_pept        356166..357587
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gltD"
FT                   /locus_tag="ABBFA_00328"
FT                   /old_locus_tag="CTY05_00328"
FT                   /product="Glutamate synthase [NADPH] small chain"
FT                   /EC_number="1.4.1.13"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:P09832"
FT                   /protein_id="ATY42794.1"
FT                   /translation="MAERLNNDFQFLDVPRQDPEKKDITVRKAEFVEIYKPFTSETVTN
FT                   QTHRCLGCGNPYCEWKCPVHNYIPNWLKLIAEGQIFQAAELCHQTNTLPEVCGRVCPQD
FT                   RLCEGACTLNDGFGAVTIGNAEKYINDTAFALGWRPDMSHVKWTGKKVAIIGAGPAGLG
FT                   CADILARGGVKPVVFDKRPEIGGLLTFGIPEFKMEKDVMKRRREIFTGMGIEFRLNTEI
FT                   GKDVTIDELLAEYDAVFMGMGTYTYMKGGFPGEDLDGVYDALDFLISNVNRCQGWEKDP
FT                   SEYISMDGKKVIVLGGGDTAMDCNRTSLRQGAHDVTCAYRRDESNMPGSAREVKNAYEE
FT                   GVKFLFNRQPIEIVGENGKVTGVKVVTTQMGEPDSRGRRSPEPIPGSEEVLPADAVLLA
FT                   FGFRPSPADWFGSVNINLDGSGRVVAPEQQEFKFQTSNPKIFAGGDMVRGSDLVVTAIW
FT                   EGRQAAEGILDYLGV"
FT   gene            357763..358650
FT                   /locus_tag="ABBFA_00329"
FT                   /old_locus_tag="CTY05_00329"
FT   CDS_pept        357763..358650
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABBFA_00329"
FT                   /old_locus_tag="CTY05_00329"
FT                   /product="putative metal-dependent hydrolase"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="protein motif:Pfam:PF10118.3"
FT                   /protein_id="ATY42795.1"
FT                   /translation="MNIAGMTAEKSYLNRRKALGITVRRLEFNPQAIKRYYFANSPLMS
FT                   HFLTALSSTFPVGEQFFVNSVRNVRDKVSDPQLQAQIAAFIGQEAMHSKAHGEFNEAWR
FT                   RDDYNLDRFQNWLNERDKYLRTISPKLQLALTCAFEHFTALLGGYILQHPELLKTLDQD
FT                   ALKLWVWHAIEEIEHRSVAFDVYQQVYGDDRIRRLLMRSVTTGFASLAFYGTTRLFWQD
FT                   KWKSLPKIGGNLFGLYLLAKMLIQLTPEYFAYYKKDFHPSQKDYGHMVDYWKSYLADEY
FT                   QMTSFQEEKNPRPS"
FT   gene            358781..359371
FT                   /locus_tag="ABBFA_00330"
FT                   /old_locus_tag="CTY05_00330"
FT   CDS_pept        358781..359371
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABBFA_00330"
FT                   /old_locus_tag="CTY05_00330"
FT                   /product="LemA family protein"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="protein motif:Pfam:PF04011.6"
FT                   /protein_id="ATY42796.1"
FT                   /translation="MKTFKQLAIATTLASTLLFSGCGYNTLQVKDEAVTAAWSEVQNQY
FT                   QRRADLVPNLVNVVKGYAKHEEQVLTEVTQARANVAGLKVDKEVLEDPALLEKYQQAQS
FT                   QLTGALSRLIAVSENYPDLKANTQFQELQVQLEGTENRIAVARNRYITTVQDYNAYVRQ
FT                   FPQAVTAKVIGMHPKANFSAEASAQQAPKVSFD"
FT   gene            359393..360475
FT                   /locus_tag="ABBFA_00331"
FT                   /old_locus_tag="CTY05_00331"
FT   CDS_pept        359393..360475
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABBFA_00331"
FT                   /old_locus_tag="CTY05_00331"
FT                   /product="hypothetical protein"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /protein_id="ATY42797.1"
FT                   /translation="MRNTILLQSKQIRVFVITLIVLCCGVLFQNAAWSENNIATATDET
FT                   DTVVAGKIIQQQQAQASKPQINSQAASSVTPQTQVANDMADGESIRGLPTLNQPVIDQA
FT                   NVLSETEKQQLSQKILNLYQQGKAQIGIVIVPTTGQEDIFDYALRVGEKWQLGSSKRDN
FT                   GLLIAVAINDHRIQILTGYGLEGVLPDIVASRIIRNQITPYFKQAQYAQGLNAGLDEIG
FT                   RILNLDPEVAQQAAQDLKERQHQAAEEQQAKQTTLTMALFILVAGVVGSFIVGRPLSAS
FT                   TAGVAAAVAGFVNGAGVVMSLLLGFGIFFLLITSIAQLILQAILSGAGGGGRGGGFGGG
FT                   GGGYGGGGGRFGGGGASGSW"
FT   gene            360469..361029
FT                   /locus_tag="ABBFA_00332"
FT                   /old_locus_tag="CTY05_00332"
FT   CDS_pept        360469..361029
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABBFA_00332"
FT                   /old_locus_tag="CTY05_00332"
FT                   /product="hypothetical protein"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /protein_id="ATY42798.1"
FT                   /translation="MVTTSETTQIITQPKIEESVEPSLKRWFKHFCYLPASSRYFSKQD
FT                   KQAIAEAVQQAEHGHVGEIQVVIEGHIPCSQAYRQNTRLRAQQLFAELGVWDTELNSGV
FT                   LLYLNLCERTVEIIFDRGIRNATTEQIWQQICKSIVEQLQQKQYQKAVVTGVQQIGEVM
FT                   SRFYDENMPDQLNELGNAPIIIN"
FT   gene            361375..361848
FT                   /gene="fimA"
FT                   /locus_tag="ABBFA_00333"
FT                   /old_locus_tag="CTY05_00333"
FT   CDS_pept        361375..361848
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fimA"
FT                   /locus_tag="ABBFA_00333"
FT                   /old_locus_tag="CTY05_00333"
FT                   /product="Fimbrial protein precursor"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:P04953"
FT                   /protein_id="ATY42799.1"
FT                   /translation="MNAQKGFTLIELMIVVAIIGILAAIAIPQYQTYIAKSQVSRAVSE
FT                   SGSLKTVIEDCLNNGKTTVGEAAGECAIGATGSNILDGAAQSGETLAAGTGVPQVTLAN
FT                   TGAATIVATFGNSASTALKSTPTTVTWTRTTDGTWTCESTAAEKYNSSACPAA"
FT   gene            362093..363721
FT                   /locus_tag="ABBFA_00334"
FT                   /old_locus_tag="CTY05_00334"
FT   CDS_pept        362093..363721
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABBFA_00334"
FT                   /old_locus_tag="CTY05_00334"
FT                   /product="O-Antigen ligase"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="protein motif:Pfam:PF04932.9"
FT                   /protein_id="ATY42800.1"
FT                   /translation="MQVFFLFLAAILLGFAWLSPFHYNPWVMFSSEMSTFAAGLSVLAV
FT                   LFYQNIKIPRAQLLLLPFTLIPVVQWAFGLVFDFSTALLSSLYLLGFWFMVLAGYNLSL
FT                   DQKKRDQIFSGFSLLIIITSLFTSLIAIFQWLNIESHLIYTLHLIGNRPYGNFGQPNNM
FT                   ATFLIIGLLGCLYLYEKHKVTLWLLLPSALIILFTIALSQSRTSWIVFPFLLIYWMVKQ
FT                   FGKQKRFRFVQGLLWCLAFFLIAGLILPYITQFIEFSTNTEITETSSFVARAGSGHERI
FT                   GMWIQILHAIAQQPWLGYGWSQTSVAVVDSIQYGTVHVWFNSAHNVLLDIIIWNGIPIG
FT                   IVIIAYFACWFVWLNQQAKETISIIAIMMVCTVLIHAMLEFPQRYAYFLLTCGFLLGII
FT                   QAQTPVLKGIVLNKQVLRLIWGISVILLVAIWRDYNVYVTNSNLLFKNKQPNAEILGSN
FT                   QIFILTQFEQRLKWIEMKPETTLSDADLAVWGNFVKNKATPYNLRKYAQLLAYNGKVEQ
FT                   AEQQIFILQHLYRQQITLAELLKNK"
FT   gene            complement(363764..364228)
FT                   /gene="bfr_1"
FT                   /locus_tag="ABBFA_00335"
FT                   /old_locus_tag="CTY05_00335"
FT   CDS_pept        complement(363764..364228)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bfr_1"
FT                   /locus_tag="ABBFA_00335"
FT                   /old_locus_tag="CTY05_00335"
FT                   /product="Bacterioferritin"
FT                   /EC_number="1.16.3.1"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:P22759"
FT                   /protein_id="ATY42801.1"
FT                   /translation="MKGNRDVINQLNQVLYHHLTAINQYFLHSRMFNDWGIEQLGSAEY
FT                   KESIRQMKHADKIIERILFLEGLPNLQHLGKLYIGQHTEEVLQCDIRKVKENIEAIQKA
FT                   VALAETEQDYVTRDLVQEILEKEEEYWDWLDTQIDLIGSVGIENYIQSQM"
FT   gene            complement(364473..364667)
FT                   /gene="bfd"
FT                   /locus_tag="ABBFA_00336"
FT                   /old_locus_tag="CTY05_00336"
FT   CDS_pept        complement(364473..364667)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bfd"
FT                   /locus_tag="ABBFA_00336"
FT                   /old_locus_tag="CTY05_00336"
FT                   /product="Bacterioferritin-associated ferredoxin"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:P0AE56"
FT                   /protein_id="ATY42802.1"
FT                   /translation="MYVCLCRGITDQDIKDAIENGAESYREIRDLLDLGTCCGRCAPEA
FT                   RAIISEELAEIAARISVAA"
FT   gene            complement(364877..365260)
FT                   /gene="yabJ"
FT                   /locus_tag="ABBFA_00337"
FT                   /old_locus_tag="CTY05_00337"
FT   CDS_pept        complement(364877..365260)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yabJ"
FT                   /locus_tag="ABBFA_00337"
FT                   /old_locus_tag="CTY05_00337"
FT                   /product="Enamine/imine deaminase"
FT                   /EC_number="3.5.4.-"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:P37552"
FT                   /protein_id="ATY42803.1"
FT                   /translation="MSRQVIHTENAPAAIGTYSQAILVGNTLYLSGQIGLDPYSMELVD
FT                   GIEAQIRRVFDNLKAVCEAAGGTLADIAKLNIFLTDLSNFQLVNQIMGEYFAQPYPARA
FT                   ALGVASLPKGALVEMDGIVIINQ"
FT   gene            complement(365381..367486)
FT                   /gene="spoT_1"
FT                   /locus_tag="ABBFA_00338"
FT                   /old_locus_tag="CTY05_00338"
FT   CDS_pept        complement(365381..367486)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="spoT_1"
FT                   /locus_tag="ABBFA_00338"
FT                   /old_locus_tag="CTY05_00338"
FT                   /product="Bifunctional (p)ppGpp synthase/hydrolase SpoT"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:P0AG24"
FT                   /protein_id="ATY42804.1"
FT                   /translation="MPGEEVSQAKQQLKLIIDPYLSVSEVEKVLAACDFGDLAHTGITR
FT                   KSGEPYILHPIAVSCILANMRLDPETLMAALLHDVIEDTQYTKDDIIERFGQTVAELVD
FT                   GVTKLSQSSDKEYNKAASFRKILQATLQDPRVIIIKLADRYHNMTTLGALRPDKRARIA
FT                   QETFDIFVPMARLVGMNEMADNLENLCYQNLDLDMFDNVQNALLQTKPERCKYQSIWEQ
FT                   NLAELLHNYHIQGRIKKKNNNIELLRHFVKNEMDLQELTHSHAFEIVLQSIADCDRLVA
FT                   ALKENFQVIQYQDHIRRPLPGGNQSLMIKLKGEKTTLSLTIQTELMRKAARFGVVLGEN
FT                   APQTCRSAIQASMQNLNTLIDGECAKTTFNDLLDYLHQEKIWVYTPHGQLHELPQGATV
FT                   VDFAYSASLFLGNHAVGAKVDGEIKPLSTPLVSGQVIEIITDVLATPNPDWLSFINTQK
FT                   ARRALQHVLKDQDIEEQRLVGAQALSRALKLFNRSINDLSDADWLDLLQWRHIDNKDAL
FT                   FEQIAVGDLLPQLVANHLFANDKHPRAENSDRLIQGTEGIDVKYAHCCNPILGDPIQGH
FT                   LTRRGLIVHRIRCHNLLHEQHLHPENIMPLQWKADDVDDVRFTAYLAIYMAMNDEQVSD
FT                   LIYQCRKNNAGVEMVHSNEQRTFVNIVVNNRKHIAKVIRDLRMHYGFPRIERLDAPAPQ
FT                   MEISKVS"
FT   gene            complement(367695..367973)
FT                   /gene="rpoZ"
FT                   /locus_tag="ABBFA_00339"
FT                   /old_locus_tag="CTY05_00339"
FT   CDS_pept        complement(367695..367973)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoZ"
FT                   /locus_tag="ABBFA_00339"
FT                   /old_locus_tag="CTY05_00339"
FT                   /product="DNA-directed RNA polymerase subunit omega"
FT                   /EC_number="2.7.7.6"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:B9JUN3"
FT                   /protein_id="ATY42805.1"
FT                   /translation="MARVTVEDCLDHVDNRFELVLVASKRARQLARQGMEPTVEWDNDK
FT                   PTVVALREIAVGHVTKEILKQREQDYQTSSLDLALSTNSLNLEGFSF"
FT   gene            complement(368046..368675)
FT                   /gene="gmk"
FT                   /locus_tag="ABBFA_00340"
FT                   /old_locus_tag="CTY05_00340"
FT   CDS_pept        complement(368046..368675)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gmk"
FT                   /locus_tag="ABBFA_00340"
FT                   /old_locus_tag="CTY05_00340"
FT                   /product="Guanylate kinase"
FT                   /EC_number="2.7.4.8"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:P60546"
FT                   /protein_id="ATY42806.1"
FT                   /translation="MSGLLFVVSAASGTGKTSLVKALLDRVSNLHVSVSHTTRGQRPGE
FT                   LDGVHYHFTTKDEFLDQVNQGGFIEYAEVFGNYYGTSQATVKQQLAQGHDVLLEIDWQG
FT                   AEQVRKLFPESKQIFILPPTQFDLRQRLSNRGTDSVEVIEHRLSCAVEDMQHYVNFDYI
FT                   IINDDFNKALHELEAVITANRLVLSQQAKRHQNLIQDLITPQPKQE"
FT   gene            368798..369748
FT                   /gene="ispH"
FT                   /locus_tag="ABBFA_00341"
FT                   /old_locus_tag="CTY05_00341"
FT   CDS_pept        368798..369748
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ispH"
FT                   /locus_tag="ABBFA_00341"
FT                   /old_locus_tag="CTY05_00341"
FT                   /product="4-hydroxy-3-methylbut-2-enyl diphosphate
FT                   reductase"
FT                   /EC_number="1.17.7.4"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:P62623"
FT                   /protein_id="ATY42807.1"
FT                   /translation="MEIVLANPRGFCAGVDRAIAIVNRALECFNPPIYVRHEVVHNKFV
FT                   VDDLRQRGAVFVDELDQVPDDSIVIFSAHGVSKAVQQEAERRGLKVFDATCPLVTKVHI
FT                   EVTKYAREGTEAILIGHEGHPEVEGTMGQYDKLKGGDIYLVEDEADVAALEVRHPEKLA
FT                   FVTQTTLSIDDTAKVIDALRAKFPNIQGPRKDDICYATQNRQDAVRDLAEKCDVVLVVG
FT                   SPNSSNSNRLRELAERMGKAAYLVDNADQLEQSWFNDTCKIGVTAGASAPEILIKQVIQ
FT                   RLQDWGAQAPKELEGREENITFSLPKELRIHVTQA"
FT   gene            369918..370391
FT                   /locus_tag="ABBFA_00342"
FT                   /old_locus_tag="CTY05_00342"
FT   CDS_pept        369918..370391
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABBFA_00342"
FT                   /old_locus_tag="CTY05_00342"
FT                   /product="putative major pilin subunit"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="protein motif:CLUSTERS:PRK10574"
FT                   /protein_id="ATY42808.1"
FT                   /translation="MRGIIPQEGFTLVELMVTIAVMAIIALMAAPSMSNLLESKRLDAN
FT                   QRDLINTLSEAKSQAILGRQNVSVNLNSTASNTPTSLNWQTASNNTLELKNIAADGTQS
FT                   SLTTSTLAFNANGVVANITQDTLLSICNFRINKKKVIILTKLGTLVFKAEETC"
FT   gene            370391..370945
FT                   /locus_tag="ABBFA_00343"
FT                   /old_locus_tag="CTY05_00343"
FT   CDS_pept        370391..370945
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABBFA_00343"
FT                   /old_locus_tag="CTY05_00343"
FT                   /product="hypothetical protein"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /protein_id="ATY42809.1"
FT                   /translation="MHHYKQKAQAGVGLLEVLVALILLAIGVLGYVALQLRAMDASSEA
FT                   LSKSQAILVMRGLAENIRTNSTQASQYPTFVRSYSNYTSDTPAPTSCFNSLCTASQLAQ
FT                   FDAYQAARNANQLGMRITMSNCPGVTNTMVQQRQCLFVFWGKTAPVITTNGTNTSVDVS
FT                   SCMSNNGVYVNNSTCLMMEAY"
FT   gene            370946..371947
FT                   /locus_tag="ABBFA_00344"
FT                   /old_locus_tag="CTY05_00344"
FT   CDS_pept        370946..371947
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABBFA_00344"
FT                   /old_locus_tag="CTY05_00344"
FT                   /product="hypothetical protein"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /protein_id="ATY42810.1"
FT                   /translation="MAQSFISNKEQGFTLIELIVALALGLILVAAATQLFIGGLLSSRL
FT                   QKANAEIQDSGIFGLEYMARDIRLLNYGNVVNPQLTDTTPWGGIVLTGSTATNANNINF
FT                   IPKVDTNTYIPEALLSRGAGDTVSTVNNHWKGLSNIQNSSNAEVQSDQLTIQFIAPTNM
FT                   TNCEGVNVLAGDLIVQRYFLRVDNNGSSQQDYALACDANTPAVSATAQPDIVNGLGDAG
FT                   QIILPRIDHFHVLLGAKNAAGNFAYYTIPQYRVAAQAARDASPAVAAPRILSIQISVLA
FT                   RSTNNAQNKAIDPNQSFLMLDQNVHAADNRTRFLRRVYSVTIALRNAMGETI"
FT   gene            371944..372762
FT                   /locus_tag="ABBFA_00345"
FT                   /old_locus_tag="CTY05_00345"
FT   CDS_pept        371944..372762
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABBFA_00345"
FT                   /old_locus_tag="CTY05_00345"
FT                   /product="hypothetical protein"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /protein_id="ATY42811.1"
FT                   /translation="MTHLNYKNIKGRSKETGATLIVVLIILLIVISVGVLAIRVAIVSL
FT                   KVATNSQVGQLNFQSSDTPLELIVQMNPTTLTNITNVIGAALKAHESNPGAEYNFCYKP
FT                   TSTSVSFAQTRGASLLRAGSANNAVVEDGGVAGFCDLTSDYGSNRQAVVTQVAVSIPTD
FT                   AMADIPGSNLPRDINLSEGTQLPKSMLSTQRIRVITTAFLPAYASTSLETLQSDCLSTS
FT                   SAKISDNFDSALTDKQTLADCLANHNVPFSTQVQEFNYTNKLTEITAPGS"
FT   gene            372762..376628
FT                   /locus_tag="ABBFA_00346"
FT                   /old_locus_tag="CTY05_00346"
FT   CDS_pept        372762..376628
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABBFA_00346"
FT                   /old_locus_tag="CTY05_00346"
FT                   /product="hypothetical protein"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /protein_id="ATY42812.1"
FT                   /translation="MGNIMKLKLKNFKPNNLWYAVCSSSMIFTWLMTSSVVQASDLQIY
FT                   ASPTAGKKTIVMMLDTSGSMTNNSYGENRLAMLKNGMNAFLASNNPVLNDTRVGLGNFS
FT                   ANGDSRSGQILVAAAPLGDASTLNTVGSQRYKLKQAVANLTAGGSTPSAHAYAEAAAYL
FT                   MGTTTYSETNYAIRKDSYIKRVRRSDNRTEYSYCTNYRDSQIDTANLWQPCRSNSYWSS
FT                   WSTNNPGVDNATAYDTSSDWTYYYTYYYTTFNYAVANADSGIPKSKSNDTASNPNIVVD
FT                   RNATNSNAVYQSPLPAVANRQSCDGQGIYFLSDGEPNNTTNTRSASVMSTALGSTFGAD
FT                   FNCSGGLSNTTADSGWACMGEFAKRLFDKTKNPAGVSIQTAFVGFGSDFSSLNSSDVKN
FT                   ACRLSSRTQSDRKGDDACSPNQSTNAVAAPGYGNGGFFPTQSSQGVTDSVIAFINNLDK
FT                   VPLEPLTTGAISVPYDALNPKNLQEYGYLRAFEPNPANTYLTWRGNLKKYHVVLSGANA
FT                   GAFEANSGGLVYNASGAFRTGTKDYWNSSTYTDGGKVFLGGSYANVPLPIAGQPETRDA
FT                   EGNITKYYYAVQSKIRNLFTDVSAVAADGSLTKISTSGTNLLKIPAAPPEETNPFDTVA
FT                   NTASYVLGKFDPSTGQNILKAFPISLKLKILNYLGYSTDINATTLPSSLVTSNEPYLSM
FT                   GGSIHSLPVQLTYNGTLDDNGNLTSAREQSILYGTMEGGLHIVDASSGIEQMVFVPADI
FT                   LNDSVASKALVVGQSDASAPAHGMDGAWVSDPAYNITTVGSGSSAVSKVTAKQMNIYGG
FT                   MRMGGSSYYGLDVLSPTSPKLLFRIGADQNDYSRMGQSWSKPVLANIRYNGSIRRVLIV
FT                   GGGYDQCYEKPNITLTDACFTNGKAKGNAVYIIDAKTGQRLWWTSDTGSNTDNANMKHS
FT                   IVSRISTLDRDADGLVDHLYFGDLGGQIFRVDLNNNQTKTNSTYSSFGVRVVRLANLAT
FT                   NDSTYDGTNDYTGGNAPRFYEPPTVTIHDYGIHTFITVGIASGDRSTPLDVYPLTGREG
FT                   MTPASALSGRPVNNVYGIIDRDFVKKNLMSLTDNQLETKDITRTGLRKNPQILRTGETR
FT                   VAQIFFPTTGVGKGGWYRSLSSTSDGTEKANNSFRIKGGLKAFEEPMAITGNLIILVYD
FT                   PQGTGIVAADPCLPRVVGETDRQTYCLPFGACLNSDGSIDQNKENHSGFETQTGTNCPV
FT                   GASECNKNVIGSGIRSVTFVPTEDNPPTTNSCGKLKLSGNEQGTGQWQCTSHLVPTRWY
FT                   ERYR"
FT   gene            376639..377121
FT                   /gene="xcpT_1"
FT                   /locus_tag="ABBFA_00347"
FT                   /old_locus_tag="CTY05_00347"
FT   CDS_pept        376639..377121
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="xcpT_1"
FT                   /locus_tag="ABBFA_00347"
FT                   /old_locus_tag="CTY05_00347"
FT                   /product="Type II secretion system protein G precursor"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:Q00514"
FT                   /protein_id="ATY42813.1"
FT                   /translation="MNKYYILRFNQGFTLIELMVVIVIVAIFASIAIPSYQSYSRRATA
FT                   SAAKSEILKLAEQLEQHKSRNFTYRGFTTTSITLPRGGYTIQITDDTTTGNLLTNAAAN
FT                   GQTWVIKATTTDSRNFNFIAKNSGIRCQSLTVTAVDNDCGGTTTCNTCETNSEVWQ"
FT   gene            377118..377543
FT                   /gene="pulG_1"
FT                   /locus_tag="ABBFA_00348"
FT                   /old_locus_tag="CTY05_00348"
FT   CDS_pept        377118..377543
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pulG_1"
FT                   /locus_tag="ABBFA_00348"
FT                   /old_locus_tag="CTY05_00348"
FT                   /product="Type II secretion system protein G precursor"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:P15746"
FT                   /protein_id="ATY42814.1"
FT                   /translation="MKNGFSLIEIMVVVAIVAILAAIATPSYLQYLRKGHRTAVQSEMM
FT                   NIAQTLESQKIVNNRYPSDATIQSIYGSNVSPIQGQALYKLAFATLNDSTWVLTAIPIS
FT                   TSSQAGDGIICLNDQGQKFWAKGATVCALSASSSWTE"
FT   gene            377690..377941
FT                   /gene="rpsP"
FT                   /locus_tag="ABBFA_00349"
FT                   /old_locus_tag="CTY05_00349"
FT   CDS_pept        377690..377941
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsP"
FT                   /locus_tag="ABBFA_00349"
FT                   /old_locus_tag="CTY05_00349"
FT                   /product="30S ribosomal protein S16"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:P0A7T3"
FT                   /protein_id="ATY42815.1"
FT                   /translation="MVVIRLARGGAKKRPFYQIVVTDSRNARDGRFIERIGFFNPTAQG
FT                   QAEKLRLDADRFAHWVSQGAQPSERVASLAAQAKKATA"
FT   gene            377961..378509
FT                   /gene="rimM"
FT                   /locus_tag="ABBFA_00350"
FT                   /old_locus_tag="CTY05_00350"
FT   CDS_pept        377961..378509
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rimM"
FT                   /locus_tag="ABBFA_00350"
FT                   /old_locus_tag="CTY05_00350"
FT                   /product="Ribosome maturation factor RimM"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:Q6F7I0"
FT                   /protein_id="ATY42816.1"
FT                   /translation="MTPTQNVPEDRIQIGQLRSAYGLNGWLWVYSNTEPMSNMFDYLPW
FT                   YIETKAGWQIVDVKRWKPHGKGLVVALKGVSDRTGAESLVGANIWIAKSQLPKADVDEY
FT                   YWSDLKGLTVLGLDDDEQEVNLGQIHELFETGANDVMVVRATPDSIDSEERMIPWHKDV
FT                   VQRVDLEAGRIYVNWGVDY"
FT   gene            378555..379295
FT                   /gene="trmD"
FT                   /locus_tag="ABBFA_00351"
FT                   /old_locus_tag="CTY05_00351"
FT   CDS_pept        378555..379295
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trmD"
FT                   /locus_tag="ABBFA_00351"
FT                   /old_locus_tag="CTY05_00351"
FT                   /product="tRNA (guanine-N(1)-)-methyltransferase"
FT                   /EC_number="2.1.1.228"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:P43912"
FT                   /protein_id="ATY42817.1"
FT                   /translation="MFFAVITLFPEMFDAITAYGISGRAAKRDIVQVTCINPRDFAEGN
FT                   YRRVDERPFGGGPGMVMMAEPLAKAINHAKQLASRAGCVHVPVVYMSPQGKTLNEQAVQ
FT                   QFVDYDGLIVLCGRYEGVDERLIQHYVDQEWSIGDYVLSGGELPAMVLLDSIIRRLPNV
FT                   MSDEQSAIQDSFVDGLLDCPQYTKPDQFEGLDVPEILKSGHHANIEKWRFLQRYQRTLE
FT                   RRPELIEQVTLTKQQKKWLSDEQG"
FT   gene            379503..379871
FT                   /gene="rplS"
FT                   /locus_tag="ABBFA_00352"
FT                   /old_locus_tag="CTY05_00352"
FT   CDS_pept        379503..379871
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplS"
FT                   /locus_tag="ABBFA_00352"
FT                   /old_locus_tag="CTY05_00352"
FT                   /product="50S ribosomal protein L19"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:Q9K0K5"
FT                   /protein_id="ATY42818.1"
FT                   /translation="MSGKHPLVQAIENSQLKTDLPEFAPGDTVVVQVKVKEGDRERLQA
FT                   FEGVVIAKKNRGLNSAFTVRKISSGVGVERVFQTHSPVVAKIEVKRRGDVRRAKLYYLR
FT                   DLSGKAARIREKLPARKA"
FT   gene            complement(379923..380897)
FT                   /gene="lip"
FT                   /locus_tag="ABBFA_00353"
FT                   /old_locus_tag="CTY05_00353"
FT   CDS_pept        complement(379923..380897)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lip"
FT                   /locus_tag="ABBFA_00353"
FT                   /old_locus_tag="CTY05_00353"
FT                   /product="Lactonizing lipase precursor"
FT                   /EC_number="3.1.1.3"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:P26876"
FT                   /protein_id="ATY42819.1"
FT                   /translation="MKRNLIFFCAAILSGLSVSATHATNAEQVKSSFVYSTYAQTKYPL
FT                   VFNHGMAGFNRVGTDTLGLDYWYQILPDLARNGGNVWATRVSPFNSTEVRGEQLAQQVE
FT                   EIIAITGKPKVNLIGHSHGGPTIRYVAGIMPEKVASLTTIGAPHKGSPMADVILNVEGT
FT                   PLSGLATLVNWFSAAITWAGGLDPNSYPHDSLAGAHSLSTQGSAQFNSQFPMGVPTTSC
FT                   GEGAYQEKGIYMYSFSGNKALTNPLDPFDIALTGSSLVVDPFGDNDGLVSRCSAKFGKT
FT                   IRDDYNWNHLDEVNQVMGIRSIFAADPVSVYRQHANRLKLQGL"
FT   gene            complement(380979..382010)
FT                   /gene="lifO"
FT                   /locus_tag="ABBFA_00354"
FT                   /old_locus_tag="CTY05_00354"
FT   CDS_pept        complement(380979..382010)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lifO"
FT                   /locus_tag="ABBFA_00354"
FT                   /old_locus_tag="CTY05_00354"
FT                   /product="Lipase chaperone"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:Q05490"
FT                   /protein_id="ATY42820.1"
FT                   /translation="MQRMQKKIWWCVLGFFILSLIACVYWLSPNSENTSPQPNQDEARL
FT                   VATSQSTLNSPLNENTYLSKSQQDTQVNCQLKINSSQHLVVNSQTRDCFEYFITQYGES
FT                   NLQQVKTHFEKFIQDQYLEPARSQIIDLWTRYLKYREQLAQIQPPQSKQQDQNYFQKIF
FT                   SSIQDIRKRFFSASEIEGLFSTEDIYQNYTLDRMKILEDSSLSEIEKAKKLKERFEQLP
FT                   EDWQENLQELSKLDDLHTLTKQIKARNGSAEELRQMRTALVGAEATQRLETLDIQRNAW
FT                   QQRVTGYLNQRDEVLHSNMSDSAKKQAIQQLRQQQFSSSQEQLRLRTFETVHDQGGELP
FT                   FNY"
FT   gene            382164..383069
FT                   /gene="truB"
FT                   /locus_tag="ABBFA_00355"
FT                   /old_locus_tag="CTY05_00355"
FT   CDS_pept        382164..383069
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="truB"
FT                   /locus_tag="ABBFA_00355"
FT                   /old_locus_tag="CTY05_00355"
FT                   /product="tRNA pseudouridine synthase B"
FT                   /EC_number="5.4.99.25"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:P60340"
FT                   /protein_id="ATY42821.1"
FT                   /translation="MTTKNQKISRRHISGVFLLNKPLGLSSNAALQKVRWLYRAQKAGH
FT                   TGALDPLATGLLPICLGEATKFSHYLLDSTKRYQTTVRLGQTTTTGDVEGDILQERPIP
FT                   VLSKELIEQTLEKFRGDIQQVPPMYSALKKEGKPLYELARKGIEIEREARPVTIYALEL
FT                   IEFTENSITLDVTCSKGTYIRVLGEDIGEALGCGGHLTMLHRIQTGHFELIPSYTIEYL
FT                   ESLTEEQREALLLPVYAPIDHFLKIQVPEGREKYFCNGLESNIDHSAEAEVLVFSGERC
FT                   LGLAEITDKKRLVPKRILNL"
FT   gene            383089..383865
FT                   /locus_tag="ABBFA_00356"
FT                   /old_locus_tag="CTY05_00356"
FT   CDS_pept        383089..383865
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABBFA_00356"
FT                   /old_locus_tag="CTY05_00356"
FT                   /product="hypothetical protein"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="protein motif:CLUSTERS:PRK10621"
FT                   /protein_id="ATY42822.1"
FT                   /translation="MGMEWDVILSLIFFAFTAGAIDAAVGGGGLIQIPGIMSTFPNMST
FT                   ATVIGTNKVSSIFGTASAAYTFAKKVKLQWKLLAVIAICALISSFAGAACLSLIPQSVL
FT                   RPFVFVMLIVIAIYTLVKKNFGQVHTEQKITTKMLVLAGIGSLAIGFYDGIFGPGTGSF
FT                   FIFFFIRFLQVDFLHASALSKIGNFMTNLAALSFLIPTGHAILHIGLMMAAANVLGSIV
FT                   GVRTALKYGSGFVRIIFLILVSILICRLGYQMFVTG"
FT   gene            384075..384518
FT                   /locus_tag="ABBFA_00357"
FT                   /old_locus_tag="CTY05_00357"
FT   CDS_pept        384075..384518
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABBFA_00357"
FT                   /old_locus_tag="CTY05_00357"
FT                   /product="DNA nickase"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:Q8YS92"
FT                   /protein_id="ATY42823.1"
FT                   /translation="MNIFEALRESHENQRNLSEQLIQTHGLTEERKELFDALKNELYAH
FT                   SVAEDRYLYIPLMFDDVGLDITRHALSEHHEMDELVEQLEKTDMSSPSWLATAKQLSEK
FT                   VHHHLKEEEHKFFQQAGKILKDSEKETLGNKYLKEYKKYKKQQ"
FT   gene            complement(384526..385386)
FT                   /gene="rhtA_1"
FT                   /locus_tag="ABBFA_00358"
FT                   /old_locus_tag="CTY05_00358"
FT   CDS_pept        complement(384526..385386)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rhtA_1"
FT                   /locus_tag="ABBFA_00358"
FT                   /old_locus_tag="CTY05_00358"
FT                   /product="Threonine/homoserine exporter RhtA"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:P0AA67"
FT                   /protein_id="ATY42824.1"
FT                   /translation="MQNLPIIAVLYMILSMVSYQISASFAKQLIAALDPLTVTILRLCF
FT                   AAVIVAVMFRSWKIWSRLPYLKWRDLLMYCASLGLMNILFYTSLGKLPQGIAVGLEFIG
FT                   PLGLALVSIKQKSEYIWVAFAMLGIALMVPWQDPTQHHFSYVGAACALGAGLCWAFYIY
FT                   FGQKVVTQNIGMHALTIGITVSALTLLPIGIWYNGPALLDTQYWGKALLIAVLATAIPY
FT                   ALDLMALKQLNKLTYGTLTSLAPALAALTGFLLLHEEISMLQWVALACVMLASIGVTLR
FT                   SKTAS"
FT   gene            complement(385477..386361)
FT                   /gene="rhtA_2"
FT                   /locus_tag="ABBFA_00359"
FT                   /old_locus_tag="CTY05_00359"
FT   CDS_pept        complement(385477..386361)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rhtA_2"
FT                   /locus_tag="ABBFA_00359"
FT                   /old_locus_tag="CTY05_00359"
FT                   /product="Threonine/homoserine exporter RhtA"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:P0AA67"
FT                   /protein_id="ATY42825.1"
FT                   /translation="MSSPSQKSQLHALGFLILAMLSVQSSASLAKVLFQNFPVLTVSAM
FT                   RLCIGAFILAFIFQIWKINFSQVRWKAILSYGFALAGMNALFYLSLERLPIGIAVAFEF
FT                   IGPLSVALYHAKQKYDFVWVTFAIIGLILLFPFNQAHSLDWIGVLFAMSAGACWALYII
FT                   AGQKPSGISSNHTVCLGMTVGACILLPITFFSGSIGQVIELPYFFYFIGLAVLASALPF
FT                   SLEMLALRNLTPLSFGTLMSLEPAVAALSGFIFLGEYLLWNQWLALATIITASVGCTIT
FT                   TQRARQQREKTVG"
FT   gene            complement(386460..387692)
FT                   /gene="serA"
FT                   /locus_tag="ABBFA_00360"
FT                   /old_locus_tag="CTY05_00360"
FT   CDS_pept        complement(386460..387692)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="serA"
FT                   /locus_tag="ABBFA_00360"
FT                   /old_locus_tag="CTY05_00360"
FT                   /product="D-3-phosphoglycerate dehydrogenase"
FT                   /EC_number="1.1.1.95"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:P0A9T0"
FT                   /protein_id="ATY42826.1"
FT                   /translation="MSQHLSLPKDKIRFLLLEGVHQNAVDTLNAAGYTNIDYRKTALEG
FT                   EALKEAIKDAHFIGIRSRTQLTEEVFEAANKLIAVGCFCIGTNQVDLKAAMARGIPVFN
FT                   APYSNTRSVAELVLAETILLLRRVPEKSAACHRGGWDKSAVGSFETRGKTLGIVGYGSI
FT                   GSQLSVLAESMGMHVIYYDAVTKLPMGNARQVGSLDELLATADVVTLHVPDVPSTRNFF
FT                   TKEQFAKMKEGAIFLNAARGTCVVIEDLADAIKSGHLAGAAVDVFPKEPKANGEEFQSP
FT                   LRGLDNVILTPHVGGSTMEAQANIGLEVAEKFVAYSDKGMTLSAVNFPEIALPLTAGQH
FT                   RLLHIHKNVPGVLSKINNLFAEQGINISGQSLMTKGDIGYLVMDVDASASQEALDMLHE
FT                   VEGTIRVRVLF"
FT   gene            388081..389490
FT                   /locus_tag="ABBFA_00361"
FT                   /old_locus_tag="CTY05_00361"
FT   CDS_pept        388081..389490
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABBFA_00361"
FT                   /old_locus_tag="CTY05_00361"
FT                   /product="putative FAD-linked oxidoreductase"
FT                   /EC_number="1.-.-.-"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:Q50685"
FT                   /protein_id="ATY42827.1"
FT                   /translation="MNAPVALTPELLTQLTAIVGENRIKTDADSLENWGKDHTKHFNPN
FT                   PSVIVFPSTTEQVQEVVKLANQFNIAITPSGGRTGLSAGAVATNGEIVISMDKMNQILE
FT                   FFPADRMVRVQAGVVTEQLQNYAEEQGMYYPVDFASAGSSQIGGNIGTNAGGIKVIKYG
FT                   MTRNWVLGLTVVTGKGDILRLNKGMIKNATGYALQHLFIGGEGTLGLVTEAEIKLERQP
FT                   QNLQVLVLGVPDFDAVMPVLHAFQKDIDLTAFEFFGELAMQKVLDRGHVQRPFETQCPF
FT                   YVLLEFEAPYEPIIDKAMEIFEHCMEQGWVLDGVMSQSLDQVESLWRLREDISESIAPF
FT                   IPYKNDISVLITHVPAFIREIDAIVQENYPDFEICWFGHIGDGNLHLNILKPENLTKDE
FT                   FFAKCQVVNKYVFDTVKKYDGSISAEHGVGMTKKPYLEYSRSAEEIEYMKALKKVFDPK
FT                   GIMNPGKLFDL"
FT   gene            389586..389954
FT                   /locus_tag="ABBFA_00362"
FT                   /old_locus_tag="CTY05_00362"
FT   CDS_pept        389586..389954
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABBFA_00362"
FT                   /old_locus_tag="CTY05_00362"
FT                   /product="hypothetical protein"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /protein_id="ATY42828.1"
FT                   /translation="MQRLFLISALCAGLMTGCATTSKLIPFVGSETPMQQVLKTQPEIV
FT                   KEHNNTSVQQVFNRVESPTVSRITVIQTGLMDDSVSAIRTEYLFKLVDEKWQLQNKQKS
FT                   YQCARGKGSKGFQMQLCS"
FT   gene            complement(389999..390313)
FT                   /gene="ygiN"
FT                   /locus_tag="ABBFA_00363"
FT                   /old_locus_tag="CTY05_00363"
FT   CDS_pept        complement(389999..390313)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ygiN"
FT                   /locus_tag="ABBFA_00363"
FT                   /old_locus_tag="CTY05_00363"
FT                   /product="putative quinol monooxygenase YgiN"
FT                   /EC_number="1.-.-.-"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:P0ADU2"
FT                   /protein_id="ATY42829.1"
FT                   /translation="MLTIIAEIRTQSGGQHRQNVLNAFQKIIPTVLAEDGCHGYEPLVD
FT                   HISNASFQNKDPDIIVMLEKWESVAHLEAHLATPHMQAHHEAVKDDVVDVKIKILESGV
FT                   "
FT   gene            complement(390327..390914)
FT                   /gene="mdaB"
FT                   /locus_tag="ABBFA_00364"
FT                   /old_locus_tag="CTY05_00364"
FT   CDS_pept        complement(390327..390914)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mdaB"
FT                   /locus_tag="ABBFA_00364"
FT                   /old_locus_tag="CTY05_00364"
FT                   /product="Modulator of drug activity B"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:P0AEY5"
FT                   /protein_id="ATY42830.1"
FT                   /translation="MSNILVINGAKQFAHSNGELNDTLTTLATNHLTELGHEVKVTRAD
FT                   SDYNAEAEVEKYLWADVVIYQMPGWWMGAPWTVKKYIDDVFTTGHGSLYANDGRSRSDA
FT                   SKKYGSGGLIHDKKYMLSLTWNAPMEAFDDADQFFHGVGVDGVYLPFHKANQFLGMSTL
FT                   PTFIVNDVIKMPDVDSYVEAYKAHLNTLFAAA"
FT   gene            391139..391504
FT                   /locus_tag="ABBFA_00365"
FT                   /old_locus_tag="CTY05_00365"
FT   CDS_pept        391139..391504
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABBFA_00365"
FT                   /old_locus_tag="CTY05_00365"
FT                   /product="hypothetical protein"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /protein_id="ATY42831.1"
FT                   /translation="MKKIGLLMMCNLLILSACTPNTNPPTPQANSPIQAVLLDQPNLLN
FT                   NASNLSISQQMNALEDPSNAQVTILQTEPSEDAVSKTRTEYLLKKDQTVWKIVNKKQSY
FT                   QCTKGEEAADFQVNPCP"
FT   gene            391874..393103
FT                   /gene="mdfA"
FT                   /locus_tag="ABBFA_00366"
FT                   /old_locus_tag="CTY05_00366"
FT   CDS_pept        391874..393103
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mdfA"
FT                   /locus_tag="ABBFA_00366"
FT                   /old_locus_tag="CTY05_00366"
FT                   /product="Multidrug transporter MdfA"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:P0AEY8"
FT                   /protein_id="ATY42832.1"
FT                   /translation="MKNIQTTALNRTTLMFPLALVLFEFAVYIGNDLIQPAMLAITEDF
FT                   GVSATWAPSSMSFYLLGGASVAWLLGPLSDRLGRKKVLLSGVLFFALCCFLILLTRQIE
FT                   HFLTLRFLQGIGLSVISAVGYAAIQENFAERDAIKVMALMANISLLAPLLGPVLGAFLI
FT                   DYVSWHWGFVAIALLALLSWVGLKKQMPSHKVSVTKQPFSYLFDDFKKVFSNRQFLGLT
FT                   LALPLVGMPLMLWIALSPIILVDELKLTSVQYGLAQFPVFLGLIVGNIVLIKIIDRLAL
FT                   GKTVLIGLPIMLTGTLILILGVVWQAYLIPCLLIGMTLICFGEGISFSVLYRFALMSSE
FT                   VSKGTVAAAVSMLLMTSFFAMIELVRYLYTQFHLWAFVLSAFAFIALWFTQPRLALKRE
FT                   MQERVAQDLH"
FT   gene            complement(393141..395291)
FT                   /gene="yccS_1"
FT                   /locus_tag="ABBFA_00367"
FT                   /old_locus_tag="CTY05_00367"
FT   CDS_pept        complement(393141..395291)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yccS_1"
FT                   /locus_tag="ABBFA_00367"
FT                   /old_locus_tag="CTY05_00367"
FT                   /product="Inner membrane protein YccS"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:P75870"
FT                   /protein_id="ATY42833.1"
FT                   /translation="MNNLTQLFNRFKTNSILIYCLQILIVLTGTTLGLLWLGHNELIVP
FT                   VTLGAIAAALTDFDDRLSLRLRNLLYVCLLFFTVSTILGFLAPYKFLFILYLSISSACF
FT                   ILLGALGQRYATISFGTILLSIYSMFGLGEYAHWYQQPTYFVYGALWYGLTSILFFILK
FT                   PTLPLQDKLSQIFEEISALLQAKARLFDPDNKENVEQLLFELSLQNTQVAQSLNQIRSS
FT                   LLTRLKASRVSNKSIYWLNLYFFARDIHEQATSNYLHYEHIQQNFSRSDLIFRFQKNLR
FT                   LQAQACHDLAQCILHNQQYQSSQESQIGLNHLESSLKDWIQQHPQNFEVKNLKLIFNNL
FT                   KGMHEQFEQLQYAQPLNETLSQNKQEHLNLLDDDIQGFSDLVLKIRQQLTPQSALFRHA
FT                   VRIAVVFAAGYAISLLPFAQHGYWILLTSLFVCQITYFATKSRLKLRTIGTLLGVLLGI
FT                   PILYFVPSIEGQLILTIICGVSFFYLRQKKYALATLMATLMVLLIFNLKGAGYSIILPR
FT                   LIDTLLGCFIAWLAVNFIWPDWNFRNIPNNIKKSSQATFDYFNMIVEQYQHGKNQDIEY
FT                   RRIRRAAHNAQIELSNMISSLSAEPNPNPELIHYAFRYLVYSHSQLSYVAALGSQRQKI
FT                   DDQQVLQLLLDCQQILKQSLFEQASVNFSFLEQTLKQIQSLITHEHFSENYTLVLKQMS
FT                   LLLETLPELISLKGKLLEHEIK"
FT   gene            complement(395484..396059)
FT                   /gene="sodC"
FT                   /locus_tag="ABBFA_00368"
FT                   /old_locus_tag="CTY05_00368"
FT   CDS_pept        complement(395484..396059)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sodC"
FT                   /locus_tag="ABBFA_00368"
FT                   /old_locus_tag="CTY05_00368"
FT                   /product="Superoxide dismutase [Cu-Zn] precursor"
FT                   /EC_number="1.15.1.1"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:P0AGD1"
FT                   /protein_id="ATY42834.1"
FT                   /translation="MPVFNKIGAVCALTALLTVGCSTVSKTVSDTAHALTTMHTKKVVD
FT                   VNEVTANGIGKKIGTISFQDSDKGLIITPALADLPSGTRGFHIHENPSCAPAVKDGKPG
FT                   AALAAGSHYNPNQAPHHGTPTTGHLGDLPALVVDNTGVATTAVIAPRLKLADIQGRAIM
FT                   IHAGGDNYSDSPLPLGGGGARIACGVIK"
FT   gene            complement(396175..397293)
FT                   /locus_tag="ABBFA_00369"
FT                   /old_locus_tag="CTY05_00369"
FT   CDS_pept        complement(396175..397293)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABBFA_00369"
FT                   /old_locus_tag="CTY05_00369"
FT                   /product="putative inner membrane protein"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="protein motif:CLUSTERS:PRK10983"
FT                   /protein_id="ATY42835.1"
FT                   /translation="MHPYAPTLQRVLLFGLFFILIFLGFNILKYFIVPVLWAAIIAYMT
FT                   WPIYLRIQHFFGENRNNLNATVMISLVILIVGVPFTCAIFILQHEGRNLYFDLQRQVFS
FT                   GHLSVPDFIRNLPFIGKEISRTLNEINTDPNSTIQNIAAWVQSHLSYGRVLLNEISKNI
FT                   VKLCFAILSLFFFYRDGHTILTQVSKALEMVIGPRIHHYLDTISETTRAVVYGVGLTAI
FT                   AQAVLAGLSYFVAGVPNPMVLTIATFLLALIPFGTPVSYLGVGLWLFSQGQTMEAIGVI
FT                   LWGVLIVSSSDNVIRPLVISGATQIPFLLIMFGVLGGIASFGLVGLFIGPVILAVLLAI
FT                   WREWLHETIDPEPMPKTTMIYDSDDDLPPSKN"
FT   gene            complement(397416..398012)
FT                   /locus_tag="ABBFA_00370"
FT                   /old_locus_tag="CTY05_00370"
FT   CDS_pept        complement(397416..398012)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABBFA_00370"
FT                   /old_locus_tag="CTY05_00370"
FT                   /product="CobQ/CobB/MinD/ParA nucleotide binding domain
FT                   protein"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="protein motif:Pfam:PF01656.17"
FT                   /protein_id="ATY42836.1"
FT                   /translation="MTAITLATALAQKGYKVALADSDNQKSSLQWLKQRPDNVAVIQSL
FT                   DWRQEKSIGDAPKNLDYLIIDAPGALSGDHAEQLVSEAHAIITPLQPSFFDIDSTRRFL
FT                   KHLQDIKRIRKGKVQILLLANRVKPNSASSKDIQQFFEKIEHEPIAWIAERSAYGSLAM
FT                   QGLSVFDKPQKNFIAIQSQWQPLLNKLIEDKSEWF"
FT   gene            398219..398689
FT                   /locus_tag="ABBFA_00371"
FT                   /old_locus_tag="CTY05_00371"
FT   CDS_pept        398219..398689
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABBFA_00371"
FT                   /old_locus_tag="CTY05_00371"
FT                   /product="Endonuclease related to archaeal Holliday
FT                   junction resolvase"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="protein motif:Pfam:PF10107.3"
FT                   /protein_id="ATY42837.1"
FT                   /translation="MSVWLAMLIGAGIGIIITTLILSNTRNGRIKAEYEQYIAELELEH
FT                   QQALAQAQKRSVNTSRAVLKGKMAEQFAPVLPEFQYLPSDAKFMGDPVDYIIFDGYTDF
FT                   RDGDGTADDIQIILLDVKSGGARLTKGQQAIAQAIKEGKVRFETLRIDFEDQ"
FT   gene            398826..399389
FT                   /locus_tag="ABBFA_00372"
FT                   /old_locus_tag="CTY05_00372"
FT   CDS_pept        398826..399389
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABBFA_00372"
FT                   /old_locus_tag="CTY05_00372"
FT                   /product="hypothetical protein"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /protein_id="ATY42838.1"
FT                   /translation="MKKQRLMIALLATLGMGSAFASTSSEYNIANGLLPVEKDQSISVL
FT                   QPFQGNFRILGSKIYHNDEQAKFSPIDYAVSWGLFAQPEIARHISVKQYDRYLNWKIAK
FT                   LPVPAEQAMQMVSNMHIIPANPEIAQQIKQVKRGDLVYLKGDLVEIKDKDLVWKSSLTP
FT                   TDTGDGACELFRVQSIHWVEKQNI"
FT   gene            complement(399439..399972)
FT                   /locus_tag="ABBFA_00373"
FT                   /old_locus_tag="CTY05_00373"
FT   CDS_pept        complement(399439..399972)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABBFA_00373"
FT                   /old_locus_tag="CTY05_00373"
FT                   /product="hypothetical protein"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /protein_id="ATY42839.1"
FT                   /translation="MLKKTPHIILMSLLSSSLLLTACKKADEPAKTEQPHTSSSTDQVL
FT                   EKLNERPVKKFPATADDAHDIALLEDYDHRFTEMSDEMETELEKMHEAGTLTTEFEQKR
FT                   TLDNVRSALTMLKDLDLKTEQGRYIQGLLYQYWENQEKNFSDKQASKDEQVKQLADYLQ
FT                   AQNQLKYWKASQQH"
FT   gene            complement(399988..400782)
FT                   /locus_tag="ABBFA_00374"
FT                   /old_locus_tag="CTY05_00374"
FT   CDS_pept        complement(399988..400782)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABBFA_00374"
FT                   /old_locus_tag="CTY05_00374"
FT                   /product="hypothetical protein"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="protein motif:CLUSTERS:PRK08317"
FT                   /protein_id="ATY42840.1"
FT                   /translation="MTQSLHPVAQKGFSSAAELYQQVRPNYPVEIVSWLQDRLQIHENS
FT                   TVIDLGSGTGKFLPYLKQTLANIIAVEPIGEMLQQLQQAYPDIKTLQAFSHNIPVNDQQ
FT                   IDAVICAQSFHWFDNIETLIEIHRVLKPQGHLGLVWNQRDESTDWVKALADFLLPLEGD
FT                   TPRYHSERWKKVFEEQDLFTFDNLNTFSQSQHGTVEQVVSKRLLSTSFIAAMTEKDQLQ
FT                   LKAKFEKIVYDFTGLGPQDQIDFPYITYAYHFQKNTSSNHRE"
FT   gene            400910..402187
FT                   /locus_tag="ABBFA_00375"
FT                   /old_locus_tag="CTY05_00375"
FT   CDS_pept        400910..402187
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABBFA_00375"
FT                   /old_locus_tag="CTY05_00375"
FT                   /product="hypothetical protein"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /protein_id="ATY42841.1"
FT                   /translation="MDKQIIFEDEHIRAIFLQGDSNTLVLSFGDLITRASGLSINAEKS
FT                   LIKYQYSVIGVMPKQKSWFPKASMVELAKVILPIIQRFKNIVGYGGSMGGYAAIKYSNL
FT                   LNMNRIIAFVPQYSIDPEQVEDRRYAEFFDAVANKDMQIQPQDVDASREYIIVYDPYFS
FT                   IDREHYLKIKEILPSLHTIHLPFTGHEALSVLASSSLLHDFIEHEFDETYFYQQVRKIK
FT                   KQSKFYYRNVLANVLTYHDSMLLKILRQNDFQLDERYLDNPLKQAVTRSLIKTKQATEQ
FT                   DFQKLGIKIQYRQQAENHKKGLKNQFEAILVFNLINLKLETYAVDVVLANPLYLIPIVA
FT                   EHTGVVQIELNNELYLLGMNDRKIIKLFKQGDALTSDMSPFVIKQYSDFFALSYKQLNL
FT                   NCDEQGVCDYVEGSVQPSQQFVLTSY"
FT   gene            402601..404034
FT                   /gene="rocC_2"
FT                   /locus_tag="ABBFA_00376"
FT                   /old_locus_tag="CTY05_00376"
FT   CDS_pept        402601..404034
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rocC_2"
FT                   /locus_tag="ABBFA_00376"
FT                   /old_locus_tag="CTY05_00376"
FT                   /product="Amino-acid permease RocC"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:P39636"
FT                   /protein_id="ATY42842.1"
FT                   /translation="MQSLNYRNNDASQHGSSAPLKRAMSTRHLVMISLGGAIGTGLFLG
FT                   SGDVISQAGPIGAIISYFLGGLIAYTVMLCLGELAVHVPESGSFGEYARRYIGPGTGYM
FT                   ITWLYWLTWTATLGTEFTAAALLVQEWFPSTSVWAWTLFFGALVFFLNVSSTRLFAESE
FT                   FWLALVKVITIICFIGLGLLAIFGFIPYQGHETAPLFSNLTAHGWFPNGLFPIFATMLI
FT                   VNFAFSGTELIGVAAGEAENPAKTVPKAINAAIWRLLIFFVGTIVVISSLLPYHLAGLS
FT                   ANDVSSSPFVTVFNYIGIPYAEDIIRFVIITALLSAANSGLFAASRMMWSLSAKNQLPK
FT                   IFAKLTPSGTPIIAIIVTMFGAIPGLLSEQFAPETIFKNLLGVAAFTMVVVWIAICISQ
FT                   FNFRRQWYKSGKTVKDLRFAAPLFPLTPIVGGLFCIVTCISMVFDPSMQVGFICCIIFI
FT                   LLCYVSYFIFYRKKDIAQN"
FT   gene            405070..406341
FT                   /gene="gdhA_1"
FT                   /locus_tag="ABBFA_00377"
FT                   /old_locus_tag="CTY05_00377"
FT   CDS_pept        405070..406341
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gdhA_1"
FT                   /locus_tag="ABBFA_00377"
FT                   /old_locus_tag="CTY05_00377"
FT                   /product="Glutamate dehydrogenase"
FT                   /EC_number="1.4.1.3"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:P96110"
FT                   /protein_id="ATY42843.1"
FT                   /translation="MSDLSYVNEHSDAWQTYLAQIDRVAPYLEHLADYIDTLKRPKRAL
FT                   IVDVPIVMDDGSIQHFEGYRVQHNLSRGPGKGGVRYHPNVDLNEVMALSAWMTIKTAVL
FT                   NLPFGGAKGGIRVDPRKLSNRELERLTRRYTTEIGHIIGPQKDIPAPDVGTNANIMGWM
FT                   MDTYSTSQGHTVTGVVTGKPVHLGGSLGRVKATGRGVFVTGREVAAKINLPIEGAKVAV
FT                   QGFGNVGSEAAFLFVESKAKITHVQDHTGTIFNADGIDLVALRDHVNANQGVGGFAGAQ
FT                   TIADEDFWTAEVDIIIPAALEGQITVERAEKLKAKLILEGANGPTYPKAEDVLVERGIV
FT                   VVPDVVCNAGGVTVSYFEWVQDMASYFWSEEEINERLDKLMVQAMDDVWNTANKNACTL
FT                   RTAAYILACERILKARKERGIFPG"
FT   gene            406486..407700
FT                   /gene="astC_1"
FT                   /locus_tag="ABBFA_00378"
FT                   /old_locus_tag="CTY05_00378"
FT   CDS_pept        406486..407700
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="astC_1"
FT                   /locus_tag="ABBFA_00378"
FT                   /old_locus_tag="CTY05_00378"
FT                   /product="Succinylornithine transaminase"
FT                   /EC_number="2.6.1.81"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:P77581"
FT                   /protein_id="ATY42844.1"
FT                   /translation="MEQPISVTRSNFNDWMVPVFAPANFIPVRGEGSRIWDQENKEYID
FT                   FAGGIAVNALGHAHPVAVNALTEQAKKLWHVGNGYTNEPVLRLAKQLTENTFADKVFFC
FT                   NSGAEANEAALKLARKVGLDSGVAGKSGIVAFNNAFHGRTLFTVSAGGQPKYSQDFAPL
FT                   PNGISHVAYNDLEAAKAVINEQTCAVIVEPVQGEGGVIPADIEFLKGLRELCDQFGALL
FT                   IFDEVQTGVGRTGALYAYMNYGVIPDVLTTAKALGGGFPVGAMLTTDKFAPHFSVGTHG
FT                   TTYGGNPLASAVAGAVFEFINTPEVLEGVKHRHQYFLDALNTLNAEYQVFDEIRGQGLL
FT                   IGCVLKAEYAGKAKDITTWAGEEGLLALIAGPNVVRFTPSLIIPEQDIDEGIARLKRAL
FT                   AKLAK"
FT   gene            407719..408750
FT                   /gene="astA_1"
FT                   /locus_tag="ABBFA_00379"
FT                   /old_locus_tag="CTY05_00379"
FT   CDS_pept        407719..408750
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="astA_1"
FT                   /locus_tag="ABBFA_00379"
FT                   /old_locus_tag="CTY05_00379"
FT                   /product="Arginine N-succinyltransferase"
FT                   /EC_number="2.3.1.109"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:P0AE37"
FT                   /protein_id="ATY42845.1"
FT                   /translation="MMIVRHAEFRDLEDIYKLAGKSGVGLTSLPQNMDTLSARISRTRN
FT                   TLNGNVHKSEQGYLFVLEDTEAQRVIGVSAIEVAVGLIEPWYNFHVGTQVHASKALNVY
FT                   KSLPTLFLSNDRTGSSELCTLFLDPERRENQNGKFLSKIRFMFIAAFKQYFEKKLIAEM
FT                   RGYSDENGCSPFWDAIGHHFFNMDFSTADYLSGIGQKVFIAELMPRFPVYVDLLPKDAQ
FT                   EVIGKMHPHTLPAYHVLESEGLRYQGYVDIFDAGPTIEANIDELRAVKESQLLNVKITN
FT                   EATVGKTQYLVANDNYHDYRAMLLKLDLVDNTLNLTHEQAEKLGVQEGHAVRVLSLNPM
FT                   EVS"
FT   gene            408750..410219
FT                   /gene="astD"
FT                   /locus_tag="ABBFA_00380"
FT                   /old_locus_tag="CTY05_00380"
FT   CDS_pept        408750..410219
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="astD"
FT                   /locus_tag="ABBFA_00380"
FT                   /old_locus_tag="CTY05_00380"
FT                   /product="N-succinylglutamate 5-semialdehyde dehydrogenase"
FT                   /EC_number="1.2.1.71"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:P76217"
FT                   /protein_id="ATY42846.1"
FT                   /translation="MSNSLFINGVWLQGSGTTFVKTNPVDNQTVWSGAEATASDVEKAC
FT                   QAARTAFPAWARLPFAERVTIVEKFAALLEENKKHLAEVISQETSKPFWETLTEVQSMI
FT                   GKVAISIRAYHQRTGESSTEMADGVASLRHRPHGVLAVFGPYNFPGHLPNGHIVPALLA
FT                   GNTVVFKPSELTPWTAEETVKLWQQAGLPNGVMNLVQGGRTTGEALAASHEIDGLLFTG
FT                   SANTGYHLHKQMAGAPEKILALEMGGNNALIIDEIVDVDAVVNLAIQSAFVSAGQRCTC
FT                   ARRILVKNGAQGDAFIQRFVEVAKNLKVGRWNDEQQPFMGGVISSAAATNMMNAQQKLL
FT                   ELGAKSLLPMTRPQEDSSLLTPGIIDVTGVAGIPDEEYFGPLTTIQRYDSFDEALKIAN
FT                   ATRFGLSVGLVSPKRELFDDLLIEARAGIVNWNKPLTGASSAAPFGGVGASGNHRASAF
FT                   YAADYCAWPMASLESESLTLPEKLSPGIVLP"
FT   gene            410237..411580
FT                   /gene="astB"
FT                   /locus_tag="ABBFA_00381"
FT                   /old_locus_tag="CTY05_00381"
FT   CDS_pept        410237..411580
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="astB"
FT                   /locus_tag="ABBFA_00381"
FT                   /old_locus_tag="CTY05_00381"
FT                   /product="N-succinylarginine dihydrolase"
FT                   /EC_number="3.5.3.23"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:P76216"
FT                   /protein_id="ATY42847.1"
FT                   /translation="MKGYEVNFDGLVGPTHHYAGLSFGNEASTKNRNNLSNPKLAAKQG
FT                   LLKMKALADMGMKQGVLAPHERPHVPMLRRLGFTGDDISVVAQAMRYSPELLSSLSSAS
FT                   PMWTANAATVSPSADSQDERVHFTAANLNNKFHRSIEAETTSQVLQAIFKNERHFVHHE
FT                   ALPQVALFGDEGAANHNRLGGDYAKRGVQVFVYGQQHLNNGLPGPKRYPARQTREASEA
FT                   IARLHRLDEAHTVFVQQNPDVIDQGVFHNDVIAVSNQQVLFHHQHAFLNQDQAFAEIRQ
FT                   KMASIGEDFISIEVPENRVTVDDAVATYLFNSQILTRPDGGMTIVVPEESRQNAAVWSY
FT                   LNDMIQMGTPIDAIQVYDLRESMRNGGGPACLRLRVALNETELNAVNPKVLMNDQLFMT
FT                   LNQWVDKHYRDRLAQEDLADPHLLMESRMALDELTKILGLGSVYPFQK"
FT   gene            411593..412567
FT                   /gene="astE"
FT                   /locus_tag="ABBFA_00382"
FT                   /old_locus_tag="CTY05_00382"
FT   CDS_pept        411593..412567
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="astE"
FT                   /locus_tag="ABBFA_00382"
FT                   /old_locus_tag="CTY05_00382"
FT                   /product="Succinylglutamate desuccinylase"
FT                   /EC_number="3.5.1.96"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:Q8ZPU8"
FT                   /protein_id="ATY42848.1"
FT                   /translation="MQDFLALTLQGEQPATREGKQANFSWRWLGEGLLECTPHAQYDKA
FT                   VVLSAGVHGNETAPIELLSHLCTDLFAGRLKLAVRLLLVLGNPYAMRQGKRYVHDDVNR
FT                   MFCGGYKNLPVTEESKRAEVLEQTVATFFQESSSQAKRYHYDLHTAIRASLLPTFALFP
FT                   YQTHGYDADLTASLEAADLDALVYHNALGKTFTHFTSENFKAASATLELGKALPFGQND
FT                   LSQFASIDEVIRNVVSEQALPVRNKPKIRVFQVSDSLIKKDEEFHMNLSAEAPNFSTFT
FT                   KGEIIATQPSGNYVVEQDQVWILFPNPNVKIGLRAGLVLTETI"
FT   gene            complement(412629..413390)
FT                   /locus_tag="ABBFA_00383"
FT                   /old_locus_tag="CTY05_00383"
FT   CDS_pept        complement(412629..413390)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABBFA_00383"
FT                   /old_locus_tag="CTY05_00383"
FT                   /product="hypothetical protein"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /protein_id="ATY42849.1"
FT                   /translation="MKMMKTAIVTASVLASASIFAQSAGVNAGASAQVNVQPGGLVSGV
FT                   ANTVKNTAHTVGNTAKHAGHVAADTTVKATKKTTGKVTELSSKAATGTKHVASEAVTGT
FT                   KHFATEAATGTKNLATKAATGTKNLAVEAKADTKAHLDAVKTKVAEKQADQKEFTAEKQ
FT                   ADAQARVDAVKARVAQNQAEQKEFVADTKADAQAKLNTAQPAHGVNAQTGVNVGVNVAG
FT                   INANANVNAGAQASTQKGEKKSFIKGLFGTN"
FT   gene            413981..414292
FT                   /locus_tag="ABBFA_00384"
FT                   /old_locus_tag="CTY05_00384"
FT   CDS_pept        413981..414292
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABBFA_00384"
FT                   /old_locus_tag="CTY05_00384"
FT                   /product="hypothetical protein"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /protein_id="ATY42850.1"
FT                   /translation="MMKIIASLLVIVGLIAVVLYFKPTSGASDVFNSALHETNSPQPDT
FT                   SSSLSKLKEPTQPKNVSLNSNHSQSVSADAVPFYDTKSDPSIQPIDPEKDPANEIKAK"
FT   gene            414328..415683
FT                   /gene="aprE"
FT                   /locus_tag="ABBFA_00385"
FT                   /old_locus_tag="CTY05_00385"
FT   CDS_pept        414328..415683
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aprE"
FT                   /locus_tag="ABBFA_00385"
FT                   /old_locus_tag="CTY05_00385"
FT                   /product="Subtilisin E precursor"
FT                   /EC_number="3.4.21.62"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:P04189"
FT                   /protein_id="ATY42851.1"
FT                   /translation="MQSKTLFLLGLCTIFSTTVSALPLDYKGAKQRLSQAAKQKVFQGK
FT                   IDLDALVSNDSNDLIVEYNIPSSSVPSGLERRSYIATNKKNLQTRFNRAGGVQVLRDYN
FT                   NLPLAFYRISNREALVSLLNDPNVKAVYPNRINRTTTTESLPLINQPQANTNGFTGEGS
FT                   SVAVLDTGVNYLHSDFGCTAVNTPSSTCRVVYSFDSAPDDGTLDDDGHGSNVSAIVSKV
FT                   ATKTKIIGIDVFRKVRSQGKWVSTAYDSDILAGINWAVNNAQTYNIKAVNLSLGVPGVK
FT                   YTSECSDSSYGTAFANARAAGVVPVVASGNDAFPDGISSPACVAGAVRVGAVYDSNIGG
FT                   VSWGNPVKCSDPTTAADKVACFSNGGSLVTLLAPGAMITAGGYTMGGTSQATPHVAGAI
FT                   ALLRANSVSPTESIDQTISRLKATGKPITDSRTGLVFPRIDLLAATNGLTVN"
FT   gene            complement(415782..416213)
FT                   /locus_tag="ABBFA_00386"
FT                   /old_locus_tag="CTY05_00386"
FT   CDS_pept        complement(415782..416213)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABBFA_00386"
FT                   /old_locus_tag="CTY05_00386"
FT                   /product="hypothetical protein"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /protein_id="ATY42852.1"
FT                   /translation="MNSQKLLFSTLCCLALTACATTAPLSSYPQAQVLEQDTNIEAYPT
FT                   TTGNVAKLIKHDKQACMIEFTGYLGGGQVTEHWIFNNKGLISAQSFTEQYPDSSGILSQ
FT                   ATNSTTKSSTTFNIQDPEIQNNFKKLQSNFSKDNLAKCD"
FT   gene            complement(416308..416727)
FT                   /locus_tag="ABBFA_00387"
FT                   /old_locus_tag="CTY05_00387"
FT   CDS_pept        complement(416308..416727)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABBFA_00387"
FT                   /old_locus_tag="CTY05_00387"
FT                   /product="hypothetical protein"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /protein_id="ATY42853.1"
FT                   /translation="MKAIKILCITSSILVSSSLFAETPQPQQVNEATSKTMPYGDNPSL
FT                   GRVLLYKTGKGIQNLGDSIQGASEKTSNKISEKWKDTKEFTAEKAEVVQQKADTAKVFT
FT                   EQKIEQAKQNITSSRNGENIPIEQGELSKSSTTAN"
FT   gene            complement(416876..417742)
FT                   /gene="gltR_1"
FT                   /locus_tag="ABBFA_00388"
FT                   /old_locus_tag="CTY05_00388"
FT   CDS_pept        complement(416876..417742)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gltR_1"
FT                   /locus_tag="ABBFA_00388"
FT                   /old_locus_tag="CTY05_00388"
FT                   /product="HTH-type transcriptional regulator GltR"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:P94501"
FT                   /protein_id="ATY42854.1"
FT                   /translation="MDITQLKMFQTVVECGTMAKASMQLHCVPSNITTRIKQLEEELGA
FT                   PLFYREGKALKLTPSGEIFLDYCHKILALCDEAKRSIHPDAPPSGPLRIGAIESSATTR
FT                   LPNLLAKYHQRFPEVSIQIITGTWKQLLVDISQHKLDGAIVAGNIEFPMLNKLGIYQED
FT                   MVLIASHSLGEIHCQEDLIGKEIFMWTEGCPYRAALEEWLKLKNISLPITSITSYATII
FT                   GCVSAGSGVALVPKSIYEQYKNLAHIQSYKFEYLAFMQNHFFWHKNVSNHKARDMFIEL
FT                   IKTEFSL"
FT   gene            417851..418753
FT                   /gene="yijE_1"
FT                   /locus_tag="ABBFA_00389"
FT                   /old_locus_tag="CTY05_00389"
FT   CDS_pept        417851..418753
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yijE_1"
FT                   /locus_tag="ABBFA_00389"
FT                   /old_locus_tag="CTY05_00389"
FT                   /product="putative inner membrane transporter yiJE"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:P0ABT8"
FT                   /protein_id="ATY42855.1"
FT                   /translation="MAISLAAETQPPAFKLYLCIAVTVFCWGYSPIGVHSALHSYTPQH
FT                   IALLRFLIASFFLLLLVMKKGIQPLNWKDVPALAVLGFFSVTLHHLLINTGQQYVTAVA
FT                   SSILSQSIPLFTFIISALLFKEQINFKQWLCILLGLCGAVLVVSGDHGFGVPSPYSLLI
FT                   VLAAIAWGLYFNLYKKFALNYDALSMMCYIIWFGTIPLLFYSTHLPHEILHATWQANMS
FT                   VVLLGIFPSAMAYVLWGYVLKNMPLTIASNFLYCSPIVAMSLAVLFLNEKPSMMVLLGG
FT                   VIIVGSLVWMNWGNRRTIE"
FT   gene            418789..419073
FT                   /locus_tag="ABBFA_00390"
FT                   /old_locus_tag="CTY05_00390"
FT   CDS_pept        418789..419073
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABBFA_00390"
FT                   /old_locus_tag="CTY05_00390"
FT                   /product="YCII-related domain protein"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="protein motif:Pfam:PF03795.8"
FT                   /protein_id="ATY42856.1"
FT                   /translation="MIVVTLTYKKPLAEVDAVLKQHIAFLDHYYEQKKFLASGRRENRV
FT                   GGVILVLSSSIQEAEEIMKNDPFYIHDVADYDFMWFEPSKSLEEIKKYI"
FT   gene            complement(419147..420214)
FT                   /locus_tag="ABBFA_00391"
FT                   /old_locus_tag="CTY05_00391"
FT   CDS_pept        complement(419147..420214)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABBFA_00391"
FT                   /old_locus_tag="CTY05_00391"
FT                   /product="hypothetical protein"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /protein_id="ATY42857.1"
FT                   /translation="MLDYRVRSWSLLNLVNDIRERRLVPDAYFQRDLVWREIHKKDFIE
FT                   TILLGLPFPQLFISKGKVDLVEMKTVSCIVDGQQRTNAIIEFIDNRFSVSDKFFRDLDD
FT                   IERTNFLKYEIAVIELDLENDDPQVQEIFQRINRTANSLRGIEKQASQYATSDFMLTAK
FT                   LLSDQIDLTAENNEYFKEDPRIPSDYYDWAKQQKVTRSQDLFTSNNLFTPLEISRKNHL
FT                   SYVLNLIASIEGGIFHRNEKTNEYLELYSENFQSKDDVVKLIEKTSSIYLKLKFSKKSY
FT                   WLNKANFFSLFYALAKNINEGKNINIEKLKENLDIFYSNLPDEYKISATEGVNNLRERR
FT                   TRDHYLNEIINNSLL"
FT   gene            complement(420219..420851)
FT                   /locus_tag="ABBFA_00392"
FT                   /old_locus_tag="CTY05_00392"
FT   CDS_pept        complement(420219..420851)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABBFA_00392"
FT                   /old_locus_tag="CTY05_00392"
FT                   /product="hypothetical protein"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /protein_id="ATY42858.1"
FT                   /translation="MDAKYYFETIKNDLAIGKDRYDIARKIFTSFPDYTAIKYDQHSVE
FT                   FEIKNEVSNHFHIPFHSIQLCGSAKTGKSLYKHHDFDKTKSDFDLAIISPELYTKYFEV
FT                   AFKQTQAFKDATTFPRKKKWNKELQRHINVNVKDEFLSYLNIGYFRPDLMPKSKDRTEW
FT                   FSFFNHLSEKYIQYFSNINAGIYLSQTFFENKQFAALDKSLEFNFED"
FT   gene            complement(420895..422964)
FT                   /gene="glyS"
FT                   /locus_tag="ABBFA_00393"
FT                   /old_locus_tag="CTY05_00393"
FT   CDS_pept        complement(420895..422964)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glyS"
FT                   /locus_tag="ABBFA_00393"
FT                   /old_locus_tag="CTY05_00393"
FT                   /product="Glycine--tRNA ligase beta subunit"
FT                   /EC_number="6.1.1.14"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:P00961"
FT                   /protein_id="ATY42859.1"
FT                   /translation="MSKHTVLFELGCEELPPKSLKTLRDALQAETVKGLNEAGLNFASV
FT                   EAYAAPRRLALKIVDVDAAQADTQKRFDGPAVQAAYDAEGKPTKALEGFMRGQGITVEQ
FT                   LSTFQAGKVEKVCYLKDVKGQSLDTLLPQILQTALDNLPIAKRMRSAASRTEFVRPVKW
FT                   VVLLKDDQVIEATIQDHKAGNVTYGHRFHAPEAVTLAHANDYLAALEKAYVVANFEKRQ
FT                   ATIQEQVKKLADEVNATAIVPADLLDEVTSLVEWPVALRATFEERYLAVPQEALITTMQ
FT                   DNQKYFCLINAEGKLQPYFITVSNIESKDPTQIIEGNEKVVRPRLSDAEFFFLQDQKQP
FT                   LASRKEKLANMVFQAQLGTLWDKSTRIAKLAVALSSITGANPADAEKAALLAKCDLTSE
FT                   LVGEFPELQGIAGTYYARIEGENTEVSEALGEQYLPKFAGDVLPKTKTGTTIALSDRLD
FT                   TLVGIFGIGQAPTGSKDPFALRRSAIGILRLIIENELDVTIEELVNLALQGYGDIVKDH
FT                   DKTRADAVAFLEGRYRAKYEDQGVAVDVLQAVQALAPKSPLDFDKRVNAVNHFRTLPEA
FT                   AALAAANKRVANILAKEATPEGSVVEANLVEDAEKALFAELQAVTPVVEPLLAAKDYTA
FT                   ALSKLAALRAPIDAFFDGVMVMADDAGLKANRLRLLAQLRNLFTAVADVSVLQG"
FT   gene            complement(422964..423941)
FT                   /gene="glyQ"
FT                   /locus_tag="ABBFA_00394"
FT                   /old_locus_tag="CTY05_00394"
FT   CDS_pept        complement(422964..423941)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glyQ"
FT                   /locus_tag="ABBFA_00394"
FT                   /old_locus_tag="CTY05_00394"
FT                   /product="Glycine--tRNA ligase alpha subunit"
FT                   /EC_number="6.1.1.14"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:P00960"
FT                   /protein_id="ATY42860.1"
FT                   /translation="MSRAISHIDTFQGLILALQNYWAEQGCVVLQPYDMEMGAGTFHTA
FT                   TFLRALGPETWNAAYVQPSRRPKDGRYGENPNRLQHYYQFQVVLKPNPDNIQQLYLDSL
FT                   KAIGIDTLTHDIRFVEDNWESPTLGAWGLGWEVWLNGMEVTQFTYFQQVGGVECYPVTG
FT                   EITYGLERLAMYLQGVDSVYDLVWTKGQFGTVTYGDVFHQNEVEQSTYNFEYAPVDKLF
FT                   ELFDFYESEANRLMEAKLPLPAYEQVVKASHTFNLLDARGAISVTERQRYILRVRTLAR
FT                   AIAQSYVQARAELGFPMAEPHLRDEVLAQLKAQAESEAAKAEKN"
FT   gene            424311..425495
FT                   /gene="tetA"
FT                   /locus_tag="ABBFA_00395"
FT                   /old_locus_tag="CTY05_00395"
FT   CDS_pept        424311..425495
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tetA"
FT                   /locus_tag="ABBFA_00395"
FT                   /old_locus_tag="CTY05_00395"
FT                   /product="Tetracycline resistance protein, class C"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:P02981"
FT                   /protein_id="ATY42861.1"
FT                   /translation="MNRSLFIIFATIALDAIGIGLIFPILPLLLQDMTHSTHISIYMGI
FT                   LASLYAAMQFIFSPLLGALSDRWGRRPVLLISLAGSAVNYLFLTFSHSLILLLVGRIIA
FT                   GITSANMAVASAYIVDVLHENNRAKYFGLINAMFGAGFIIGPVLGGFLSEYGLRLPFFA
FT                   AAILTGLNLLSAYFVLPESRKVTLENKQLSTLNPFKIFAGISSIRGVLPLITTFFIFSA
FT                   IGEVYGVCWALWGHDTFQWSGFWVGLSLGAFGLCQMLVQALIPSHASRLLGNRNAVLAG
FT                   IACSCFALAVMAFAQSGWMIFAIMPIFALGSMGTPSLQALASQKVSADQQGQFQGVIAS
FT                   TVSMASMIAPMFFSTLYFQFQEKWPGAIWLSVILIYLLTLPIILYSTRPVVQQR"
FT   gene            425668..426930
FT                   /locus_tag="ABBFA_00396"
FT                   /old_locus_tag="CTY05_00396"
FT   CDS_pept        425668..426930
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABBFA_00396"
FT                   /old_locus_tag="CTY05_00396"
FT                   /product="hypothetical protein"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /protein_id="ATY42862.1"
FT                   /translation="MSDRIREKLQILADAAKYDVSCSSSGSDRKNKNKGLGDASHSGIC
FT                   HSYTEDGRCVSLLKILFSNVCIFDCAYCVSRRSNDVQRAAFTVQEVVDLTINFYRRNYI
FT                   EGLFLSSGIFKSADHTMERMLQVVKKLRLEENFNGYIHLKTIPGASPELIHEAGLYADR
FT                   MSINLEMPTEIGLKTFAPEKSHQEVQKDLGLVRDRLIQLKDERQIIKHVPKYVPAGQTT
FT                   QMVVGAHQESDQDVLFMADKHYKEFKLKRVYFSGYIPINTENNYLPAVGSAPPVLRENR
FT                   LYQSDWLMRFYGFEVNEIVNEKHPNLDLDVDPKLSWALRHPEQFPVDLNRADYQMILRV
FT                   PGIGVKSAKKIVQARRFGKIHIDLLKKLGVAYQRAKFFIRCEDSPKFQKELSSSFIRQQ
FT                   ILTQGSSKYVQQLSPQLSLGF"
FT   gene            426933..427730
FT                   /locus_tag="ABBFA_00397"
FT                   /old_locus_tag="CTY05_00397"
FT   CDS_pept        426933..427730
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABBFA_00397"
FT                   /old_locus_tag="CTY05_00397"
FT                   /product="hypothetical protein"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /protein_id="ATY42863.1"
FT                   /translation="MFNEEVAYYFDGSMVGLLSCVFRAFQFKELQVRLCLNDTAQHGLF
FT                   ADKIEVVNNEQHAERVWAALQKKLSSSSLKQFYFAYLSESLDAYQHLFNYCIYVFSSHV
FT                   SIEKDYSHPSVLAITQWTKKVGREKHRMEAFIRFKKTKDELFLSLVRPDFNVLPLIQPH
FT                   FKRRYQDQRWLIYDEQRKFGLYYDLREIHEVSLEASDVDRNLKNGMSQSFQLELDEQEV
FT                   LYDQLWKDYFKSVNITERQNIKLHVQYLPKRYWRYLNEKLIEY"
FT   gene            427863..428963
FT                   /locus_tag="ABBFA_00398"
FT                   /old_locus_tag="CTY05_00398"
FT   CDS_pept        427863..428963
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABBFA_00398"
FT                   /old_locus_tag="CTY05_00398"
FT                   /product="putative voltage-gated ClC-type chloride channel
FT                   ClcB"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="protein motif:CLUSTERS:PRK01862"
FT                   /protein_id="ATY42864.1"
FT                   /translation="MSVIQPEWLQILKPNFKVLPLKERLLCGVGALCGLAISSLISWYV
FT                   LGGINAWYIAPMGASSVLLFAVPTSPLAQPWNVIVGNTLAGIIGVACAQWIPDLTTAFS
FT                   VAVGLAIFLMMTTDSLHPPSGAVAITAVLGGAAIHKLGFYFVFYPVLLNSLLLLGFAVF
FT                   FNRLIGRHYPVTAHLNERSKDPTPTQKVSIQPKDIEYALEHHTELLDISQYDLEKIILE
FT                   AQEHANERMVNQYTCQDIMSRDVIKLHENDDIHQALDKFKQVNLMSLPVVNADNHLVGT
FT                   LALYEVVEWFKGATDPRNSWQHYVRQIMSRRVVTVLPTQPIQDLVPYFVEKSFNYIPVV
FT                   EERKLIGIISRADMIAALQQQLNRKL"
FT   gene            complement(429033..429287)
FT                   /locus_tag="ABBFA_00399"
FT                   /old_locus_tag="CTY05_00399"
FT   CDS_pept        complement(429033..429287)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABBFA_00399"
FT                   /old_locus_tag="CTY05_00399"
FT                   /product="DNA-binding transcriptional activator PspC"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="protein motif:CLUSTERS:PRK10697"
FT                   /protein_id="ATY42865.1"
FT                   /translation="MANSGLYRSNRQSMIAGVMGGIAERFGWNANLLRIIFVLVSIMSA
FT                   AFPGILVYLVLWLVIPKKQPEQVQGYQQPVRTVREEQIH"
FT   gene            429568..430188
FT                   /locus_tag="ABBFA_00400"
FT                   /old_locus_tag="CTY05_00400"
FT   CDS_pept        429568..430188
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABBFA_00400"
FT                   /old_locus_tag="CTY05_00400"
FT                   /product="hypothetical protein"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /protein_id="ATY42866.1"
FT                   /translation="MKHLGVAAILCMGLSACDVNHADSKDHSAVATTSRHEDSLIKSTT
FT                   KVKTLDDAAGRTFLPEGIPDQSSKLSEADQQYAGRYHTRISCEDNFADCETGEAEYILN
FT                   LLPDGTAYWNVVHFGRVGSKDGSKSAVINQLCPSLKWKVEPATHELTIQCPLSDVNFYF
FT                   DIDAKQRLVVNLEKLFYSDFGKNREFLEQNYFVPTKAYVLDKE"
FT   gene            complement(430260..432083)
FT                   /gene="mmgC_1"
FT                   /locus_tag="ABBFA_00401"
FT                   /old_locus_tag="CTY05_00401"
FT   CDS_pept        complement(430260..432083)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mmgC_1"
FT                   /locus_tag="ABBFA_00401"
FT                   /old_locus_tag="CTY05_00401"
FT                   /product="Acyl-CoA dehydrogenase"
FT                   /EC_number="1.3.99.-"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:P45857"
FT                   /protein_id="ATY42867.1"
FT                   /translation="MPAYKAPLHDIRFLMNEVLDYPAHYKTLSNGESADPDTVDMILEG
FT                   AADYCENVLSPLNQSGDEEGCHFDNGEVKTPKGFKEAYDQFVMGGWQGLSYPEEFGGQG
FT                   LPMSLNLIKSEMMGTANWSFTMYPGLSSGCMNTILQFGTDEQKQTYMPKLVEGTWSGTM
FT                   CLTEPQCGTDLGQVKTKAEPQADGTYKISGTKIFISAGEHDLTENIIHIVLARLPDAPA
FT                   GTRGISLFIVPKFIPTADGGVGERNTVSCGSIEHKMGIRASATAVLNFDNATGYLIGEV
FT                   NKGLHAMFTFMNTARIGTAVQGIAHAELSFQGALPYAKERMSMRALSGKKDPDKVADAI
FT                   IHHADVRRMLLTQKAIAEGGRSMIYYAAQLADKMTDALTRGDQAAFEDYDDKLGFYTPI
FT                   LKGFLTELGLEAANHGMQVYGGHGYIKEWGMEQIVRDARISTLYEGTTGVQALDLIGRK
FT                   VLLSSKGKVVREYTAEILKFCAAHARNKYLRRFAWDLTKLCAQWNTLTVRIMLAARKDR
FT                   DIVSSASVDFLMFSGYVMMAYFWAQQAVVASEKLEAGNGQETPEFYKAKIKVADFYFDR
FT                   LLPRAQGHAESMVTTSRTLTSLPAEHFSFDY"
FT   gene            432341..434644
FT                   /locus_tag="ABBFA_00402"
FT                   /old_locus_tag="CTY05_00402"
FT   CDS_pept        432341..434644
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABBFA_00402"
FT                   /old_locus_tag="CTY05_00402"
FT                   /product="hypothetical protein"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /protein_id="ATY42868.1"
FT                   /translation="MHLKYLSLCLFSLGLTACAQHGVRSQVASASLEQKAIQSVNAMYE
FT                   YPSYDYRGNFKITVDPSQIKQNVKAENTAKLDAELQKKVDQYLREQKVALSKAQKQTLY
FT                   AAIANEQGDLGLTSSARSEKINTVLFNLLNDLQFSYDGSIHYRQKMGSFNLTARYEKPT
FT                   LLVQAKLPMVLDLENYKFYINYFGLMPYLVNKDNQNNLAYVDFSKYKAFFKNVDKKKFI
FT                   EYLKASSAVSYRLAEPQNLQRVSLTEADRKAGAVERIRLKTTVEQLLLEVDLFGQVNEK
FT                   YLQKSVLGLDEEKLAETLAAEIAASDAKKGTPDKEEQKVSSDDAAAVSQQLYSLVNAHL
FT                   GNTSTSEDEEVESASSEEASDVAVAETEQTSENEEVVALTEDQCIELKSLKKPVALGDI
FT                   NYCQIYGIDVLDQSDTSIQKAQIKSRQDALKQIFEAYNQNQFINDEAFKALWLKHKDEI
FT                   EQALPKQRNPITIDVALDDKGRAVNMDYDVDYTPAEFKHRFNIKADMQILNYGKATSID
FT                   QQQLKQAKSVAEASKGSMLENFIKGFSEKLGQSDVSEHPVGTHSDVQDLDANLAVLADK
FT                   TYDATHAYDKTYKAVFIAKLTAEKPSYIKYYSVQQLQEIAEVYAYWFSDEDTYNPQGKA
FT                   LERITALQKKHHLEQDDQFDHELGRAVDHIVLTTIQGKTGREAWQKLQKQYKQPGQLFS
FT                   KQYQLEFEKQNGVSAEEKHLLSETADILGNVYVAARKKQLSEKTIQNLKPEHNEFIDYE
FT                   IFREVYKQMVTAKK"
FT   gene            complement(434690..435478)
FT                   /gene="aroE"
FT                   /locus_tag="ABBFA_00403"
FT                   /old_locus_tag="CTY05_00403"
FT   CDS_pept        complement(434690..435478)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroE"
FT                   /locus_tag="ABBFA_00403"
FT                   /old_locus_tag="CTY05_00403"
FT                   /product="Shikimate dehydrogenase"
FT                   /EC_number="1.1.1.25"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:P15770"
FT                   /protein_id="ATY42869.1"
FT                   /translation="MTKQFAVIGNPIEQSRSPELHHAFAEKTGVDLNYQKRLAPLDGFE
FT                   SSMRSFFAEGGSGMNVTVPFKEQAFALCDVLTERAQIAKAVNTLWMENGKLHGDNTDGQ
FT                   GLVAAIQALEWNLENTTILILGAGGATRGVIYPLVQAGAQKIVIANRTLARAEQLVDDL
FT                   KTAVPQAQLQAISLNDLEGDFDIMINATSTSLSGDALQLPEKLQFKYAYEMAYGKPSSF
FT                   IDQAKQRNVPYAEGFGMLVGQAIEAFYIWNGVRPQLKDFL"
FT   gene            complement(435652..436602)
FT                   /gene="hemF"
FT                   /locus_tag="ABBFA_00404"
FT                   /old_locus_tag="CTY05_00404"
FT   CDS_pept        complement(435652..436602)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemF"
FT                   /locus_tag="ABBFA_00404"
FT                   /old_locus_tag="CTY05_00404"
FT                   /product="Coproporphyrinogen-III oxidase, aerobic"
FT                   /EC_number="1.3.3.3"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:Q3KKE0"
FT                   /protein_id="ATY42870.1"
FT                   /translation="MQHPTSTDIQRVREFLLDLQARICAGLEQQEKAGGGTAEFIIDDW
FT                   ERPEGGGGRSRVLQNGTVIEKGGVMFSHINISKLPASATERHPQIAGAKAQALGVSLVI
FT                   HPKNPNIPTSHANVRLFVAEREDQDPIWWFGGGFDLTPFYPDDQDVLNWHQAAYDLCKP
FT                   FGDNVYAEHKKWCDDYFYLKHRDEQRGVGGLFFDDLNCWDFETCFKYIQAVGNGYLNAI
FT                   LPIFEKHREQPYTEAQREFQLYRRGRYVEYNLVYDRGTLFGLQTGGRIESILVSLPNLA
FT                   AWSYRPEWDEDSPEKRLTDYYLKPRDWLGLEEKVA"
FT   gene            complement(436730..437332)
FT                   /gene="ribA"
FT                   /locus_tag="ABBFA_00405"
FT                   /old_locus_tag="CTY05_00405"
FT   CDS_pept        complement(436730..437332)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ribA"
FT                   /locus_tag="ABBFA_00405"
FT                   /old_locus_tag="CTY05_00405"
FT                   /product="GTP cyclohydrolase-2"
FT                   /EC_number="3.5.4.25"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:P0A7I7"
FT                   /protein_id="ATY42871.1"
FT                   /translation="MPIEFIATSKLPTAFGEFNISVFQDPVTGEEHVALSKGLENPPTG
FT                   PVLVRVHSECLTGDAFASLKCDCGPQLQATQKLINEAGQGVILYLRQEGRGIGLTNKIR
FT                   AYALQDQGHDTVDANLLLNLPADARRYDMCSIMLDHLKVKEVKLITNNPLKIQALKDQG
FT                   INVVDRVPLTVGRNPFNEQYLKTKRERMDHLYQKDDF"
FT   gene            437636..439540
FT                   /gene="dxs_1"
FT                   /locus_tag="ABBFA_00406"
FT                   /old_locus_tag="CTY05_00406"
FT   CDS_pept        437636..439540
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dxs_1"
FT                   /locus_tag="ABBFA_00406"
FT                   /old_locus_tag="CTY05_00406"
FT                   /product="1-deoxy-D-xylulose-5-phosphate synthase"
FT                   /EC_number="2.2.1.7"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:Q9KGU7"
FT                   /protein_id="ATY42872.1"
FT                   /translation="MLYTEIPTQRPVTPLLDAIDHPQQLRQLEHSQLLQVADELRQYIL
FT                   YAAGQSGGHFGANLGVVELTVALHYCFNTPNDRLVWDVGHQAYPHKILTGRREQITTIR
FT                   AKNGLAAFPAREESVFDTFGVGHSSTAISAGLGMSLARRYQKDPCEVVCIVGDGAMTAG
FT                   MAFEAMNDAVAHDADLIVVLNDNDMSISCSTGGFAKHLAAIWEKGHLVNVNEHGEAYIQ
FT                   PHPKWTYNSRLHQSATDAADNLFKAIGFDYFGPFDGHDVTQLVQVFNALKKRKGPRLVH
FT                   VYTKKGKGFAPAEADPITYHAIGKINAASGGKTPPKYSDVFGEWLCDEAAQDERLLAIT
FT                   PAMCEGSGMVKFAKQFPQRFFDVAIAEQHAVTLAAGMACEGLKPVVAIYSTFLQRGYDQ
FT                   LIHDVALQNLDVTFGIDRAGLVGEDGPTHAGAYDYAYMRTVPNMVIMAPKDENECRQML
FT                   HTAYAYNGPAAVRYPRGAGVGVEIQKEMTVLELGKAEIVAEIKANSDEQITVLAFGSRV
FT                   MVALEAAEQFAQKHDVSVCIVNMRFVKPLDEQMIRDLAEHTHLFVTVEEHAIMGGAGSA
FT                   VNEFMAQEQIVKPIINLGLPDSFLHQATHNQMLQDCGLDAKGILNSIERAWLKVNQVV"
FT   gene            439612..440493
FT                   /gene="suhB"
FT                   /locus_tag="ABBFA_00407"
FT                   /old_locus_tag="CTY05_00407"
FT   CDS_pept        439612..440493
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="suhB"
FT                   /locus_tag="ABBFA_00407"
FT                   /old_locus_tag="CTY05_00407"
FT                   /product="Inositol-1-monophosphatase"
FT                   /EC_number="3.1.3.25"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:P0ADG4"
FT                   /protein_id="ATY42873.1"
FT                   /translation="MHYSLSKSSNLYCSGCSMEPMVVMAARAAQTVGQELLKAHQNRHK
FT                   LDLQVEEKGIDGPVTRVDRYLEQLTIDTLRKSYKNHSFLGEEFGLQEGKGHDADWCWVI
FT                   DPLDGTQNFINGFPHFCISIAVQHKGVTQHGVIYDPVRDELFSASRGRGAVMNQRRIRV
FT                   NVKDSLENTFLAVGHPYRAKRAGEIVSYAEQHFASLLAVTQAGAQIRRGGSAALDLAYV
FT                   AAGRFDGFFELGLKPWDIAAGELIIKEAGGVVVDARGGNDSLENGQVIACSLKMLKPLM
FT                   QTVVPAWGKAAK"
FT   gene            440903..442750
FT                   /gene="deaD"
FT                   /locus_tag="ABBFA_00408"
FT                   /old_locus_tag="CTY05_00408"
FT   CDS_pept        440903..442750
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="deaD"
FT                   /locus_tag="ABBFA_00408"
FT                   /old_locus_tag="CTY05_00408"
FT                   /product="ATP-dependent RNA helicase DeaD"
FT                   /EC_number="3.6.4.13"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:P0A9P6"
FT                   /protein_id="ATY42874.1"
FT                   /translation="MSKTFAEFSLHETLQQALEGLGFTNPTPVQEQSIPAALEGKDLLV
FT                   SSQTGSGKTAAFLLPTLHNLAGQDTFVPFKERMKAVTQPSILVLCPTRELAQQVSQDAI
FT                   AFVRHMKGVRIAAIMGGMPFGKQIQQLKGAQVVVATPGRLLDLVNRRQLKLDKVDALIV
FT                   DEADRMLDLGFSEDLEAISDLAANRGQTLMFSATFADRIIRLAERMMNEPERIAIETGH
FT                   STNTDITQTLHWTDGFEHKKKLLTHWLADETLDQAVVFASTQEDTDMLAEELAEAGHSV
FT                   VALHGAMPQTVRNRRLRSIREGRAKILVATDVAARGLDVPTISHVINFGLPMKHEDYVH
FT                   RIGRTGRAGRTGQAITLATYRERGKIRALEDYLEARLNVSEIEGLEPSPPPARPRREGG
FT                   RGGNGGRDGRRGGGFGGGRRFEGEGNFKRREGGRDDRPRRSFDDKPRGERPAFGGEDRP
FT                   RREFNSDRPRREGGFEDRPKRSFGGEDRPRREFNSDRPRREGGFEDRPKRSFGGEDRPR
FT                   REFNSDRPRREGGFNDKPRFDSNDDNRGNRVDYKPRRENGFGDRPQRSFGGEDRPRREG
FT                   GFGDRPKRSFGGEDRPRRAVREEHFNQESRGERRRKFDR"
FT   gene            442842..443027
FT                   /locus_tag="ABBFA_00409"
FT                   /old_locus_tag="CTY05_00409"
FT   CDS_pept        442842..443027
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABBFA_00409"
FT                   /old_locus_tag="CTY05_00409"
FT                   /product="hypothetical protein"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /protein_id="ATY42875.1"
FT                   /translation="MFIVIMRKSKRKESPLAWLSKFLFQRGLPYLFIALALCNGIYFAY
FT                   ALLTGHFVDQFQVLDQ"
FT   gene            443154..443972
FT                   /locus_tag="ABBFA_00410"
FT                   /old_locus_tag="CTY05_00410"
FT   CDS_pept        443154..443972
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABBFA_00410"
FT                   /old_locus_tag="CTY05_00410"
FT                   /product="putative ABC transporter ATP-binding protein"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:P45031"
FT                   /protein_id="ATY42876.1"
FT                   /translation="MNNKTPLSTQSLIEVKNLSFNRGERVIYDNISLNIRRGQITAIMG
FT                   PSGTGKTTLLRLIGGQLVPDHGEVLLDGKDIAQMSRQELFAARARMGMLFQSGALFTDM
FT                   SVYENVAFPIRAHTKLSENLIAELVALKLESVGLRGTEQLMPTELSGGMNRRVALARAI
FT                   ALDPDLIMYDEPFAGQDPIVMGVLTRLIRSLREALDLTTIIVSHDVAETLSIADYIYVV
FT                   AEGRIQGEGTPEQLKAHASPFVKQFLTGSVEGPVEYQFSHQAYLDNEVRP"
FT   gene            443969..444748
FT                   /gene="mlaE"
FT                   /locus_tag="ABBFA_00411"
FT                   /old_locus_tag="CTY05_00411"
FT   CDS_pept        443969..444748
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlaE"
FT                   /locus_tag="ABBFA_00411"
FT                   /old_locus_tag="CTY05_00411"
FT                   /product="putative phospholipid ABC transporter permease
FT                   protein MlaE"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:P64606"
FT                   /protein_id="ATY42877.1"
FT                   /translation="MNTIAWLGRLVIERIRGIGAAAHMLLQIIFSFPTKGGFGRFVYQM
FT                   HRVGVMSLLIIAVSGLFIGAVLGLQMYSILVTFGAESMLGTAISLTLLRELASVVAALL
FT                   FAGRAGSALTAEIGSMKQSEQLASMEMIGVDPLKQIVSPRLWAGIVSLPMLTVIFAAIG
FT                   IIGGKMVGVDFLGADEGSFWSGMQNTVRFGHDIFNGTIIKSIVFALICTWVAVYQGYAC
FT                   DPTPEGIATAMTRTVVYSSLCVLGFDFVLTAVMFGGI"
FT   gene            444748..445428
FT                   /gene="mlaD"
FT                   /locus_tag="ABBFA_00412"
FT                   /old_locus_tag="CTY05_00412"
FT   CDS_pept        444748..445428
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlaD"
FT                   /locus_tag="ABBFA_00412"
FT                   /old_locus_tag="CTY05_00412"
FT                   /product="putative phospholipid ABC transporter-binding
FT                   protein MlaD"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:P64604"
FT                   /protein_id="ATY42878.1"
FT                   /translation="MKSRTSELAVGIFVIIFGIALFFLAMKVSGLVGTNLSDGYTMKAQ
FT                   FDNVNGLKPRAKVTMSGVTIGRVDSITLDPVTRLATVTFDLDGKLTSFNAEQLKEVQKN
FT                   ALDELRYSSDYTQATPAQQKTMEQQLISNMNSITSIDEDAYIMVATNGLLGEKYLKIVP
FT                   GGGLNYLKRGDTISNTQGTMDLEDLISKFITGGGAGKVAAGSSSAEEKAPASTDSSAQP
FT                   SFVE"
FT   gene            445455..446096
FT                   /gene="mlaC"
FT                   /locus_tag="ABBFA_00413"
FT                   /old_locus_tag="CTY05_00413"
FT   CDS_pept        445455..446096
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlaC"
FT                   /locus_tag="ABBFA_00413"
FT                   /old_locus_tag="CTY05_00413"
FT                   /product="putative phospholipid-binding protein MlaC
FT                   precursor"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:P0ADV7"
FT                   /protein_id="ATY42879.1"
FT                   /translation="MNTLFKQTLTASILSTMIAGTAFAAPSEAPPDFIKRVADGLISRL
FT                   KADHAKLQNNPALVKTIVRQNLDPYVDSQAFTRIVMGTYATNQYSTAAQRAQFETNFRN
FT                   TLIENYGSAFAKYTNQTYTMRPYKATAGKNPVVTLDFNHNGEKIPVSFQLADKGSQWKI
FT                   RNINVSGIDLGLQFRNQFAATVKRNGGDLNKAIATFQPDADAAVNQNKQK"
FT   gene            446108..446395
FT                   /locus_tag="ABBFA_00414"
FT                   /old_locus_tag="CTY05_00414"
FT   CDS_pept        446108..446395
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABBFA_00414"
FT                   /old_locus_tag="CTY05_00414"
FT                   /product="hypothetical protein"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /protein_id="ATY42880.1"
FT                   /translation="MVQYLNQELVVSGKIDFENAEQQYQAGLAIIKKQTSFPLIVDLKQ
FT                   LEHGNTLALAVLVQWLRQTPQKSGLHFKNVPEKMLKIIQACHLQEDLHLV"
FT   gene            complement(446465..447478)
FT                   /gene="corA_1"
FT                   /locus_tag="ABBFA_00415"
FT                   /old_locus_tag="CTY05_00415"
FT   CDS_pept        complement(446465..447478)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="corA_1"
FT                   /locus_tag="ABBFA_00415"
FT                   /old_locus_tag="CTY05_00415"
FT                   /product="Magnesium transport protein CorA"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:P0ABI4"
FT                   /protein_id="ATY42881.1"
FT                   /translation="MLEAFYATERGSLEDATINGGFDLHPELVWLDLIAPSQEEQQWVL
FT                   DAYNQNLPTLKSLEDISSSARFYRDDDGILHISTYFLTKNKNYQVDGDAEDSSHMLAMV
FT                   QTVAFILHKDRLFTLRGEKLVAFRAFRARARRNDYEMDYKDPTWILLGLLEAKLDELAD
FT                   ILEDIHKDLEKYSTEVLNNHQREQILDLDDMITRLAQQEDMLGKAQLCLIDLRRVLTFL
FT                   SRPRALGSHIYDADIRELSEDVRSLVEHDAFLFQKVRFLLDTTSGFINTEQNDTIRRFS
FT                   ILPSMLAPPMLIASIYGMNTDVLPFAHGTTSFIIVLLIIIGFFIGPIIYFRWKKWI"
FT   gene            447636..448217
FT                   /gene="yvdD_1"
FT                   /locus_tag="ABBFA_00416"
FT                   /old_locus_tag="CTY05_00416"
FT   CDS_pept        447636..448217
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yvdD_1"
FT                   /locus_tag="ABBFA_00416"
FT                   /old_locus_tag="CTY05_00416"
FT                   /product="LOG family protein YvdD"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:O06986"
FT                   /protein_id="ATY42882.1"
FT                   /translation="MNSICIFCGSSLGSNPIFQQIAQLTGEAIAKQGKTLVYGGGRSGL
FT                   MGVVADSALQAGGQVIGVIPRALVDRELAHPGLTKLYVVENMHERKTKMADLSDGFIAL
FT                   PGGAGTLEEIFEQWTWAQLGIHQKPCAFLNVAGFYEDLLKMIQGTVDNGFSQARFVDKL
FT                   IVSDKIEDILQQFEQYQAPAPKWTNADVQP"
FT   gene            448232..448633
FT                   /gene="mutT_1"
FT                   /locus_tag="ABBFA_00417"
FT                   /old_locus_tag="CTY05_00417"
FT   CDS_pept        448232..448633
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mutT_1"
FT                   /locus_tag="ABBFA_00417"
FT                   /old_locus_tag="CTY05_00417"
FT                   /product="8-oxo-dGTP diphosphatase"
FT                   /EC_number="3.6.1.55"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:P08337"
FT                   /protein_id="ATY42883.1"
FT                   /translation="MKTITVAAAVILNEQNELLLVRKRNTQAFMQVGGKLEPNEAPESA
FT                   IQREILEEIGSPCVIEQFIGRFETAAANEPDHTLISHLYLVRLKQSPQIAAEIAEMKWV
FT                   KFNDSETKLAPLTKEIVIPWCEQNLSITL"
FT   gene            complement(448636..449277)
FT                   /locus_tag="ABBFA_00418"
FT                   /old_locus_tag="CTY05_00418"
FT   CDS_pept        complement(448636..449277)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABBFA_00418"
FT                   /old_locus_tag="CTY05_00418"
FT                   /product="DNA utilization protein GntX"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="protein motif:CLUSTERS:PRK11595"
FT                   /protein_id="ATY42884.1"
FT                   /translation="MHMFKFLNPQYLFQLLSPCLLCEIGTREKYSLCKECWEQLPWLKQ
FT                   TIQRNDQSVLVACHYAYPINRIIQQFKYEQKLHYQTLLAEVLQQLKFPKVQAIVPMPIS
FT                   KQRLTERGFNQSLLLANLLSKQLKIPVWQPVQRLNEHSQKGLSRLERFENIEQQFVALT
FT                   QEKRRYRRVLIIDDVITTGSSIHALSQALKQLGCTSIHASCLAAASSTSY"
FT   gene            complement(449264..451309)
FT                   /gene="recG"
FT                   /locus_tag="ABBFA_00419"
FT                   /old_locus_tag="CTY05_00419"
FT   CDS_pept        complement(449264..451309)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recG"
FT                   /locus_tag="ABBFA_00419"
FT                   /old_locus_tag="CTY05_00419"
FT                   /product="ATP-dependent DNA helicase RecG"
FT                   /EC_number="3.6.4.12"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:P24230"
FT                   /protein_id="ATY42885.1"
FT                   /translation="MTSVHQLQGVGSASAALLEKLNIFTTDDLLFHLPRDYEDRSTIIP
FT                   MNQLVVGRSYLLEGEVKSVDFPPGKRKSMAALIQDEFGKVTLRFYHIYKNLTDKIKPGN
FT                   RLRIFGEVRVGARGLELYHPEIQLINEHTPLPKTQLTAIYPSTDGLTQAKLREYVKQAL
FT                   KHHSDALPELLPKQYTNGYALKEALHYIHEPPVDANMIQLAQGSHPAQQRLIFEELVAH
FT                   QISLLTRRAYIRQIASPAFPSSKVLAKKLLEALPFQMTNAQKRVSKEILNDLKQHQPML
FT                   RLVQGDVGAGKTLVAAVAACHALEADWQVALMAPTEILAEQHYLNFKRWFEPLGITVAW
FT                   LSGKQKGKARAHAEQQIKEGHAELIVGTHALFQDNVEFAKLGLVIIDEQHRFGVDQRLA
FT                   LRNKGAEQLTPHQLVMTATPIPRTLAMSAYGDLDTSIIDELPPGRTPIQTVTIPLDRRE
FT                   EVLQRIASNCREGKQAYWVCTLVEQSETLDAQAAEATYQEMKERFPELNIGLVHGKMKA
FT                   DEKQAVMQAFKNNELQLLIATTVIEVGVDVPNASIMVIENAERLGLSQLHQLRGRVGRG
FT                   AKASFCVLLYKPPLSQNGQERLSILRESNDGFVIAEKDLELRGPGELLGTKQTGDMGFR
FT                   VARLERDDHLLSQAHYVAQQVLKDYPEQADALLKRWLPEAPRYAYV"
FT   gene            451330..452145
FT                   /locus_tag="ABBFA_00420"
FT                   /old_locus_tag="CTY05_00420"
FT   CDS_pept        451330..452145
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABBFA_00420"
FT                   /old_locus_tag="CTY05_00420"
FT                   /product="hypothetical protein"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /protein_id="ATY42886.1"
FT                   /translation="MHILFIGYGKTSQRVAKQLFEKGHQITTISRSEKTDPYGTHLVQD
FT                   IFTLDLSEIAPVDVVYILLSPDDSTVEGYQHTYVDSIEPIRQALKSHPVKRLIVVSSTR
FT                   VYGENSGETIDDHSEIHPNDAQGHILHNMELLWQKYFPSQCVIVRPTGIYGASIDRLKR
FT                   MAEHTQTYPNIHYSNRIHIDDLARFLVFLADFEKPHKSYLVANNAPVPLHEVLLWFQSQ
FT                   LDLPLLTLDSAHVSGKKIYAKHLFETGFQLEHPICFNDYLLCLNAHGTN"
FT   gene            452225..453211
FT                   /locus_tag="ABBFA_00421"
FT                   /old_locus_tag="CTY05_00421"
FT   CDS_pept        452225..453211
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABBFA_00421"
FT                   /old_locus_tag="CTY05_00421"
FT                   /product="hypothetical protein"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /protein_id="ATY42887.1"
FT                   /translation="MKKFCLALFLSVTSVTSWAGDQVWCAYDPAGTQGDITRRLNDIRL
FT                   YAQQYQVKFKVVSYQKEQQAIQAFDEGKCSGLAASNFNTYQYNHFMGSTSGIGLIPNNR
FT                   TARNLLQLLNHPTIEKRLINKDYEAVGMIPVGTANMVMKTKKISKVAQLRGQRIGVLAN
FT                   NPPQQALVRSVGAQPVYVDLSNAIAQFQQNKIDIMPAPVYGLLPYNLQKDFGPDTQVIN
FT                   FPLAYFGVNIIIKPQAYPANFGRKIRAWFVQNSQLLTNRAIQWENHLPAYYWVDVSFYE
FT                   KQSYDIMVAKIRNQYVRSGYYDAYFVELMKRLRCIDDPRYFECPMSR"
FT   gene            complement(453255..455828)
FT                   /gene="plsB"
FT                   /locus_tag="ABBFA_00422"
FT                   /old_locus_tag="CTY05_00422"
FT   CDS_pept        complement(453255..455828)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="plsB"
FT                   /locus_tag="ABBFA_00422"
FT                   /old_locus_tag="CTY05_00422"
FT                   /product="Glycerol-3-phosphate acyltransferase"
FT                   /EC_number="2.3.1.15"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:P0A7A7"
FT                   /protein_id="ATY42888.1"
FT                   /translation="MSKSGFGQMYRRLSSKLLDLVVTPHVLGEVPTEPVSATTETEAKT
FT                   ERQKVVCYVLQNHSRSNALVVDGETRRLNLKPALDPLVIGTHQEKASVLFLQHNDENNL
FT                   LNPPPHAFPPRLIKLIEVLQANPELDIELVPVTVLWGRSPDKEDSWFKLLFSDTWATPS
FT                   TVKQLVNIGLHGRQSYLEFHEPQSLRDLVEYAQKHYPNLSPATYIVSTLNDYLDRQREV
FT                   VLGPDLSDRRNVMQSVLKSRDVQEAIRRESIRGKISMLEAERRAIGYVNEIVSDYSHSA
FT                   VRFADLALTRLWTQLYDGVEVHNFSTVRELAKDYEIVYTPCHRSHIDYLLLSYVIYKRG
FT                   LMVPYIAAGDNLNLPFVGQLLRGGGAFFIRRSFRGNGLYTSVFKEYLYSILSRNTPLEY
FT                   FIEGGRSRTGRLLPPKTGMLAMTVHSHLRGRAKPIVFVPTYIGYERLMEGSTYVGEMQG
FT                   KPKEAESIFGILKTLRKIERIFGKVHVNFGEPVFLDDLLKQHNAENVYIEKNDDPVPPA
FT                   VSEAVNSSANAILENINRAVVINPVSLLSIILLATPKHTLDEEICIKQLEAYRNLASNF
FT                   PYDQRTEVTPLSGKEIIAYGLKLKLIKRVQHALGDIIAIEDNQAVLLTYFRNNILHAFV
FT                   LPSLIASLVEHNGKISLADLSNVIYTLYPFLKAELFLKWKSSELKEQIEQYADALVQSN
FT                   LIQQDDEGNLISSAPNTEEHNQLVVLATPVKQSLERYYMTLALITQRGSGNISAKQVEE
FT                   LSHLLGQRLSVLYEFNSPEFFDKALFQSFIKVLTQQNYIRTNDQGQIEFDDNFRQMAAG
FT                   AQLVLDEVTLQMLQHITTFTDEELKEALEAMASQQAKRRLKRKKA"
FT   gene            456104..456976
FT                   /gene="tesB"
FT                   /locus_tag="ABBFA_00423"
FT                   /old_locus_tag="CTY05_00423"
FT   CDS_pept        456104..456976
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tesB"
FT                   /locus_tag="ABBFA_00423"
FT                   /old_locus_tag="CTY05_00423"
FT                   /product="Acyl-CoA thioesterase 2"
FT                   /EC_number="3.1.2.-"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:P0AGG2"
FT                   /protein_id="ATY42889.1"
FT                   /translation="MNALTQELVELLTLEKLEENIYRGISRNLVGKRVFGGQVLGQALR
FT                   AASYTTDRPAHSLHAYFLYGGDINAPIIYEVDRLRDGKSFVSRQVRAIQHGRVIFSAMV
FT                   SFANPEEGLNYQHPEPDYPAPEALKSESELKEGILNFVPENVRASFMRERHVEIRPIDP
FT                   VNPFQPQPEAPFNAHYIRTHDRIPKQLDDISLHQAIVAFYSDFTLMTTALRPHGLSYIS
FT                   PSLQCASIDHAIYFHRPLRADEWMLYDMEATVSAASRGLNFGRMWQNGQLVCSTVQEGL
FT                   MRLREIETQ"
FT   gene            457029..458348
FT                   /gene="gltP_1"
FT                   /locus_tag="ABBFA_00424"
FT                   /old_locus_tag="CTY05_00424"
FT   CDS_pept        457029..458348
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gltP_1"
FT                   /locus_tag="ABBFA_00424"
FT                   /old_locus_tag="CTY05_00424"
FT                   /product="Proton glutamate symport protein"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:P21345"
FT                   /protein_id="ATY42890.1"
FT                   /translation="MTKNCSNEKQAHVIFTKGLPTEKNNVDMNLNTQILIAAILGLAFG
FT                   FLLTMYPDTAFVKHSLYGLGILSSVFIGLLKMLLVPLIFSSIVVGVSNLQAGGQLGPVW
FT                   KITFLCCITTTTLALILGISCAHLFEVGRGVDISIFQASMQSYQTPDSLNPATFFTNFI
FT                   QNTLINPFKAFSDGNVLAVVVFALFVGVALVHGGERFKSIRVLSHQFFEMMMMLVGWVM
FT                   KLAPLGIFALLAKLMATEDISVLSRLAEFAAVVTGTTIFHGAVVLPLLLWIFGRMSPWT
FT                   FFKGTRTALITAFATSSSSATMPLSMKCAQENLGVRPQTAGFVIPLGTQLNMDGTALYE
FT                   AAAALFVANLVGLDLNLTQQIVVCLTAMIASLGAPGIPSAGMVTMIMVLQSVGLPAEAI
FT                   AILLPIDRLLDTVRTVVNVQGDMMISVVVDRYTKDKDISI"
FT   gene            complement(458391..459338)
FT                   /locus_tag="ABBFA_00425"
FT                   /old_locus_tag="CTY05_00425"
FT   CDS_pept        complement(458391..459338)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABBFA_00425"
FT                   /old_locus_tag="CTY05_00425"
FT                   /product="putative metal-dependent hydrolase"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="protein motif:Pfam:PF10118.3"
FT                   /protein_id="ATY42891.1"
FT                   /translation="MKLLSFLKNKALGSSIDYKILPRKVKFDWKDTPIDWIPNQPFASY
FT                   FINEINNILPAGEFWFCRLYNKVLPRITDEKLKQDVQAFIRQEAMHANAHTSANKEYLS
FT                   ARNIDIQRNLDIMNYLFTTALADKPFDKEVPQFLQEQWDLFRLGVIATVEHMTCVLGKY
FT                   ALYNKRWEELGADPEMVDLVKWHGSEEIEHRTVAFDLYRHLGGGYIPRYYLSLAVIVLV
FT                   LGLWVDGAAHIMKQDPRFADAAKSRFFAAWVALEWYKISRKDNQVLPNPIWLIAQQIDY
FT                   LMPWYDPVKEGSTEDAVSYLSQSPAAKRAELQAA"
FT   gene            complement(459465..460241)
FT                   /gene="engB"
FT                   /locus_tag="ABBFA_00426"
FT                   /old_locus_tag="CTY05_00426"
FT   CDS_pept        complement(459465..460241)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="engB"
FT                   /locus_tag="ABBFA_00426"
FT                   /old_locus_tag="CTY05_00426"
FT                   /product="putative GTP-binding protein EngB"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:P0A6P7"
FT                   /protein_id="ATY42892.1"
FT                   /translation="MRRSEKSKDTKARLAPKQKISYEKKPDPAITAYAVQSLNWLRQAE
FT                   FLMSAPKLALCVEDSGYEIAFAGRSNAGKSSAINALTNQKQLARASKKPGRTQMINFFS
FT                   LGNPDQRLVDLPGYGYAAVPEDMKRVWQKELENYLIHRKSLQGLVLLMDIRHPLQHFDM
FT                   MMLEWAYSRHLFVHILLTKADKLNRGPANKVLLEVKQQLKKMKLDFSIQLFSSLNKLGL
FT                   EELASVMAGRLHFTLEQQPEFDVNAIPEASNEDAEE"
FT   gene            complement(460350..460787)
FT                   /gene="nsrR"
FT                   /locus_tag="ABBFA_00427"
FT                   /old_locus_tag="CTY05_00427"
FT   CDS_pept        complement(460350..460787)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nsrR"
FT                   /locus_tag="ABBFA_00427"
FT                   /old_locus_tag="CTY05_00427"
FT                   /product="HTH-type transcriptional repressor NsrR"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:Q9L132"
FT                   /protein_id="ATY42893.1"
FT                   /translation="MQLNKFTDYALRILMYVARPSDAPYTIAEIAQDLYVSQNHLVKVV
FT                   HFMGKQEWIITIRGKGGGIRLNPKALDLKLGTIVRILQGDHQIVECNTPPCVLRSHCGL
FT                   KGILDQALESFYQSLDQYTLGEVLQQPKSASDHSPIAFLQI"
FT   gene            complement(460873..461637)
FT                   /gene="hmp"
FT                   /locus_tag="ABBFA_00428"
FT                   /old_locus_tag="CTY05_00428"
FT   CDS_pept        complement(460873..461637)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hmp"
FT                   /locus_tag="ABBFA_00428"
FT                   /old_locus_tag="CTY05_00428"
FT                   /product="Flavohemoprotein"
FT                   /EC_number="1.14.12.17"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:P39662"
FT                   /protein_id="ATY42894.1"
FT                   /translation="MTPQQIELVKSTVPVLREHGVTLTTYFYKRMLNNNPELKNVFNLD
FT                   DQTSLRQPRALAAAVLAYAENIENPTVLAKAVERITTKHVSLDIQPDQYAIVGDNLLHS
FT                   ISEVLNVPFESELIEAWKQAYLQLADILIGVEKQKYEQLESLKGGWAGWRSFEITQIDP
FT                   LESGKRFTLKATDHEDVLTSPANAFISVKVQVPNQQLEQPKAFKFTEAQEDNTYHFDVQ
FT                   PEEDHTEFSVSNILLEHYRVGDQVQVSAPLTL"
FT   gene            complement(461783..463330)
FT                   /locus_tag="ABBFA_00429"
FT                   /old_locus_tag="CTY05_00429"
FT   CDS_pept        complement(461783..463330)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABBFA_00429"
FT                   /old_locus_tag="CTY05_00429"
FT                   /product="AAA-like domain protein"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="protein motif:Pfam:PF12846.1"
FT                   /protein_id="ATY42895.1"
FT                   /translation="MGTPIVIAKNINDTSKEIVLLSQFANRHGLIAGATGTGKTVTLKV
FT                   LAESFSRIGVPVFLADAKGDVSSLAKAGEASDKFNERLKLLQIDSVPFAANPVVFWDLF
FT                   GQQGHPIRTTISEIGPILLARILNLNDTQEGVLSAVFRIADDQGLLLVDFKDLKAMITF
FT                   VSEHAAEFKAEYGNLSPASLGAIQRNLLALADQGGEQFFGEPALNILDFIQTDANGHGY
FT                   INILAADKLMNTPKLYATFLLWMLSELFEQLPEVGDMDKPKLVFFFDEAHLLFDNASQA
FT                   LQEKIEQVVRLIRSKGVGIYFITQNPLDLPESVLGQLGNRVQHALRAFTPKDQKAVKTA
FT                   ADTFRSNPDFKVDEAITELGVGEALISCLDEQGTPQIVERGWVMPPYSSFTPITPEERQ
FT                   TLISQSIIAGVYEQAVDRDSAYEMLQNKVAEREQQKQDAELAKQQAKEQETLAKQQAKE
FT                   QERLAREQQKEEERAARERAKLTQDIVGTFAKSAARSLGGSTGQKLVRGLLGSLFGK"
FT   gene            complement(463374..464564)
FT                   /gene="metC"
FT                   /locus_tag="ABBFA_00430"
FT                   /old_locus_tag="CTY05_00430"
FT   CDS_pept        complement(463374..464564)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metC"
FT                   /locus_tag="ABBFA_00430"
FT                   /old_locus_tag="CTY05_00430"
FT                   /product="Cystathionine beta-lyase"
FT                   /EC_number="4.4.1.8"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:Q07703"
FT                   /protein_id="ATY42896.1"
FT                   /translation="MKKHNNFQTQLIHAPRKAPQFIETVQPPLFRASTIIFKSTSHLFD
FT                   RHWTDPYDYSYGTHGTPTTFTLGDNIAQIEGGLYCLLAPSGLSAINLVNSAVLATGDEV
FT                   WVPDNIYGPNLEHLNYLKDQYGINVQVYNPIDVSSFHPSDKTKLLWLEAAGSVTLEFPD
FT                   LKALVKKAKAHGVLTALDNTWGAGLAFNAFDFSDEHLSVDLTIHALTKYPSGGGDILMG
FT                   SVVTRDEELHHRLFRMHAILGISVSGDDTAQIQRSLAHMSLRYEQQSNNAKTLLTWLKE
FT                   QSQFAQVLHPSDKASPGHQYWQEICSTGRSAGLVSVVFKSDYDISAVRRFCDALKLFKL
FT                   GFSWGGPVSLVMLYDLKMMRKLENTHLQQGLLVRFCIGLEDPQDLIQDIENALKQM"
FT   gene            464732..465460
FT                   /gene="guaA_1"
FT                   /locus_tag="ABBFA_00431"
FT                   /old_locus_tag="CTY05_00431"
FT   CDS_pept        464732..465460
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="guaA_1"
FT                   /locus_tag="ABBFA_00431"
FT                   /old_locus_tag="CTY05_00431"
FT                   /product="GMP synthase [glutamine-hydrolyzing]"
FT                   /EC_number="6.3.5.2"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:Q5SI28"
FT                   /protein_id="ATY42897.1"
FT                   /translation="MKSHLRVHYFQHIAGEGFGSCYSFLKAHHATITATEFFALPVDLP
FT                   LEIEALPHIEDVDLLLIMGGTMSVNDEANYPWLKIEKRWIRRYLAAGKPAIGLCLGGQL
FT                   IANALGAAVSRNRYQELGWSTVQRVPNLPKESFLLPEKINVMQWHSETFEIPKGAIHLA
FT                   ENSVCRNQMYQIGSNVLGFQFHPEMTPKVLNLLLENEQELSIFKGEYVQSLDELHHCDI
FT                   QKFEQGNQLLNRAIEFVVNQ"
FT   gene            465712..466023
FT                   /gene="rpsJ"
FT                   /locus_tag="ABBFA_00432"
FT                   /old_locus_tag="CTY05_00432"
FT   CDS_pept        465712..466023
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsJ"
FT                   /locus_tag="ABBFA_00432"
FT                   /old_locus_tag="CTY05_00432"
FT                   /product="30S ribosomal protein S10"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:P0A7R5"
FT                   /protein_id="ATY42898.1"
FT                   /translation="MSNQRIRIRLKSFDHRLIDQSAQEIVETAKRTGAQVCGPIPMPTR
FT                   IERFNVLTSPHVNKDARDQYEIRTYKRLIDIVQPTDKTVDALMKLDLAAGVDVQIALG"
FT   gene            466081..466719
FT                   /gene="rplC"
FT                   /locus_tag="ABBFA_00433"
FT                   /old_locus_tag="CTY05_00433"
FT   CDS_pept        466081..466719
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplC"
FT                   /locus_tag="ABBFA_00433"
FT                   /old_locus_tag="CTY05_00433"
FT                   /product="50S ribosomal protein L3"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:P60438"
FT                   /protein_id="ATY42899.1"
FT                   /translation="MAIGLVGRKCGMTRIFTDAGVSVPVTVIEVDPNRITQIKTLETDG
FT                   YQAVQVTTGERRESRVTNAQKGHFAKAGVAAGRLVKEFRVTEAELEGREVGGTIGVDLF
FT                   TVGQIVDVTGQSKGKGFQGGVKRWNFRTQDATHGNSVSHRVLGSTGQNQTPGRVFKGKK
FT                   MAGHLGDERVTVQGLEIVSVDTERSVLVVKGAIPGATGGDVIVRPTIKA"
FT   gene            466731..467333
FT                   /gene="rplD"
FT                   /locus_tag="ABBFA_00434"
FT                   /old_locus_tag="CTY05_00434"
FT   CDS_pept        466731..467333
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplD"
FT                   /locus_tag="ABBFA_00434"
FT                   /old_locus_tag="CTY05_00434"
FT                   /product="50S ribosomal protein L4"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:P60726"
FT                   /protein_id="ATY42900.1"
FT                   /translation="MNLKTVSGSAVELSEVAFGREFNEALVHQVVTAYLAGGRQGTRAH
FT                   KSRADVSGGGKKPFRQKGTGRARAGSIRSPIWVGGGKTFAARPQDWSQKVNRKMYRGAM
FT                   QCILAELVRQDRLVLVEEFAVAAPKTKELLAKLNDLNAARALIVTDAVDENLYLAARNL
FT                   PHVDVVDATAIDPVSLIAFDKVVMSVAAAKKIEVELG"
FT   gene            467330..467650
FT                   /gene="rplW"
FT                   /locus_tag="ABBFA_00435"
FT                   /old_locus_tag="CTY05_00435"
FT   CDS_pept        467330..467650
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplW"
FT                   /locus_tag="ABBFA_00435"
FT                   /old_locus_tag="CTY05_00435"
FT                   /product="50S ribosomal protein L23"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:Q9K1I6"
FT                   /protein_id="ATY42901.1"
FT                   /translation="MNNERIYQVLKGPVFSEKAQVLGDTAGVQVFKVDINATKLEIKKA
FT                   VEKLFGVEVVKVNTTITKGKTKRFGRTLGRRSDVKKAYVTLKAGQDVEMADLGDTAESA
FT                   AE"
FT   gene            467662..468486
FT                   /gene="rplB"
FT                   /locus_tag="ABBFA_00436"
FT                   /old_locus_tag="CTY05_00436"
FT   CDS_pept        467662..468486
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplB"
FT                   /locus_tag="ABBFA_00436"
FT                   /old_locus_tag="CTY05_00436"
FT                   /product="RplB"
FT                   /note="50S ribosomal protein L2"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:P60422"
FT                   /protein_id="ATY42902.1"
FT                   /translation="MPIQKCKPTSPGRRFVEKVVHDHLHKGAPYAPLVEAKKRTGGRNN
FT                   NGHITTRHVGGGHKQHYRIVDFKRNKDGVPAVVERIEYDPNRTAHIALLKYADGERRYI
FT                   IAPKGLRAGDKVQSGNDAPIRPGNCLPLRNMPIGSTLHNVELKIGKGAQLARSAGASVQ
FT                   LLGRDGSYAIIRLRSGEMRKVHVECRAVIGEVSNQENNLRSLGKAGAARWRGVRPTVRG
FT                   MAMNPIDHPHGGGEGRNKGIQPVSPWGQKAKGYKTRTNKRTTKMIIRDRRVK"
FT   gene            468500..468775
FT                   /gene="rpsS"
FT                   /locus_tag="ABBFA_00437"
FT                   /old_locus_tag="CTY05_00437"
FT   CDS_pept        468500..468775
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsS"
FT                   /locus_tag="ABBFA_00437"
FT                   /old_locus_tag="CTY05_00437"
FT                   /product="30S ribosomal protein S19"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:P0A7U3"
FT                   /protein_id="ATY42903.1"
FT                   /translation="MPRSLKKGPFVDAHLFAKVEAAVASNSRKPIKTWSRRSMILPDFV
FT                   GLTISVHNGRNHVPVIVTEHMVGHKLGEFAPTRTYRGHGVDKKSKR"
FT   gene            468787..469116
FT                   /gene="rplV"
FT                   /locus_tag="ABBFA_00438"
FT                   /old_locus_tag="CTY05_00438"
FT   CDS_pept        468787..469116
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplV"
FT                   /locus_tag="ABBFA_00438"
FT                   /old_locus_tag="CTY05_00438"
FT                   /product="50S ribosomal protein L22"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:P61175"
FT                   /protein_id="ATY42904.1"
FT                   /translation="MEVTAKLRGAAISAQKARLVADLIRGKSVAHALNILNFSNKKAAV
FT                   LVKKALESAIANAEHNNSLDVDDLKVSTIYVDEGMSLKRIMPRAKGRADRITKRTCHIT
FT                   VKVGV"
FT   gene            469118..469870
FT                   /gene="rpsC"
FT                   /locus_tag="ABBFA_00439"
FT                   /old_locus_tag="CTY05_00439"
FT   CDS_pept        469118..469870
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsC"
FT                   /locus_tag="ABBFA_00439"
FT                   /old_locus_tag="CTY05_00439"
FT                   /product="30S ribosomal protein S3"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:P0A7V3"
FT                   /protein_id="ATY42905.1"
FT                   /translation="MGQKVHPIGIRLGVVKRHNANWYANPKQYAEYLLKDLQVREFLTK
FT                   KLKNAMVSNILIERPSGAAKVTISTARPGIVIGKKGEDIEKLQRELTNIMGVPAQVSIN
FT                   EIDRPDLDARLVAEAIASQLEKRVMFRRAMKRAVQNTMRAGAKGIKVEVSGRLGGAEIA
FT                   RTEWYREGRVPLHTLRADIDYATMRAETTYGTIGVKVWIFRGEILGGMKQVMNPAPAEE
FT                   RPAKRGRGRGEGQERRGRRGDRAADKGE"
FT   gene            469874..470287
FT                   /gene="rplP"
FT                   /locus_tag="ABBFA_00440"
FT                   /old_locus_tag="CTY05_00440"
FT   CDS_pept        469874..470287
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplP"
FT                   /locus_tag="ABBFA_00440"
FT                   /old_locus_tag="CTY05_00440"
FT                   /product="50S ribosomal protein L16"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:P0ADY7"
FT                   /protein_id="ATY42906.1"
FT                   /translation="MLQPKRTKFRKVHKGRNTGLAHRGSTVSFGSIAIKATERGRMTAR
FT                   QIEAARRTISRRIKRGGKIFIRVFPDKPITEKPLEVRMGNGKGNVEYWVCEIKPGKILY
FT                   EIEGVNEDLAREAFALAAAKLPFKTTIVTRTVM"
FT   gene            470287..470484
FT                   /gene="rpmC"
FT                   /locus_tag="ABBFA_00441"
FT                   /old_locus_tag="CTY05_00441"
FT   CDS_pept        470287..470484
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmC"
FT                   /locus_tag="ABBFA_00441"
FT                   /old_locus_tag="CTY05_00441"
FT                   /product="50S ribosomal protein L29"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:Q9HWE3"
FT                   /protein_id="ATY42907.1"
FT                   /translation="MKTKDLREKSVEELKALLDEQQLNQFRLRMAKATGQLGKSHEVQV
FT                   ARKTIARIKTLLTEKQGNGQ"
FT   gene            470481..470738
FT                   /gene="rpsQ"
FT                   /locus_tag="ABBFA_00442"
FT                   /old_locus_tag="CTY05_00442"
FT   CDS_pept        470481..470738
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsQ"
FT                   /locus_tag="ABBFA_00442"
FT                   /old_locus_tag="CTY05_00442"
FT                   /product="30S ribosomal protein S17"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:Q1R616"
FT                   /protein_id="ATY42908.1"
FT                   /translation="MSEKTVRTLTGKVVSDKMDKSIVVLIERRVQHPLYGKSIRRSTKL
FT                   HAHDENNVAKIGDVVTIKESRPISKTKAWTLVEVVEAAAE"
FT   gene            470831..471199
FT                   /gene="rplN"
FT                   /locus_tag="ABBFA_00443"
FT                   /old_locus_tag="CTY05_00443"
FT   CDS_pept        470831..471199
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplN"
FT                   /locus_tag="ABBFA_00443"
FT                   /old_locus_tag="CTY05_00443"
FT                   /product="50S ribosomal protein L14"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:Q1R617"
FT                   /protein_id="ATY42909.1"
FT                   /translation="MIQTETMLDVADNSGARRVQCIKVLGGSHRRYASVGDIIKVTVKE
FT                   AIPRARVKKGDVMNAVVVRTKFGIRRPDGSVIRFDDNAAVILNNNKAPIATRIFGPVTR
FT                   ELRTEQFMKIISLAPEVL"
FT   gene            471209..471526
FT                   /gene="rplX"
FT                   /locus_tag="ABBFA_00444"
FT                   /old_locus_tag="CTY05_00444"
FT   CDS_pept        471209..471526
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplX"
FT                   /locus_tag="ABBFA_00444"
FT                   /old_locus_tag="CTY05_00444"
FT                   /product="50S ribosomal protein L24"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:P60624"
FT                   /protein_id="ATY42910.1"
FT                   /translation="MAKIKKGDQVIVIAGKEKGKQGTVLSVSEDRVKVEGLNLVKKHQK
FT                   PNRVTGAEGGIVTQEASLHISNVAILNATTQKADRVGYQVIDGVKTRVYKSTGESVAVA
FT                   K"
FT   gene            471542..472078
FT                   /gene="rplE"
FT                   /locus_tag="ABBFA_00445"
FT                   /old_locus_tag="CTY05_00445"
FT   CDS_pept        471542..472078
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplE"
FT                   /locus_tag="ABBFA_00445"
FT                   /old_locus_tag="CTY05_00445"
FT                   /product="50S ribosomal protein L5"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:P62399"
FT                   /protein_id="ATY42911.1"
FT                   /translation="MARLKARYNDELKAKLQEELSIKNVMEIPRITKITLNMGVGAAAT
FT                   DKKLLDGAVADMQLIAGQKPVVTLARKSIAGFKIRDGWPIGCKVTLRGDQMYEFLDRLI
FT                   SIAIPRIRDFRGFSAKSFDGRGNYSMGLKEQIVFPEIDFDKIDRIRGMDITITTTARTD
FT                   DEGRALMRAFGFPFK"
FT   gene            472088..472393
FT                   /gene="rpsN"
FT                   /locus_tag="ABBFA_00446"
FT                   /old_locus_tag="CTY05_00446"
FT   CDS_pept        472088..472393
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsN"
FT                   /locus_tag="ABBFA_00446"
FT                   /old_locus_tag="CTY05_00446"
FT                   /product="30S ribosomal protein S14"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:P0AG59"
FT                   /protein_id="ATY42912.1"
FT                   /translation="MAKKGMINRELKREKTVAKYAAKRAELKATIANVNASDEERFEAM
FT                   LKLQALPRNASPVRLRNRCGLTGRPHGYFRKFGLSRNKLRDTVMQGDVPGVVKASW"
FT   gene            472405..472800
FT                   /gene="rpsH"
FT                   /locus_tag="ABBFA_00447"
FT                   /old_locus_tag="CTY05_00447"
FT   CDS_pept        472405..472800
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsH"
FT                   /locus_tag="ABBFA_00447"
FT                   /old_locus_tag="CTY05_00447"
FT                   /product="30S ribosomal protein S8"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:P0A7W7"
FT                   /protein_id="ATY42913.1"
FT                   /translation="MSMQDTVADMLTRVRNAQMAKKQTVSMPSSKLKVAIANVLQQEGY
FT                   ISNVEVAQEETKSTLTITLKYFEGKPVIEMVKRVSRPGLRQYRGKDKLPSVKQGLGIAI
FT                   VSTSKGIMTDRAARAAGIGGEVIAFVS"
FT   gene            472814..473347
FT                   /gene="rplF"
FT                   /locus_tag="ABBFA_00448"
FT                   /old_locus_tag="CTY05_00448"
FT   CDS_pept        472814..473347
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplF"
FT                   /locus_tag="ABBFA_00448"
FT                   /old_locus_tag="CTY05_00448"
FT                   /product="50S ribosomal protein L6"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:P0AG55"
FT                   /protein_id="ATY42914.1"
FT                   /translation="MSRVAKAPVTVPNGVTVTQNGRQVEVKGSKGTLSFNLHALVELKQ
FT                   EEGKLQLAPAKESKDAWMQAGTARAVLNNLVKGVSEGFERKLQLVGVGYKAAVKGTVVN
FT                   LNLGYSHPIDYALPEGVTAETPTATEIILKSANKQLLGQVAAEIRAYRSPEPYKGKGVR
FT                   YSDEVILRKEAKKK"
FT   gene            473362..473712
FT                   /gene="rplR"
FT                   /locus_tag="ABBFA_00449"
FT                   /old_locus_tag="CTY05_00449"
FT   CDS_pept        473362..473712
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplR"
FT                   /locus_tag="ABBFA_00449"
FT                   /old_locus_tag="CTY05_00449"
FT                   /product="50S ribosomal protein L18"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:A6U875"
FT                   /protein_id="ATY42915.1"
FT                   /translation="MNEKKQSRLRRAKSTRLHIRALGATRLCVNRTPRHIYAQVISADG
FT                   GKVLAQASTLDASLRSGTTGNIEAATKVGALIAERAKAAGVTKVAFDRSGFKYHGRIKA
FT                   LADAAREGGLEF"
FT   gene            473715..474212
FT                   /gene="rpsE"
FT                   /locus_tag="ABBFA_00450"
FT                   /old_locus_tag="CTY05_00450"
FT   CDS_pept        473715..474212
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsE"
FT                   /locus_tag="ABBFA_00450"
FT                   /old_locus_tag="CTY05_00450"
FT                   /product="30S ribosomal protein S5"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:P0A7W4"
FT                   /protein_id="ATY42916.1"
FT                   /translation="MAKVEQNEGLVEKLVAVDRVAKVVKGGRIFSFTALTVVGDGNGRV
FT                   GFGRGKAREVPAAISKALEAARRNMITVDLAGTTLQHPVNARHGASRVYMQPASEGTGV
FT                   IAGGAMRAVLEAAGVHNVLAKCYGSTNAANVVNATFKGLRDMTSPEKVAAKRGKSVEEI
FT                   QG"
FT   gene            474219..474395
FT                   /gene="rpmD"
FT                   /locus_tag="ABBFA_00451"
FT                   /old_locus_tag="CTY05_00451"
FT   CDS_pept        474219..474395
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmD"
FT                   /locus_tag="ABBFA_00451"
FT                   /old_locus_tag="CTY05_00451"
FT                   /product="50S ribosomal protein L30"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:Q9HWF3"
FT                   /protein_id="ATY42917.1"
FT                   /translation="MKTIKVTQTKSSSHRLKNHKLCLQGLGLRRIGHTVEVQDTPSNRG
FT                   MINKVYYMVSVEE"
FT   gene            474399..474839
FT                   /gene="rplO"
FT                   /locus_tag="ABBFA_00452"
FT                   /old_locus_tag="CTY05_00452"
FT   CDS_pept        474399..474839
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplO"
FT                   /locus_tag="ABBFA_00452"
FT                   /old_locus_tag="CTY05_00452"
FT                   /product="50S ribosomal protein L15"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:P02413"
FT                   /protein_id="ATY42918.1"
FT                   /translation="MTLRLNELAPAEGAKREHRRLGRGIGSGVGKTGGRGIKGQKSRKS
FT                   GGVRPGFEGGQTAIYRRLPKFGFTSQIALKTAEVRLSELSKVEGDIVSLETLKAANVVR
FT                   RDQIRARIVLSGEITRAFTVQGVALTKGAKAAIEAAGGKVEE"
FT   gene            474852..476204
FT                   /locus_tag="ABBFA_00453"
FT                   /old_locus_tag="CTY05_00453"
FT   CDS_pept        474852..476204
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABBFA_00453"
FT                   /old_locus_tag="CTY05_00453"
FT                   /product="preprotein translocase subunit SecY"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="protein motif:CLUSTERS:PRK09204"
FT                   /protein_id="ATY42919.1"
FT                   /translation="MSPSSSGHVNMMKGQPFHVKYREIIRRMSFLIGALLVFRLGAHIP
FT                   VPGINNAALENLFHANQGTILGLFNMFSGGALERMSILALGIMPYISASIIVQLMSTVI
FT                   PSLEALKKEGEQGKRKINQYTRQGTLLLAVVQAVGMCAGLIGQGITLSSGLAFYIPAVT
FT                   SLVAGTMFLMWLGEQITERGIGNGISMIIFAGIVAGLPKLIMQSVSSVDNGQTSLIGLV
FT                   IFGLLSLGVLAAIVFIEKAQRRIPVNYAQKQQGRRIFTAQQTHLPLKINMAGVIPAIFA
FT                   SSLLLFPASLGQWVGSADPNAGLIKRSLQDLALVLSPGQPLYLVLFGALIIFFCYFYTA
FT                   LVFSPKEVSENLKRSGAYVPGIRPGEQTARYLDHILNRLTFIGAIYITVICLMPMILQS
FT                   SFGIPFYLGGTSLLIVVVVVMDFMAQLQAHLTSHQYDNQTLMRKTTAHPKG"
FT   gene            476225..476341
FT                   /gene="rpmJ"
FT                   /locus_tag="ABBFA_00454"
FT                   /old_locus_tag="CTY05_00454"
FT   CDS_pept        476225..476341
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmJ"
FT                   /locus_tag="ABBFA_00454"
FT                   /old_locus_tag="CTY05_00454"
FT                   /product="50S ribosomal protein L36"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:P0A7Q6"
FT                   /protein_id="ATY42920.1"
FT                   /translation="MKVQASVKKICGSCKVIRRNGVIRVICSAEPRHKQRQG"
FT   gene            476449..476805
FT                   /gene="rpsM"
FT                   /locus_tag="ABBFA_00455"
FT                   /old_locus_tag="CTY05_00455"
FT   CDS_pept        476449..476805
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsM"
FT                   /locus_tag="ABBFA_00455"
FT                   /old_locus_tag="CTY05_00455"
FT                   /product="30S ribosomal protein S13"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:P0A7S9"
FT                   /protein_id="ATY42921.1"
FT                   /translation="MARIAGVNIPDNKHAVISLTYIFGIGRHTAKNILAAVGITETTKI
FT                   RELDDAQLDAIRAEVAKVPTEGDLRREISMNIKRLMDLGCYRGLRHRRSLPVRGQRTKT
FT                   NARTRKGPRKPIKK"
FT   gene            476825..477211
FT                   /gene="rpsK"
FT                   /locus_tag="ABBFA_00456"
FT                   /old_locus_tag="CTY05_00456"
FT   CDS_pept        476825..477211
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsK"
FT                   /locus_tag="ABBFA_00456"
FT                   /old_locus_tag="CTY05_00456"
FT                   /product="30S ribosomal protein S11"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:P0A7R9"
FT                   /protein_id="ATY42922.1"
FT                   /translation="MAKDTRTRKKVTRTVSEGVAHIHASFNNTIVTITDRQGNALAWAT
FT                   SGGQGFRGSRKSTPFAAQVAAEVAGKAALDYGLKNLDVLVKGPGPGRESAVRALGAVGY
FT                   KINSITDVTPIPHNGCRPPKKRRV"
FT   gene            477224..477850
FT                   /gene="rpsD"
FT                   /locus_tag="ABBFA_00457"
FT                   /old_locus_tag="CTY05_00457"
FT   CDS_pept        477224..477850
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsD"
FT                   /locus_tag="ABBFA_00457"
FT                   /old_locus_tag="CTY05_00457"
FT                   /product="30S ribosomal protein S4"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:P0A7V8"
FT                   /protein_id="ATY42923.1"
FT                   /translation="MARYIGPKCKLSRREGTDLQLKSGVKPFDVKTKKANKAPGQHGQA
FT                   RGGKQSEYSLQLREKQKVRRIYGVLERQFSNYYKEAARVKGATGENLLKLLESRLDNVV
FT                   YRMGFGSTRAEARQLVSHRSITLNGRRVNIASIQVKAGDVIAVHEGAKQQLRIKNAIEL
FT                   AAQRGIPAWIEVDHSKLEGTFKAAPDRSDLPAEINESLIVELYSK"
FT   gene            477868..478875
FT                   /gene="rpoA"
FT                   /locus_tag="ABBFA_00458"
FT                   /old_locus_tag="CTY05_00458"
FT   CDS_pept        477868..478875
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoA"
FT                   /locus_tag="ABBFA_00458"
FT                   /old_locus_tag="CTY05_00458"
FT                   /product="DNA-directed RNA polymerase subunit alpha"
FT                   /EC_number="2.7.7.6"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:P0A7Z4"
FT                   /protein_id="ATY42924.1"
FT                   /translation="MTRTANEFLTPQAIKVEAVSGTSAKVILEPLERGFGHTLGNALRR
FT                   ILLSSLPGAAVVEVEIEGVEHEYSTLEGLQQDIVELLLNLKGLSIKLFDQNEAYLTLEK
FT                   QGPGDITAADLRLPHNVEVVNPEHLIGTLSATGSLKMRLKVSQGRGYETSDSRFPEGET
FT                   RPVGRLQLDASYSPIKRVSYTVENARVEQRTDLDKLVIDLETNGTVDPEEAIRKAATIL
FT                   QQQIAIFVDLQKDQTPVAQEPREEVDPILLRPVDDLELTVRSANCLKAENIYYIGDLVQ
FT                   RTEVELLKTPNLGKKSLTEIKDVLASKGLQLGMRLENWPPASLRMDDRFAYRSR"
FT   gene            478894..479271
FT                   /gene="rplQ"
FT                   /locus_tag="ABBFA_00459"
FT                   /old_locus_tag="CTY05_00459"
FT   CDS_pept        478894..479271
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplQ"
FT                   /locus_tag="ABBFA_00459"
FT                   /old_locus_tag="CTY05_00459"
FT                   /product="50S ribosomal protein L17"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:P0AG44"
FT                   /protein_id="ATY42925.1"
FT                   /translation="MRHRNSGVKLGRTSSHRKAMFQNLANSLFEHELIKTTLPKAKELR
FT                   RVAEPLITLAKNDTVANRRLAFARTRNAATVGKLFTVLGPRYKERNGGYLRVLKAGFRA
FT                   GDAAPMAYVELVDREVNTSAE"
FT   gene            479452..480942
FT                   /gene="mymA"
FT                   /locus_tag="ABBFA_00460"
FT                   /old_locus_tag="CTY05_00460"
FT   CDS_pept        479452..480942
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mymA"
FT                   /locus_tag="ABBFA_00460"
FT                   /old_locus_tag="CTY05_00460"
FT                   /product="Putative FAD-containing monooxygenase MymA"
FT                   /EC_number="1.14.13.-"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:O53300"
FT                   /protein_id="ATY42926.1"
FT                   /translation="MEKQVDVLIIGAGISGIGVAAHLSKNSPQRQFEILERRESFGGTW
FT                   DLFRYPGIRSDSDMSTFGFNFKPWRKANVLADGASIKGYLGEVIDEFKLKEKIHFGHRV
FT                   LSANYDSASKKWHVIVEDNKKKQQTWVANFVVGCTGYYNYDQGYAPTFPNQEAFKGQLI
FT                   HPQHWPENLDYKGKKVVIIGSGATAITLVPAMSKGGAGHVTMLQRSPTYIASVPSIDFI
FT                   YEKTRRFMSEEAAYKFTRARNIGMQRAIYALSQKHPKTVRRLLLKAIEMQLKGKVDMKH
FT                   FTPSYNPWDQRLCVVPDGDLFKILREGKASVETDQIEKFTETGIQLKSGKHLDADIIVS
FT                   ATGLQVQIMGGVQATIDGEPVKSSEHMLYNGVMLSDVPNMAMIIGYVNASWTLKVDIAA
FT                   DYICRLLNYMDKNNYDEVIPSGDKSVMEEDTVMGSLSSGYISRAADVIPKQGKQAPWQV
FT                   TNNYLEDRKSLKNAKFDDGVLRFHKHSEVTTRKPKLVS"
FT   gene            complement(480992..482164)
FT                   /gene="mmgC_2"
FT                   /locus_tag="ABBFA_00461"
FT                   /old_locus_tag="CTY05_00461"
FT   CDS_pept        complement(480992..482164)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mmgC_2"
FT                   /locus_tag="ABBFA_00461"
FT                   /old_locus_tag="CTY05_00461"
FT                   /product="Acyl-CoA dehydrogenase"
FT                   /EC_number="1.3.99.-"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:P45857"
FT                   /protein_id="ATY42927.1"
FT                   /translation="MQSGAIRPIPNMLPRHLFNEEHEAFRETVRKFYEKEVVPNIEKYE
FT                   KQQHVDRDLWNKAGALGLLCTTMPEQYGGSGVDRLYSMILIEEQAYAMDSSTGFSLHSD
FT                   IVANYINNFGNEEQKQKWLPKMATGETVTAIAMTEPGTGSDLQAVRTTAVLDGDEYVIN
FT                   GSKIFITNGYLCDMAIVVCKTGNSDKGSANLSLIIVEADRAGFTKGKPLNKIGMKGQDT
FT                   CELFFDNVRVPKENLLGMEGMGFIMLMKELAWERMLVAIICQAGAEAAFAHTVQYTKDR
FT                   KAFGKPIGAFQNTRFKLAELRTEIDFCRTYLDRCMELQLDEKLSVEAAAAAKYKISDMF
FT                   SKVVDECLQLHGGYGYMLEYPIARAYIDHRANRIYAGTNEIMKELISRTL"
FT   gene            482352..482609
FT                   /gene="cptB"
FT                   /locus_tag="ABBFA_00462"
FT                   /old_locus_tag="CTY05_00462"
FT   CDS_pept        482352..482609
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cptB"
FT                   /locus_tag="ABBFA_00462"
FT                   /old_locus_tag="CTY05_00462"
FT                   /product="Antitoxin CptB"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:P64559"
FT                   /protein_id="ATY42928.1"
FT                   /translation="MSEEMTLEERKVIYRARRGLKEIDVYFDPYVKNYYLKADPAEKAL
FT                   FAELVEQEDPDLLDWFMEVSEPPRTELRDFIYKLKHYVHG"
FT   gene            482715..483005
FT                   /locus_tag="ABBFA_00463"
FT                   /old_locus_tag="CTY05_00463"
FT   CDS_pept        482715..483005
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABBFA_00463"
FT                   /old_locus_tag="CTY05_00463"
FT                   /product="hypothetical protein"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /protein_id="ATY42929.1"
FT                   /translation="MPLLWWLVVISLLFISFIFFLKRPQLAKIAYLDKKLWSLAYHSQN
FT                   TISRVKILKIIDYQIFIVIYFEGHKTLTSIIWFDQMSLAEWKKLKTLEKLY"
FT   gene            483441..483542
FT                   /locus_tag="ABBFA_00464"
FT                   /old_locus_tag="CTY05_00464"
FT   CDS_pept        483441..483542
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABBFA_00464"
FT                   /old_locus_tag="CTY05_00464"
FT                   /product="hypothetical protein"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /protein_id="ATY42930.1"
FT                   /translation="MEISMWMFLLIAVIMAVVVGRAGTLLKDYLEQQ"
FT   gene            483775..484860
FT                   /locus_tag="ABBFA_00465"
FT                   /old_locus_tag="CTY05_00465"
FT   CDS_pept        483775..484860
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABBFA_00465"
FT                   /old_locus_tag="CTY05_00465"
FT                   /product="hypothetical protein"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /protein_id="ATY42931.1"
FT                   /translation="MSKVQKICQGLAVSFLAASVLSGCSYVVKSGANVALGFTEKHVVP
FT                   PILAMQDAEMVCNTGSALTPAIMSTKGMGADPTRVAVLMYAASGVCAENQALEQELRYL
FT                   RASKAGQVTEAQDARIAQKRWAAIAAERQYAGYKLFADRWESKYKYHLGDSCPTMRSDI
FT                   DQTVYLLGMISGLQAVTNDINSGGSVNVPKDIAAIVERGMVCLDNQKFWGAPNATRAVI
FT                   WTLLPGANEGKPDPYETLKQSVQIGEQKGVRLSHALYAVAAQASGDDAKIRDALKTYAA
FT                   SQADDKPVNPNFKLIDSMAGLIVRGISDRYWTEHTGVRTGDDGMSHFWDEKNEGSAELD
FT                   ELFDGGAASEAPADTKTAPAQ"
FT   gene            484938..485504
FT                   /locus_tag="ABBFA_00466"
FT                   /old_locus_tag="CTY05_00466"
FT   CDS_pept        484938..485504
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABBFA_00466"
FT                   /old_locus_tag="CTY05_00466"
FT                   /product="Rhomboid family protein"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="protein motif:Pfam:PF01694.16"
FT                   /protein_id="ATY42932.1"
FT                   /translation="MKDHVLNKKVLLVAGCISVSACLQVFPDYFIYWRESLLGEFWRLW
FT                   TAHWVHVGWIHFLLNMMAFACLPFIFPHTKVWHILSLLFLLPPFISLVFYFYLPNIDAY
FT                   AGLSGVLHGLYTAVALVYLQYRKERNFAFLVLGLIVAKLIWENTFGQTGTAQLIGSPVL
FT                   TEAHLYGAIGGAIFGGCYWLIQRFK"
FT   gene            485692..487887
FT                   /locus_tag="ABBFA_00467"
FT                   /old_locus_tag="CTY05_00467"
FT   CDS_pept        485692..487887
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABBFA_00467"
FT                   /old_locus_tag="CTY05_00467"
FT                   /product="DctM-like transporter"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="protein motif:Pfam:PF06808.6"
FT                   /protein_id="ATY42933.1"
FT                   /translation="MQEYQEKRSGLGLLGYIWNEWISTFIILILLLMTLIIGTGEMIHG
FT                   QLLRIGERLYGDPATGMQYSFLRAEPEKPTCDRHPNIDAQVKEQMKANASDDFASFFGA
FT                   ASESDVRASLLAAQQQCEEKYQAYDKTIKYIEANPGVRTYRAIETGFFGIFKFGTENRA
FT                   ILLVFMVLISAITASLKYHHIGLRNPATKIDYKVYSLFMLIGNALLSFSVISQYRSVIN
FT                   SGVTPTYETVTIYWIWMILFVVLTLISLYQLFVSPPPKREGGNIGLALLSVPLYAYMAL
FT                   ITGIVFTFFMDYPMGQGIYLGLLVEFSGIFLNLALFIWAGMLLTQTRVMDLFLNVLRPW
FT                   NLAPETLTWLILIAAAVPTAYTGASGIFVIAAGAIIYKEVWNAGARRQYALAVSAMSGS
FT                   LGVVVRPCLLVVLIAMLDSRHVTSDELFGHGIYVFWLTAFIFLGVSLLLAEEKFRVNSP
FT                   KVALPGMARAFVPVIPYILITVVVLAFYKYALDTGMNEFTAPVILPLVLIAMILYDKMV
FT                   MPKEAPALNIHEAIVREHEKKSPFLQTHDPHSSQFRLGFGGALRFATSETVGHIGALII
FT                   LMALSASVGGLIERSEVVELLPTHLGSIYISLACIALLLAIIGMCTDPFGAVILVAATI
FT                   APVAYENGIHPIHFWMIVLVAFEFGYVTPPVALNHLLTRLSVGDDEVNAADAEAKEKYT
FT                   SFYYRYERWLLPIIVLFSSLVLVTYAPLILKLFGWYK"
FT   gene            complement(488035..488466)
FT                   /locus_tag="ABBFA_00468"
FT                   /old_locus_tag="CTY05_00468"
FT   CDS_pept        complement(488035..488466)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABBFA_00468"
FT                   /old_locus_tag="CTY05_00468"
FT                   /product="hypothetical protein"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /protein_id="ATY42934.1"
FT                   /translation="MPLQRKQNSKLLWILIGGLSILVVLFFAAQWFFKKTETSAPMVDP
FT                   QPASVPAPEKTTKPSESSEPVVQTQTANSQQLVNEDVLKQPIPAQESLAKEEVSKLNDI
FT                   HRQLQDQEATLKAQHADADQLIKLKEEQVKLLEAQVKQQ"
FT   gene            complement(488478..488687)
FT                   /locus_tag="ABBFA_00469"
FT                   /old_locus_tag="CTY05_00469"
FT   CDS_pept        complement(488478..488687)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABBFA_00469"
FT                   /old_locus_tag="CTY05_00469"
FT                   /product="hypothetical protein"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /protein_id="ATY42935.1"
FT                   /translation="MKKRFIAGAKCPKCEAIDRIVMLTTTEDEWIECIECGYSENRPTH
FT                   IDEPETPAIPDEIGVIQFKPRRSD"
FT   gene            complement(488728..490782)
FT                   /gene="prlC_1"
FT                   /locus_tag="ABBFA_00470"
FT                   /old_locus_tag="CTY05_00470"
FT   CDS_pept        complement(488728..490782)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prlC_1"
FT                   /locus_tag="ABBFA_00470"
FT                   /old_locus_tag="CTY05_00470"
FT                   /product="Oligopeptidase A"
FT                   /EC_number="3.4.24.70"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:P27237"
FT                   /protein_id="ATY42936.1"
FT                   /translation="MWLLAMTLQQATLPTPRFDQITLDNLKQDIQQAIQAGQEFLNTLT
FT                   AAPSETDQQLAVLEQIDALENNLSESWGVLSHLNAVMNNAETREVYQSLLPALSEYYTQ
FT                   LGQHTALYQTYQLIHDGQSYSTLSPAQQSAIRLALRDFKLSGVALEGEDKKRYAEISAR
FT                   LSQLSSDFSNHVLDATQAYFKPLTEDELKGLPESNVELLKQYGKQRELDQAVATLDFPA
FT                   YFAIMTYADDRALREELYKAYVTRASDQSEQTEFDNSKIMEEILSLRQEMAKLLGFNNY
FT                   AEYSLASKMAPDVKTVHDFLVDLAEHARTPALQEVAELQAIAKQDGIDELKPWDTTYYS
FT                   EKLKQQQFNLSQEALKPYFPAPKVIQGLFQIVQRLYGINIVEREAPVWHPDARYFELED
FT                   QGEVVGGFFFDLYARTGKRGGAWMSGFRSRMQTVHGLQKPICYMVCNFTPPVGNQPALL
FT                   THDEVITLFHEFGHGLHHMLTEVDNISVAGTHGVAWDAVELPSQFMEFWSWDKESLDVL
FT                   SEHIESKQTLPQELLDALLNARFFQSGMQTLRQLEFALFDLTIHTKTPALNSEQIQQTL
FT                   NDIRKQYAVVPTVDYNRFQHSFSHIFAGGYAAGYYSYKWAEVLASDAFDRFENEGIFNT
FT                   QTGKEFRQAILAVGGKDTALEAFVNFRGREPKIDALLRHQGWTNDNKTA"
FT   gene            complement(490916..493348)
FT                   /gene="rnr"
FT                   /locus_tag="ABBFA_00471"
FT                   /old_locus_tag="CTY05_00471"
FT   CDS_pept        complement(490916..493348)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rnr"
FT                   /locus_tag="ABBFA_00471"
FT                   /old_locus_tag="CTY05_00471"
FT                   /product="Ribonuclease R"
FT                   /EC_number="3.1.13.1"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:P21499"
FT                   /protein_id="ATY42937.1"
FT                   /translation="MKPNDMTKNWVDPEAKAEAERYDNPIPSRTLILDTLEQLQTPQSH
FT                   AELVDHFHIQDQKSIEALSHRLSAMVRDGQLMKDGFKFQLVADQPTYEATVYINSKGLG
FT                   TAHIDGQDDLLLPERELRLVFNGDRVRVRQTSVDRKGKPWGFITEVIQHRVKQLIGKLS
FT                   VHDGEYFIQPNNPNQHQPIPLEKELVEHAKANVGDMLRVAIDTYPTREEFATAHIIQSM
FT                   ADKADTEIIIPQTILEFGLPYEFPDEVIKEAESFKEPAEQDREGRVDLRDLALVTIDGE
FT                   DARDFDDAVYAEKRPGGGYRVVVAIADVSHYVRLDSALNEEAEERGTSVYFPHFVLPML
FT                   PEALSNGLCSLNPHVDRLCMVCDLKLSRTGRVTGYEFYPAVMHSKARLTYTQVGQYFEG
FT                   ATDAIPKDRDIHKSLNTLFQLYQILKNLRVDRHAMEFETIETYMTFDELGGIKEILPRT
FT                   RNDAHKLIEECMLLANVAAAEYALEHDIPMLYRVHEAPEFSRIQKVKDFVKLLGLPFPD
FT                   QPTQADYQKVIEATKDRIDAPSIHAVLLRSMMQAYYGAKNAGHYGLAYEAYTHFTSPIR
FT                   RYPDLLLHRAIKAHLKQKPYPLSGAALDDAGEHFSQTERRADEASRSVTTWLKCHYMQQ
FT                   HLGDEFIGIVSAVTEFGLFVTLKDLYVDGMIHISQLGDDFFIYDQASQNLIGQNRGQVF
FT                   GLGDEVKIQVAGVNLEERKIDFQLIKQVTHAGRVVRSRAPRTTKTSTQATEEVFGKPSV
FT                   STDGEKPVRKKKEKGKPSSYSKKSGKKTSTKAEAKPEKVKKKAKPKKKKSNAKSKAD"
FT   gene            493595..493685
FT                   /locus_tag="ABBFA_00472"
FT                   /old_locus_tag="CTY05_00472"
FT   tRNA            493595..493685
FT                   /locus_tag="ABBFA_00472"
FT                   /old_locus_tag="CTY05_00472"
FT                   /product="tRNA-Ser"
FT                   /note="tRNA-Ser(gct)"
FT                   /inference="COORDINATES:profile:Aragorn:1.2"
FT   gene            493696..493772
FT                   /locus_tag="ABBFA_00473"
FT                   /old_locus_tag="CTY05_00473"
FT   tRNA            493696..493772
FT                   /locus_tag="ABBFA_00473"
FT                   /old_locus_tag="CTY05_00473"
FT                   /product="tRNA-Arg"
FT                   /note="tRNA-Arg(acg)"
FT                   /inference="COORDINATES:profile:Aragorn:1.2"
FT   gene            493812..493888
FT                   /locus_tag="ABBFA_00474"
FT                   /old_locus_tag="CTY05_00474"
FT   tRNA            493812..493888
FT                   /locus_tag="ABBFA_00474"
FT                   /old_locus_tag="CTY05_00474"
FT                   /product="tRNA-Arg"
FT                   /note="tRNA-Arg(acg)"
FT                   /inference="COORDINATES:profile:Aragorn:1.2"
FT   gene            493996..494589
FT                   /locus_tag="ABBFA_00475"
FT                   /old_locus_tag="CTY05_00475"
FT   CDS_pept        493996..494589
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABBFA_00475"
FT                   /old_locus_tag="CTY05_00475"
FT                   /product="haloacid dehalogenase-like hydrolase"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="protein motif:Pfam:PF12710.1"
FT                   /protein_id="ATY42938.1"
FT                   /translation="MNLALFDFDGTITHNDTFSLFLKFSLSKKTQILGGIRLAPYIAGY
FT                   KLGWVTDKTIRTKLCQVGYIGYDAASLICKGQEFAKKVIPSCIRENALERILWHKQQGD
FT                   QVVVVSASLSVYLESWCKSLDLDVICNQLEIDNGILTGYFIDGDCGYLEKVNRIKNKYD
FT                   LTQYSIIYAYGDTPNDYAMLELAHRKYYKWQEIN"
FT   gene            complement(494649..497072)
FT                   /locus_tag="ABBFA_00476"
FT                   /old_locus_tag="CTY05_00476"
FT   CDS_pept        complement(494649..497072)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABBFA_00476"
FT                   /old_locus_tag="CTY05_00476"
FT                   /product="hypothetical protein"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /protein_id="ATY42939.1"
FT                   /translation="MFLLKNLVSSISKVTQDLGNIVSITPVVNTGSSVNVNVSDINIAN
FT                   VSTTGLLSNVISTVTDTVSHTTTDLVSNVVGTVTGTVGSTNPIDTVTNIIGGVTGGITG
FT                   NPLEVVTDIIGGVTGGVVGGTSPISPVIDVVQGGIDILQGVESLKTEIINTGIETVADA
FT                   VIGVLPQAEHPVSEIADLGTLTFETSRDTVNGALEVVSDLVGGDIQGATESATGILDTL
FT                   ITNGTTATGIVTGVVGSVTDVIGGVTGGVDGNPLEVITDIIGGVTGGVDGNPLEVITDI
FT                   IGGVAGGVGGDNPLGVVTDIIGGVTGGIIGGGTSPISPVIDVVQGGIDILQGVESLKTE
FT                   IINTGIDTVADTIIGVLPQAEHPVSEIADLGTLTFETSRDTVNGALEVVSDLVGGDIQG
FT                   ATENATGILGTLIQNGSTATGIVTDILGGVTGTIGGVTGGIGGDNPLGVVTDIIGGVTG
FT                   GIGGDNPLGVVTDIIGGVTGGIGGDNPLGVVTDIIGGVTGGIGGDNPLGVVTDIIGGVT
FT                   GGIGGDNPLGVVTDIIGGVTGGIIGGGTSPISPVIDVVQGGIDILQGVESLKTEIINTG
FT                   IDTVADTIIGILPQAEHPVSEIADLGTLTFETSRDTVNGALEVVSDLVGGDIQGATESA
FT                   TGILDTLITNGTTATGLVTEIIGGVTGTIGGVTGGDSPLGLVTDLLGGLTGSVGGDSPL
FT                   GVVTDLLGGLTGSVGGDSPLGVVTDLLGGLTGGITGGTDNPIGIVTDIVGSLTGGVTGE
FT                   GSLDVISNLLGGLTGGSLLGGVTSTVSSVTNTTHTIVPTSLLTDNFLENSFNTV"
FT   gene            497664..497740
FT                   /locus_tag="ABBFA_00477"
FT                   /old_locus_tag="CTY05_00477"
FT   tRNA            497664..497740
FT                   /locus_tag="ABBFA_00477"
FT                   /old_locus_tag="CTY05_00477"
FT                   /product="tRNA-Arg"
FT                   /note="tRNA-Arg(acg)"
FT                   /inference="COORDINATES:profile:Aragorn:1.2"
FT   gene            complement(497863..498555)
FT                   /locus_tag="ABBFA_00478"
FT                   /old_locus_tag="CTY05_00478"
FT   CDS_pept        complement(497863..498555)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABBFA_00478"
FT                   /old_locus_tag="CTY05_00478"
FT                   /product="Nitroreductase family protein"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="protein motif:Pfam:PF00881.18"
FT                   /protein_id="ATY42940.1"
FT                   /translation="MSFFAKLFGFKQKTTAQEDVALKAAQELEPSNETSFIELIKNRRS
FT                   IYAIGNNLSQLNDEIEKLIQEAIRHSPSAFNSQSSRAVILFGQSHHKFWNTVLEVLKTI
FT                   IPAEAVSGTEQKIQSFAAGAGTVLFYEDQSVIKSLQEQFELYADNFPIWSEHSTAIAQF
FT                   AVWNVLAEQNIGASLQHYNPIIDEKINTSFNIPAEWKLRAQLVFGSIEGAAGEKAFIDD
FT                   ESRFKTFG"
FT   gene            498780..499277
FT                   /locus_tag="ABBFA_00479"
FT                   /old_locus_tag="CTY05_00479"
FT   CDS_pept        498780..499277
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABBFA_00479"
FT                   /old_locus_tag="CTY05_00479"
FT                   /product="hypothetical protein"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /protein_id="ATY42941.1"
FT                   /translation="MTEQKSALSLRYYLNLEESQDGFGLVTFGKKQFTRFLTPVISIAI
FT                   IIWGLYLGFSGVGRYYVALGVFFLVMQGLMRYWLLPMMFKRQFVRYQFGKSEQGIDLYQ
FT                   DYFELYAAGRKQAVQYSEVQTFAKGKLTYMLELKNKTVIIVPKRAFAQASDQTIFENTF
FT                   KK"
FT   gene            499317..499958
FT                   /gene="nagK"
FT                   /locus_tag="ABBFA_00480"
FT                   /old_locus_tag="CTY05_00480"
FT   CDS_pept        499317..499958
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nagK"
FT                   /locus_tag="ABBFA_00480"
FT                   /old_locus_tag="CTY05_00480"
FT                   /product="Fumarylpyruvate hydrolase"
FT                   /EC_number="3.7.1.20"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:O86042"
FT                   /protein_id="ATY42942.1"
FT                   /translation="MKTRPSKIVCVGRSYADHVKELNNAMPGRPVLFIKPPSSLIGLDE
FT                   GISWNPAWGSCHFECEFVLRIDQPLKGETDPQKVLQAIGAVTLGLDLTLRDLQNELKDK
FT                   GQPWERAKAFDGSCVLADWVDVSEITNWEETRFNFHINDELRQDGNTALLMFNIAYLLV
FT                   DINQVFSLEPGDVIMTGTPAGVGPLNAGDQLKMTLKGATQDFVWETFVKA"
FT   gene            complement(500035..500829)
FT                   /gene="ripA_1"
FT                   /locus_tag="ABBFA_00481"
FT                   /old_locus_tag="CTY05_00481"
FT   CDS_pept        complement(500035..500829)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ripA_1"
FT                   /locus_tag="ABBFA_00481"
FT                   /old_locus_tag="CTY05_00481"
FT                   /product="HTH-type transcriptional repressor of iron
FT                   proteins A"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:Q8NRR3"
FT                   /protein_id="ATY42943.1"
FT                   /translation="MKKSAQRVQDFQEIPAHNAIPDLLWFRVRNAPAETVYPQHAHAWG
FT                   EFIYAFSGVLEVNIDQINYLTPPPYGIWLPPYTKHSGINRNEVTHATLYVHESLCQKLP
FT                   QKAGILLTSPLVPALLDHLRQNPQDETQVEYIRLLQVLLDQLIQAELVGSYLPTTDHPA
FT                   LAKILNDLHQCPADNSTLQELAERINMTERTLARYSQKELGMSLHEWRQRLKVMKAMTM
FT                   LNQGKTIESIAFDLGYASASAFIYMFKRWMGFTPDQFRKLYQ"
FT   gene            500935..501849
FT                   /gene="yijE_2"
FT                   /locus_tag="ABBFA_00482"
FT                   /old_locus_tag="CTY05_00482"
FT   CDS_pept        500935..501849
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yijE_2"
FT                   /locus_tag="ABBFA_00482"
FT                   /old_locus_tag="CTY05_00482"
FT                   /product="putative inner membrane transporter yiJE"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:P0ABT8"
FT                   /protein_id="ATY42944.1"
FT                   /translation="MEERKNLDTRASALMVLLCMVLGLQQVVLKIAAPDISPIMQIALR
FT                   SGLSAVLVLPLLWRDHSIHLFSYRQCKAGALVALFFSLEFYFVTQALKFTSTSHTVVLL
FT                   YTAPIFVALGLHWKFPTERLNRAQWGGIALAFMGIILTFYPTTTATNAPALAQVLLGDL
FT                   YALMAGLAWALSTIIVRLSPLAQAPATQTLFYQLFGCFVLLLLIAFLTNQTTIHFTTLA
FT                   ILSLSFQTLIVSFASLLLWFWLLRNYLASRLGIFSFLTPLFGVLFSILLLEEKLEIKFI
FT                   FGSILVLSGIVIMSLKQGKANSS"
FT   gene            complement(501870..503117)
FT                   /locus_tag="ABBFA_00483"
FT                   /old_locus_tag="CTY05_00483"
FT   CDS_pept        complement(501870..503117)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABBFA_00483"
FT                   /old_locus_tag="CTY05_00483"
FT                   /product="ribonuclease BN/unknown domain fusion protein"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="protein motif:CLUSTERS:PRK04214"
FT                   /protein_id="ATY42945.1"
FT                   /translation="MLERFLKKLPFYNKTWFQFILFVIKRFEADRCREQAGSLTYTTLF
FT                   AVVPMLTVFLVIISSIKALEPARQQLQHLIYSNFLPKSTIAFDKALNAFTEKSSNLTVI
FT                   GVLFLFVTTVLMLTSIETVFNRIWRVKETRSGIVGFMRYWTIISLGPIILGSAFVISST
FT                   VASMNLLSNNFTGYQLDGAFLLWLISFVLTILGFFILYWTIPNRTVPLYAAAIAACLSA
FT                   ALFETLKNLFSFVMSNFTSYEIIYGAFAAVPIFLLWVFLSWNIVLLGVEVSFALTAFHS
FT                   GKEQKRHPVLMLLDILELFYKKQKLGESVSDKEALEILGRGEVGRWPAYVLLLEEQNLV
FT                   KRTDKDEYVLVRNLSQVDFWSFFTALPYPLPLRQDVSNVHDDDEWMEKIGPALVESNDY
FT                   LAAKLSIPLSTIFEEK"
FT   gene            503405..503998
FT                   /locus_tag="ABBFA_00484"
FT                   /old_locus_tag="CTY05_00484"
FT   CDS_pept        503405..503998
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABBFA_00484"
FT                   /old_locus_tag="CTY05_00484"
FT                   /product="NAD(P)H dehydrogenase (quinone)"
FT                   /EC_number="1.6.5.2"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:Q9I509"
FT                   /protein_id="ATY42946.1"
FT                   /translation="MQPYILVLYYSKYGSTKEMAHLIANGVESAGVNVKIRTVPNIATV
FT                   VTEAEPSIPEEGDIYCTLEELANCAGLALGSPTRFGNMASEMKYFWDQTTSLWLNGALH
FT                   NKPACVFTSSGSMHGGQESTLLTMLPPLFHHGMMILGLPNSIPALSNTKTGGTPYGASH
FT                   VSGPRHDQSLSQDEKVLCEAQGKRLGEIVKKLHS"
FT   gene            complement(504051..504626)
FT                   /gene="xpt"
FT                   /locus_tag="ABBFA_00485"
FT                   /old_locus_tag="CTY05_00485"
FT   CDS_pept        complement(504051..504626)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="xpt"
FT                   /locus_tag="ABBFA_00485"
FT                   /old_locus_tag="CTY05_00485"
FT                   /product="Xanthine phosphoribosyltransferase"
FT                   /EC_number="2.4.2.22"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:P42085"
FT                   /protein_id="ATY42947.1"
FT                   /translation="MHALEQKILTEGIVLSDQVLKVDAFLNHQIDPVLMQQIGKEFAAR
FT                   FKDAGITKIITIEASGIAPAIMAGLELGVPVIFARKYQSLTLKDDLYRAKVFSFTKQTE
FT                   STIAISNKHINSSDKALVIDDFLANGQAALGLIDLIHQANAEVVGVGIVIEKSFQPGRD
FT                   LLLEKGYRVESLARVQSLADGTVTFVKE"
FT   gene            complement(504699..505412)
FT                   /locus_tag="ABBFA_00486"
FT                   /old_locus_tag="CTY05_00486"
FT   CDS_pept        complement(504699..505412)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABBFA_00486"
FT                   /old_locus_tag="CTY05_00486"
FT                   /product="hypothetical protein"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /protein_id="ATY42948.1"
FT                   /translation="MATKFLKSFSIATGISTTLLIASFSSHALAMSPFQANYQFTYNNK
FT                   GMGSATRALSQQGNNWTYQFTAKAGGIASASETSKFSFANGKIGSQSFSRTSKILIHNN
FT                   TMSINFNPGHKTISTKKDDKARSFAWQAGVLDELNAELQIREDLKNGSLKSSYPLADAK
FT                   EVENRRFVKQGNEKIKTSYGTFDTVKVVLQHKKPERSTIFWLAPKLDYLPVKVSHIDGK
FT                   TSYGLLLTSYTGKTN"
FT   gene            complement(505570..506241)
FT                   /locus_tag="ABBFA_00487"
FT                   /old_locus_tag="CTY05_00487"
FT   CDS_pept        complement(505570..506241)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABBFA_00487"
FT                   /old_locus_tag="CTY05_00487"
FT                   /product="hypothetical protein"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /protein_id="ATY42949.1"
FT                   /translation="MQTLFSSLVKRLHKVYRKAEAFIEEERDFTLSQTFLNATLERYVT
FT                   NNVEFLDDLHADLYHDWLRLYATMHVKGLETTLSVDLKLIQMEFNKEQQLIVFEQISNT
FT                   QIVEAKYKNFWQKIAVKAAIFYYHKILKKDPLGMILERFDVAQEKDDLIFLDLNRWFAK
FT                   KASIIETLGKVHINYARVREAELVVFGNVNLAALLFRDQDDDSEDELEDTEITPIQQKD
FT                   V"
FT   gene            506472..507356
FT                   /locus_tag="ABBFA_00488"
FT                   /old_locus_tag="CTY05_00488"
FT   CDS_pept        506472..507356
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABBFA_00488"
FT                   /old_locus_tag="CTY05_00488"
FT                   /product="Gram-negative bacterial tonB protein"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="protein motif:Pfam:PF03544.8"
FT                   /protein_id="ATY42950.1"
FT                   /translation="MLKKRSLSIEPFYYWWQDRVFIAAIILAILLHIFVLLIHFAMPAP
FT                   SEQSTKEIAISIRPTEDVIKHADFLAQADQQGSGAFREAHRMSSNSPAPMPSDASTGEA
FT                   QLETLEKVQQQRELKFEEKVLMTVLSWQKQAEESQRKKALEQLQSQFQAKAAMVASLEA
FT                   QYLQRQQDFSRQQKIKTVDGIQAKKDASAAYLDKFREKVELYGNRYYPEEAKQQQLKGE
FT                   VRLMVILNAQGGIRAIRLLESSGHPVLDEAAKASVRRGAPFGRFDANMKDISELRIIRT
FT                   WRFDPAEAEFEVH"
FT   gene            complement(507446..507922)
FT                   /gene="ybeY"
FT                   /locus_tag="ABBFA_00489"
FT                   /old_locus_tag="CTY05_00489"
FT   CDS_pept        complement(507446..507922)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybeY"
FT                   /locus_tag="ABBFA_00489"
FT                   /old_locus_tag="CTY05_00489"
FT                   /product="Endoribonuclease YbeY"
FT                   /EC_number="3.1.-.-"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:P71335"
FT                   /protein_id="ATY42951.1"
FT                   /translation="MKISLSLQQDFRSPELELKRAQLKKIIETTLRHVGYKEDCEIGIA
FT                   CVDLEESHQLNLQYREKDKPTNVLSFPSDIPEEVLPMLDALPLGDLVICIPVVLQEALE
FT                   QKKTAQNHFAHLLVHGVLHLLGYDHETSDEDAEEMEGLEIEILAKLNIANPYQE"
FT   gene            complement(507932..509020)
FT                   /gene="ybeZ"
FT                   /locus_tag="ABBFA_00490"
FT                   /old_locus_tag="CTY05_00490"
FT   CDS_pept        complement(507932..509020)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybeZ"
FT                   /locus_tag="ABBFA_00490"
FT                   /old_locus_tag="CTY05_00490"
FT                   /product="PhoH-like protein"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:P0A9K3"
FT                   /protein_id="ATY42952.1"
FT                   /translation="MTAAIRRTVTFPEISMERLKSILGAYNGHLKQIEQRLDVKITHRG
FT                   DVFYIDGEIDAVGRAEALLQRLYEETEASQQISADLLHLLIQSSQTERNFELVGEEMDE
FT                   HDAPMDVYFQTRKGRINPRGANQKRYVQRILQSDISFGVGPAGTGKTYLAVAAAVDMLE
FT                   RNEIQRILLVRPAVEAGEKLGFLPGDLTQKIDPYLRPLYDALYEMLGFEKVAKLIERQV
FT                   IEVAPLAYMRGRTLNHSFVILDEAQNTTPEQMKMFLTRLGFGSRAVITGDITQVDLPRG
FT                   QQSGLAHALRVLENIKEIHITRFHSRDVVRHQLVQKIVEAYEGWDGEQQRLNAEARAER
FT                   KARQEALIAENDTAADLQHQDA"
FT   gene            complement(509058..510509)
FT                   /gene="miaB"
FT                   /locus_tag="ABBFA_00491"
FT                   /old_locus_tag="CTY05_00491"
FT   CDS_pept        complement(509058..510509)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="miaB"
FT                   /locus_tag="ABBFA_00491"
FT                   /old_locus_tag="CTY05_00491"
FT                   /product="(Dimethylallyl)adenosine tRNA
FT                   methylthiotransferase MiaB"
FT                   /EC_number="2.-.-.-"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:Q9RCI2"
FT                   /protein_id="ATY42953.1"
FT                   /translation="MTVQTFIPNGAKAASENTVTQPTHTTDVSIKKLYIETQGCQMNEY
FT                   DSHRMADLLGDSHGYVLTNNPNEADILLMNTCSIREKAQEKVFSELGRWRKLKEQNPDL
FT                   VIGVGGCVASQEGDNIQKRAPYVDMIFGPQTLHRLPQMLDQHHAQVEKPKKEKIKLVDI
FT                   SFPDIEKFDFLPEPRVEGFKAFVSIMEGCSKYCSFCVVPYTRGEEVSRPLDDVLAEIAG
FT                   LAEKGVREISLLGQNVNGYRGETFEGGICTFPELLRLVAEIPGIGRLRYTTSHPLEFSD
FT                   ELIQCYEDLPQMVSHLHLPVQSGSNDVLKAMKRNHTIDVYIDKIAKLRKIRPDMHLSSD
FT                   FIIGFPGETDENFAETLQFIKDLDFDHSYSFVYSKRPGTPASDLPDTTPEHVKKERLAQ
FT                   VQQVIKQSSIEKTDAMLGKIERVLIEKVSDQDPNILVGTADNTRLVTFVGDASWVGRFA
FT                   EIEITEIKTLNLVYGELLNLEPDVA"
FT   gene            510756..512741
FT                   /gene="slt_1"
FT                   /locus_tag="ABBFA_00492"
FT                   /old_locus_tag="CTY05_00492"
FT   CDS_pept        510756..512741
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="slt_1"
FT                   /locus_tag="ABBFA_00492"
FT                   /old_locus_tag="CTY05_00492"
FT                   /product="Soluble lytic murein transglycosylase precursor"
FT                   /EC_number="4.2.2.-"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:P0AGC3"
FT                   /protein_id="ATY42954.1"
FT                   /translation="MRPGKKSSSNKSRVMKNKYAHRSWLGAVCLLGCSLSYAAEEQFND
FT                   ALNAANSGNTALLDQYQLAMQNDVLGYYPEYWKLNTNLGFQSPTSIVSFAQRYPQSAMA
FT                   EKLAADYVEEKVKQADFASAQPILPYVSNPDQAENCALAQVRAKSGDALVFAEYKDVWL
FT                   ATESQPESCIGLGRMMLSSPLMSTQDKQQRLWVQLRAGLSGQALATAQTLGLNLSLAQL
FT                   NQIQANPLNYLWSAPKTNDVDYAYLIFALGRLANNDLGNAFANVQRVAQGTPESVQKYL
FT                   YRTVAYIGGTTVMKNNFNREVLQYFDASYGYPLSPEEAEIYARQAIRFSAWESLIRAID
FT                   SMSVSQKQEDRWQYWLARATEQRGDSNSKNTAQRIYKKLAETGDDYHNLLAKDRLGVRY
FT                   NHQPYNDEPTASDLRRLDQNIHFNRAFTLRRINANPTYTNREWNWAVRQAYLQHDDGLL
FT                   LAAAKRAHDMGWYDRAIYAADRTTNKHNDTYRYVTPHKTNVVSHSYNAGIDPAWAYGLM
FT                   RQESRFVTSARSHVGAGGLMQIMPDTAKLIARQMGETYNPAALSEMNTNIRYGTFYLSM
FT                   IQGQLSNNPVLATAGYNAGPNRARRWQPDYQPIEADQYTETIPLLETRDYVKHVMTNAT
FT                   HYGVILGQGAQSLIQRMKVIPTRSSP"
FT   gene            512799..513461
FT                   /locus_tag="ABBFA_00493"
FT                   /old_locus_tag="CTY05_00493"
FT   CDS_pept        512799..513461
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABBFA_00493"
FT                   /old_locus_tag="CTY05_00493"
FT                   /product="Ribonuclease T2 family protein"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="protein motif:Pfam:PF00445.12"
FT                   /protein_id="ATY42955.1"
FT                   /translation="MKYRDLGLQSISQLAWWIICASVGLLSSVLHAEPVNVQGYVMHVQ
FT                   MTPAVCALDPSKQKQRKCLEGYSLTITGLMPETTRTDCSTQSSATLSPLQAKVVARVMP
FT                   DNNARVQLWRSVGGCVPMNASQYFRTIINFAERLKIPANLTSSTNVEMQQSTLRQQFTK
FT                   LNPSLPQNGIRFTCQLSRSDVVLTEVKVCYTVNGQYKQCSNHVVSNCPSEITIKGSY"
FT   gene            513673..514659
FT                   /gene="mdh_1"
FT                   /locus_tag="ABBFA_00494"
FT                   /old_locus_tag="CTY05_00494"
FT   CDS_pept        513673..514659
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mdh_1"
FT                   /locus_tag="ABBFA_00494"
FT                   /old_locus_tag="CTY05_00494"
FT                   /product="Malate dehydrogenase"
FT                   /EC_number="1.1.1.37"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:Q9ZF99"
FT                   /protein_id="ATY42956.1"
FT                   /translation="MKQPVRVAVTGAAGQIGYSLLFRIASGEMLGKDQPVILQLLEVPV
FT                   EKAQQALKGVMMELDDCAFPLLAGMIGTDDPKVAFKDADYALLVGSRPRGPGMERADLL
FT                   KVNGEIFIGQGQALNEVASRDVKVLVVGNPANTNAYIAMKSAPDLPAKNFTAMLRLDHN
FT                   RALTQVAQKAGVAVADIEKLTVWGNHSPTMYADYRFATANGESLKDKINDPAWNKDVFL
FT                   PTVGKRGAAIIEARGLSSAASAANAAIDHMRDWALGTNGKWVTMGVPSDGSYGIPEGVM
FT                   FGFPVTTENGEYKIVQGLEIDEFSRERINFTLNELEEERAAIADMVK"
FT   gene            514823..515068
FT                   /locus_tag="ABBFA_00495"
FT                   /old_locus_tag="CTY05_00495"
FT   CDS_pept        514823..515068
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABBFA_00495"
FT                   /old_locus_tag="CTY05_00495"
FT                   /product="hypothetical protein"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /protein_id="ATY42957.1"
FT                   /translation="MFEQQPTLQLLFEQLGLDSDDASIENFIRTHQLPAEQKLHEASFW
FT                   SQGQSDFLKSHWEKDDEWIVVIDELNEQLHEDSVKK"
FT   gene            complement(515117..515644)
FT                   /locus_tag="ABBFA_00496"
FT                   /old_locus_tag="CTY05_00496"
FT   CDS_pept        complement(515117..515644)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABBFA_00496"
FT                   /old_locus_tag="CTY05_00496"
FT                   /product="hypothetical protein"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /protein_id="ATY42958.1"
FT                   /translation="MSIETKAIVSRIGETDQLYLTENTPELALERAELRMQLVTLSRVR
FT                   QEQIHFLQEAIVLLEQARMEYEEMPMSLYLNLSLHLAKAYMLYFELNKEKRFALIAQQI
FT                   LKPLAHHQHGDIYFFLAYASAAQQESALTRHWLTKYLSTAQCDLELLHEHPIFNPVRHE
FT                   PWYKNLIKLRTH"
FT   gene            complement(515712..516317)
FT                   /locus_tag="ABBFA_00497"
FT                   /old_locus_tag="CTY05_00497"
FT   CDS_pept        complement(515712..516317)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABBFA_00497"
FT                   /old_locus_tag="CTY05_00497"
FT                   /product="2OG-Fe(II) oxygenase superfamily protein"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="protein motif:Pfam:PF03171.14"
FT                   /protein_id="ATY42959.1"
FT                   /translation="MHSQPLPDCWNLDQILDDLNAHGFAIVNQAYSPEYHTQVAKECSH
FT                   HFDEFREAGIQNGVVSTIRSDHILWINESLPVAEQHVETLTSFCQHLNQAFFLGIKEVE
FT                   AHFACYNPGEFYALHRDNPQQKNDRIMSTVYYLHPQWQDDWGGQLRLQDKNNIWHIITP
FT                   EPNRLVIFQSNLLHEVLVSKQQRLSITAWLRSGNSIWV"
FT   gene            516435..517292
FT                   /gene="rlmJ"
FT                   /locus_tag="ABBFA_00498"
FT                   /old_locus_tag="CTY05_00498"
FT   CDS_pept        516435..517292
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rlmJ"
FT                   /locus_tag="ABBFA_00498"
FT                   /old_locus_tag="CTY05_00498"
FT                   /product="Ribosomal RNA large subunit methyltransferase J"
FT                   /EC_number="2.1.1.266"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:P37634"
FT                   /protein_id="ATY42960.1"
FT                   /translation="MNYRHHFHAGNFADVMKHVLLLQLLNRLNAKDKPYRYIDTHGGAG
FT                   KYDLSQAPAQKSGEFLTGIHRLVQLSDMEKRQAPEAIQQYLKLVEELRAQEGKGSYPGS
FT                   PWFALQGMREIDKATIFEMQRDVFQQLRHNIHDKRAGLHERDAYEGLLAVIPPKEKRGL
FT                   VMIDPPYELERKDFPQLVELLQSAYKKWPTGVFAVWYPIKDRAMIERFEKKMFKTGIRR
FT                   QLICEICVWPDDTPVGLNGCGLLVINPPWQFSEQADQALQWLFPHLRMQETGGHAAVRW
FT                   LVGE"
FT   gene            517334..518167
FT                   /locus_tag="ABBFA_00499"
FT                   /old_locus_tag="CTY05_00499"
FT   CDS_pept        517334..518167
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABBFA_00499"
FT                   /old_locus_tag="CTY05_00499"
FT                   /product="CDP-alcohol phosphatidyltransferase"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="protein motif:Pfam:PF01066.15"
FT                   /protein_id="ATY42961.1"
FT                   /translation="MTNAPKPEQDLTHNEHSFDGITFEVVEEEDNPEGQKVKRRGIYLW
FT                   PNLITTAALLSGFYSIIASMNGEFAQAIYAIFLAALFDGLDGRVARAIGAQSAFGEQYD
FT                   SLSDLLAFGVAPAMLMYSWSLHDLGRIGLACCFVYTACAAFRLARFNVQIGVVDKRYFI
FT                   GIASPLAAIIIISLVWVARDYPFIFDLRDIAIQTINAVIMVVVGLLMISNIKYYSFKQM
FT                   DRKRVPFVVMLPVVLIFAAITYNIPMGILIVSIIYALSGFVTTLLAKKNNETIKT"
FT   gene            518186..519253
FT                   /locus_tag="ABBFA_00500"
FT                   /old_locus_tag="CTY05_00500"
FT   CDS_pept        518186..519253
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABBFA_00500"
FT                   /old_locus_tag="CTY05_00500"
FT                   /product="hypothetical protein"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /protein_id="ATY42962.1"
FT                   /translation="MPKLISEKNQLQQLSLNSNGGVVYQPARGFFKVVYQGLILPNLPA
FT                   PLRYFNYISLIGQPRIPLCYNANGIVTSAVDTATVLVSNSLHSVGHLKTYSIRRQCQLN
FT                   PSRYQFDKTDLIEWQIPRVQLRRIDSEMSCDLIVQTPSDISNSSALQWGISDYWSILCH
FT                   CEGEILYKGQKYEVNGLGRFKHARALHLPFLSLCFYTCQIINLNETTQVTLSQIRNQWN
FT                   IILFSRLDIQELGTQPLTFTEDVNFHIHRVYPKVETPHGREMYLPREFSWQCKKNGKVI
FT                   FELYGESRGDYKFGLAAGYIGSFRYQLSWNDQCLQGEGGYCEYIDCRPLRWQEKNQNEK
FT                   MLDKLLLLQPCLYKK"
FT   gene            521313..521389
FT                   /locus_tag="ABBFA_00501"
FT                   /old_locus_tag="CTY05_00501"
FT   tRNA            521313..521389
FT                   /locus_tag="ABBFA_00501"
FT                   /old_locus_tag="CTY05_00501"
FT                   /product="tRNA-Ile"
FT                   /note="tRNA-Ile(gat)"
FT                   /inference="COORDINATES:profile:Aragorn:1.2"
FT   gene            521445..521520
FT                   /locus_tag="ABBFA_00502"
FT                   /old_locus_tag="CTY05_00502"
FT   tRNA            521445..521520
FT                   /locus_tag="ABBFA_00502"
FT                   /old_locus_tag="CTY05_00502"
FT                   /product="tRNA-Ala"
FT                   /note="tRNA-Ala(tgc)"
FT                   /inference="COORDINATES:profile:Aragorn:1.2"
FT   gene            525262..525612
FT                   /locus_tag="ABBFA_00503"
FT                   /old_locus_tag="CTY05_00503"
FT   CDS_pept        525262..525612
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABBFA_00503"
FT                   /old_locus_tag="CTY05_00503"
FT                   /product="Glutathione-dependent formaldehyde-activating
FT                   enzyme"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="protein motif:Pfam:PF04828.8"
FT                   /protein_id="ATY42963.1"
FT                   /translation="MEYKGSCHCGQVKFAAEGELTEALSCNCSICQKKGSLLWFLPTNQ
FT                   VTVTLDSPDILANYTFNKHVINHHFCKNCGIHPYAQGIDAQGNSIFAINVRCIDDIDLE
FT                   KIKINYFDGRSV"
FT   gene            525632..526195
FT                   /locus_tag="ABBFA_00504"
FT                   /old_locus_tag="CTY05_00504"
FT   CDS_pept        525632..526195
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABBFA_00504"
FT                   /old_locus_tag="CTY05_00504"
FT                   /product="hypothetical protein"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /protein_id="ATY42964.1"
FT                   /translation="MMTKKQLTSKQIDMLLELLKNRFEKNIHRHKEIDWANVRAKLIKS
FT                   PDKLWTLQEMENTGGEPDVVAYNKQKDEYLFVDCSAETPKGRRSLCYDREALESRKDHP
FT                   PKNSAIDLVQEIGAELLTEEQYHQLQQLGEFDLKTSSWLATPEEIRKLGGALFADRRYG
FT                   RVFIYHNGAQSYYAARGFRCCLRV"
FT   gene            526332..527495
FT                   /gene="mmgC_3"
FT                   /locus_tag="ABBFA_00505"
FT                   /old_locus_tag="CTY05_00505"
FT   CDS_pept        526332..527495
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mmgC_3"
FT                   /locus_tag="ABBFA_00505"
FT                   /old_locus_tag="CTY05_00505"
FT                   /product="Acyl-CoA dehydrogenase"
FT                   /EC_number="1.3.99.-"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:P45857"
FT                   /protein_id="ATY42965.1"
FT                   /translation="MQLNPIYYNEQHIAFADNVRRFVQKEMTPFVNEWDEAETFPRELY
FT                   KKAAEIGLLGLGFSEEYGGIPDADPFYSLLAGIEMAKAGSGGVHISLMVHTIGAPPIQY
FT                   FGSEELKARVLPGIISGEKISALAITEPGGGSDVAALQTKAVRDGDYYIVSGEKTFITS
FT                   GIRADYYTVAVRTDPTKTGAEGISMLLIDAHSEGITKTPLKKMGWWASDTAHLHFDQVR
FT                   VPVSNLLGKENAGFKVIMNNFNMERFFLGVVAYGYALVCYEEALEWAQQRKTFGKRLID
FT                   HQVVRHKLVDMATQLTSTRALLEETAWKMTQLKLQGPELVAQISMLKNVATRTMQFCAD
FT                   AAVQTLGGMGFMRGTKSERIYREVKVNMIGGGAEEIMKDLISKQLGY"
FT   gene            complement(527527..528126)
FT                   /gene="kstR2_1"
FT                   /locus_tag="ABBFA_00506"
FT                   /old_locus_tag="CTY05_00506"
FT   CDS_pept        complement(527527..528126)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kstR2_1"
FT                   /locus_tag="ABBFA_00506"
FT                   /old_locus_tag="CTY05_00506"
FT                   /product="HTH-type transcriptional repressor KstR2"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:A0R4Z6"
FT                   /protein_id="ATY42966.1"
FT                   /translation="MIATSIEQIPNIPCFDDSPRGRLLHGAAYLFHKQGYDKTTVRELA
FT                   QFIGIQSGSLFHHFKSKDDILAHVMEQTIIYNLARLNDAATQSTDPEQQLRALIKAELI
FT                   SITGDTGAAMAVLVYEWFALSKEKQDYLLKMRNEYEQIWLDIIEKLRTQGKVKHDAFIW
FT                   RRLIGGAISWTVTWYKSEGKVKIDELTEMVWEMALK"
FT   gene            528313..530118
FT                   /locus_tag="ABBFA_00507"
FT                   /old_locus_tag="CTY05_00507"
FT   CDS_pept        528313..530118
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABBFA_00507"
FT                   /old_locus_tag="CTY05_00507"
FT                   /product="hypothetical protein"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /protein_id="ATY42967.1"
FT                   /translation="MANNQQDDHRVVKIGCASGFWGDTNTAAFQLVHLTDINYLVFDYL
FT                   SEITMSIMAKAKMVEPKHGYALDFVSRVMAPLLKKIAEKKIKVISNAGGVNPLACRDAL
FT                   QKIIKEYGLDLKVAVVLGDDLLPKHEQLKSQNIQEMFSGEALPEQVASSNAYLGAVAIR
FT                   DALDLGADIVITGRVVDSAVVLAPLLHEYQWSLDDYDKLAQGSLAGHVIECGAQCTGGN
FT                   FTDWQLVQGFDNMGFPVVEVSEDGSFVVTKPQGTGGLVSTATVAEQIVYEIDNPQAYLL
FT                   PDVIADFSHVHLEQVGEHRVRVMGAKGQAPTTQYKVSATYPDGYRVLVSFLIAGREAPQ
FT                   KAQVIADAILTKCERVLAMRSVPPFSEKSVEILGIESTYGDHAKTLNSREVVVKIAVKH
FT                   MFKEACMFFASEIAQASTGMAPALAGIVGGRPKASPVIKLFSFLIDKNQVNVEIDFDGQ
FT                   RHAVEIPQGVSTEQLLTLTAGENAVYQGDEIEVPLIEIAHARSGDKGNHSNIGVIARKA
FT                   DYLPWIRAALTEQSVASYMQHVLDAEKGRVIRYELPGLNALNFMLENALGGGGVASLRI
FT                   DPQGKAFAQQLLDMPVKVPAHLLEK"
FT   gene            530139..531050
FT                   /gene="fadH_1"
FT                   /locus_tag="ABBFA_00508"
FT                   /old_locus_tag="CTY05_00508"
FT   CDS_pept        530139..531050
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fadH_1"
FT                   /locus_tag="ABBFA_00508"
FT                   /old_locus_tag="CTY05_00508"
FT                   /product="putative 2,4-dienoyl-CoA reductase"
FT                   /EC_number="1.3.1.34"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:O34717"
FT                   /protein_id="ATY42968.1"
FT                   /translation="MSYQSIFRPDAFANKVIIVTGGGSGIGRCTAHELAALGAQVVITG
FT                   RKIEKLEKVSQEIIEDGGLVHFIVCDNREEEQVKNMIAEVIEKFGKLDGLVNNAGGQFP
FT                   SALENISANGFDAVVRNNLHATFYLMREAYNQWMAKHGGSIVNMTADMWGGMPGMGHSG
FT                   AARSGVDNLTKTASVEWGKSGVRVNAVAPGWIVSSGMDNYSGDFAKVIIPSLAGNVPLK
FT                   RMGTESEVSSAICYLLSDAAAFVSGVTLRIDGAASQGTRMYPLAEATNSQSYNGFHRAF
FT                   IPEIFKKDKTAKVEQSNNSGSE"
FT   gene            531061..532674
FT                   /gene="accD5"
FT                   /locus_tag="ABBFA_00509"
FT                   /old_locus_tag="CTY05_00509"
FT   CDS_pept        531061..532674
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="accD5"
FT                   /locus_tag="ABBFA_00509"
FT                   /old_locus_tag="CTY05_00509"
FT                   /product="putative propionyl-CoA carboxylase beta chain 5"
FT                   /EC_number="6.4.1.3"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:P96885"
FT                   /protein_id="ATY42969.1"
FT                   /translation="MTILQSEITVGSEQYQKNKEALLAQLNEVRAIQQKSIDKSYAAKP
FT                   KFDKKGKILPHERVRLLLDADSPFVELCGLVGYNMHDDKDGSEAGGGVIAGIGFVSGVR
FT                   CLVSASNSAIKGGTMSPMGVQKTLRLQKIALEQKLPLITLTESGGANLNYAAEVFTYGG
FT                   MTFANQARLSAAGIPQLAVVHGNATAGGAYQPGLSDYVIVVRKQTEMLLAGPPLLLAAT
FT                   GEVATVEELGGAEMHAQVAGTAEYLAENDADGIRLAREIFEHLNWKEQIKPVDVTYKEP
FT                   RYDTEELLGVIPSDPKQPFDMKEVVARIIDDSDFLEFKQEYDDLTVCGWAKIGGLHIGI
FT                   ITNNGPITPQGAVKAAQFIHLCEQTNRPLLFLHNTTGFMVGTDAEQNGIIKHGSKLIQA
FT                   VANCTVPKISIVVAGSYGAGNYAMCGRSLSPDFIFAWPNSHVAVMGAAQAGKVLRIVAE
FT                   GKQKASGQEPNPQMLDFLEQSTAMKLEQQSTALFNTAMLHDDGIIDPRDTRKLLIFLLE
FT                   TIYEAQQRDLNPTRFGVSRF"
FT   gene            532717..533874
FT                   /gene="mmgC_4"
FT                   /locus_tag="ABBFA_00510"
FT                   /old_locus_tag="CTY05_00510"
FT   CDS_pept        532717..533874
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mmgC_4"
FT                   /locus_tag="ABBFA_00510"
FT                   /old_locus_tag="CTY05_00510"
FT                   /product="Acyl-CoA dehydrogenase"
FT                   /EC_number="1.3.99.-"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:P45857"
FT                   /protein_id="ATY42970.1"
FT                   /translation="MKFTAEHEALRRTARQFVENELNPNIPEWEEAGRFPIHDVFKKMG
FT                   DLGLLGICKPEENGGLALDYSYNLVVAEEIGRAACGGVPLAIGVQTDMATPALARFGSK
FT                   ELRDEFLTPAIAGEYVASIAVSEVHAGSDVAAIKTTAKKDGDDYVINGSKMWITNSLQA
FT                   DFFCLLANTSDDKPHVNKSMIIVPAKTKGISFSEPLNKLGMRSTTTAQVYLDNVRVPQR
FT                   NLVGVEGMGFMMQMMQFQEERLWACANAIGGLENLIQKTIAYTKERTTFGQPLINNQYI
FT                   HFRFAELMTEVEALKALTYQACEQHIAGEDVTKLASMAKLKAGRLSREVADSCLQYWGG
FT                   NGFMWDNPASQLYRDGRLGSIGGGADEIMLGIICKLMDILPKKQK"
FT   gene            533885..534718
FT                   /gene="echA8_1"
FT                   /locus_tag="ABBFA_00511"
FT                   /old_locus_tag="CTY05_00511"
FT   CDS_pept        533885..534718
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="echA8_1"
FT                   /locus_tag="ABBFA_00511"
FT                   /old_locus_tag="CTY05_00511"
FT                   /product="putative enoyl-CoA hydratase echA8"
FT                   /EC_number="4.2.1.17"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:P64016"
FT                   /protein_id="ATY42971.1"
FT                   /translation="MTLSASLHIDIDDSIQLEQDGSILYLWLNRPESRNAMNLNMVNAI
FT                   QQVFTAIRDDLSIRAVIIRGEGGTFCAGGDIKDMAALRVEATNVGSLQPYTNFNRRFGA
FT                   MLEQVEAAPQTVVVILESAVLGGGFGLACVSDVAISRDNAQFGLPETGLGVIPAQIAPF
FT                   VVKRIGLTQARRLALLGMRFEGHTALSVGVVHQIAHNEIELEQALQETIQQIKRAAPQA
FT                   SRVTKALLHRTLNEPLNQLLDDAAQQFAQAVGSAEGQEGTMAFIQKRLPNWADET"
FT   gene            534737..536677
FT                   /gene="accA1_1"
FT                   /locus_tag="ABBFA_00512"
FT                   /old_locus_tag="CTY05_00512"
FT   CDS_pept        534737..536677
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="accA1_1"
FT                   /locus_tag="ABBFA_00512"
FT                   /old_locus_tag="CTY05_00512"
FT                   /product="Acetyl-/propionyl-coenzyme A carboxylase alpha
FT                   chain"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:P0A508"
FT                   /protein_id="ATY42972.1"
FT                   /translation="MKFSKILVANRGEIAVRVMQTAKAMGYQTVAVYSDADRNARHVQE
FT                   ADEAVYIGASKVSESYLSIAKIIEACKKTGADAVHPGYGFLSENTDFAQACIDNQITFI
FT                   GPTASAIELMGSKRLSKIAMIEAGVPCVPGYEGDRQDLEYLATQAEQIGFPIMVKASAG
FT                   GGGRGMRLVQQASELFEALQTARSEAENAFGSGELILEKAVIAPRHVEIQVFGDTHGNY
FT                   VYLFERDCSIQRRHQKVVEEAPCPVMTPELRQKMGEAAVAAAKTCAYVGAGTVEFLLDA
FT                   SGAFYFLEMNTRLQVEHPVTELITGLDLVEWQLRVANGEQLPLKQQELTLNGHAIEVRL
FT                   YAEDPRQDFLPQTGKILRWKPAALPNVRIDHGMLATDEVSPFYDPMVAKVIAYGKTRED
FT                   AIRLLARAVDDSVLLGVNSNKQLLVNLLRHPVVVAGDTNTAFIQQHFKNDPSLHYQVLS
FT                   LETLAIAAALFSQSKGPAVWQTGLGVPLPLKLQTADQQIQLQLSSVNNTFTVELCEQTV
FT                   SIEVVEKTAEQLIYLLDGVRHRVQYVLDGDQLYLDRDNGNVAIRNVTYAAPEIADVAGD
FT                   GKIRAPMDGAVVNILVNKGDQVIKGQTLLVLEAMKIQQQIKSDVDGVVDEILGQQGQQV
FT                   KKRQMLFSIQI"
FT   gene            complement(536781..537437)
FT                   /locus_tag="ABBFA_00513"
FT                   /old_locus_tag="CTY05_00513"
FT   CDS_pept        complement(536781..537437)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABBFA_00513"
FT                   /old_locus_tag="CTY05_00513"
FT                   /product="hypothetical protein"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /protein_id="ATY42973.1"
FT                   /translation="MAFDLVQYFAEQIKIQKPQLLNQYPANEKNKLIDEVNILTLGKLI
FT                   SLWRQDDNKIYHEIKTADPLYIQEVARHLTTSKHNKSVLKNAELEQSISEILALQLTEL
FT                   NQLDETGGFGQSGLKELILGQVEHLSGQAEDWVWSTNHLTELIGSKPVEQEELSLDATM
FT                   KEFNQMVHQAQPHHEDLHVEEQPIETFIPGWSKIIAPLVALAILGYLYCMYTQLV"
FT   gene            complement(537455..537883)
FT                   /gene="sspB"
FT                   /locus_tag="ABBFA_00514"
FT                   /old_locus_tag="CTY05_00514"
FT   CDS_pept        complement(537455..537883)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sspB"
FT                   /locus_tag="ABBFA_00514"
FT                   /old_locus_tag="CTY05_00514"
FT                   /product="Stringent starvation protein B"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:P0AFZ3"
FT                   /protein_id="ATY42974.1"
FT                   /translation="MSEQTIELTPTRPYLARAIYEWICDNQLTPYLLVDATQPHTDVPQ
FT                   QFVKDGQIVLNIVPHAVHQLLISNDAITFSARFGGVSKDIYVPIQAVLGIYARENGQGL
FT                   FFDPEEYANVAPVEDKLDSETQETSEPTKKKPTLRILD"
FT   gene            complement(537890..538543)
FT                   /gene="sspA"
FT                   /locus_tag="ABBFA_00515"
FT                   /old_locus_tag="CTY05_00515"
FT   CDS_pept        complement(537890..538543)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sspA"
FT                   /locus_tag="ABBFA_00515"
FT                   /old_locus_tag="CTY05_00515"
FT                   /product="Stringent starvation protein A"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:P0ACA3"
FT                   /protein_id="ATY42975.1"
FT                   /translation="MSVENTSIQGITLYSHADDFRSHWIRFLLAEKQIKYQLIVTDHED
FT                   EDLASLNPYNQLPMLVEQNLKLFSAPIIAEYLDDRYRQNKLYADAPMARAEQRQYIWRL
FT                   ENDWFKLADHMLRHADTLNIEQKQKAQKELRDTLISLTPLFQHFPYFMSENFSILDCML
FT                   APIFVRLNSMGIDLPKQQCRPIFLYCKRIFSRPSFVKSMTPQEKTRYNELLNME"
FT   gene            complement(538714..539100)
FT                   /gene="rpsI"
FT                   /locus_tag="ABBFA_00516"
FT                   /old_locus_tag="CTY05_00516"
FT   CDS_pept        complement(538714..539100)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsI"
FT                   /locus_tag="ABBFA_00516"
FT                   /old_locus_tag="CTY05_00516"
FT                   /product="30S ribosomal protein S9"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:P0A7X3"
FT                   /protein_id="ATY42976.1"
FT                   /translation="MATNYGTGRRKTATARVFLSAGTGKLVINNRTLEQYFGRETARMV
FT                   VRQPLELLEATEKYDLYITVKGGGIGGQAGAIRHGITRALIAADETLKPVLRQAGFVTR
FT                   DAREVERKKLGLRKARKRPQFSKR"
FT   gene            complement(539113..539541)
FT                   /gene="rplM"
FT                   /locus_tag="ABBFA_00517"
FT                   /old_locus_tag="CTY05_00517"
FT   CDS_pept        complement(539113..539541)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplM"
FT                   /locus_tag="ABBFA_00517"
FT                   /old_locus_tag="CTY05_00517"
FT                   /product="50S ribosomal protein L13"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:Q1R6A9"
FT                   /protein_id="ATY42977.1"
FT                   /translation="MKTLSAKPAEVQHDWFVVDATGKTLGRLATEIARRLRGKHKTSYT
FT                   PHVDTGDYIIVINAEQVQVTGNKALDKKYYRHTEFPGGLKETNFEKLVAHKPEEIFERA
FT                   VKGMLPKGPLGYAMIKKMKVYAGSEHPHAAQQPQVLDI"
FT   gene            539723..540697
FT                   /gene="pdxA1"
FT                   /locus_tag="ABBFA_00518"
FT                   /old_locus_tag="CTY05_00518"
FT   CDS_pept        539723..540697
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pdxA1"
FT                   /locus_tag="ABBFA_00518"
FT                   /old_locus_tag="CTY05_00518"
FT                   /product="4-hydroxythreonine-4-phosphate dehydrogenase 1"
FT                   /EC_number="1.1.1.262"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:Q9I5U4"
FT                   /protein_id="ATY42978.1"
FT                   /translation="MIVLPLYVTSGEPAGIGPDICLSLAKRVDERPVVVLADRNLLQQR
FT                   AQKLGLDIKFLEYSGQAESSLQGELYIEHVPLETIVVDGQLNAANAAYVLEQLRRSADY
FT                   AMSGKSVGVATAPVQKSVINDAGILFSGHTEYYQEFAGVERVVMMLATKTLRVALATTH
FT                   LPLRDVADAITKERLHQVIDILLHDLKTKFKINDPRVLVCGLNPHAGEDGYLGREEIDT
FT                   INPVLESYRSQGVKLSLSLPADTLFTPEHLKNADAVLAMYHDQGLPVLKSQGFGEAINI
FT                   TLGLPFIRTSVDHGTALSLAGTGLAKSSSLNVAVDLALSLAAS"
FT   gene            540721..541533
FT                   /gene="rsmA"
FT                   /locus_tag="ABBFA_00519"
FT                   /old_locus_tag="CTY05_00519"
FT   CDS_pept        540721..541533
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rsmA"
FT                   /locus_tag="ABBFA_00519"
FT                   /old_locus_tag="CTY05_00519"
FT                   /product="Ribosomal RNA small subunit methyltransferase A"
FT                   /EC_number="2.1.1.182"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:P06992"
FT                   /protein_id="ATY42979.1"
FT                   /translation="MYQINALNPKDEGHKARKRFGQNFLHDQRVIAKIVRSVNPRTGDN
FT                   IVEIGPGLAALTSPLIGECDALTVVELDRDLAAGLPERVPHPERLTIVEADALKYDFSQ
FT                   LVKDGRPLRVVGNLPYNISTPLLFHLLEFGSQVKDMHFMLQKEVVERITAEPNTKEYGR
FT                   LSVMIQYYCQPTFLFEVPAGAFNPPPKVTSAVFRLVPYEQKPITAKDEKALARLVAHVF
FT                   TQRRKTLRNSLKGMLAEDGFEKAGVDPMARPETLTLAEFVALADQMVA"
FT   gene            541534..542373
FT                   /gene="apaH"
FT                   /locus_tag="ABBFA_00520"
FT                   /old_locus_tag="CTY05_00520"
FT   CDS_pept        541534..542373
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="apaH"
FT                   /locus_tag="ABBFA_00520"
FT                   /old_locus_tag="CTY05_00520"
FT                   /product="Bis(5'-nucleosyl)-tetraphosphatase, symmetrical"
FT                   /EC_number="3.6.1.41"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:Q83SQ2"
FT                   /protein_id="ATY42980.1"
FT                   /translation="MTKRYNYIIGDVQGCFEALKALLKEIRFDPDQDFIWFAGDLVARG
FT                   ENSIGALRFIKKLADRGAAATVLGNHDLTLIAGARGLKEIKEKDRTQDVIDAVDGDDLI
FT                   DWLRKQPLCLFPNEQTILTHAGVPCIWDAQKTAALAKEVEAVLAHDDLSVLDAFLAEMY
FT                   GSKPDLWTDDLTGNERLRCITNYLTRMRLTNAEGALEFSFKDTLDAPMPEGYLPWFEFP
FT                   SKAAQTHQIFFGHWAALEGRTISEHIQNVDGGCVWGKNLIAYRLEDQQAFSVSNPVM"
FT   gene            complement(542416..542859)
FT                   /locus_tag="ABBFA_00521"
FT                   /old_locus_tag="CTY05_00521"
FT   CDS_pept        complement(542416..542859)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABBFA_00521"
FT                   /old_locus_tag="CTY05_00521"
FT                   /product="hypothetical protein"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /protein_id="ATY42981.1"
FT                   /translation="MGKFFVGALLLVGINTATFAADITGLWQTIDDKTGTPKAHVEIRK
FT                   EANGTYAGKIVKITPRPGYTPKEICDNCPAPYTNKPILGLDIATGLKQTDNSTYTGGKI
FT                   LDPNTGKVYGLKAKLSANGKRLHMRGYLGVSALGRNQIWIRLE"
FT   gene            complement(542944..543618)
FT                   /gene="cidB_1"
FT                   /locus_tag="ABBFA_00522"
FT                   /old_locus_tag="CTY05_00522"
FT   CDS_pept        complement(542944..543618)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cidB_1"
FT                   /locus_tag="ABBFA_00522"
FT                   /old_locus_tag="CTY05_00522"
FT                   /product="Holin-like protein CidB"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:P60639"
FT                   /protein_id="ATY42982.1"
FT                   /translation="MFMILYGFLITLVGYLCAKPLNRRFPQVPLLVFGMFIVIGLLSIL
FT                   KVPYEEYRLYVNDLFSHLLGYVTVALAIPLAAMRYDDLPLKSVIGILCFASISAVALPM
FT                   GLAYLLHMSEPTILAFATRAVTTPIALNIATLLHAPETLVTLIVILSGVIGAAFSPFLL
FT                   KHIHDERASGLALGLAAHAIGTAQAWQRGPVAGRYAAFGMALNGVFTAIWLPTFMLSFG
FT                   IH"
FT   gene            complement(543629..544000)
FT                   /locus_tag="ABBFA_00523"
FT                   /old_locus_tag="CTY05_00523"
FT   CDS_pept        complement(543629..544000)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABBFA_00523"
FT                   /old_locus_tag="CTY05_00523"
FT                   /product="hypothetical protein"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /protein_id="ATY42983.1"
FT                   /translation="MDKIKSIDWAAWVGTLLLIIGFREGSVVVMRAFGHPELGNLVGLI
FT                   SLLIVLLIWRKFKKIPLRLVDTNNKVMKESGFAFLPICAGSLIMLVHMGKEIPLFLFVL
FT                   VVSTLIPLWVYAKMAKHWL"
FT   gene            complement(544043..545377)
FT                   /gene="hflX"
FT                   /locus_tag="ABBFA_00524"
FT                   /old_locus_tag="CTY05_00524"
FT   CDS_pept        complement(544043..545377)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hflX"
FT                   /locus_tag="ABBFA_00524"
FT                   /old_locus_tag="CTY05_00524"
FT                   /product="GTPase HflX"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:P25519"
FT                   /protein_id="ATY42984.1"
FT                   /translation="MEYVDRHQGGERTILVSVSVQLLDDLDAEEFALLAQSAGADILEH
FT                   IKVQRNKPDPKFFIGSGKVDEIAEQVQELEASLVIFDHALTPAQERNLEKILKCRVIDR
FT                   TGLILDIFAQRARTHEGKLQVELAQLKHLSTRLIRGWSADFEQQKGGIGLRGPGESQLE
FT                   TDRRLIRVRITQLKDKLEKVHQTRMQGRAARQKASIPTVSLVGYTNAGKSTLFNILAKS
FT                   DVYAADQLFATLDPTLRRLEWDGIGTVVLADTVGFVRNLQHDLVESFKATLEETLEATL
FT                   LLHVIDSSSHDMLDQIEAVEGVLKEIGADAPVLRVYNKIDLSGEEAKIIYSEPHVPDRV
FT                   YVSAHSGLGLDLLRQAVQECLMGQLQHFSLVLKPAYGKLRTQLYALNVIQSEHYDDEGL
FT                   LHIDIRIAPHKLEQLIRQAKLPIDEILGERASQFKRPLEEFEIKH"
FT   gene            545581..546390
FT                   /locus_tag="ABBFA_00525"
FT                   /old_locus_tag="CTY05_00525"
FT   CDS_pept        545581..546390
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABBFA_00525"
FT                   /old_locus_tag="CTY05_00525"
FT                   /product="2-acyl-glycerophospho-ethanolamine
FT                   acyltransferase"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="protein motif:CLUSTERS:PRK08633"
FT                   /protein_id="ATY42985.1"
FT                   /translation="MTQTQSIVNSTLKKFSKIGLYGKKVTSATAAISEGFYLVYRHGLY
FT                   KDPNNPVNTRYVQYFCRRLCQVFNLEVQVHGTIPREPALWVSNHISWLDIAVLGSGARV
FT                   FFLAKAEIEKWPILGNLAKGGGTLFIKRGSGDSIKIREQITEFLKQNIPVLFFPEATTT
FT                   DGHSVKRVHGRLLGAAIEAQRPVQVCLICYVNRHGELDNVAPFIGEMSFVEHIQRVLEM
FT                   PKVTAHLLTLPPISVEGHDVKSLTQEVQEKMVEGLAQLHKKVLKPKS"
FT   gene            complement(546391..548016)
FT                   /gene="clsA"
FT                   /locus_tag="ABBFA_00526"
FT                   /old_locus_tag="CTY05_00526"
FT   CDS_pept        complement(546391..548016)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="clsA"
FT                   /locus_tag="ABBFA_00526"
FT                   /old_locus_tag="CTY05_00526"
FT                   /product="Major cardiolipin synthase ClsA"
FT                   /EC_number="2.7.8.-"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:P71040"
FT                   /protein_id="ATY42986.1"
FT                   /translation="MAQSFHSKQLQTHQLAKGFLIKASIVVCSSFAVALTGCSTLPKHS
FT                   PEPIQYARDIDTSQTSLSKIITPLREKNPNLTGYHLLNDPLEALAARLRLIDKAEKTLD
FT                   LQYYIWDNDKVGALALHAIIRAADRGVKVRLLIDDNNAKKMEGVLLALSQHKNIEVKLF
FT                   NPYRFRKYRAMDMILDLKRINRRMHNKSFIADNQVALIGGRNMTNQYYNVSDSYQFSDV
FT                   DVMLVGAAVDDIVNSFDDYWNHEYAYSVQSIVSAQQHRLRYESLKQQLDAHYQQATVQN
FT                   FLDLTSRSHAFDKWLDSNIKFDWVKAEVVKDSPDKIRSKAKKEEHLNFQLINHLEKPES
FT                   NVDLISAYFIPEKQGAKILSTLAKEGVEVRVLTNSFKANDVAVVHAFYGKYRKELLKNG
FT                   VQLYEFLPTPDKRDLNKNTDELATKAKVNMKGLSRSSLHTKLMALDEQVFIGSFNFDPR
FT                   SAYLNTEIGVILDSPSLAKTIHHTMDENLNKYAYKLKLDPDNHIYWQQETPKGPIIYKK
FT                   EPEMKWWQKAGMKLLSWLPLEGFM"
FT   gene            548123..549133
FT                   /locus_tag="ABBFA_00527"
FT                   /old_locus_tag="CTY05_00527"
FT   CDS_pept        548123..549133
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABBFA_00527"
FT                   /old_locus_tag="CTY05_00527"
FT                   /product="putative metallophosphoesterase"
FT                   /EC_number="3.1.-.-"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:Q9PP77"
FT                   /protein_id="ATY42987.1"
FT                   /translation="MWNPNSIIFCFYFIFSILALWGIIEAWVHQSRTETIHPFKAFVHL
FT                   LAFYLSYLLIPLWFFNLYAGWIGYYSIHETIFIFLLSGILIYARFIEPHMVRVDVHQYR
FT                   LNPDRRFAKPVKVALIADLHIGLFSGHERQLKIIVKKLNEQQPDLVVVAGDWTYEPEDK
FT                   LVQELSVLKDIKAPVYSVPGNHDEQYPGPPIQQLLKDALHYNDVMDIEGKIVEFDEFRL
FT                   IGIGDLWAGKTDMRSMPDLPQDKPWLILSHNPDTVDMVPKLPNRPLMLSGHTHGGQVEL
FT                   PWVTNYIMKKVSILGHKRGFYSHEHADVFVTVGTGMVGIPLRFRVPPTIDIIELV"
FT   gene            complement(549181..549660)
FT                   /gene="psaB"
FT                   /locus_tag="ABBFA_00528"
FT                   /old_locus_tag="CTY05_00528"
FT   CDS_pept        complement(549181..549660)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="psaB"
FT                   /locus_tag="ABBFA_00528"
FT                   /old_locus_tag="CTY05_00528"
FT                   /product="Photosystem I P700 chlorophyll a apoprotein A2"
FT                   /EC_number="1.97.1.12"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:Q7NFT5"
FT                   /protein_id="ATY42988.1"
FT                   /translation="MNTRSLKLSFIALLCIALAGCLSFGPLKYRQVKMLKKEGFVLTNE
FT                   GWTLGLPERLLFDFNDATLKQSHEAELTRLANQLNKYDLNKLKIVGHTDDVGNPEYNQK
FT                   LSEERAQSVANLFLTHGFKKENIYVIGRGSTQPYVPNTTNENRAINRRVAIVIIP"
FT   gene            complement(549675..550898)
FT                   /gene="yfiN"
FT                   /locus_tag="ABBFA_00529"
FT                   /old_locus_tag="CTY05_00529"
FT   CDS_pept        complement(549675..550898)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yfiN"
FT                   /locus_tag="ABBFA_00529"
FT                   /old_locus_tag="CTY05_00529"
FT                   /product="putative diguanylate cyclase YfiN"
FT                   /EC_number="2.7.7.65"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:P46139"
FT                   /protein_id="ATY42989.1"
FT                   /translation="MISKLYQSTSLHALFRKSQFTIFAITFFICSFTFVSISVFTMETY
FT                   AKQNLQLLSHTLLERIQPAVVFNDKITIEQILNEYTNDHSIRAIHIYDSEHHLIAQSFK
FT                   LSSQTSVLEKWFDHWFLNEPVHLTIYHHQQNVGELTLFGSSEKILQFLKMIMVGLAIAM
FT                   LFIVCALWWSVNLTYRQIMQAIYPLTNIAQIVSEQKAYNLRFPYNRIKEFQDLNTVFNE
FT                   LLEEIQIWDNQLQKENRKLSFQAHHDQLTLLPNRHYFYQILLDMFEDKDFDNKSALLFI
FT                   DNNNFKSINDQFGHLAGDEVLKEMAKRLQTRLRHQDFIARLGGDEFAVILHSITHADHL
FT                   ISIAENLLESCKEPLHLNDQTIYFSFSVGIALSQFASSPEDFIMQADQAMYKAKTSEQH
FT                   WFIYKPEN"
FT   gene            complement(550904..551407)
FT                   /locus_tag="ABBFA_00530"
FT                   /old_locus_tag="CTY05_00530"
FT   CDS_pept        complement(550904..551407)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABBFA_00530"
FT                   /old_locus_tag="CTY05_00530"
FT                   /product="hypothetical protein"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /protein_id="ATY42990.1"
FT                   /translation="MWHSAKKVLFCILVVFATSGPAYANSKHNFYVLTLSILSYSKWEN
FT                   VSTPTLCVIDNASITSTFQSYIQQLSYNYRVQTVNAKDFSKSHCQAVYFSTTPPQQQQN
FT                   LIQNYPYRSLLSLSINNPECEVGSIFCLYNQNNYTTFKVNLDALSHSKVHIDPRVLLLA
FT                   KNAE"
FT   gene            553545..553621
FT                   /locus_tag="ABBFA_00531"
FT                   /old_locus_tag="CTY05_00531"
FT   tRNA            553545..553621
FT                   /locus_tag="ABBFA_00531"
FT                   /old_locus_tag="CTY05_00531"
FT                   /product="tRNA-Ile"
FT                   /note="tRNA-Ile(gat)"
FT                   /inference="COORDINATES:profile:Aragorn:1.2"
FT   gene            553677..553752
FT                   /locus_tag="ABBFA_00532"
FT                   /old_locus_tag="CTY05_00532"
FT   tRNA            553677..553752
FT                   /locus_tag="ABBFA_00532"
FT                   /old_locus_tag="CTY05_00532"
FT                   /product="tRNA-Ala"
FT                   /note="tRNA-Ala(tgc)"
FT                   /inference="COORDINATES:profile:Aragorn:1.2"
FT   gene            complement(557496..558869)
FT                   /gene="pdhD"
FT                   /locus_tag="ABBFA_00533"
FT                   /old_locus_tag="CTY05_00533"
FT   CDS_pept        complement(557496..558869)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pdhD"
FT                   /locus_tag="ABBFA_00533"
FT                   /old_locus_tag="CTY05_00533"
FT                   /product="Dihydrolipoyl dehydrogenase"
FT                   /EC_number="1.8.1.4"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:P11959"
FT                   /protein_id="ATY42991.1"
FT                   /translation="MFDLIIIGAGTAGISAYKEAVKYTNNLLIINDGPWDTTCARVGCM
FT                   PSKVLISTANRMHDIQNAQEVGLSASADINTDQVMEHVRTLRDRFTKATVKDVEQWPTE
FT                   HKISGKAHFIDAKTIEVNGKRYQSKSFILAVGSTPNYDQSWKQELGDRLITTDQIFELN
FT                   TLPKSIAIIGSGVIALEIAQAMHRLDVETTIFARSKRIGIFTSPKLQQLAQEELSKELN
FT                   FLFETLPHEVKSTSDGVILNYKIDEKEESIQTEYVLSATGRSSLLDTLKLENIDKSFKD
FT                   IKLLPVNAKTKQLDDYPIFIAGDAYTSTPLQHEAAHEGKKVVYNCLNYPQVNAVKTLTP
FT                   LGIVFSHPEMAIVGQSYKQLKDNGVDFVTGEASYERQGRAIVLGKNKGAIEVYIERESQ
FT                   KLLGAELFTEATEHMAHLLSWIIGEKLTLNDILEKPFYHPTLEEGLRTALKHARRQLK"
FT   gene            complement(558956..560149)
FT                   /locus_tag="ABBFA_00534"
FT                   /old_locus_tag="CTY05_00534"
FT   CDS_pept        complement(558956..560149)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABBFA_00534"
FT                   /old_locus_tag="CTY05_00534"
FT                   /product="hypothetical protein"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /protein_id="ATY42992.1"
FT                   /translation="MKLTQGVCGLTLAVFLSACGGGGDGYYNQNSDSGSTTTPTTPSTD
FT                   QELANSVLNSVKQEGKYLFGSYDLNNESLSKGYIDHALDTFAQGPLKLTLDIRKVDLTK
FT                   YNDHYREKCFINSTTDYRACYVFKGEEIKSLLTGYNDWDFDITADDLKNIKLASDNISP
FT                   NLQEYQSNTRIYIFENENKDKNFQDVTITGAFAYPFQQSWGLQQTKQKRFVLINSTTSD
FT                   YKITTTTMVQEPQTGQPNEKEVTTGAMSVYKDNTSTDGDLYVIQGGSGFNVLINDNPNV
FT                   PFAEPISFVVNSTPGNTNNATYRVRLGKNQVLSLPNITGIEGSRVENEAPTTNIQKFNG
FT                   SIYLEGQNIFTFKQDLNGSTLDFKHVINGVSIEGQSTNQNGVVSTTLKSPFAQKFTF"
FT   gene            complement(560501..560836)
FT                   /gene="blh_1"
FT                   /locus_tag="ABBFA_00535"
FT                   /old_locus_tag="CTY05_00535"
FT   CDS_pept        complement(560501..560836)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blh_1"
FT                   /locus_tag="ABBFA_00535"
FT                   /old_locus_tag="CTY05_00535"
FT                   /product="Beta-lactamase hydrolase-like protein"
FT                   /EC_number="3.-.-.-"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:Q8UAA9"
FT                   /protein_id="ATY42993.1"
FT                   /translation="MSENVGFAGQIGPEHVGQVVEKGFKSIINNRPDMEGGPEQPTSAQ
FT                   IEEAARQAGLDYVYQPVVAGQITELDVRTFANHYNELPKPVLMFCRTGNRSNNLYQLAK
FT                   QMDLLDD"
FT   gene            561029..561925
FT                   /locus_tag="ABBFA_00536"
FT                   /old_locus_tag="CTY05_00536"
FT   CDS_pept        561029..561925
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABBFA_00536"
FT                   /old_locus_tag="CTY05_00536"
FT                   /product="Alpha/beta hydrolase family protein"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="protein motif:Pfam:PF12695.1"
FT                   /protein_id="ATY42994.1"
FT                   /translation="MHAYTVEPLYVPCDQEMIAADFYIPKTNNKSAVIIMAHGFAGLRQ
FT                   FKLIQYAQRFAQAGYAVILFDYRYWGGSTGKPREMISINSQLEDWKTMIQYASTCKFID
FT                   NRRIVLWGTSLSGGYALSLASELKNIQAIMVQIPYVDGAETAKLYPLQRYPQALKLSSQ
FT                   DYMGSKMGLNPKRLPVVDQYKLCFMPTADSYYGYLSIVNPDYYWSGEVPARVFFNLMRY
FT                   RPIQLVRQINIPVLFIAAQHDSLIPIESSREAATNIAPFVSYHEWDMKHFDIYHGSWFE
FT                   KAVTTQLEFLHQHIGVM"
FT   gene            561926..562363
FT                   /gene="trxC"
FT                   /locus_tag="ABBFA_00537"
FT                   /old_locus_tag="CTY05_00537"
FT   CDS_pept        561926..562363
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trxC"
FT                   /locus_tag="ABBFA_00537"
FT                   /old_locus_tag="CTY05_00537"
FT                   /product="Thioredoxin-2"
FT                   /EC_number="1.8.1.8"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:P0AGG4"
FT                   /protein_id="ATY42995.1"
FT                   /translation="MIIVCASCGAKNRVPEEKLTAQPSCGQCHQPLLPLAPIELNEQNF
FT                   SNYITNSDLPILIDLWAEWCGPCKMMAPHFAQVAKQNPRVIFAKINTEESPRLSQAFNV
FT                   RSIPTLVLMNKTTEVARMSGALRAPELQQWLDQQLQTNFGS"
FT   gene            562365..562787
FT                   /locus_tag="ABBFA_00538"
FT                   /old_locus_tag="CTY05_00538"
FT   CDS_pept        562365..562787
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABBFA_00538"
FT                   /old_locus_tag="CTY05_00538"
FT                   /product="putative acyl-CoA thioester hydrolase"
FT                   /EC_number="3.1.2.-"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:P44886"
FT                   /protein_id="ATY42996.1"
FT                   /translation="MSEAYTKPEGILSLQTIAMPADTNWSGDVFGGWIVSQMDLAGAIH
FT                   AERFSRGRCATISINQMTFLVPVKVGFVISCYTKILKVGNTSIQMQIEVWDSHDDSREP
FT                   IRITEGVFTFVAVDVKGNKRQIPEEAKQKFLASQES"
FT   gene            complement(562827..563321)
FT                   /locus_tag="ABBFA_00539"
FT                   /old_locus_tag="CTY05_00539"
FT   CDS_pept        complement(562827..563321)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABBFA_00539"
FT                   /old_locus_tag="CTY05_00539"
FT                   /product="hypothetical protein"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /protein_id="ATY42997.1"
FT                   /translation="MSQSNRLLKLVKATSKFPKGIRSTLWSKAFGRIVPMVGTANIRYL
FT                   EVDVNHVTVRLENQKNMQNHIKGVHAAAMALLAETATGFLTGLHIPDNRILLIKSLHVD
FT                   YLKVVEGGLTATAILSTEQQKYIADHEKGELVIPVTVIDDAGNEPIQCQMLWAWLPKRK
FT                   K"
FT   gene            complement(563357..563845)
FT                   /locus_tag="ABBFA_00540"
FT                   /old_locus_tag="CTY05_00540"
FT   CDS_pept        complement(563357..563845)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABBFA_00540"
FT                   /old_locus_tag="CTY05_00540"
FT                   /product="putative nucleotide-binding protein"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="protein motif:CLUSTERS:PRK05412"
FT                   /protein_id="ATY42998.1"
FT                   /translation="MPSFDIVSELELFEVNHAVQNTQKEIATRFDFRGHDVSIELNEKN
FT                   KEIKISTESDFQCEQVYNMLENHFYKRKIDVQALDPQKATASGKNFVQVIKLKDGLDSD
FT                   TAKKINKAIKESGIKVQSSIQGDKIRVTDKKRDTLQQVMAFLREQQFGLPLQFNNFKD"
FT   gene            563937..564251
FT                   /locus_tag="ABBFA_00541"
FT                   /old_locus_tag="CTY05_00541"
FT   CDS_pept        563937..564251
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABBFA_00541"
FT                   /old_locus_tag="CTY05_00541"
FT                   /product="molybdopterin biosynthesis protein MoeB"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="protein motif:CLUSTERS:PRK08762"
FT                   /protein_id="ATY42999.1"
FT                   /translation="MIRKQEITTFEFPENAVIWDVRDSSAYAEGHVKGAVSRPINDLNA
FT                   DILNQVAADQPIYILCGGGSKAPRAAEKLEGLDASREYVVLMGGTRAARDAGLPLEQGA
FT                   "
FT   gene            complement(564303..566174)
FT                   /gene="mnmC"
FT                   /locus_tag="ABBFA_00542"
FT                   /old_locus_tag="CTY05_00542"
FT   CDS_pept        complement(564303..566174)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mnmC"
FT                   /locus_tag="ABBFA_00542"
FT                   /old_locus_tag="CTY05_00542"
FT                   /product="tRNA 5-methylaminomethyl-2-thiouridine
FT                   biosynthesis bifunctional protein MnmC"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:P77182"
FT                   /protein_id="ATY43000.1"
FT                   /translation="MNKSNRIQTAELDWESIDGIEVPISKQFGDVYFSKDNGLLETRHV
FT                   FLNGNDLSERLANLQDFEYFSVGETGFGTGLNILALWQLWQQVRPNNHSHLHAISVEKF
FT                   PLSKADLIRALNVWDELKPLSKQLIEQYPLPLAGCHRLSFPEERFSIDLWLGDAQDIFP
FT                   SMVKTKAVNAWFLDGFAPSCNPDMWEQNVLNNIVRLSNYGTTFASFSVAGVLKRGLKAH
FT                   GIDISRPRGFGHKREMLKAIWKAPVSEEILFEPVSDTFHFTQQRIAIIGAGIAGLSTAW
FT                   AFAQRGHQVTLFERTAPLSGASGNPLALLNPKLCPIEQSHEHLMTLSWQHALNFYKNFQ
FT                   AFRPIQIQQMALKNAQDLLDLTNQYPADIVTQQTSSLESDYPHIILTEAGAVSPHQLRD
FT                   EILQHPGIELKIANITTLVSFENKVQLKSGNETTLEADHVVVCCARESAALFENYPLLK
FT                   PIRGQVSWVDNSFATLPLHEAYSYGGYCMQLNTSELILGASFYPNRDDQEVLLDDHVHN
FT                   FELIHSVFPHYAKQLPPVEQWQGRASVRAQSPDYFPVVGKMQNESRISTFAGLGSKGFL
FT                   FAPLCSEVLVAQILGEAYPVPKSLLQKLDAQRFQKKVKPKKPYFKSQ"
FT   gene            complement(566198..566677)
FT                   /locus_tag="ABBFA_00543"
FT                   /old_locus_tag="CTY05_00543"
FT   CDS_pept        complement(566198..566677)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABBFA_00543"
FT                   /old_locus_tag="CTY05_00543"
FT                   /product="hypothetical protein"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /protein_id="ATY43001.1"
FT                   /translation="MQLATKSFLGLCLICSTAGAVEPAATPATPPTAASTQNAKPAPTS
FT                   ATVAKPATTTAPTTTQPLTAEQIAKNKQQQDAKIKALVQDQASRLKQLEHANLEALAQN
FT                   QELQLKNDNLSVQVQVLQSERSAQMFLYGAVTLAGGVLLGFFIASYVYTKRRRQW"
FT   gene            complement(566682..566984)
FT                   /locus_tag="ABBFA_00544"
FT                   /old_locus_tag="CTY05_00544"
FT   CDS_pept        complement(566682..566984)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABBFA_00544"
FT                   /old_locus_tag="CTY05_00544"
FT                   /product="YciI-like protein"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="protein motif:CLUSTERS:PRK12863"
FT                   /protein_id="ATY43002.1"
FT                   /translation="MPFFVLSCTDNEGTLEKRLAVRPQHIERLQKLDDEGRLVAAGAMP
FT                   KDPNDPQAGFYGSTMIVEFDTREALDEWLKEEPFLKEGIYSHVDVKPFNKAFPKG"
FT   gene            complement(567019..567633)
FT                   /gene="yciB"
FT                   /locus_tag="ABBFA_00545"
FT                   /old_locus_tag="CTY05_00545"
FT   CDS_pept        complement(567019..567633)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yciB"
FT                   /locus_tag="ABBFA_00545"
FT                   /old_locus_tag="CTY05_00545"
FT                   /product="Intracellular septation protein"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:P95745"
FT                   /protein_id="ATY43003.1"
FT                   /translation="MKALLDFVPLIIFFYLYKTVDPADTQHPLLKLIGSAGGVDNNNIL
FT                   VATTGLIISMLVVYGALFIMQKFRLDKQQWIVLFMTVIFGGITLMLSDDFYIRLKAAIL
FT                   NLVFAGAFLVSPWFGKDRKPLIQRLFDPILALSEKGWKNLNFAWAAMFVVMSGLHVFFA
FT                   FLFHGGKYWGEFTAFGDMIVMFSFIIIQFIILRKHFKSPDA"
FT   gene            567678..568529
FT                   /locus_tag="ABBFA_00546"
FT                   /old_locus_tag="CTY05_00546"
FT   CDS_pept        567678..568529
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABBFA_00546"
FT                   /old_locus_tag="CTY05_00546"
FT                   /product="error-prone DNA polymerase"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="protein motif:CLUSTERS:PRK05672"
FT                   /protein_id="ATY43004.1"
FT                   /translation="MQGIDLHTHSNISDGTLSPELLVQAAVDVKLHTLALTDHDTMDGL
FT                   QRARNAAQPHDLQIISGVEISSQWSRPSTKKSYGVHIVALNMQDEAPILEALEQQKRIR
FT                   AQRAVVICELLKKCIGFDIYQDVLDKVENQPDRITRTHIAKALVEKNVVSRPQQAFDRF
FT                   LKEGKRAFVKFEGLGLKETIEVIHNSKGFAVLAHPTRYDLSATNTRYLIEIFASCGGDA
FT                   VELPPPVDPLSTRQMIDRMLEQHHLAISIGSDFHGENMPWIKLGNTPKPTSNQQGIWER
FT                   FI"
FT   gene            complement(568537..569448)
FT                   /locus_tag="ABBFA_00547"
FT                   /old_locus_tag="CTY05_00547"
FT   CDS_pept        complement(568537..569448)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABBFA_00547"
FT                   /old_locus_tag="CTY05_00547"
FT                   /product="Bestrophin, RFP-TM, chloride channel"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="protein motif:Pfam:PF01062.15"
FT                   /protein_id="ATY43005.1"
FT                   /translation="MIVREQPSIFKVLFSWRGTILPKILPSLGVVMLISAIIGGVEYIN
FT                   LYRFPEIPLVGFTLIGVVLSIFLGFKNTACYDRWWEARKLWGVLIATSRHFDRDCRILT
FT                   QARRERVIQHVIVFANVLRDRLRRQTANPTELIQTSGMSQQALTQLYQQNNAPQYTLSL
FT                   IQWELLQALKEGEISDIIYAQMNKNVADLSVVQTGCDRIANTPIPFAYSVLLNRTVYFF
FT                   CFMLPFSLGSLLGLATPLLVGILAYTFLGLDALSTEIEEPFGTQSNDLPLDAMVRSIEI
FT                   ELLGTLGKPTPPPIQAQDNNLL"
FT   gene            complement(569510..570217)
FT                   /locus_tag="ABBFA_00548"
FT                   /old_locus_tag="CTY05_00548"
FT   CDS_pept        complement(569510..570217)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABBFA_00548"
FT                   /old_locus_tag="CTY05_00548"
FT                   /product="hypothetical protein"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="protein motif:CLUSTERS:PRK00024"
FT                   /protein_id="ATY43006.1"
FT                   /translation="MNTSIKNWPEQERPRERLLQQGPQSLSDSELLAIFLRSGSRQHSA
FT                   VELARLLIQQFGSLNAVFDASYNELAQFNGIGATKYSQLLAVKELGRRYLDYHFSQTEL
FT                   SLHSSHLVLDYLRYELKGEKQEVFAVLCLDAELRKLHFKKLFFGSVQHCAVSVNQTLRY
FT                   ALQQHACQLVIAHNHPFGSPQPSPEDIKLTQQLEQACQLVEIRLLDHFIISPEGSFSFA
FT                   EQQLLNPTSIAVQ"
FT   gene            570330..571583
FT                   /gene="coaBC"
FT                   /locus_tag="ABBFA_00549"
FT                   /old_locus_tag="CTY05_00549"
FT   CDS_pept        570330..571583
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="coaBC"
FT                   /locus_tag="ABBFA_00549"
FT                   /old_locus_tag="CTY05_00549"
FT                   /product="Coenzyme A biosynthesis bifunctional protein
FT                   CoaBC"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:P0ABQ0"
FT                   /protein_id="ATY43007.1"
FT                   /translation="MSFDLSVIPHKNIVLAVTGGIAAYKSAILVRRLKDYGFDVRVVMT
FT                   HGAQAFITPLTFQALSGNPVHTELLDPEAEAGMGHIELARWADLLLVAPASCDTLAKFA
FT                   NGLADDLLSTLFLATKAPVWVAPAMNQQMWAAKATQRNLQTLVEDGVHVIMPDAGEQAC
FT                   GDVGLGRMPEPEEIARQVAGYFHQAQRAIAEKFGLLAGKRVVITAGPTREAIDPVRYIS
FT                   NHSTGKMGFALAAACYAAGAKVTLIAGPVSLDTPNGVQRVNVASARQMLDVSMESLETG
FT                   CDIFIATAAVADYRVAEVAEHKIKKAGDELNVSLVKNPDIVATIAAQEKRPFMVGFAAE
FT                   TQNVEEYAAGKLVAKKLDMIACNDVSRADIGFASDENAMTVFFAESYHMKKRELEKASK
FT                   QEISQQLVEAISDALRRK"
FT   gene            complement(571649..572611)
FT                   /locus_tag="ABBFA_00550"
FT                   /old_locus_tag="CTY05_00550"
FT   CDS_pept        complement(571649..572611)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABBFA_00550"
FT                   /old_locus_tag="CTY05_00550"
FT                   /product="preprotein translocase subunit SecF"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="protein motif:CLUSTERS:PRK13022"
FT                   /protein_id="ATY43008.1"
FT                   /translation="MTKVTQQPSKQYGRPDDAKIIPFMKIAKPAAIFSILITLASIFFI
FT                   ATKGLNLGLDFTGGVSAELNYAQPANQAEVIQALDKAGFKDAVVQTLGSNKDLLVRMPV
FT                   QDIKVEDLNNAITKAVQLPNNAAEVHKVDSVGGQVGNELYVRSAGAVALALILMLIYVT
FT                   IRFEFKLAMGAVISLFHDIIIIIGAFALFQWPFDLTVLAAVLAVIGFSLNDNIVVSDRI
FT                   RENFRKIRGATPREIVDIALTETLRRTIHTSMTLLLVVLAMMFLGGDGLHWFSVAMFVG
FT                   VFVGTYSSIYIGTAFALWRGLNRQDFIVQVKPEFEDEIP"
FT   gene            complement(572623..574524)
FT                   /locus_tag="ABBFA_00551"
FT                   /old_locus_tag="CTY05_00551"
FT   CDS_pept        complement(572623..574524)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABBFA_00551"
FT                   /old_locus_tag="CTY05_00551"
FT                   /product="preprotein translocase subunit SecD"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="protein motif:CLUSTERS:PRK05812"
FT                   /protein_id="ATY43009.1"
FT                   /translation="MRYPAWKYLLILVVLVVSTLYALPSLYPDEPAVQISGAKAGTQID
FT                   QSVVQKAEQILKTANIASHDNTFTNNAALLRVSSSEAQLKAKEVLRRDLGDQYVVALNL
FT                   APTTPEWLQKIGAKPMKLGLDLRGGVHFLLEVDMDKAISQRMETSATDLRRQFRENKIK
FT                   FNNLALNNNVITVQFADNADRDAAMDFLRRNGNEYTQQALASTTGSILKLTYTDVRRQE
FT                   IQAYAVNQNLTTLRNRINELGVAEALVQSQGSNRIVVELPGVQDTAEAKRVLGRTANLE
FT                   FRLVSDLNDQYIDPYTGKYNGQPLPPGTEVFAYQSLDSGRQLLLQRNRILTGERVQNAS
FT                   SGFSQDSGGAEVNITLDSAGGKLMSDATRNAVGKRMAVLFIENKQKISYVTDPKTGAQT
FT                   EVRTPYTESVVINAATVQAVLGSTFRITGLSSPQEASELALMLRAGALAAPMYFVEERV
FT                   VGPSLGQENIDKGVLSTQIGFLLVAIWMVVFFRLFGLIANFALVFNLAMILTIMSWIGA
FT                   SLTLPGIAGIVITIGMAVDANVLICERIREEMLWGASPKQAIVAGYDRAYNTIFDSNLT
FT                   TFLVAFILFAIGTGPIKGFAVTLMIGIICSMFTAITVTRAIVQIIYGKRRNLKKLSI"
FT   gene            complement(574576..574905)
FT                   /locus_tag="ABBFA_00552"
FT                   /old_locus_tag="CTY05_00552"
FT   CDS_pept        complement(574576..574905)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABBFA_00552"
FT                   /old_locus_tag="CTY05_00552"
FT                   /product="preprotein translocase subunit YajC"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="protein motif:CLUSTERS:PRK05585"
FT                   /protein_id="ATY43010.1"
FT                   /translation="MSLFISTAHAAPAAAQSPGLLPNILMIVVFVAIFYFLIWRPQAKR
FT                   AKEHRSLIESLGVGSEVVFAGGLMGKVTKLEGDYAVVELNRGVEVKIQRASVISVLPEG
FT                   TLNNL"
FT   gene            complement(575004..576137)
FT                   /gene="tgt"
FT                   /locus_tag="ABBFA_00553"
FT                   /old_locus_tag="CTY05_00553"
FT   CDS_pept        complement(575004..576137)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tgt"
FT                   /locus_tag="ABBFA_00553"
FT                   /old_locus_tag="CTY05_00553"
FT                   /product="Queuine tRNA-ribosyltransferase"
FT                   /EC_number="2.4.2.29"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:P0A847"
FT                   /protein_id="ATY43011.1"
FT                   /translation="MKFEKLGQSGRARRGRLTLEHGVVETPVFMPVGTYGTVKGMLPRD
FT                   IEDIQAQIILGNTFHLYLRPGLEVIKQHGGLHDFIKWNKPILTDSGGFQVFSLGAMRKI
FT                   KEEGVTFRSPIDGSKVFLSPEISMEIQHVLNSDIVMIFDECTPYPATHEEAQKSLQLSL
FT                   RWAKRCKAHHHDELKNKNALFGIIQGGMYEDLRDESLNGLLEIGFDGYAIGGLSVGEPK
FT                   EEMIKVLDYLPNKMPHDKPRYLMGVGKPEDIVEAVRRGVDMFDCVMPTRNARNGHYFVT
FT                   DGLVRIRNSKYRHDQGPLDPHCDCYTCKNFTRAYLFHLEKCGEMLASMLGTIHNLRYYQ
FT                   RLTEGMRDALDNGTFDEFVQDFYARRGLEVPPCPVDE"
FT   gene            complement(576313..576882)
FT                   /locus_tag="ABBFA_00554"
FT                   /old_locus_tag="CTY05_00554"
FT   CDS_pept        complement(576313..576882)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABBFA_00554"
FT                   /old_locus_tag="CTY05_00554"
FT                   /product="LemA family protein"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="protein motif:Pfam:PF04011.6"
FT                   /protein_id="ATY43012.1"
FT                   /translation="MTGLFIFLGIFVVLIAWGIHIRNNIVRYFNATKRAWAEVANFERQ
FT                   KVKTLEALETTLNQYTQFEKSTLEQVTALRQQILSLNVDHTDIAQLQQIEKMSKELIRS
FT                   LNVVVENYPELKADTLYGKMMDDIQEQNENVGAAISIFNRNVEVFNNQIEVFPNNIINT
FT                   MTLSKKTIRPFRDNLATDNFDYKPNF"
FT   gene            complement(576969..577997)
FT                   /locus_tag="ABBFA_00555"
FT                   /old_locus_tag="CTY05_00555"
FT   CDS_pept        complement(576969..577997)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABBFA_00555"
FT                   /old_locus_tag="CTY05_00555"
FT                   /product="hypothetical protein"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /protein_id="ATY43013.1"
FT                   /translation="MPIDTIQQTLHIRRKKNSQVFRNIARLWDAGQKSQTDQELLNALH
FT                   PWGEDHNLRFVNTLSYLLSICSITTLLFGYFFHPHIQYIWSLLWAFLTGFLAYLLYEPQ
FT                   KPLTEVIHYLEQRMTALRYGLKFQQLPAYLPIQAQPILVLSKLKQHFPLFNRGNEANEI
FT                   TEFASVTWNDGITDHQVLLFKYHYVNNLPILQDQNSDKKIVKEIHKDLWGAFIFQMPAL
FT                   GIAASNQRSRFFEPYLSEWQSSDILINQELSIFGTDQHQLAKEMSPSLTLKLHDFFQHF
FT                   NGDLIYHHEEQILCYLGEQDLFQTTSKRSEIHDIPALRGHLRTMTMPQYEKFQQFMLNL
FT                   IK"
FT   gene            complement(578151..579188)
FT                   /gene="queA"
FT                   /locus_tag="ABBFA_00556"
FT                   /old_locus_tag="CTY05_00556"
FT   CDS_pept        complement(578151..579188)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="queA"
FT                   /locus_tag="ABBFA_00556"
FT                   /old_locus_tag="CTY05_00556"
FT                   /product="S-adenosylmethionine:tRNA
FT                   ribosyltransferase-isomerase"
FT                   /EC_number="2.4.99.17"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:P0A7F9"
FT                   /protein_id="ATY43014.1"
FT                   /translation="MQLSDFSFELPDELIARYPLETRSASRLLHLDAKGQYHDHMFTDI
FT                   IDLFEEGDLLVLNDTKVMKARLKGKRATGGAIEILVERMLNHTTAYCHIKASNSPKAGA
FT                   ELFVGADNIPVIVRGRHENLFVVEFSQPILPVLEQYGQLPIPPYFNREAEEIDTERYQT
FT                   VFHNPEKIASVAAPTASLHFDEELLAELDQKGVKKTFVTLHVGAGTFMPVRTDDITNHV
FT                   MHSEWCDVPQETIDLILATKARGNKVIAVGTTATRALESAAQAHGGKIAAWTGDTQIFI
FT                   YPGYEFCIVDRLITNFHLPESTLLMLVSALSNRENILAAYEHAVKDRYRFFSYGDAMLI
FT                   DKLEV"
FT   gene            579370..579456
FT                   /locus_tag="ABBFA_00557"
FT                   /old_locus_tag="CTY05_00557"
FT   tRNA            579370..579456
FT                   /locus_tag="ABBFA_00557"
FT                   /old_locus_tag="CTY05_00557"
FT                   /product="tRNA-Leu"
FT                   /note="tRNA-Leu(caa)"
FT                   /inference="COORDINATES:profile:Aragorn:1.2"
FT   gene            579991..581259
FT                   /gene="bvgS"
FT                   /locus_tag="ABBFA_00558"
FT                   /old_locus_tag="CTY05_00558"
FT   CDS_pept        579991..581259
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bvgS"
FT                   /locus_tag="ABBFA_00558"
FT                   /old_locus_tag="CTY05_00558"
FT                   /product="Virulence sensor protein BvgS precursor"
FT                   /EC_number="2.7.13.3"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:P16575"
FT                   /protein_id="ATY43015.1"
FT                   /translation="MTQRLELHQVEQLTACKISLLLGLNAEQNYIEQFFRFSLRLLKCQ
FT                   KALLTFNQEPYFWHHCPDGMTAISFKPSRHLKQCFAKQQVIHHNHPSYQNLINYLKELN
FT                   IECGRALAVHLVQPDQTSMGFAVFFDDDENCFEDDQIQLLLDYCSSFMQQVELKFNYEE
FT                   LNELYEQQVALNSSKTKFFSIISHDLRAPFHGLLGFSEVLAKERETLDESSIQNIADYL
FT                   YDTSQSTYNLLESLLTWAMAEGGRFVYHPINFKLRQVSNIVCDVLHTLALKKNIELVNA
FT                   VSEDLKIYADINMMTSVIQNLVSNALKFTDVDGSGKVFIEAKQVGTNVEITVRDTGLGM
FT                   TEQQMANLFHPRITASFKGTAGEKGAGLGLSLCKRFVEINQGKISVTSQKGVGTSFKVL
FT                   LPSAQEVPEHHVEQQNTSEAKLV"
FT   gene            581328..584078
FT                   /gene="glnE"
FT                   /locus_tag="ABBFA_00559"
FT                   /old_locus_tag="CTY05_00559"
FT   CDS_pept        581328..584078
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glnE"
FT                   /locus_tag="ABBFA_00559"
FT                   /old_locus_tag="CTY05_00559"
FT                   /product="Glutamate-ammonia-ligase adenylyltransferase"
FT                   /EC_number="2.7.7.42"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:P30870"
FT                   /protein_id="ATY43016.1"
FT                   /translation="MNAEQLQKTLRASQYAEQVLGLHQAVLEQDYQIDQFAAPLSTEQI
FT                   YQLVDTTLDGIGDEITWMRALRILRSRLMFRWIWQDANQLTDVVTLTRELSDFADASIC
FT                   AAKAFARVALVAKHGEPLSYSGKVQDLIVVAMGKLGAQELNLSSDIDLIFAFDEQGETN
FT                   GRKCIDVQQFCILWGQKLIYLLEHITADGFVFRVDMRLRPWGDGSALAISHAALEKYLS
FT                   QHGREWERYAWIKARVVTGGKEGQDLLEMTRPFVFRRYVDYTAFAAMRDMKAMIEREVL
FT                   RRHIEDDIKLGAGGIREIEFIVQVFQLIYGGSKRELQDRQCLVSLEHIGEASLLEKQAV
FT                   LELEDAYLFLRRVEHAIQALNDQQTQLLPEEADLRQRIIDTLGFTSWNEFIDVLNEKRQ
FT                   KVKVQFKQLIEDTSSNAATENFGQLEQQLDEVLDDNAKNLIHEFWHGHALKKLPSNAVQ
FT                   RLKMFWPHLIEAILQSEQPQTALLRLMPLIESVMRRTVYLVMLIESKGALQRLVKMATV
FT                   SPWICEELTQYPVLLDEFLSMDFELPKRKDLEDSLRQQLLRIEIDQVEDQMRVLRLFKK
FT                   SNVLTVAASDVLAESPLMKVSDALTDIAEVSVNATLNLAYQTVAKRHGYPKDVEGKRCS
FT                   LDYKAFAVIGYGKVGGIELGYGSDLDLVFIHYLDEQADTDGTKSITGFEFAMRVAQKFM
FT                   SLMTTQTLDGRVYEIDTRLRPSGEAGLLVTSLKAYEHYQLKSAWLWEHQALVRARSIAG
FT                   DEALCQKFEIFRREILTQSRDEAYVREEVLKMRQKMKDHLGSSSEQKKHGIFHLKQDAG
FT                   GIVDIEFMAQYAVLAWSGTKPDLAHYSDNVRILEDAAKADCLSSEDATALIRAYLSERA
FT                   ESHRLALANQSMQVSAADWRSTRAVVCNLWQRLIDPTASVELDSE"
FT   gene            584103..585029
FT                   /gene="ilvE"
FT                   /locus_tag="ABBFA_00560"
FT                   /old_locus_tag="CTY05_00560"
FT   CDS_pept        584103..585029
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ilvE"
FT                   /locus_tag="ABBFA_00560"
FT                   /old_locus_tag="CTY05_00560"
FT                   /product="Branched-chain-amino-acid aminotransferase"
FT                   /EC_number="2.6.1.42"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:O86428"
FT                   /protein_id="ATY43017.1"
FT                   /translation="MNLADRDGFIWQDGQLIDWRDAKIHVLTHTLHYSMGVFEGVRAYE
FT                   TPKGTAIFRLQDHTKRLLNSAKIYQMKVPYDQAALEQAQIDVVRENKLASCYLRPLIWI
FT                   GSEKLGIAATNNTIHAAVAAWAWGAYLGDEAMAKGIRVKTSSFTHHHPNVTMCKAKASG
FT                   NYTLSILAHQEVAHSGYDEAMLMDPQGYVCQGSGENVFLIKDGVLHTPDIAGGALDGIT
FT                   RQTVMTIAKDLGYEVVERRITRDEFYIADEAFFTGTAAEVTPIREYDDRQIGAGCRGPI
FT                   TTEIQKTFFDAVQGKNPKYEHWLTYVK"
FT   misc_feature    585030..593806
FT                   /note="OCL1 outer core oligosaccharide biosynthesis gene
FT                   cluster"
FT   gene            585097..585987
FT                   /gene="gtrOC1"
FT                   /locus_tag="ABBFA_00561"
FT                   /old_locus_tag="CTY05_00561"
FT   CDS_pept        585097..585987
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gtrOC1"
FT                   /locus_tag="ABBFA_00561"
FT                   /old_locus_tag="CTY05_00561"
FT                   /product="GtrOC1"
FT                   /note="glycosyltransferase"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /protein_id="ATY43018.1"
FT                   /translation="MHIVYVSDGKAGHRSQALGLFQAMQRQQANVTFEEVSINDLPVMS
FT                   LIKALFSSKKSLFQQAPDFIFGVGSHTHFRVWLLGKIFKKAKTIILMKPNLPTVWFNYA
FT                   VIPEHDGIPANNRVIVTRGALNPIRNEKRHQASRILIALGGSSKRHQWNQEKVLLSVQK
FT                   IVENNPDAEIILTTSRRTPAEFIDILRQQSFAQHLQIFPVEQTPQGWIFEEMQKAEAVW
FT                   VTEDSVSMVFEALTAGCRVGVIAIDRLKDDRITHSIDQMIESQLISQNTCVVQLPQPYA
FT                   FKEADRVATYLLAKN"
FT   gene            586010..587038
FT                   /gene="gtrOC2"
FT                   /locus_tag="ABBFA_00562"
FT                   /old_locus_tag="CTY05_00562"
FT   CDS_pept        586010..587038
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gtrOC2"
FT                   /locus_tag="ABBFA_00562"
FT                   /old_locus_tag="CTY05_00562"
FT                   /product="GtrOC2"
FT                   /note="glcosyltransferase"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /protein_id="ATY43019.1"
FT                   /translation="MKILHIANFGFNKQGAHFYCTDRKISAGLIENGHFVYDFSFRDMA
FT                   RMGTIFKTKKLGAKWANKEVLKVVNNIEPDLVLIGHSDLMSPDVLRQIKESYPNTKIAF
FT                   WYVDPLYLENKLDFVKAFSPYLDAIFCTTGGEYLQKLKQPHLSVAYMPNVGHRNVETLQ
FT                   QFSNSKTDKTFIFCGVVYKEPEREKFLKDLAEALQQGHVNYQYYGCFEQPGVYGKAYYK
FT                   VLSETKMGLNYSRRNDVTLYSSDRIVQLTGNGLLTFSPRIPGFEKLYTEQEVVYFDDQF
FT                   DLAKKIQFFDQNPEQAEKIAKEGWEKTRKSFNAKRITQFMVEVTFKQPLSEDYEWSHEV
FT                   YA"
FT   gene            587035..587790
FT                   /gene="pda1"
FT                   /locus_tag="ABBFA_00563"
FT                   /old_locus_tag="CTY05_00563"
FT   CDS_pept        587035..587790
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pda1"
FT                   /locus_tag="ABBFA_00563"
FT                   /old_locus_tag="CTY05_00563"
FT                   /product="Pda1"
FT                   /EC_number="3.5.1.-"
FT                   /note="polysaccharide deacetylase"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:Q6TYB1"
FT                   /protein_id="ATY43020.1"
FT                   /translation="MMWFLYVAVGLLALAALLYVLGNYTFWLPFRSSKLPRIVMLHQVT
FT                   PKDAASGMNMPPEKFEQLLTLLTRKGAIFCFVSELEQYRNQKNVVALSFDDGFMDNYLY
FT                   AYPLLKKYNAKATIYLATQIEGIEKLTHEQIHEMANSGLIEFGAHTQHHVNLLKLDDQT
FT                   AYDEMLQSKRDVEALVGKCPSFAYPFGRFNEKHQKMAQEIGFKNAVSTRKKIEAYEADN
FT                   QFNIPRVSTHGAMNALQMRIALAKGRYKL"
FT   gene            587787..588551
FT                   /gene="gtrOC3"
FT                   /locus_tag="ABBFA_00564"
FT                   /old_locus_tag="CTY05_00564"
FT   CDS_pept        587787..588551
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gtrOC3"
FT                   /locus_tag="ABBFA_00564"
FT                   /old_locus_tag="CTY05_00564"
FT                   /product="GtrOC3"
FT                   /EC_number="2.4.1.-"
FT                   /note="glycosyltransferase"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:O31986"
FT                   /protein_id="ATY43021.1"
FT                   /translation="MNKIPCSVYIVTLNCGAWLERTLQSVSEFDEVIILDSGSTDNTYE
FT                   IAQSFENTQISHQDWQGYAGQKSLALAKCRNDWVLNLDGDEVLSNELKQEIVETIQQNK
FT                   LDALITPINDVFLGVPNSKHTKKHAKVRFFRRSKGHYDLANKVHENVIVDGESQRAQHD
FT                   IYHYGESSIFVKVEKNNQYSNLKALEKYQKGKSPSIAKLVLVMPVTFMKSYFIRRSFLN
FT                   GWRGFVNSMINAFYAFLKEAKLFEQTMNKDKK"
FT   gene            588563..589597
FT                   /gene="gtrOC4"
FT                   /locus_tag="ABBFA_00565"
FT                   /old_locus_tag="CTY05_00565"
FT   CDS_pept        588563..589597
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gtrOC4"
FT                   /locus_tag="ABBFA_00565"
FT                   /old_locus_tag="CTY05_00565"
FT                   /product="GtrOC4"
FT                   /EC_number="2.4.1.291"
FT                   /note="glycosyltransferase"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:Q0P9C7"
FT                   /protein_id="ATY43022.1"
FT                   /translation="MKIVQVLATSGGVGGLEQHTFNLVNELALNHEVHVIAHPCYVDKF
FT                   SQQVHFHAIDFARSRWNIFLLWQLKNLIQQIQPAIVHAQAGKAAELIARIKPFLSGPKF
FT                   VTTVHGTKKNKSAYLAGDAVIAVSQALTQGIPESKAHVVYNGVYPQPVLTTENKEKLLQ
FT                   SIQKDFTELDTSKKVVMCIGRLESVKNISLLIESMQQIDANLWIVGDGSLRASLEKQVS
FT                   ELNMQNRVAFLGFRTDARDLVQLADIVVLSSDREGFPLVMVEALQADKAMASTKVNGVI
FT                   EWLPEQYLAEIGDTQGLAKAIEYALQPEAQNDFGPLYAKAKAELTVPAMAEQTLNIYKG
FT                   LLKT"
FT   gene            complement(589594..590484)
FT                   /locus_tag="ABBFA_00566"
FT                   /old_locus_tag="CTY05_00566"
FT   CDS_pept        complement(589594..590484)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABBFA_00566"
FT                   /old_locus_tag="CTY05_00566"
FT                   /product="hypothetical protein"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /protein_id="ATY43023.1"
FT                   /translation="MLNRLIQKKWYKYQQAKKAKTFDSHWYMRFGWLEQPFTTLEQLDS
FT                   LFEIHSPGKFTFADSFYAHENGRHFIFFEEVDDQHPVGFLSVLEVFKDGTYTPPETILK
FT                   LDYHLSYPCVFKIDSTWYMIPESSANKTIELWKCTDFPMKWEKHSNLIKNIEAVDSTPF
FT                   YHEGLWYLFTSTRRDCKKFGDRLDLFFTEDILNPNWQEHPMNPVCRGSQQFRMAGKPFI
FT                   YKGQLVRPSQDSLKRYGGNIELKTITQLSPAAYEEKLLEVVLPNWNQADDGCHTINVED
FT                   NFVVLDAIRLTPKNN"
FT   gene            590553..591308
FT                   /gene="gtrOC5"
FT                   /locus_tag="ABBFA_00567"
FT                   /old_locus_tag="CTY05_00567"
FT   CDS_pept        590553..591308
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gtrOC5"
FT                   /locus_tag="ABBFA_00567"
FT                   /old_locus_tag="CTY05_00567"
FT                   /product="GtrOC5"
FT                   /note="glycosyltransferase"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="protein motif:Pfam:PF01755.11"
FT                   /protein_id="ATY43024.1"
FT                   /translation="MKKYLISIESTNSERLKKLYSQATFYKYRDEFKQFGVIGKNLSVS
FT                   EYFQQGVAGKKKPMTPGELGCAMSHIAALKDFLSSDEEYAIIFEDDVIERFEIDFQDLE
FT                   KHIRSLNFGPCFFLSLGGIQMKICNRVRGKLLPEELYNQKILKVDYDYLEKLAYAYAYV
FT                   VDRKMAQMLVDYHQPIKIYDHWQDLVGRGEFSFYVSFLFDHPIIENNDALSYLEKERSL
FT                   VGSHSQDDSDFLRYLRVKLKKYILNKYII"
FT   gene            591338..592267
FT                   /gene="gtrOC6"
FT                   /locus_tag="ABBFA_00568"
FT                   /old_locus_tag="CTY05_00568"
FT   CDS_pept        591338..592267
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gtrOC6"
FT                   /locus_tag="ABBFA_00568"
FT                   /old_locus_tag="CTY05_00568"
FT                   /product="GtrOC6"
FT                   /note="predicted glycosyltransferase"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /protein_id="ATY43025.1"
FT                   /translation="MIKQKNIIIGSATGYNADLISSFVYSLGKTDFDGILTLIIYKEQM
FT                   TEFVNAFSDVKNFKIEFKVSTIGKFKSKSKYSGIYKYKFVKNIFKKIIDLTVNEEKPET
FT                   KIKGLKITGYPHVSRFFEYKEIVENHPDASHVLLTDVRDVFFQSNPFKNLGKGLFVGME
FT                   NPDFTIGTEQYNQKWILDAYGESFYNLAKDEQVSCSGVTIGDHESIKVYINKMIDEFCK
FT                   QPYQKMSNRIYDQAMHNKLLITNELVEVTRCQPFESIIVTLGLYPIEQISINDQGFIIN
FT                   RNQEIIPIVHQHDRHPELIQLCDNYIGK"
FT   gene            complement(592305..592523)
FT                   /locus_tag="ABBFA_00569"
FT                   /old_locus_tag="CTY05_00569"
FT   CDS_pept        complement(592305..592523)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABBFA_00569"
FT                   /old_locus_tag="CTY05_00569"
FT                   /product="hypothetical protein"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /protein_id="ATY43026.1"
FT                   /translation="MAMRPDVRRHALVVIVFSLAQWFFMRYILANELFNLTTNQRILYF
FT                   CVSSLVGALLIFVALIYMVLKGNADKN"
FT   gene            592726..593754
FT                   /gene="gtrOC7"
FT                   /locus_tag="ABBFA_00570"
FT                   /old_locus_tag="CTY05_00570"
FT   CDS_pept        592726..593754
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gtrOC7"
FT                   /locus_tag="ABBFA_00570"
FT                   /old_locus_tag="CTY05_00570"
FT                   /product="GtrOC7"
FT                   /EC_number="2.7.-.-"
FT                   /note="predicted glycosyltransferase"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:Q69AA9"
FT                   /protein_id="ATY43027.1"
FT                   /translation="MQPIDFVMIWVDSTDTKWQQQYIYYKSKETKTKIDELVDQCRYRD
FT                   WNNLHYWFRSVEKFCPWVRKIHLVTCGHFPEFLVKNHPKLNLVTHDQIIEPHCLPTFNS
FT                   HAIEINIHKIEGLAEHFVYFNDDTFINSPLEPEFFFKNGLPCDGIQLQPLMVVGEENFL
FT                   GAVALTDVAIINKYFDKRKLFRSNPSALFNHRYSISNNLGNFLSLYNRKFSSFYSTHLP
FT                   QPFLKSVFEEVWRNEESYLKEVSSHRFRQPLDVNQYLFRLWQLCSARFYPVNIFQRGQN
FT                   FNLRIQNLPEINHVIKYEQLPQICLNDDEHVVDFEKLKTEIIQIFEQKFNTVSSFEKKI
FT                   TH"
FT   gene            complement(593807..595585)
FT                   /gene="aspS"
FT                   /locus_tag="ABBFA_00571"
FT                   /old_locus_tag="CTY05_00571"
FT   CDS_pept        complement(593807..595585)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aspS"
FT                   /locus_tag="ABBFA_00571"
FT                   /old_locus_tag="CTY05_00571"
FT                   /product="Aspartate--tRNA ligase"
FT                   /EC_number="6.1.1.12"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:P21889"
FT                   /protein_id="ATY43028.1"
FT                   /translation="MMRTHYCGSLTEAQIDQTVTLCGWVHRRRDHGGVIFLDMRDRDGL
FT                   VQVVIDPDTPEAFATADKARSEYVLKITGRVRRRYEGTENPNMVSGQIEVLGKEIEVLA
FT                   ASETPPFPLNDDTINVSEEHRLKYRFLDIRRPEMLERLRFRSKVTNLIRNYLDDHGFLD
FT                   VETPILTRATPEGARDYLVPSRVQNGSFYALPQSPQLFKQLLMVGGIDRYYQIAKCFRD
FT                   EDLRADRQPEFTQIDIETSFLNDDDIMDLMEGMTVKLFNDLLGVKFEKFRRMPYSEAMR
FT                   DYASDKPDLRIPLKLVDVADLMQEVEFKVFAGPAKDPKGRIAALRVPGAGSLTRSQIDE
FT                   YTKFVGIYGAKGLAYIKVNEIEKGIEGLQSPIVKFIEPIVMQLLERVGAENGDIVFFGA
FT                   DKAKIVNDAMGALRVKIGHDLNLATCEWAPLWVVDFPMFEETDDGKWTSVHHPFTLPKS
FT                   SVEDVKSNPGEALSVAYDMVLNGTEVGGGSLRIYTLEMQKAIFEALGISDEEAEEKFSF
FT                   LLNALRYGAPPHGGLAFGLDRLVMLMTGATSIRDVIAFPKTKTAECPLTQAPAPVEANQ
FT                   LRDLGIRLREQQKKEA"
FT   gene            complement(595756..596520)
FT                   /locus_tag="ABBFA_00572"
FT                   /old_locus_tag="CTY05_00572"
FT   CDS_pept        complement(595756..596520)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABBFA_00572"
FT                   /old_locus_tag="CTY05_00572"
FT                   /product="hypothetical protein"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /protein_id="ATY43029.1"
FT                   /translation="MPFTISHAVIAPPLAKLSRNTLPIAALAIGSMTPDLYRLFTMQSG
FT                   MLTHQWKGLFYPNLALGLLFSAIWYLLYRPVVYRFFGIQHDLKLDSFRHFFSFFIGIII
FT                   ALLIGIATHLIWDGLTHSDFRTFIFQDFLSQTVHLFGRPYPLHRLLQLGSSALALPFLG
FT                   WMSIHYYQRHKQHWKVNYKIKIFAWCLFALSTLLGLFSFWDYARYIPHEVWHSDTYYFT
FT                   GRSINEFMQGWLSTFSLGCLLFLFLDRQQRMG"
FT   gene            596656..598731
FT                   /locus_tag="ABBFA_00573"
FT                   /old_locus_tag="CTY05_00573"
FT   CDS_pept        596656..598731
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABBFA_00573"
FT                   /old_locus_tag="CTY05_00573"
FT                   /product="putative TonB-dependent receptor precursor"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:Q9JZN9"
FT                   /protein_id="ATY43030.1"
FT                   /translation="MLFYKNILTLSILAAISIPVFAAENENVEKLETIRIKAHPLEQTS
FT                   KDFAVADTVVDQKHLTEGAATIGDALNSEVGIYANQFGAGSSRPVIRGQDGPRVKVLQN
FT                   SSENVDVSTLSPDHAVTVDPVLAKQVEVIRGPSTLLFGAGTVGGLVNVIDNKIPTQMPE
FT                   NGYEGQVGLRYNTGSDEKLASAGVTVGLGSQVALRVEGLTRDANNYIAPNYIHEGEKER
FT                   RVDNTFAQGDSVNVGLSWIYDRGYTGISYSNRRDQYGLPGHSHEYESCSAHLGGRPHLH
FT                   CDAHEHDHEEGEEAHAHEEHEHEHGGPWIDLKSERYDFKTELNDPFAGFQKLRAQASYT
FT                   DYQHDEIEEGAIATRFQNKGYDGRIELVHNPIADWEGVIGTQLGQQKLNLTGEEAFMAP
FT                   TTTKKWSVFALEHKQWKDVHFELSARADQQEINVDDNSKQDFDGSAFSYAGAANWEFAP
FT                   NYKLSFVASHQERLPLAQELYANGAHFATNTYELGNDQLSKEKSNNVELGLHFDNDKLD
FT                   YHLHVYHNWFDDYIYAQTLDRYKDFRLVQYTQDKARFYGAEGEIGYQITPMYKISAFGD
FT                   YVRGKIDAEGNAPRIPAGRLGTKVDADFGDGFSGSAEYYHVFNQDKIAAYETETEGYNM
FT                   LNLGVAYSGQYGAKTDYRVYLKANNLLDDTVYQHASFLSNIPQVGRNFTVGVDFSF"
FT   gene            598807..600270
FT                   /locus_tag="ABBFA_00574"
FT                   /old_locus_tag="CTY05_00574"
FT   CDS_pept        598807..600270
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABBFA_00574"
FT                   /old_locus_tag="CTY05_00574"
FT                   /product="cardiolipin synthetase"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="protein motif:CLUSTERS:PRK01642"
FT                   /protein_id="ATY43031.1"
FT                   /translation="MRIFQRIHQKLNWSGRRYMAVILCVVAIAYLASAIYHTVKPLPQG
FT                   INFSGKLRHADVKFLADKTYIDANGQQQVDQHIFDEILKMIDEAKTTIVVDMFLFNSEV
FT                   GDSKLKQRPLMQELTDALVSKKRQNPQIQVVMITDPINSVYGGLSPEHYRQLRQAGVDV
FT                   IETNLAPLRASNPFWSGFWYICCQNIGNNPEKGWLPNPFGDEKITLRSYLNLFNFKANH
FT                   RKTVVVDTDTGWKSLVTSANPHDGSSRHSNVALVVNGATAADVLQTEAAVAQMSGSSSP
FT                   SLILGDFEKDVSKPQVQVLTEGAIYEAVLKLINTAKPKEHLDLSMFYLSERKIIKALKS
FT                   AQERGVIVRVLLDPNKDAFGRQKNGIPNRQVASELHAAGIPIRWCDTHGEQNHSKMILK
FT                   YNAQQAVLIVGSANFTARNLKNYNLETDMLVVGKVQDQVFKDAQNYFNTSWSNLQGRQM
FT                   SVDYAKYADESKVKYWIYRFMEWSGLSTF"
FT   gene            complement(600465..600911)
FT                   /locus_tag="ABBFA_00575"
FT                   /old_locus_tag="CTY05_00575"
FT   CDS_pept        complement(600465..600911)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABBFA_00575"
FT                   /old_locus_tag="CTY05_00575"
FT                   /product="hypothetical protein"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /protein_id="ATY43032.1"
FT                   /translation="MSEISFERLHQFFCKVPSVQEARIMAHGADGEHAWWFKFSIDVQH
FT                   PLAWQTVQELGHVLNYLSTNERLPTLFFPVSPPPYMNGEAKDFLSWVIQCNHPEFSPDV
FT                   VCDWLEARLPNPVDDESQWKIKTDLSEIEKLDDKALDQLIPPTA"
FT   gene            601076..601459
FT                   /locus_tag="ABBFA_00576"
FT                   /old_locus_tag="CTY05_00576"
FT   CDS_pept        601076..601459
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABBFA_00576"
FT                   /old_locus_tag="CTY05_00576"
FT                   /product="hypothetical protein"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /protein_id="ATY43033.1"
FT                   /translation="MKKPIVLVLSTLMLGMSATAMADSNHRWDNYHGKDHNRYEQRHDY
FT                   RYDHRNDHRAPVWSHSERGNHYGRYVAFKRGDRIPVEYRNSRYYVSDWRAHRLYAPPRG
FT                   YHWVKTPNQYLLVDSKHHIYRVR"
FT   gene            complement(601497..601979)
FT                   /locus_tag="ABBFA_00577"
FT                   /old_locus_tag="CTY05_00577"
FT   CDS_pept        complement(601497..601979)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABBFA_00577"
FT                   /old_locus_tag="CTY05_00577"
FT                   /product="phosphate-starvation-inducible protein PsiE"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="protein motif:CLUSTERS:PRK02833"
FT                   /protein_id="ATY43034.1"
FT                   /translation="MPDPKKFERTLDRFGHYAVEAFHYLALFIIGCMIAWSAAHTVFEI
FT                   LTVKKYASIDDILLLFIYLELGAMVGIYFKTNHMPVRFLIYVAITALTRLLISDIQHDH
FT                   KADLDQVIITGSILILALSILVVRFASWHYPSVMKEKHSKTPTSLKTPQPQDDELA"
FT   gene            complement(602098..603879)
FT                   /gene="mmgC_5"
FT                   /locus_tag="ABBFA_00578"
FT                   /old_locus_tag="CTY05_00578"
FT   CDS_pept        complement(602098..603879)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mmgC_5"
FT                   /locus_tag="ABBFA_00578"
FT                   /old_locus_tag="CTY05_00578"
FT                   /product="Acyl-CoA dehydrogenase"
FT                   /EC_number="1.3.99.-"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:P45857"
FT                   /protein_id="ATY43035.1"
FT                   /translation="MPIYNAPLADMKFILNDVFKAEQFWQANEKLAHVDAATAEAILEE
FT                   MAKFAQNVTHPLNRTGDEEGARYENGEVFTPAGFKDAFRQYAEGGWIGLGADEEWGGQG
FT                   MPKMLTVLADEMLFATNPSFMLYPLLSVGAGMALSSYASQEQKETYLPKIYSGEWSGTM
FT                   CLTEPHAGTDLGIIKTKAERNEDGTYNITGTKIFITGGDNDLAENIIHLVLAKTPDAPA
FT                   GSRGISLFIVPKYLVNEDGSLGDRNHVGPGSIEHKMGIKASATCVMNFDGAKGYLVGKE
FT                   NEGLAAMFVMMNYERLSMGIQGLGASEFAYQNAAQYATDRLQGRSAAGVQSPSKPADSI
FT                   LVHGDVRRMLLNVRANNEASRAFAVYVGQQLDITKFSTDAEAVKKANDRVALLTPIAKA
FT                   YLTDTAFQATLDAQMVFGGHGYIREWGMEQCIRDLRIAQIYEGTNGVQSQDLIGRKTIK
FT                   CGGAFIAEYITEIRDFANDLDTDLNFIKDATLDAATEIEAITQFIIEQAAENVEFPNSA
FT                   AVDYLHAVGLLSFSYMFAKIAAAAKDKSGDFYQNKLALAQYFVERILPDIDARIAKIKA
FT                   GSDLIMGFSEDYFTNQA"
FT   gene            complement(604047..605849)
FT                   /gene="mmgC_6"
FT                   /locus_tag="ABBFA_00579"
FT                   /old_locus_tag="CTY05_00579"
FT   CDS_pept        complement(604047..605849)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mmgC_6"
FT                   /locus_tag="ABBFA_00579"
FT                   /old_locus_tag="CTY05_00579"
FT                   /product="Acyl-CoA dehydrogenase"
FT                   /EC_number="1.3.99.-"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:P45857"
FT                   /protein_id="ATY43036.1"
FT                   /translation="MPQYKAPLRDMQFVLHELLNAEEHYAKLPDFQGNVSRELVDQYLE
FT                   AAADFCENELSPLNQVGDREGCTWNDGVVTTPTGFKEAYQKYIELGFPSLSAEEQYGGQ
FT                   GLPNSLGIAISEMVGSSNWAWGMYPGLSHGAVRTLEHHGSEEQKNTYLPNLVSGVWTGT
FT                   MCLTESHAGSDLGIIRTKAEPNADGSYAISGEKIFISAGEHDMAENIIHIVLARLPGAP
FT                   KGTKGISLFIVPKFNVNADGTLGERNAVRCGSIEHKMGIHGNATCVINFDQAKGYLIGP
FT                   ENRGLNCMFTFMNTARIGTAVQGLSASESSFQGALTYAKERLAMRSLSGPKAPEKEADP
FT                   IIVHPAVRNMLLTQKAFAEGGRALVYLLAQYADIVEKGETEEERKFADNILSLLTPIAK
FT                   AFLTETGSESAKHGVQVFGGHGFISEHGMEQIVRDTRIACLYEGTTEIQALDLLGRKVL
FT                   QTQGAMLRDFTKIVHKFVEANKDNPAMKEFVEPLAALNKEWGDLTMQIGMRAMQNPDEV
FT                   GAAAVDYLYFSGYVTLAYLWARMALVAQEKLAAGTTDVDFYNAKVTTARFYFKKILPRV
FT                   RSHVDVIAGGLDPLMALDAEHFAF"
FT   gene            complement(606139..606519)
FT                   /locus_tag="ABBFA_00580"
FT                   /old_locus_tag="CTY05_00580"
FT   CDS_pept        complement(606139..606519)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABBFA_00580"
FT                   /old_locus_tag="CTY05_00580"
FT                   /product="hypothetical protein"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /protein_id="ATY43037.1"
FT                   /translation="MKMTAKIALFSAAIVTMGSLAACQSTTQPPKPEHGMMQDGPRDGH
FT                   HHRMKHREFTPEQKAAWEQHRAERKARFEQIQKACEGKVVGQTVNVQVGDKTLEGTCNL
FT                   RFEPKRPQPPVNAPAPVATQAK"
FT   gene            606753..608309
FT                   /gene="baeS_1"
FT                   /locus_tag="ABBFA_00581"
FT                   /old_locus_tag="CTY05_00581"
FT   CDS_pept        606753..608309
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="baeS_1"
FT                   /locus_tag="ABBFA_00581"
FT                   /old_locus_tag="CTY05_00581"
FT                   /product="Signal transduction histidine-protein kinase
FT                   BaeS"
FT                   /EC_number="2.7.13.3"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:P30847"
FT                   /protein_id="ATY43038.1"
FT                   /translation="MQKNFAKYVADVEMQKLDRLITNLGNVYTVYHDWGNAIQAQILQI
FT                   EGTAAPDDYDRLSQWWLRRQYDIAIQQHSFDEHTLINISPDAGTVNKNSIFSDEELRTL
FT                   EQNLPSEYQPFEGLRFPLSANQFRPSDDKNKSKKGSLKDIETQNGKKRFIALPDRLGLS
FT                   SRLSLYDAKHQFVVGEPPSSDQMSYRPIMVNSQVVGYLGLKPVLDKEDALSINFFSNQK
FT                   RYLLLIYALTLLSSLVAALLMATYFKKPIQRLLNATNELTKGNYQHQVVIKRNDELGDL
FT                   STQLNHLAEILHQHEESRRQWVADTSHELKTPLAVLQAQIEAMQDGIRKATPEHLDAMM
FT                   RQVSSLKKLTQDLADLAQADAQQLKCYLSSVNPWEVILQEVENFRPKLEQAGLEIEVEG
FT                   EGASLLLDRDRFKQIIVNLIGNSIRYTETGGKIHIHTNQTSQEWTLYVDDSPFGLSDEQ
FT                   LSRLGERFYRVDDSRTRSTGGTGLGLALSCKIAQALGGTLSFEHSPLGGLRCVLTFKKQ
FT                   S"
FT   gene            608329..609015
FT                   /gene="baeR"
FT                   /locus_tag="ABBFA_00582"
FT                   /old_locus_tag="CTY05_00582"
FT   CDS_pept        608329..609015
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="baeR"
FT                   /locus_tag="ABBFA_00582"
FT                   /old_locus_tag="CTY05_00582"
FT                   /product="Transcriptional regulatory protein BaeR"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:P69228"
FT                   /protein_id="ATY43039.1"
FT                   /translation="MKHIMLVEDEVELAHLVRDYLEAAGFEVSMFHDGQDAYTNFQQRK
FT                   PNLMILDLMVPRMDGLTICRKVREQSDLPIIMVTARTEEIDRVLGLNMGADDYVCKPFS
FT                   PKELVARVQAVLRRLERKAEPEQNDSFRIDKAQQRIWYQQKSLSLTPTEFRLLELFLEH
FT                   VGQVYSRAQLLDHINPDSFDVADRVIDSHIKNLRRKITEVAETGNRHEWIQAVYGVGYR
FT                   FEYPEE"
FT   gene            complement(609079..610521)
FT                   /locus_tag="ABBFA_00583"
FT                   /old_locus_tag="CTY05_00583"
FT   CDS_pept        complement(609079..610521)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABBFA_00583"
FT                   /old_locus_tag="CTY05_00583"
FT                   /product="hypothetical protein"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="protein motif:CLUSTERS:PRK00029"
FT                   /protein_id="ATY43040.1"
FT                   /translation="MQFNPLYSSLNPKLFHIQQPSPLRGAKVGHFNLALAEELQWTDEE
FT                   KQAWVEICSGQRTFSEFPPLAMVYAGHQFGQWAGQLGDGRGLLIAQILNKKGQTIDLHL
FT                   KGAGPTPYSRMGDGRAVLRSVIREYLAGHALNALGVASSHAVGFTSSTQGVQREKLEPG
FT                   AMLLRTSECHIRLGHFEWINQYAPELLAEFTQKCIEWHYPECQQEEQPILAFAKAVIRN
FT                   TAIMIAKWQLVGFAHGVMNTDNLNITGSTLDFGPYGFMERFRPNWINNHSDYQGRYTYQ
FT                   NQPSIAHWNLWTWLNNLIPLAEPEHKEQFKEALAACLEEFEPTFIEHYTTGLCQKMGLP
FT                   HFHKDSTECGLSFLRILQAEQLDYTQSFIRLQNKEYKALRDDCLDIRQFDAFLTQYQNI
FT                   REYQDIDELDANMQQVNPIYILRNHMAQRAIEAAERDDFSEVDRLFKLLNHPYTKQSDL
FT                   EKPEDLGPLPSDVPDVAVSCSS"
FT   gene            complement(610635..611807)
FT                   /locus_tag="ABBFA_00584"
FT                   /old_locus_tag="CTY05_00584"
FT   CDS_pept        complement(610635..611807)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABBFA_00584"
FT                   /old_locus_tag="CTY05_00584"
FT                   /product="Fatty acid desaturase"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="protein motif:Pfam:PF00487.18"
FT                   /protein_id="ATY43041.1"
FT                   /translation="MTSAPLKAPINWTASITLIGLPILAAIIIPIYAYYYDFSVSAWVS
FT                   LFFLLALSSMGITAGYHRLWAHRAYEASLPLKILLMIGGTFAVQNSILFWASGHRTHHR
FT                   HVDDVDEDPYSIERGFWYAHMGWMIRDHSPSEPDFKNAPDLLNDKLVMFQHKYYALMVV
FT                   AVHVGILGLVGWATGDLWGVVLLGGLLRLIISHQVTFFINSLCHMFGKRPYTDENSARD
FT                   NFWLAIATWGEGYHNYHHIFQYDYRNGVKWWQYDPTKWLIWTCSKIGLAKNLRRIPSFN
FT                   IKKAELAMKFKYAEQDLAIYGHDVNADISQMKQRIAQEYEAFTHTLNDWAKLKEQELQA
FT                   KKAAMAEKIHKMDHKLKVDFQLLEHRLSHHRECLETLMRNIKKNTNVVPD"
FT   gene            612016..612546
FT                   /locus_tag="ABBFA_00585"
FT                   /old_locus_tag="CTY05_00585"
FT   CDS_pept        612016..612546
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABBFA_00585"
FT                   /old_locus_tag="CTY05_00585"
FT                   /product="META domain protein"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="protein motif:Pfam:PF03724.10"
FT                   /protein_id="ATY43042.1"
FT                   /translation="MKIQRLRKKNSIDIARKLPLKCLFIAISLVLAACQSTPQPNNHKG
FT                   QVKPTHRVQTPVVKKKVSPDGIQDIDWQITQINGHKAKFFNQWPTLSLNSTVKTVTGHT
FT                   GCNRVFGRYTFDFSQKKLDMEVNAGHSSCDGALAQEAELVDSLQRIKRFQLVGNTLYLL
FT                   DQSGQRLIQAEKK"
FT   gene            complement(612575..613288)
FT                   /gene="ugpQ"
FT                   /locus_tag="ABBFA_00586"
FT                   /old_locus_tag="CTY05_00586"
FT   CDS_pept        complement(612575..613288)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ugpQ"
FT                   /locus_tag="ABBFA_00586"
FT                   /old_locus_tag="CTY05_00586"
FT                   /product="Glycerophosphoryl diester phosphodiesterase"
FT                   /EC_number="3.1.4.46"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:P10908"
FT                   /protein_id="ATY43043.1"
FT                   /translation="MRIIGHRGARREAPENTLGGFQHIKNLGIRGVEFDIRQLQDQELV
FT                   VIHDDNFLRTAGVDQIVEQSTLAQALSFDHRQNWPNWPTSEPTPTLTDVLNLLDNFDHI
FT                   EVEVKAVRDMALAEKLVQKLETELQGFEKVVTITSFDLQILTTLRDTNSQFKRGLLVEL
FT                   PVGATAIELAHQYGCCHIGWHDQLATDEMIQLSHQAGLNISVWTVNDVERAKRLQDLDI
FT                   QGLITDIPTTMLEAL"
FT   gene            complement(613361..613939)
FT                   /gene="yvqK"
FT                   /locus_tag="ABBFA_00587"
FT                   /old_locus_tag="CTY05_00587"
FT   CDS_pept        complement(613361..613939)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yvqK"
FT                   /locus_tag="ABBFA_00587"
FT                   /old_locus_tag="CTY05_00587"
FT                   /product="Cob(I)yrinic acid a,c-diamide
FT                   adenosyltransferase"
FT                   /EC_number="2.5.1.17"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:O34899"
FT                   /protein_id="ATY43044.1"
FT                   /translation="MGHRLSKIYTRTGDSGTTGLGDGSRVAKDDLRIAALGDIDELNAI
FT                   IGVLRAQITASQVTDKAGWDKSLSLIQHWLFDLGGEVCIPNYHLLQPVCIEFLEQEIDR
FT                   MNEDLPMLKEFILPSGSLSCSYAHQARAVCRRAERSLMSVQTRDQNIQATALQLLNRLS
FT                   DWLFVASRALQRAEGGQEVLWQKNINEMI"
FT   gene            complement(614035..615897)
FT                   /gene="btuB_1"
FT                   /locus_tag="ABBFA_00588"
FT                   /old_locus_tag="CTY05_00588"
FT   CDS_pept        complement(614035..615897)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="btuB_1"
FT                   /locus_tag="ABBFA_00588"
FT                   /old_locus_tag="CTY05_00588"
FT                   /product="Vitamin B12 transporter BtuB precursor"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:P06129"
FT                   /protein_id="ATY43045.1"
FT                   /translation="MSKSFQPTRLVGAIAIAMGCSPVIFAEDATDATQLDPIVITASKS
FT                   AEKASEVPARISIIEPKIVEQSPIAELPHLLMSDAAINMVQSGGLGQTSSIFIRGTNSE
FT                   HALILRDGARLNTASTGAANLAFIDTTDIKQIEILKGPASVLYGTDAIGGVVQIISKTP
FT                   EKTSAFVTGEIGENKTYKSIVGADLAENGFYAQVRGQRLESDGSRITDLKGNDIKKASY
FT                   DQKGFSTKVGVEKEDFGASVDYTQNEGTSQYDTFRYDGSLTSQDFKNELLNIRGRVNLN
FT                   SDISLNARLSQFKDELDQNGSRDFVHSTTKEAEVYGKWQFTSSQNVLAGVTHQNIDGDV
FT                   LSYGSPYDEDVNSTGYFVQHQYQNNGLNTQVGVRVEDNEKYGTHTVAQGAIRYQLLPLT
FT                   SIYANIGSAFKAPTLNDMYGSGGNPNLKPEESISYEVGIDQKLNYNISTGLSAYYTKID
FT                   NLIESRCIAVCNGDWINTFPVYQNINIDKASMRGGEIYANWNRDDLFIKSSYNYVKAIN
FT                   DETDQELSRRPRQSFTVSTGLQNEHYGLSISLSAKSKAKDYKQDTPGYTTVDFNGYWNA
FT                   TPNVKLFTNIQNIGDVKYKTASYDKGIYYVNGGRLASAGVTLSY"
FT   gene            616267..616926
FT                   /gene="trpF"
FT                   /locus_tag="ABBFA_00589"
FT                   /old_locus_tag="CTY05_00589"
FT   CDS_pept        616267..616926
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trpF"
FT                   /locus_tag="ABBFA_00589"
FT                   /old_locus_tag="CTY05_00589"
FT                   /product="N-(5'-phosphoribosyl)anthranilate isomerase"
FT                   /EC_number="5.3.1.24"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:Q56320"
FT                   /protein_id="ATY43046.1"
FT                   /translation="MSQSNQKRTRAKICGITRKQDVQAVVAAGADAIGFVFFPPSPRNV
FT                   TVEQAEELAKLVPPYVQMVGLFVNASVTEIQDILDCVPLDVLQLHGDETPEQCQEIARH
FT                   CKRRWYKAIQVKPDLDVIAEIQKYQAAGASAVLLDAWHPELKGGTGHQFDWSKFPKLDI
FT                   PLILAGGLTPDNVIDAIHTTGAFAVDVSGGVESAKGIKDQQLIERFMQGVQRGSAK"
FT   gene            616910..618139
FT                   /gene="trpB_1"
FT                   /locus_tag="ABBFA_00590"
FT                   /old_locus_tag="CTY05_00590"
FT   CDS_pept        616910..618139
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trpB_1"
FT                   /locus_tag="ABBFA_00590"
FT                   /old_locus_tag="CTY05_00590"
FT                   /product="Tryptophan synthase beta chain"
FT                   /EC_number="4.2.1.20"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:A6UEI1"
FT                   /protein_id="ATY43047.1"
FT                   /translation="MDQQNNMIDYTQFPDANGHFGIHGGRFVSETLMAALEDLENLYSR
FT                   MKNDEQFLAEFDRDLAYYVGRPSPLYYAERWSKELGGAQIYLKREDLNHTGSHKVNNTI
FT                   GQALLAKLSGKKRIIAETGAGQHGVATATIAARLGLECVVYMGAEDVKRQAMNVYRMRL
FT                   LGATVVPVQSGSKTLKDAMNEAMRDWVTNVDTTYYVIGTVAGPHPYPQLVRDFQSIIGR
FT                   EARKQILEQAGRLPDALVACVGGGSNAMGLFYPFLNDANVKMYGVEAAGFGIETGKHSA
FT                   PLNAGHVGVLHGNRTYLMSDEQGQIIETHSISAGLDYPGVGPEHSFLKDMKRVEYVPIN
FT                   DTEALQGFRDLTKIEGIIPALESSHAMAYVSKLAPTMSKDQIIIATVSGRGDKDLMTVA
FT                   RIDGVEMVEM"
FT   gene            618149..618661
FT                   /locus_tag="ABBFA_00591"
FT                   /old_locus_tag="CTY05_00591"
FT   CDS_pept        618149..618661
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABBFA_00591"
FT                   /old_locus_tag="CTY05_00591"
FT                   /product="hypothetical protein"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /protein_id="ATY43048.1"
FT                   /translation="MPSLFMVMLGGRHARANTEVHDVVMAVGDTLEEVYPQLKQAWFGE
FT                   AQGLHIDAWAKLSGVSSQGQNYQIHFTDAAPQPDDLKLYLINLGGYNASEFGELHRYEF
FT                   VVAPNAVAAKQLGKQFIDRQWQKAHTDRVIDIDDCLAIDCVAGRYIHLIKGDFAETIWE
FT                   NTYLTVV"
FT   gene            618699..619694
FT                   /locus_tag="ABBFA_00592"
FT                   /old_locus_tag="CTY05_00592"
FT   CDS_pept        618699..619694
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABBFA_00592"
FT                   /old_locus_tag="CTY05_00592"
FT                   /product="hypothetical protein"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /protein_id="ATY43049.1"
FT                   /translation="MDLIQENGKPRYGRFESVPSTIHVQHYIYKTPYGKVLKGWRKQLK
FT                   YKKFKFCGIQHKHYSIGLAIADIGWVGHGFFYIYDHETEQVIEWNAIQPLGHKTYLDEQ
FT                   PLFNQSYFSKSPYQFDIQHANGVRYIRVTKYGEIQLSARIFCAGTDILSLCTPTGINGW
FT                   TYTQKQTTLAVEGMFINKQNQVVQFDEKTFASLDDTCGFLRPETAWFWLSCNFWDEQGR
FT                   RIGLNLASGVNESFGNENCLWINGVLFPLTDVLFEKVNDELWQISSLDQKLNLQVHIGW
FT                   CRYENINLRMIGSQFNQWQAKISGTIEHEATDIINCNEQYGLLEQHYAKW"
FT   gene            complement(619703..620578)
FT                   /locus_tag="ABBFA_00593"
FT                   /old_locus_tag="CTY05_00593"
FT   CDS_pept        complement(619703..620578)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABBFA_00593"
FT                   /old_locus_tag="CTY05_00593"
FT                   /product="putative metal-dependent hydrolase"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="protein motif:Pfam:PF10118.3"
FT                   /protein_id="ATY43050.1"
FT                   /translation="MNAHVSYQVEPVVRKDLDFHLNEAPRFWFNNDPFLTRMFDALSLT
FT                   FPDGERYFIECVRMFRDKIDDPELQKRVADFIKQEAQHGIAHDKMNQLMKEQGMPVDQF
FT                   TTTLKKIFRFELTKRSPQYNIAMTAAAEHLTALMAETFYSHKKTLENAHPYVRALFAWH
FT                   AIEEMEHRDVAFDVMKQVGEVPESTRRFVLVLTTVLMFGFTLYRTNIMLKCDGFSPRER
FT                   LLMNLKGLPWFFGKNGTLTAMKKQYMDWFKKDFHPSQHPVIRQYPVWIETLEKTNDPIA
FT                   AGEAFWQAGL"
FT   gene            620699..621748
FT                   /locus_tag="ABBFA_00594"
FT                   /old_locus_tag="CTY05_00594"
FT   CDS_pept        620699..621748
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABBFA_00594"
FT                   /old_locus_tag="CTY05_00594"
FT                   /product="DNA-binding transcriptional activator FeaR"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="protein motif:CLUSTERS:PRK09685"
FT                   /protein_id="ATY43051.1"
FT                   /translation="MQEFTISNGYFYLWNTYLKEKGIDWQTLNLSEIQTRQVQNILSAS
FT                   IDAQSSLDLFIELLEITETRLHVTNLALEMAACITPANFGVLGYMASRSDTLGQVVEYI
FT                   AKFHRLVIDGAQVIPIQIEQDASKIRLYWPLVDDSNILLSELTLAAMVQLAKQIAPVHE
FT                   FLLQHVEFVHRARGAVVHYQRFFQCKLSFERPYYALTFASESLNVRPQHADPTLVQLLV
FT                   KQAEEALVQRKIHADLVQQIHWIVQEYFKHKQQAPKIEDIAIELNVSVRSLQRQLQALN
FT                   TSFKLILDAERMKRCEILLSQNESLTAIADQLGYSDQSALARAYKNLTGQTLLTRKKQL
FT                   QLIQKNATK"
FT   gene            621993..622796
FT                   /gene="trpA"
FT                   /locus_tag="ABBFA_00595"
FT                   /old_locus_tag="CTY05_00595"
FT   CDS_pept        621993..622796
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trpA"
FT                   /locus_tag="ABBFA_00595"
FT                   /old_locus_tag="CTY05_00595"
FT                   /product="Tryptophan synthase alpha chain"
FT                   /EC_number="4.2.1.20"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:O67502"
FT                   /protein_id="ATY43052.1"
FT                   /translation="MSRLATRFEKLQSQQRKALVSYVMAGDPQPQVTVPLLHKMVAAGV
FT                   DVIELGLPFSDPMADGPVIALAAERALAAGTNTLDALNMVKEFREQDQETPVVLMGYLN
FT                   PVEVIGYEKFVSYAKQCGVDGLLLVDLPPEESKEFGAILKQHDMDQIFLLAPTSTDQRI
FT                   QHVANQASGFIYYVSLKGVTGAATLDTSEAAARIEKIKGMTNVPVGVGFGISDAASAKA
FT                   MGSVADAVIVGSAFVKSFATLAADEAVEQTVNKVKELRAALDELV"
FT   gene            622793..623689
FT                   /gene="accD"
FT                   /locus_tag="ABBFA_00596"
FT                   /old_locus_tag="CTY05_00596"
FT   CDS_pept        622793..623689
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="accD"
FT                   /locus_tag="ABBFA_00596"
FT                   /old_locus_tag="CTY05_00596"
FT                   /product="Acetyl-coenzyme A carboxylase carboxyl
FT                   transferase subunit beta"
FT                   /EC_number="6.4.1.2"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:Q9HZA7"
FT                   /protein_id="ATY43053.1"
FT                   /translation="MNQEVKSGKVLSPSTPWTQRPVPGIEVADEQQTLKATFTEPTIEC
FT                   PECHALVTRTAISFNAYVCPQCDEHLRMKARDRLNWFFDNVVAELGQEFSAKDPLKFVD
FT                   SKPYPDRMREAQTKTGETEALIAMQGNLNGVDMIACAFEFDFMGGSMGTVVGDRFVKAA
FT                   ELAIEKRQPLICFAASGGARMQEGMLSLMQMARTSAAIQKLKDAGLPYIVVLTHPVYGG
FT                   VTASLAMLGDIHIAEPKAMIGFAGKRVIEQTVRETLEEPFQRAEYLLDHGVVDQIVHRH
FT                   ALRDTVSRLVSKLMNLP"
FT   gene            623686..624972
FT                   /gene="folC"
FT                   /locus_tag="ABBFA_00597"
FT                   /old_locus_tag="CTY05_00597"
FT   CDS_pept        623686..624972
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folC"
FT                   /locus_tag="ABBFA_00597"
FT                   /old_locus_tag="CTY05_00597"
FT                   /product="Bifunctional protein FolC"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:P08192"
FT                   /protein_id="ATY43054.1"
FT                   /translation="MKQQAPLSTDSLDTWLNYWSHVHVTGIDLGLERVIPVAEKLGVTK
FT                   PNAKVFTVAGTNGKGSTTTTLASILKAQGYKVGLYQSPHIYRFNERVKLGGVEVDDQSL
FT                   IDAFVQVDQARRECDLSLSFFEATTLAAFVIFKQQQCDVWVLEVGLGGRLDVVNVIDPD
FT                   IAVITNIGLDHTDWLGDTIEKIAFEKAGIIRPHIPVIFAGEQSLPQAIQDKANSSQATL
FT                   YAINRDYFYKLADDGKHWYFASEGTTLRLPLGTLAIENIAGAVAAVLNSGLEISQLALE
FT                   EGITNARLAGRFEVRQVNGKTIIFDAGHNPHGVEFLLKQLRNFLEYNKQYTEVVAVFSM
FT                   LADKDIKSVVDLLKPTVLHWKIAELNVPRAAPIQQLNDALQGQTIQQFGNIKEAFKSAL
FT                   EQTNNNQLILACGSFHTLEAIWEYLEECQ"
FT   gene            624963..626033
FT                   /locus_tag="ABBFA_00598"
FT                   /old_locus_tag="CTY05_00598"
FT   CDS_pept        624963..626033
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABBFA_00598"
FT                   /old_locus_tag="CTY05_00598"
FT                   /product="Sporulation related domain protein"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="protein motif:Pfam:PF05036.7"
FT                   /protein_id="ATY43055.1"
FT                   /translation="MSMNNKQRWMGGVVLLGGGVLLAALLLKGNEEIKQVDVQPQTSTS
FT                   PKLQAKPKQSAQEGQMVQLQPLAVDVETEKRLLEEQRRSREKAVAEQEARAAEFLAMQQ
FT                   QAEADAARKAAAEYAAINARRAAAQESSDNIPPEVAGSENKAKGQQTDTKKSVDLAKAD
FT                   ADKKAAEAKRLAEADKKAAEAKRQAEADKKAAEAKRQAEADKKAAEAKRQAEADKKAAE
FT                   AKRQAEADKKAAEAKRQAEADKKAAEAKRKAEAEKKAEAEKARELLENGDKKWMVQVAL
FT                   AANQANADAVVSKLRAKGYKVTTSPTSKGIRIMVGPAKDRDTADTTRKKITSDASLNMK
FT                   SAWVIDWVPLDQRKSD"
FT   gene            complement(626052..626630)
FT                   /locus_tag="ABBFA_00599"
FT                   /old_locus_tag="CTY05_00599"
FT   CDS_pept        complement(626052..626630)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABBFA_00599"
FT                   /old_locus_tag="CTY05_00599"
FT                   /product="Dual specificity phosphatase, catalytic domain"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="protein motif:Pfam:PF00782.14"
FT                   /protein_id="ATY43056.1"
FT                   /translation="MKKFSLIAFAVCLSLQGCMQHESIAHEHRPHDWGTLVSQTHNFYQ
FT                   ISNDVFRSEQPDAAMIPELKHHQIGTIINLRAKASDDLVFKNENFNLVHIPINTWAIDR
FT                   QDLLEVMQQIQLAKQNNQRVLLHCYHGSDRTGASVAMYRIIFENWAIDDAVKEMKQGGY
FT                   GYHIIWKNIDRLFTPENVKWIQQQLSNPS"
FT   gene            complement(626627..627403)
FT                   /gene="aiiA"
FT                   /locus_tag="ABBFA_00600"
FT                   /old_locus_tag="CTY05_00600"
FT                   /note="Y2-aiiA"
FT   CDS_pept        complement(626627..627403)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aiiA"
FT                   /locus_tag="ABBFA_00600"
FT                   /old_locus_tag="CTY05_00600"
FT                   /product="N-acyl homoserine lactonase"
FT                   /EC_number="3.1.1.81"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:Q08GP4"
FT                   /protein_id="ATY43057.1"
FT                   /translation="MCPVCAPLFGQRGWKAEIVCHCLLVETDRGLVLIDTGFGLQDYLH
FT                   MQQRLGSLVKRLGKIEPNLEFSAIQQIQKLGFHPKDIQHIFVTHLDFDHAGGISDFPHA
FT                   TVHVLATEYNAAQLPNFKGKLRYRTNQYKQHRYWNFVEYQQGEKWFNLEKVKGFPLFQD
FT                   EILMVPLLGHSAGHCGIAIKQQNQWLLFCGDAYYSHLELNPANKLRSLTLLEKTFAEDN
FT                   EKRLINLKKLQHLAQHEPTIEIICAHDPHELRRYQT"
FT   gene            complement(627701..628342)
FT                   /gene="ahpC_1"
FT                   /locus_tag="ABBFA_00601"
FT                   /old_locus_tag="CTY05_00601"
FT   CDS_pept        complement(627701..628342)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ahpC_1"
FT                   /locus_tag="ABBFA_00601"
FT                   /old_locus_tag="CTY05_00601"
FT                   /product="Alkyl hydroperoxide reductase subunit C"
FT                   /EC_number="1.11.1.15"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:Q7BHK8"
FT                   /protein_id="ATY43058.1"
FT                   /translation="MTLRLGDTAPDFQQESSEGTINFYDFLGDSWGILFSHPADYTPVC
FT                   TTELGYTAKLKDEFEKRNVKAIALSVDDVESHKGWINDINETQNTTVNFPIIADKDRKV
FT                   SELYGFIHPNASETLTVRSLVIIDPHKKVRLIITYPASTGRNFNEVLRVVDSLQLTDKH
FT                   KVATPANWQQGEDVVIVPSLKDEEEIKQRFPKGYTAVKPYLRLTPQPEQD"
FT   gene            628750..631473
FT                   /locus_tag="ABBFA_00602"
FT                   /old_locus_tag="CTY05_00602"
FT   CDS_pept        628750..631473
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABBFA_00602"
FT                   /old_locus_tag="CTY05_00602"
FT                   /product="preprotein translocase subunit SecA"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="protein motif:CLUSTERS:PRK13103"
FT                   /protein_id="ATY43059.1"
FT                   /translation="MLASLIGGIFGTKNERELKRMRKIVEQINALEPTISALSDADLSA
FT                   KTPEFKQRYNNGESLDKLLPEAFAVCREAAKRVMGMRHYDVQLIGGITLHEGKIAEMRT
FT                   GEGKTLMGTLACYLNALSGEGVHVITVNDYLAQRDAELNRPLFEFLGLSIGTIYSMQEP
FT                   AEKAAAYLADITYGTNNEFGFDYLRDNMVFSLAEKKQRGLHYAIIDEVDSILIDEARTP
FT                   LIISGQSEDSSHLYTAINTIPPKLRPQKEEKVADGGHFWIDEKQRSVEMTEIGYETVEQ
FT                   ELIQMGLLAEGESLYSATNLNLVHHVSAAIRAHFLFQRDVHYIIHDGEVIIVDEHTGRT
FT                   MPGRRWSEGLHQAVEAKEGLAIQPENQTLATTTFQNYFRLYKKLSGMTGTADTEAAEMK
FT                   EIYGLDVVIIPTHRPMIRNDQNDLIYLNRNGKYNAIIQEIMNIRQQGVAPILIGTATIE
FT                   ASEILSSKLKQAGIHHEVLNAKQHEREADIIAQAGSPNAVTIATNMAGRGTDIILGGNW
FT                   KAKLAKLENPTPEDEARLKAQWEQDHEDVLQAGGLHIIGSERHESRRIDNQLRGRAGRQ
FT                   GDPGVSRFYLSLEDDLMRIFAGDRVVAMMRAMGLKEDEAIEHKMVSRSIENAQRKVEAR
FT                   NFDIRKNLLKYDDVNNEQRKIIYSQRDEILAENTLQEYVEEMHREVMQAMIANFIPPES
FT                   IHDQWDVEGLENALRIDLGIELPVQEWLEQDRRLDEEGLVERISDEVIARYRQRRAQMG
FT                   DESAAMLERHFVLNSLDRHWKDHLAAMDYLRQGIHLRGYAQKNPEQEYKKEAFNLFVNM
FT                   LGVIKTDVVTDLSRVHIPTPEELAEMEAQQQQQAEAMKLSFEHDDVDGLTGEVTASQEA
FT                   LNDSATEQQTFPVPESRNAPCPCGSGLKYKQCHGKI"
FT   gene            631606..632049
FT                   /locus_tag="ABBFA_00603"
FT                   /old_locus_tag="CTY05_00603"
FT   CDS_pept        631606..632049
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABBFA_00603"
FT                   /old_locus_tag="CTY05_00603"
FT                   /product="hypothetical protein"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /protein_id="ATY43060.1"
FT                   /translation="MKKVLQPLFLTVLAVPSFVFAAETASAPQTTTVDKVLAAKGPTSA
FT                   QAVVKQENTTVISPRTGIRYTLGNTGNRPIILQTAAIAPANSANINRIVASNPALSPKS
FT                   QEKAKVALIGEAAVAGAAAVAANNVTAPAVPNSVTAANPASLN"
FT   gene            complement(632116..633426)
FT                   /gene="yhjE_1"
FT                   /locus_tag="ABBFA_00604"
FT                   /old_locus_tag="CTY05_00604"
FT   CDS_pept        complement(632116..633426)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yhjE_1"
FT                   /locus_tag="ABBFA_00604"
FT                   /old_locus_tag="CTY05_00604"
FT                   /product="Inner membrane metabolite transport protein YhjE"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:P37643"
FT                   /protein_id="ATY43061.1"
FT                   /translation="MESTSATAAPVVATNSKTRVLFASLVGTTIEFFDFYIYATAAVII
FT                   FPHLFFPASSGSAAVLQSLATFAIAFIARPIGAALFGHLGDRIGRKATLVAALLTMGIS
FT                   TVCIGLLPTYAQIGIVAPLLLALCRLGQGLGLGGEWSGAVLLATENAPEGKRAWYGMFP
FT                   QLGAPIGFILATGSFLLLSAAIPEQAFMQWGWRIPFIASAVLVIVGLYIRLKLHETPAF
FT                   QKVLDKQKEVNIPFKEVVTKHTGKLILGTIAAICTFVVFYLTTVFALNWGTTKLGYARG
FT                   EFLELQLFATLCFAAFIPLSAIFAEKFGRKATSIGVCIAAAIFGLFFSSMLESGNTLIV
FT                   FLFLCTGLAIMGLTYGPIGTVLSEIFPTSVRYTGSALTFNLAGIFGASFAPLIATKLAE
FT                   TYGLYAVGYYLTAASLLSLIAFLLIRETKNVDVNNQI"
FT   gene            complement(633561..634190)
FT                   /locus_tag="ABBFA_00605"
FT                   /old_locus_tag="CTY05_00605"
FT   CDS_pept        complement(633561..634190)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABBFA_00605"
FT                   /old_locus_tag="CTY05_00605"
FT                   /product="hemolysin-III related"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="protein motif:Pfam:PF03006.14"
FT                   /protein_id="ATY43062.1"
FT                   /translation="MLETYDPKEELFNAYSHGAGVIMAVVASVFLIIKGSYLSTAQWIG
FT                   LWVYAFSLILVFTSSTLYHFAQTQNLRYWYKKLDHTAIYYLIAGTYTPFLSIAIPTQKA
FT                   HILLIALWSIAAIGTLFKLVFIHRFQKISLLAYVLMGWLAVFVMDDMRTYLSKDTLMLL
FT                   ITGGLAYTVGALFYALKKVRYTHAIWHIFVLLGAGAHFLAIYWYVV"
FT   gene            634302..635540
FT                   /locus_tag="ABBFA_00606"
FT                   /old_locus_tag="CTY05_00606"
FT   CDS_pept        634302..635540
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABBFA_00606"
FT                   /old_locus_tag="CTY05_00606"
FT                   /product="Methyltransferase TRM13"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="protein motif:Pfam:PF05206.8"
FT                   /protein_id="ATY43063.1"
FT                   /translation="MSHHFLGISVSVFSFEQEQQFFHEIKQMLDQQTFERLILSQYKGE
FT                   LTQLEKITFRVVELHGKKQLSALYHHTTQDVTKNYSFEDGLEQIAALITQCKQANLFST
FT                   HQEIQLKKNKKKAMLNMGKKQSMTTAPTVQAHDREKQRYVQQSSAFLKELGITDEKAQI
FT                   IPSMARKWKQINKFIEIFASAYEQIDAEQKELNIVDFGSGKGYLTFALYDYLQEQQKIP
FT                   LITGVELRRNLVEFCQNVAEKVHFNHLDFFEGDVRSYQPEKLDVMIALHACDIATDFAI
FT                   HTGIRLNASMIMCAPCCHKELRPQLHSPEVLQPMLQFGIHAGQQAEMLTDTLRALLLKA
FT                   YGYETKVFEFVSLEHTSKNKMILATKRKNVTQPDAKIMAQIQALKEMYGIKKQTLELLL
FT                   QDQLPIENIGCKC"
FT   gene            635553..635972
FT                   /gene="yjcF"
FT                   /locus_tag="ABBFA_00607"
FT                   /old_locus_tag="CTY05_00607"
FT   CDS_pept        635553..635972
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yjcF"
FT                   /locus_tag="ABBFA_00607"
FT                   /old_locus_tag="CTY05_00607"
FT                   /product="putative N-acetyltransferase YjcF"
FT                   /EC_number="2.3.1.-"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:O31628"
FT                   /protein_id="ATY43064.1"
FT                   /translation="MYKVIAGSWTQFEEDAKYIREQVFIQEQGIEPEDEWDDFDSIAMH
FT                   FIVYDKEQPIATARLLPQHSVGRVAVLMPYRKQGIGKILMQHIIEYARQHKLPYLKLSA
FT                   QTYVTAFYEALGFKVQGEVYQDCGIPHIDMTLTLS"
FT   gene            complement(636002..636862)
FT                   /locus_tag="ABBFA_00608"
FT                   /old_locus_tag="CTY05_00608"
FT   CDS_pept        complement(636002..636862)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABBFA_00608"
FT                   /old_locus_tag="CTY05_00608"
FT                   /product="Patatin-like phospholipase"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="protein motif:Pfam:PF01734.1"
FT                   /protein_id="ATY43065.1"
FT                   /translation="MTDFSRNALVVEGGGMRGAFTSGVLDAFLQQQFNPFDLYVGVSSG
FT                   STNVANYLAGQQGRTLTFYIDHSLRPEFIDYKRFFKGGDLLDLKWMWEIGEQEHPLDQQ
FT                   SLFAKNPDFYMVLTHAKTGHAEYLRAGKDNLLNALRASSSIPVLTRHPVDIMGEPYFDG
FT                   GVADALPVRWAAQQSGVKKLLVLRTRPKNYFKASSRGDQFLAKYAFKHHYGFANSLRNR
FT                   CARYNASVEFVRSSNPEQQILEVCPPPLKNMAGRLTTNPKKLRYSYEVGLETGLQAIEN
FT                   WNAMK"
FT   gene            complement(636878..637132)
FT                   /locus_tag="ABBFA_00609"
FT                   /old_locus_tag="CTY05_00609"
FT   CDS_pept        complement(636878..637132)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABBFA_00609"
FT                   /old_locus_tag="CTY05_00609"
FT                   /product="hypothetical protein"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /protein_id="ATY43066.1"
FT                   /translation="MSDKNSSESAILGWKFVLIVGVLSAIFLGFFYLAMSNEPDYMPGA
FT                   QRKAQQHEMQQKAEKSTDQQTQHDNMPEMDMQEHQHSHQ"
FT   gene            complement(637297..639432)
FT                   /gene="fadJ"
FT                   /locus_tag="ABBFA_00610"
FT                   /old_locus_tag="CTY05_00610"
FT   CDS_pept        complement(637297..639432)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fadJ"
FT                   /locus_tag="ABBFA_00610"
FT                   /old_locus_tag="CTY05_00610"
FT                   /product="Fatty acid oxidation complex subunit alpha"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:P77399"
FT                   /protein_id="ATY43067.1"
FT                   /translation="MSAIQYEKNADNIVILTLDSTGQSANTMNAEFRDSLDEVTQKLKA
FT                   VTELSGVIFRSAKKTFFAGGDLDELIQVQPEHATDFFNMVEKLKGHLRTIETLGVPVVA
FT                   ALNGTALGGGWEIALSCHHRIAINDPKSKFGLPEVTLGLLPGGGGIVRMVRLLGLQNAF
FT                   PFLMEGKQFGVDKAKSLGLIHDTAENEQELLDKAIAWIKANPKSQQPFDVKGYKIPGGD
FT                   PKTPAVAQVLAIAPAMLKDKTKGCYPAPEAIMAAAVEGAQVDVDTALRIESRYFTQLAT
FT                   GQISKNMIGTFWHGLNAIKSGASRPADIAKWQATKVGVLGAGMMGAGIAYATAIKGIPV
FT                   ILKDVSVENAEKGKAYSQKLLDKRVSQGRMTAEKRDQILSLITATASAEDLQGCDLIIE
FT                   AVFENQELKAKVTQEAEQYLAPNGVMASNTSTLPITGLAQASKNDKAFIGLHFFSPVDK
FT                   MQLVEIIKGKNTSAETLAKAYDFVQQIGKTPIVVNDSRGFFTSRVFGTFIQEGMRLLAE
FT                   GVHPARIEMAALKAGMPVGPLAIQDEVSLTLTEHVASETRKALQAEGKELPKTPVDEVI
FT                   HTMIHELNRKGKAAGAGFYDYPENGKKHLWEGLNRWQKDHDISEQDMIDRILFVQALDT
FT                   LRCYEEGVLESVIDANVGSIFGIGYAPWTGGAIQFLNQYGIDKAQKRAEELAAKYGERF
FT                   TPPTLLKTKAEQKQNIQ"
FT   gene            complement(639453..640658)
FT                   /gene="fadA_1"
FT                   /locus_tag="ABBFA_00611"
FT                   /old_locus_tag="CTY05_00611"
FT   CDS_pept        complement(639453..640658)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fadA_1"
FT                   /locus_tag="ABBFA_00611"
FT                   /old_locus_tag="CTY05_00611"
FT                   /product="Putative acyltransferase"
FT                   /EC_number="2.3.1.-"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:O53871"
FT                   /protein_id="ATY43068.1"
FT                   /translation="MSEAYIIDAIRTPRGKGKKDGSLYEVKPITLLTTLLNELQQRHQL
FT                   DTSKVDDIVLGCVTPIGDQGGDIAKTAAIAAGWNDDVAGVQINRFCASGLEAVNMAAMK
FT                   VRSGWEDLVVAGGVESMSRIPMGSDGGPWALDPETNLKSSFVPQGIGADLIATLDGYSR
FT                   EDVDNFAVKSQQKAAAAQSNGYFDQSVVPVKDHAGVVILEKDEFIKGNTTLEGLTKLNP
FT                   SFEMMGQMGFDAVALQKYPEAQKINHVHHAGNSSGIVDGAAVVLLASEKAVKEQNLKPR
FT                   AKVLATALVGTDPTIMLTGPAPAARKALEKAGLTIDDIDLFEVNEAFAAVVMRFINELN
FT                   VPAEKVNVNGGAIALGHPLGATGAMILGTLLDELERQNKKRGLATLCVGGGMGIATIIE
FT                   RV"
FT   gene            complement(640828..641838)
FT                   /gene="nphR_1"
FT                   /locus_tag="ABBFA_00612"
FT                   /old_locus_tag="CTY05_00612"
FT   CDS_pept        complement(640828..641838)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nphR_1"
FT                   /locus_tag="ABBFA_00612"
FT                   /old_locus_tag="CTY05_00612"
FT                   /product="Transcriptional activator NphR"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:B1Q2A8"
FT                   /protein_id="ATY43069.1"
FT                   /translation="MSRDTISIHFVNAALTGVKRLGMDVETLLSHVGIEAELLRQPKAR
FT                   ISPEQYTRFIKMLWMVTQDEHVGFDVQPRRLGTFAIMCQLIIHAKTLGQALELSSQFYK
FT                   LFGDEWSVTLERDKHEARLVPLIPKTLDPDHFITESMLMIWHGLASWLIERRLPLERVH
FT                   FSYPRPAHADEYDALFFAPVMQFDAPRTEITFAADYLDLPIRQDEKTLEEFLKAAPAQL
FT                   LVKFKNTNSLTSRIREVLKSQIGEEMPTLNDVASMLYLSPQTLRRRLAAEGKSYQGVKD
FT                   ALRRDAAIHLLLNPELTLEDVAQQVGFSETSTFHRAFKKWTGVTPGLYRQLHGYH"
FT   gene            642049..643167
FT                   /gene="frc"
FT                   /locus_tag="ABBFA_00613"
FT                   /old_locus_tag="CTY05_00613"
FT   CDS_pept        642049..643167
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="frc"
FT                   /locus_tag="ABBFA_00613"
FT                   /old_locus_tag="CTY05_00613"
FT                   /product="Formyl-coenzyme A transferase"
FT                   /EC_number="2.8.3.16"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:P69902"
FT                   /protein_id="ATY43070.1"
FT                   /translation="MTTALNGLKVLDFSTLLPGPFATMYLADMGAEVIHIESPSRPDLI
FT                   RIMPPYANGQATAHSYLNRNKQSIVLDLKDAASIDLIKDKISEFDVVIEQFRPDVMRRL
FT                   GLDYATLAEINPRLIYCSITGYGQTGSYKDRAGHDINYLALAGIAGYSGRQDSGPPPLG
FT                   IQVADIAGGSLHAVIAILAAVVERSRSGIGQYIDISMTDCVASLNSMAASATLAAQVEQ
FT                   APEQGMLNGGIFYDYYMTQDGRYLSIGSLEPQFMAGLSAALDLPVLLQKGASLDEQDRQ
FT                   EVKQAIQEKIKAKTFKEWHEIFANLDVCVEPVLSLSEALNSPLAQQRGWIVNVPLQNNT
FT                   PDTEPQIACPIKFSRSQMRYSFVGQKLGEGQW"
FT   gene            643303..644556
FT                   /gene="oprB_1"
FT                   /locus_tag="ABBFA_00614"
FT                   /old_locus_tag="CTY05_00614"
FT   CDS_pept        643303..644556
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="oprB_1"
FT                   /locus_tag="ABBFA_00614"
FT                   /old_locus_tag="CTY05_00614"
FT                   /product="Porin B precursor"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:Q51485"
FT                   /protein_id="ATY43071.1"
FT                   /translation="MKTHKSLMVSCLSVLSITLFVQHAQAAAAFDPNGSWMLGDWNGQR
FT                   TALQAQGYDFSFGYTGEYAGILDSKQTSTHGSAYTGQLALGSHLDLGKILGWQDTEAQI
FT                   TLTYRDGQSLSEHSPALAGHQSSVQEVWGREQTWRLTDLWIKKKFLDQKLDVKVGRFGE
FT                   GEDFNSFDCDFQNLALCGSQVGNWVGDQWYNWPVSQWAMRVKYNLQPDLYTQVGVYEYN
FT                   PENLERGKGFNLSTDGSHGAIIPAEVVWSPKLGVQSMPGEYRLGYYYSTADAKEIADST
FT                   KTSHKQGVWVTAKQKLFQPADQTDRGLTGFVNLTFHDSDTNKVDNMQNIGLVYKGLLNQ
FT                   RPQDELALGVARIHINDDWNDVQAKEYDTEYNTELYYGIHATNWLTIRPNVQYVRHVGA
FT                   LKNGDNTWVGGIKFSTAF"
FT   gene            644730..647135
FT                   /gene="gcd"
FT                   /locus_tag="ABBFA_00615"
FT                   /old_locus_tag="CTY05_00615"
FT   CDS_pept        644730..647135
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gcd"
FT                   /locus_tag="ABBFA_00615"
FT                   /old_locus_tag="CTY05_00615"
FT                   /product="Quinoprotein glucose dehydrogenase"
FT                   /EC_number="1.1.5.2"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:P15877"
FT                   /protein_id="ATY43072.1"
FT                   /translation="MNQPSSRSGLTTFTVIIIGLLALFLLIGGIWLATLGGSIYYIVAG
FT                   VLLLIVAWQLYKRASAALWVYAALMLGTIIWSVWEVGTDFWALAPRLDILGILGLWLLV
FT                   PAVTRGINNLGSSKVALSSTLAIAIVLMVYSIFNDPQEINGEIKTPQPETAQAVPGVAE
FT                   SDWPAYGRTQAGERYSPLKQINDQNVKDLKVAWTFRTGDFKTDNDSGETTNQVTPIKIG
FT                   NNMFICTAHQQLIAIDPATGKEKWRFDPKLKTDKSFQHLTCRGVMYYDANNTTEFATSL
FT                   QTKKSTSTQCPRKVFVPVNDGRLVAVNADTGKACTDFGQNGEVNLQEFMPYAYPGGYNP
FT                   TSPGVVTGSTVVIAGSVTDNYSNKEPSGVIRGYDVNTGKLLWVFDTGAADPNAMPGEGT
FT                   TFVHNSPNAWAPLAYDAKLDIVYVPTGVGTPDIWGGDRTELKERYANSMLAINASTGKL
FT                   IWNFQTTHHDLWDMDVPSQPSLADIKDKSGKTVPAIYVLTKTGNAFVLDRRNGQPIVPV
FT                   TEKPVPQTVKRGPQTKGEHYSKTQPFSDLNLAPQDKLTDKDMWGATMLDQLMCRVSFKR
FT                   LNYDGIYTPPSENGTLVFPGNLGVFEWGGMSVNPDRQVAVMNPIGLPFVSRLIPADPNR
FT                   AQTAKGAGTEQGVQPMYGVPYGVEISAFLSPLGLPCKQPAWGYVAGVDLKTHEVVWKKR
FT                   IGTIRDSLPNLFQLPAVKIGVPGLGGSISTAGNVMFVGATQDNYIRAFNVTNGEKLWEA
FT                   RLPAGGQATPMTYEINGKQYVVIMAGGHGSFGTKMGDYLVAYALPDNK"
FT   gene            647302..648945
FT                   /gene="sir"
FT                   /locus_tag="ABBFA_00616"
FT                   /old_locus_tag="CTY05_00616"
FT   CDS_pept        647302..648945
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sir"
FT                   /locus_tag="ABBFA_00616"
FT                   /old_locus_tag="CTY05_00616"
FT                   /product="Sulfite reductase [ferredoxin]"
FT                   /EC_number="1.8.7.1"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:P71753"
FT                   /protein_id="ATY43073.1"
FT                   /translation="MYLYTDFDQQLINQRVAQFRDQTERYLAGKLSEDEYRPLRLQNGL
FT                   YVQRYAPMLRIAVPYGLMNSKQLRKIAEVSTQYDRGYAHVSTRQNIQLNWPALEDVPEI
FT                   LAELATVQMHAIQTSGNCIRNTTTDQYAGVVAGEIADPRPTCELIRQWSTFHPEFAFLP
FT                   RKFKIAVSALEEKDRAATAFHDIGVYIVRNEAGEMGYKIMVGGGLGRTPIIGSVIREFL
FT                   PREDLIAYLEAVLRVYNLHGRRDNKYKARIKILVKALTPEVFAQKVEAEFEHTRETLKI
FT                   QPEILKKLDEEFTPFDYQDLEDEDFTALFAEHPKFKQWFNINTHAHKVKGYRIVTISLK
FT                   RAGIAPGDMTTEEMNFIADLADKYTFGELRTTHEQNIALADVPQKDLFDVWQALEQHNM
FT                   ARAHIGFITDIISCPGGDFCSLANAKSIPIAEAITRRFEDLDKVYDLGHLDLNISGCMN
FT                   ACGHHHVGNIGILGVDKKGAEFYQITLGGNSDHDASIGDILGPSFAAEAVPDVIEEVLN
FT                   TYLDLRIEGERFVDTYRRVGIQPFKERAYA"
FT   gene            648938..649423
FT                   /locus_tag="ABBFA_00617"
FT                   /old_locus_tag="CTY05_00617"
FT   CDS_pept        648938..649423
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABBFA_00617"
FT                   /old_locus_tag="CTY05_00617"
FT                   /product="hypothetical protein"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /protein_id="ATY43074.1"
FT                   /translation="MLNTALPVLYKDGTIADNTYQIIAEDGVIPQGDVVLTTAQLDQLA
FT                   NIQGKKALYVTVNDSPEDHTFPLSELDAIFIEFAGFGDGRGYSFAALLRRQGFQGELRA
FT                   TGDVFKDVLNYLKRSGFDSFVIKEGKDVQEAAAGLQDFTHPYQASTAVPKASYQTGA"
FT   gene            649506..649859
FT                   /gene="emrE_1"
FT                   /locus_tag="ABBFA_00618"
FT                   /old_locus_tag="CTY05_00618"
FT   CDS_pept        649506..649859
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="emrE_1"
FT                   /locus_tag="ABBFA_00618"
FT                   /old_locus_tag="CTY05_00618"
FT                   /product="Multidrug transporter EmrE"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:P23895"
FT                   /protein_id="ATY43075.1"
FT                   /translation="MFALISKINPGAWWLIFAIATDVLSTFYSAKGNGLVNKTAQGIAL
FT                   VLYIISFACAAIALKYMQAGILYVLWSGVGVLATAFLAKIFLGQNIDVAGWIGIGFITV
FT                   GLMIIAQYSNIDV"
FT   gene            complement(649902..650345)
FT                   /locus_tag="ABBFA_00619"
FT                   /old_locus_tag="CTY05_00619"
FT   CDS_pept        complement(649902..650345)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABBFA_00619"
FT                   /old_locus_tag="CTY05_00619"
FT                   /product="hypothetical protein"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="protein motif:CLUSTERS:PRK10148"
FT                   /protein_id="ATY43076.1"
FT                   /translation="MQLNHYLNFQSQAEQAFNFYKSVFGGEFAMLSRYSDMPPHDGVTL
FT                   SEAQKNLVLHVSLPINEYTVLMASDVIDQFCTPNSVFTQGNNHYIAINLEKDEQEKAKQ
FT                   LFDALSVNGKIEMPLEKTFWGALYGAFTDQFGVKWMVNCQLDT"
FT   gene            complement(650472..651647)
FT                   /gene="thlA_1"
FT                   /locus_tag="ABBFA_00620"
FT                   /old_locus_tag="CTY05_00620"
FT   CDS_pept        complement(650472..651647)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thlA_1"
FT                   /locus_tag="ABBFA_00620"
FT                   /old_locus_tag="CTY05_00620"
FT                   /product="Acetyl-CoA acetyltransferase"
FT                   /EC_number="2.3.1.9"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:P45359"
FT                   /protein_id="ATY43077.1"
FT                   /translation="MTDIVIVNGARTAMGGFQGSLSGLTAPELGAVTIKEAIARAGLQP
FT                   TDVEEVIMGCVLPAGLKQGPARQAMRKAGLPDSTGAVTINKLCGSGMKAVMQAADMIKA
FT                   GSAEIVVAGGMESMTNAPYVLPKARAGYRMGHGEIKDHMFFDGLEDAETGRLMGSFAQD
FT                   MANTRGYTREQMDDFAIRSLKRAQTAITEGYFKDEIVPVTVSTRKGDVIVDQDEQPLNA
FT                   KIDKIPSLKPAFAKDGTITAANASSISDGASALVLTSSEVAAQRGLQPLAKIIATASNS
FT                   QHPSEFTIAPVGAIEKVLKKAGWNAQDVDLWEINEAFAMVTMCPIDDFKLDPEKVNIHG
FT                   GACALGHPVGSTGSRIILTLIHALKRTGGKKGVAALCIGGGEATAVAIEIL"
FT   gene            complement(651756..652271)
FT                   /locus_tag="ABBFA_00621"
FT                   /old_locus_tag="CTY05_00621"
FT   CDS_pept        complement(651756..652271)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABBFA_00621"
FT                   /old_locus_tag="CTY05_00621"
FT                   /product="Type II transport protein GspH"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="protein motif:Pfam:PF12019.2"
FT                   /protein_id="ATY43078.1"
FT                   /translation="MFKSPGFTIVELTITLVILVIMSVIAIPLYHQFMASVELKNTPRI
FT                   LTIHIQKAKYDAIIRHKNVVLCPSSDQLVCNTNWDNRVISFVDNNRNLQHDLNEELLTS
FT                   IDLNHHYGSMKLQRFGKKQNSIIFQGSSGLPIESNGSFIYCSYDQLKNFKLILSKMGHV
FT                   RLEELKNC"
FT   gene            652651..653712
FT                   /locus_tag="ABBFA_00622"
FT                   /old_locus_tag="CTY05_00622"
FT   CDS_pept        652651..653712
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABBFA_00622"
FT                   /old_locus_tag="CTY05_00622"
FT                   /product="Outer membrane protein Omp38 precursor"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:Q6RYW5"
FT                   /protein_id="ATY43079.1"
FT                   /translation="MKLSRIALATMLVAAPLAAANAGVTVTPLLLGYTFQDTQHNNGGK
FT                   DGELTNGPELQDDLFVGAALGIELTPWLGFEAEYNQVKGDVDGLAAGAEYKQKQINGNF
FT                   YVTSDLITKNYDSKIKPYVLLGAGHYKYEIPDLSYHNDEEGTLGNAGVGAFWRLNDALS
FT                   LRTEARGTYNFDEKFWNYTALAGLNVVLGGHLKPAAPVVEVAPVEPTPVAPQPQELTED
FT                   LNMELRVFFDTNKSNIKDQYKPEIAKVAEKLSEYPNATARIEGHTDNTGPRKLNERLSL
FT                   ARANSVKSALVNEYNVDASRLSTQGFAWDQPIADNKTKEGRAMNRRVFATITGSRTVVV
FT                   QPGQEAAAPAAAQ"
FT   gene            complement(653835..653993)
FT                   /locus_tag="ABBFA_00623"
FT                   /old_locus_tag="CTY05_00623"
FT   CDS_pept        complement(653835..653993)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABBFA_00623"
FT                   /old_locus_tag="CTY05_00623"
FT                   /product="hypothetical protein"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /protein_id="ATY43080.1"
FT                   /translation="MKIKEMPKIKVRNQVALSPLLHKGGMHETEKPRAQHRRNRQDTKQ
FT                   QLKKGVW"
FT   gene            complement(653997..655202)
FT                   /gene="rtcB"
FT                   /locus_tag="ABBFA_00624"
FT                   /old_locus_tag="CTY05_00624"
FT   CDS_pept        complement(653997..655202)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rtcB"
FT                   /locus_tag="ABBFA_00624"
FT                   /old_locus_tag="CTY05_00624"
FT                   /product="RNA-splicing ligase RtcB"
FT                   /EC_number="6.5.1.-"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:P46850"
FT                   /protein_id="ATY43081.1"
FT                   /translation="MGIQKILNEEAQYGVPVKIFTQDIDSESIEQLKKMAQLRFIYSHI
FT                   AVMPDVHVGKGATVGSVIPTKHAIIPAAVGVDIGCGMNAIRLSLKASQLPDNLSRLRDA
FT                   IERKVPVGFALHKQVKAKASSIIPLEKRLEPIIKKHPGLVRMLRQFEATWQKQLGTLGG
FT                   GNHFIELCIDENQDVWVMLHSGSRGLGNVIGTYFIELAKKEAQHRFGHVPDKDLSYFAE
FT                   GSQSFNDYVEAVEWAQEYAFENRKEMMRLILEAIRPLLPSFQMTKEAINCHHNYVSQET
FT                   HFGENLFVTRKGAIRAGLDELGIIPGSMGARSYIVKGKANPESFCSCSHGAGRKMSRSK
FT                   AKVLFNQQDLIEQTQGIECRKDSGVVDEIPSAYKDIDEVIANQADLIEVVHTLKQVLCI
FT                   KG"
FT   gene            complement(655480..656940)
FT                   /gene="lysP"
FT                   /locus_tag="ABBFA_00625"
FT                   /old_locus_tag="CTY05_00625"
FT   CDS_pept        complement(655480..656940)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lysP"
FT                   /locus_tag="ABBFA_00625"
FT                   /old_locus_tag="CTY05_00625"
FT                   /product="Lysine-specific permease"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:P25737"
FT                   /protein_id="ATY43082.1"
FT                   /translation="MSETHAPEKLQRKLGARHLNMIAIGGSIGTGLFLASGSTIANAGP
FT                   GGALLAYSLIGIMIYFLMTSLGELATHTPTSGAFFTYGSRYVEEGFGFALGWNYWYNWA
FT                   ITVAFELVAVQFIMKFWFPDVPGFYWSALFLVIIFMINAMTVKGFGESEFWFSMVKVIA
FT                   IVAFIIIGIAMIIKIMLTPGVATFGNWTYKEAPFVGGLQAMIGVAMIAGFSFQGTEMVG
FT                   VAAGESKDPKKTIPLAIKQIFWRILLFYILCIFIIGTLIAYDDPNLLQAAATENIALSP
FT                   FTLLYEKVGFAFAASLMNAVILTAILSAGNSGMYSSTRMLFDMAQQGRAPKWFAKLDSR
FT                   GVPMNALYATTFIAAFCFLTTFIGEKQVFNWLLNMSGMCGFIVWLGIAISHYRFRKGYI
FT                   AQGYKLEDLAYRAKFFPFAPWFAFILCSVIILGQNYQAVLGGKIDWIGLLSTYISLPLF
FT                   LVIWLGYKWKNKTKLIPYDQMDVKPEQD"
FT   gene            complement(656962..657975)
FT                   /gene="rsmC"
FT                   /locus_tag="ABBFA_00626"
FT                   /old_locus_tag="CTY05_00626"
FT   CDS_pept        complement(656962..657975)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rsmC"
FT                   /locus_tag="ABBFA_00626"
FT                   /old_locus_tag="CTY05_00626"
FT                   /product="Ribosomal RNA small subunit methyltransferase C"
FT                   /EC_number="2.1.1.172"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:P39406"
FT                   /protein_id="ATY43083.1"
FT                   /translation="MDPRSEVILRQQDYLKGRVLLINAPNDALVSQLPTEIDASVWTWN
FT                   YADYQGFVNTGTPAHFSVEFPSQEFDQAIIFVPKSKELLNYILHVVMSHLKTDQSVFLV
FT                   GEKKGGVERAAKQLQNFGTILKLDSARHCQLWHLKIEKIEKIKPLESWLKTYTVQVNGQ
FT                   ELTICALPGVFSQTHLDVGTAVLLPYLNQVKSGRIADFGCGAGIISCYLAKANSSNIIH
FT                   ALDIDAFALQSTEMTFSRNGIGSDQLRLQPVTGIADAPTELDAIVSNPPFHQGIHTNYD
FT                   ASEGLCQNAKKHLKASGELWIVANRFLNYPILIEKHFGQCEIKTDLQGFKVLYACA"
FT   gene            complement(658038..659396)
FT                   /gene="xanP"
FT                   /locus_tag="ABBFA_00627"
FT                   /old_locus_tag="CTY05_00627"
FT   CDS_pept        complement(658038..659396)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="xanP"
FT                   /locus_tag="ABBFA_00627"
FT                   /old_locus_tag="CTY05_00627"
FT                   /product="Xanthine permease XanP"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:P0AGM9"
FT                   /protein_id="ATY43084.1"
FT                   /translation="MSNQPSQDRLDLVYGLDDRPKPFVAFLAAFQHLLAIIVPIVTPGL
FT                   LICLALGVPRNETNMILSMSLVISGIATFLQCKKVGPFGAGLLIVQGTSFNFIGPIIGI
FT                   GSAMVAAGTPVNQVMAAIFGVVIAGSFIEMGVSQILPWVKKLITPLVTGIVVLLIGLTL
FT                   IKEGLISMGGGYQAMQDHTFASADNLIMSCTVLAIIIVLNRIRIVWIKSSAILIALVIG
FT                   YILAGFMGYLDFSGLKDAPVIQIPTPMHFGLSFSWGLFIPMAFIYLVTSLEAIGDVTAT
FT                   SKLSNQPVDGPQWMQRIKGGVLVNGANSLLAGLFNTFPSSVFAQNNGVIQLTGVASRYV
FT                   GIWIAALLILLGLFPAVAGVIQAVPQAVLGGAVMVMFGAVAASGINILSSIHLDRRALL
FT                   IIAISLALGLGVAQVPQILEHLPELFKNIFSSGVATGGIAALILNVVLPETHK"
FT   gene            659575..661410
FT                   /gene="typA"
FT                   /locus_tag="ABBFA_00628"
FT                   /old_locus_tag="CTY05_00628"
FT   CDS_pept        659575..661410
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="typA"
FT                   /locus_tag="ABBFA_00628"
FT                   /old_locus_tag="CTY05_00628"
FT                   /product="GTP-binding protein TypA/BipA"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:P32132"
FT                   /protein_id="ATY43085.1"
FT                   /translation="MSDIKNLRNIAIIAHVDHGKTTLVDKLLQQSGALGDRAGEIERVM
FT                   DSNALESERGITILAKNTAITWLDKRTDTTYRINIVDTPGHADFGGEVERVMSMVDCVL
FT                   LLVDSQEGPMPQTRFVTQKAFARGLKPIVIINKVDKPSARPDWVIDQVFDLFDNLGATD
FT                   EQLDFPIVYASGLRGVAGPAPEELAEDMTPLFETIVDIVEPPAVDVDGPFQMQISSLDY
FT                   NSFVGVIGVGRIQRGSVKLNTPVTVIDKEGNTRNGRILKIMGYHGLERIDVDSASAGDI
FT                   VCITGIDALNISDTICDPKNVEALPPLSVDEPTVSMTFQVNNSPFAGKEGKFVTSRNIR
FT                   ERLDRELIHNVALRVEDTDSPDRFKVSGRGELHLSVLIENMRREGFELGVSRPQVIIKE
FT                   IDGEKQEPYENVTFDVEEQHQGAVMEQMGHRKGEMTNMEVDGKGRIRIEATVPSRGLIG
FT                   FRSEFLTMTSGTGIMTSSFSHYGPLKQGTVAKRQNGVLISMVQGTCLGYALFSLQDRGR
FT                   LFAKPQLEVYEGMIVGINSRSDDMVVNPTKAKQLTNVRASGTDDALTLTPAIEFTLEQA
FT                   LEFIEDDELVEVTPKSIRIRKRYLTENERKRNRDK"
FT   gene            661666..662097
FT                   /gene="mscL"
FT                   /locus_tag="ABBFA_00629"
FT                   /old_locus_tag="CTY05_00629"
FT   CDS_pept        661666..662097
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mscL"
FT                   /locus_tag="ABBFA_00629"
FT                   /old_locus_tag="CTY05_00629"
FT                   /product="Large-conductance mechanosensitive channel"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:P0A742"
FT                   /protein_id="ATY43086.1"
FT                   /translation="MSIIQEFKEFAIKGNMMDLAIGVIIGGAFGKIVDSLVKDIIMPLI
FT                   TVITGGGVDFSQKFIVLGANPNNLQSLDALQKAGINVLTYGNFLTILINFLILAWVVFL
FT                   MVKLLNKLRRDKNEPEAPAATPEDIQLLREIRDELKKQA"
FT   gene            662240..662593
FT                   /locus_tag="ABBFA_00630"
FT                   /old_locus_tag="CTY05_00630"
FT   CDS_pept        662240..662593
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABBFA_00630"
FT                   /old_locus_tag="CTY05_00630"
FT                   /product="AIG2-like family protein"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="protein motif:Pfam:PF06094.1"
FT                   /protein_id="ATY43087.1"
FT                   /translation="MNQLFVYGTLCPNKANAHILEQIGGNWTKASVRGVIHILDWGPDK
FT                   GLKALELDPEADWVEGYLFSTEKLAENWQMLDDFEGFQYQRVTADIKLESGEYVKAWTY
FT                   QINMQAKASHSYK"
FT   gene            complement(662604..662894)
FT                   /gene="ppiC"
FT                   /locus_tag="ABBFA_00631"
FT                   /old_locus_tag="CTY05_00631"
FT   CDS_pept        complement(662604..662894)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ppiC"
FT                   /locus_tag="ABBFA_00631"
FT                   /old_locus_tag="CTY05_00631"
FT                   /product="Peptidyl-prolyl cis-trans isomerase C"
FT                   /EC_number="5.2.1.8"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:P0A9L5"
FT                   /protein_id="ATY43088.1"
FT                   /translation="MQTAIVRHILVKDKDLAEQLKKKLQSGADFAKLAKQYSTCNSAKR
FT                   GGELGEVKKGQLVPVIDKVVFTAAERVLQGPIKSQFGYHLLEVKFRMTGLR"
FT   gene            complement(662914..663738)
FT                   /gene="mutM"
FT                   /locus_tag="ABBFA_00632"
FT                   /old_locus_tag="CTY05_00632"
FT   CDS_pept        complement(662914..663738)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mutM"
FT                   /locus_tag="ABBFA_00632"
FT                   /old_locus_tag="CTY05_00632"
FT                   /product="Formamidopyrimidine-DNA glycosylase"
FT                   /EC_number="3.2.2.23"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:P05523"
FT                   /protein_id="ATY43089.1"
FT                   /translation="MPELPEVETTKTSLFPLLNQKVLSVEVRNPSLRWPIPDNVQKLVG
FT                   QRLIGLNRRSKYILAEFEQDQMLWHLGMSGSFRLCQPNDELRKHDHLIIQFEDQQLRYH
FT                   DPRRFGCILWLNPETQGKLIDTLGPEPLNTDFHAEYLASKLKNKSVGIKIALMDNHVVV
FT                   GVGNIYATESLFNVGIHPAQPAGDLTLQQIEKLVVEIKRILKSAIDLGGSTLRDYSNAM
FT                   GENGYFQQTLLAYGRAGEMCVNCETTLENLKLGQRASVFCPQCQPLKKLRKP"
FT   gene            663814..664380
FT                   /locus_tag="ABBFA_00633"
FT                   /old_locus_tag="CTY05_00633"
FT   CDS_pept        663814..664380
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABBFA_00633"
FT                   /old_locus_tag="CTY05_00633"
FT                   /product="3-methyladenine DNA glycosylase"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="protein motif:CLUSTERS:PRK00802"
FT                   /protein_id="ATY43090.1"
FT                   /translation="MSDILPLSWFQRETSEVAYDLIGCVLCKRQPDGQVIRCTISETEA
FT                   YLGVRDKACHSYNDKRTARTEVMYRHGGTIYVYLIYGMYEMLNIITQTEGVPEGVMIRS
FT                   AFLNSASTKKEYKLLAGPGKLTRYLGIDRTLKGQTLGEESGLWIEAATTQPEVVLTPRI
FT                   GIDYAEEAKDWPERYCWKDHPSLSR"
FT   gene            664513..666717
FT                   /gene="iutA_1"
FT                   /locus_tag="ABBFA_00634"
FT                   /old_locus_tag="CTY05_00634"
FT   CDS_pept        664513..666717
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="iutA_1"
FT                   /locus_tag="ABBFA_00634"
FT                   /old_locus_tag="CTY05_00634"
FT                   /product="Ferric aerobactin receptor precursor"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:Q6U607"
FT                   /protein_id="ATY43091.1"
FT                   /translation="MSLLRLDRLHYCILMSMGCISSPLVWAEDLNSDVAKLPTLHVEAT
FT                   RTDTGYLQTPASVFRIEAPQVDSSSQVNLTEVVKGIPSLQIRNRENYAQDLQLSMRGFG
FT                   ARSTFGVRGIRLYVDGIPATMPDGQGQTSNIDLSSLDHVEVLTGPFSSLYGNSSGGTIL
FT                   TSTKEGQGKDSIELSYSGGSHDKSRAGLVLQGGAKGANEPSYIISSSYFDTDGYREHSG
FT                   AEKVLNNAKLSWNLDDGSKINWVTNYVKIHADDPMGLERKDWQANPKQIAPYVKKWGFN
FT                   ARKDIEQTQTGITWFKPINDQHELYAMAYLGNRQVTQYQSIPQGQVVVENGKPVYTGQK
FT                   SPKHAGGVIDFERNYYGADFRWTGKELLPNTTVSIGVAFDAMDEERKGFENFNADGIYG
FT                   VKGNLRRDEDNTLWNIDPYLQASWQFLPTWRLDTGVRYSNVHYKSKDHFTSGPDEYGTV
FT                   NGDDSGKTDYEKVLPSAALSWQILPELMAYVSYAKGFETPTFTEMAYHTDISKSGFNFG
FT                   LKPSTSDTYETGLKSQNLLGDFTLAVFQTKTKNDIVSAGNLGGRSTFRNADKTLREGVE
FT                   FAWNKKLWRDLTATASYTYLDATFDANVPEKLDQDNKVLASAIPTGNAIPGIAKNQAYA
FT                   SLAWQPSHGLYGGVDVQYMDKVYVNDTNSDAAPSYSVTSANVGYAWVMGDWKVNSFARV
FT                   DNLFDKKYAGSVIVNDGNSRYFEPADGRNWSAGLRVIKQF"
FT   gene            666727..667833
FT                   /gene="namA"
FT                   /locus_tag="ABBFA_00635"
FT                   /old_locus_tag="CTY05_00635"
FT   CDS_pept        666727..667833
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="namA"
FT                   /locus_tag="ABBFA_00635"
FT                   /old_locus_tag="CTY05_00635"
FT                   /product="NADPH dehydrogenase"
FT                   /EC_number="1.6.99.1"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:P54550"
FT                   /protein_id="ATY43092.1"
FT                   /translation="MAKLFETVNFDSLQLVNRIVIAPMCQYSATDEGEITYWHEQQWAN
FT                   YALSGAGLCIVEATAVQAEGRISYADLGLWNDQQRDQIKTLLGKVKTLSPMPFGIQLAH
FT                   AGRKASTEKPWLGKGQIAKDQPHGWQTVAPSTSTFSVHDAAPHALTIAEIKQIQQDFAA
FT                   AAKRAVEAGFELIEVHAAHGYLLHQFLSPIANQRTDEYGGSLENRMRMTLEVLQAIKLA
FT                   VPEGYPVGVRLSATDWMDGNEQWDIESTVGLSKALEQLGAAYIHVSSGGLHEHQNITIG
FT                   AGYQVPFAEQVKKHVAIPVIAVGLITDPQHAEQILENQADAIGLARAMLYDPRWPWHAA
FT                   ATLGAKVKIAPQYLRCQPHGLKQLFDSF"
FT   gene            667899..668822
FT                   /locus_tag="ABBFA_00636"
FT                   /old_locus_tag="CTY05_00636"
FT   CDS_pept        667899..668822
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABBFA_00636"
FT                   /old_locus_tag="CTY05_00636"
FT                   /product="putative transporter YfdV"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="protein motif:CLUSTERS:PRK09903"
FT                   /protein_id="ATY43093.1"
FT                   /translation="MVFQVILPILILLLMGYCSVLIKLVTPEQIKALSAFVIKISLPAF
FT                   LIQSLANKNLQDIWHPAYFIAYGGGSLILFFGAFILYRKYFKNSLTHSAVISMGASMSN
FT                   TGFMGTAILTMLMGSHAAIYISLTLIIENLLIVALMLILAEAGLHQQQRLLPLLKKTFI
FT                   NLLKNPVIIAILVGMSCILLDIHLPSKLGQALELLGRTASPLALFAIGGSLVGIGITAV
FT                   NFQSILLAGFNVILMPVVIFGLFLLLPNVSQEMLYAGTLLAALPMPIAFGIFGQAYGLN
FT                   ERALTPLMISTIIGFMGVSGLIALWW"
FT   gene            complement(668857..669681)
FT                   /locus_tag="ABBFA_00637"
FT                   /old_locus_tag="CTY05_00637"
FT   CDS_pept        complement(668857..669681)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABBFA_00637"
FT                   /old_locus_tag="CTY05_00637"
FT                   /product="Sel1 repeat protein"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="protein motif:Pfam:PF08238.6"
FT                   /protein_id="ATY43094.1"
FT                   /translation="MKKLLIASLIAISSSSIFAADTTTSAAKNDVFKQAEQLYAAKNYP
FT                   AAFQEVQRLAQTGNAQAIYNLGYMTQMGQGTAKDNAKALKYYENASNKGYAQASYTLAQ
FT                   IYETGELGVAKDSNKFSQYIQKAAAQGSDDATVKIATILFAQKKPQSHQIALQKLAPLI
FT                   RKGNYPAIQVKALYDISQGVENKNPLMKRQGIEALQTIAQKGYAPASMALATMMANGNI
FT                   IPQNLPQAKQIFTELAKQNVPNARESLASVEKIIAEKNKQAAAAPTQPAPKK"
FT   gene            complement(669864..670574)
FT                   /gene="dsbC_1"
FT                   /locus_tag="ABBFA_00638"
FT                   /old_locus_tag="CTY05_00638"
FT   CDS_pept        complement(669864..670574)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dsbC_1"
FT                   /locus_tag="ABBFA_00638"
FT                   /old_locus_tag="CTY05_00638"
FT                   /product="putative thiol:disulfide interchange protein DsbC
FT                   precursor"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:Q7VU58"
FT                   /protein_id="ATY43095.1"
FT                   /translation="MKTKLATLMLSLAFFGSAHADVKTLEQNLKTNYPDLPVKGVYQSP
FT                   VAGIYEVYTSGRIVYTNQDAKYFFVGNLVDIKQQKNMTEERIAELGKIDVKSLPLNQAI
FT                   KYVKGKGERTLYIFSDPDCPYCQRLEQNMVGVDNVTVYIFLYPLTSLHPNAEKVSNQIW
FT                   CSKNPSEAWTNYMLNRKLPAASKSCTSPIQKNIALGQKLNIDGTPTLFLQDGQRISGVP
FT                   SDAKQIEALLQSVK"
FT   gene            complement(670720..671442)
FT                   /gene="ygfZ"
FT                   /locus_tag="ABBFA_00639"
FT                   /old_locus_tag="CTY05_00639"
FT   CDS_pept        complement(670720..671442)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ygfZ"
FT                   /locus_tag="ABBFA_00639"
FT                   /old_locus_tag="CTY05_00639"
FT                   /product="tRNA-modifying protein YgfZ"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:P0ADE8"
FT                   /protein_id="ATY43096.1"
FT                   /translation="MSLLAFSSYALNGVDAQKFLQGQVTVDTERLAENETRYTAICDLK
FT                   GRIHFGLWLKKNNAESFDIIVTQDQAEELAKHIKKYGAFSKMTLSEQGAVFPKVVNGHT
FT                   EFSSTETDISEWQKQAIMTGQAWIAQATEHEFQPQELRLHQREGVNYDKGCYLGQEIVA
FT                   RLWFKAKPKHWLHLVQGTGDAPAPATQLHNDVEVVNSTQTTDGYIALVVAKPAALQELG
FT                   LQVLDLPEALSGDVARPQ"
FT   gene            671659..672108
FT                   /locus_tag="ABBFA_00640"
FT                   /old_locus_tag="CTY05_00640"
FT   CDS_pept        671659..672108
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABBFA_00640"
FT                   /old_locus_tag="CTY05_00640"
FT                   /product="hypothetical protein"
FT                   /note="Activator of Hsp90 ATPase homolog 1-like protein"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="protein motif:Pfam:PF08327.5"
FT                   /protein_id="ATY43097.1"
FT                   /translation="MATGTVKLHRVFKAPAERVYRAFLDPDALVKWMAPHGFTAKVHSF
FT                   DAKVGGSYKMSFTNFSTGSTHSFGGTYVELVPNELIRYNDQFDDANLPGTMQVTITLKT
FT                   VLVGTEIHITQEGIPEVIPVEACYLGWQESLSLLKLLVEADIPDQ"
FT   gene            672252..672608
FT                   /locus_tag="ABBFA_00641"
FT                   /old_locus_tag="CTY05_00641"
FT   CDS_pept        672252..672608
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABBFA_00641"
FT                   /old_locus_tag="CTY05_00641"
FT                   /product="hypothetical protein"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /protein_id="ATY43098.1"
FT                   /translation="MDIQIKRIYDDVSGGDGKRILVDRLWSRGISKENAHLDLWLKEIA
FT                   PSTELRKWFHAESAEHWNEFKQRYLKELETNPAVKELLEIVSHHKVTLLYSAKDVEHNH
FT                   AIILKEYLLEKSKS"
FT   gene            672699..673043
FT                   /locus_tag="ABBFA_00642"
FT                   /old_locus_tag="CTY05_00642"
FT   CDS_pept        672699..673043
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABBFA_00642"
FT                   /old_locus_tag="CTY05_00642"
FT                   /product="hypothetical protein"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="protein motif:CLUSTERS:PRK10220"
FT                   /protein_id="ATY43099.1"
FT                   /translation="MSLPNCPKCQSEYTYQDGDLLICPECSHEWKEGEALVTEEQEVIK
FT                   DANGNVLADGDSVTVIKDLKIKGSSSVVKVGTKVKSIRLVPDASDGHNIDCKIDGIGQM
FT                   KLKSEFVKKA"
FT   gene            673255..673596
FT                   /locus_tag="ABBFA_00643"
FT                   /old_locus_tag="CTY05_00643"
FT   CDS_pept        673255..673596
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABBFA_00643"
FT                   /old_locus_tag="CTY05_00643"
FT                   /product="hypothetical protein"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /protein_id="ATY43100.1"
FT                   /translation="MAGWYEITQANDGQYRFVLKAGNGEIILNSELYKAKASAVNGIES
FT                   VQKNSSDDARYDRLTAKNGKPYFNLKAANHQIIGSSQFYASEASRDKGIESVKNNGSST
FT                   TIKDLTVQA"
FT   gene            complement(673649..675364)
FT                   /gene="proS"
FT                   /locus_tag="ABBFA_00644"
FT                   /old_locus_tag="CTY05_00644"
FT   CDS_pept        complement(673649..675364)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="proS"
FT                   /locus_tag="ABBFA_00644"
FT                   /old_locus_tag="CTY05_00644"
FT                   /product="Proline--tRNA ligase"
FT                   /EC_number="6.1.1.15"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:P43830"
FT                   /protein_id="ATY43101.1"
FT                   /translation="MRASRFLFATLRETPNDAEVISHQLMLRAGMIRKLASGLYTWLPM
FT                   GTRVLKKVDAIVREEMNRSGAMEVFMPVTQPASLWEESGRYEQYGPELLRFKDRHDNPF
FT                   VLGPTHEEVITDLARNELKSYKQLPVNFYQIQTKFRDEIRPRFGVMRSREFIMKDAYSF
FT                   HATQESLQETYDVMYDTYSRIFTRLGLDFRPVQADTGSIGGSASHEFHVLAASGEDDIA
FT                   FSTESDYAANVEMAEAVLVGERAAPTQEFKLVETPNQKTIADVCQFLNADPKQSVKALL
FT                   VQGVADEKGNVPVVALFLRGDHELNEIKAEKHPLVAAPLAFATEEQLQAFGLTAGFTGP
FT                   QGLVEKGITVIVDRAASVLSDFVAGANEADKHAIGVNWERDAQITEVFDLRNVVEGDPS
FT                   PDGKGTLQIKRGIEVGHIFQLGTKYSEALGCKVLGEDGKPFTVTMGCYGIGVTRVVAAA
FT                   IEQNYDDKGIIWPQAIAPFEIAIVPMNAHKSPRTLEAAEALYAELQAQGFDVLLDDRNE
FT                   RPGVKFSDLELMGIPHRIVIGEKGLDAGTFEYKGRRDAEASNLTKEELLAKLAR"
FT   gene            complement(675423..678521)
FT                   /gene="mdtC"
FT                   /locus_tag="ABBFA_00645"
FT                   /old_locus_tag="CTY05_00645"
FT   CDS_pept        complement(675423..678521)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mdtC"
FT                   /locus_tag="ABBFA_00645"
FT                   /old_locus_tag="CTY05_00645"
FT                   /product="Multidrug resistance protein MdtC"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:B7UTB4"
FT                   /protein_id="ATY43102.1"
FT                   /translation="MWFTRISVKYPVFTIMMMLSLMVLGLASWKRMTVEEFPNIDFPFV
FT                   VVTTQYAGASPEAVESDITKKLEDQINTISGIKQITSRSSEGLSMVIAEFNLDTSSAIA
FT                   AQDVRDKIAPVIAQFRDEIDTPIVQRYDPSSSPIMSVVFESNSMSLAQLSSYVDKKIVP
FT                   QLKTVSGVGNVNLLGDAKRQIRIKVHPEQLQSYGIGIDQVINTLKNENIEVPAGTLQQK
FT                   NSELVVQIQSKVIHPLGFGDLVIANKNGSPIFLKQVATVEDTQAELQSSAFYNGRTAVS
FT                   VDILKSSDANVIQVVDKTYQTLEKLKAQMPAGLNYKVVADSSKGIRASIKDVVRTIIEG
FT                   AVLAVLIVLLFLGSFRSTVITGLTLPITLLGTLTFIWAFGFSINMMTLLALSLSIGLLI
FT                   DDAIVVRENIVRHTELGKDHVTAALDGTKEIGLAVLATTLTIVAVFLPVAFMGGLIGRF
FT                   FYQFGVTVSTAVLISMFISFTLDPMLSAHWKDPVKKKESRLQRFFNYISNLLDGLTHIY
FT                   EKLLKLALRFRFITVIIAIVSLVVALGLSKMIGTEFVPTPDKGEIRIQFETPVDSSLEY
FT                   TQAKLHQVDQIIRQFPDVVSTYGVVNSEVDSGKNHAGLGVTLKPKQERSADLTTLNNEF
FT                   RDRLQSVAGIRVTSVAAAQDSVSGGQKPIMISIKGSDLNELQKISDRFMTEMEKIDGVV
FT                   DLESSLKEPKPTLGVHINRVLASDLGLSVSQIANAIRPLIAGDNVTTWEDRDGETYDVN
FT                   IRLNENKRVLPQDVQNLYLNSNKTNANGQNILVPLSAVATTQEKLGASQINRRDLEREV
FT                   LIEANTSGRPSGDIGQDIDKMQKAFKLPAGYTFDTQGANADMAESAGYALTAITLSIVF
FT                   IYIVLGSQFNSFIHPAAIMASLPLSLIGVFLALFLFRSTLNLFSIIGIIMLMGLVTKNA
FT                   ILLIDFIKKAMEDGISRYDAILQAGKTRLRPILMTTSAMVMGMVPLALGLGEGGEQSAP
FT                   MAHAVIGGVITSTLLTLVVVPVIFTYLDDLKNFMLRQTRRFMS"
FT   gene            complement(678537..679655)
FT                   /gene="cnrB"
FT                   /locus_tag="ABBFA_00646"
FT                   /old_locus_tag="CTY05_00646"
FT   CDS_pept        complement(678537..679655)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cnrB"
FT                   /locus_tag="ABBFA_00646"
FT                   /old_locus_tag="CTY05_00646"
FT                   /product="Nickel and cobalt resistance protein CnrB"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:P37973"
FT                   /protein_id="ATY43103.1"
FT                   /translation="MRTTHLTPSTFFKLSLISLSLILAACNQQEVPKTTASEPKKIELI
FT                   PQDLIPVKEGSLAAQTAFTGTIRAVQQSSIQAQVSATATAVTANVGQKVQKGQVLVRLN
FT                   NQDNAARLAQAQANLASAQAQAELARNLMNRKQRLLNQGFIARVEFEQSQVDYKGQLES
FT                   VRAQQANVDIAKKADRDGIITSPISGVVTKRQVEPGQTVSVGQTLFEIVNPDQLEIQAK
FT                   LPIEQQSALKVGSSIQYQIQGNSKQLHAILTRISPVADQDSRQIEFFASPKEAIDSLSI
FT                   GAFINGIILHNDSNQGQTIPLDSIQNLQHDPFVWVIRNQTIQKVKIRVVEQRYNENIAL
FT                   VQGLQSTDQVSRIQFEDSDINKKVTLTTEKNK"
FT   gene            complement(679715..680353)
FT                   /locus_tag="ABBFA_00647"
FT                   /old_locus_tag="CTY05_00647"
FT   CDS_pept        complement(679715..680353)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABBFA_00647"
FT                   /old_locus_tag="CTY05_00647"
FT                   /product="hypothetical protein"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /protein_id="ATY43104.1"
FT                   /translation="MNKRMKYAFYRNCLSVSIGITSCGALFFSSPTLAANAAPKAVWYR
FT                   YYDQHGIANISTSVTPAHIRYGYEALDQNMQVIKRNHPYNSEADLNQSSQRALSARYRE
FT                   EDNKLKRAYSNSKTATIKRDQALLAIKKQINYQQDQLSQLQQDKILFKRQEMEYFRKGE
FT                   QVPERHKTLIENNLMNINKVKQTLEILSKTYNRTNKDYENIIERLKKLE"
FT   gene            680636..681019
FT                   /gene="phoP"
FT                   /locus_tag="ABBFA_00648"
FT                   /old_locus_tag="CTY05_00648"
FT   CDS_pept        680636..681019
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phoP"
FT                   /locus_tag="ABBFA_00648"
FT                   /old_locus_tag="CTY05_00648"
FT                   /product="Alkaline phosphatase synthesis transcriptional
FT                   regulatory protein PhoP"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:P13792"
FT                   /protein_id="ATY43105.1"
FT                   /translation="MEDAFQNLKVMVIDDSKTIRRTAETLLQREGCEVITAVDGFEALS
FT                   KIAEANPDIVFVDIMMPRLDGYQTCALIKNSQNYQNIPVIMLSSKDGLFDQAKGRVVGS
FT                   DEYLTKPFSKDELLNAIRNHVSS"
FT   gene            681043..681405
FT                   /gene="pleD_2"
FT                   /locus_tag="ABBFA_00649"
FT                   /old_locus_tag="CTY05_00649"
FT   CDS_pept        681043..681405
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pleD_2"
FT                   /locus_tag="ABBFA_00649"
FT                   /old_locus_tag="CTY05_00649"
FT                   /product="Response regulator PleD"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:Q9A5I5"
FT                   /protein_id="ATY43106.1"
FT                   /translation="MARILIVDDSPTETFRFKEILTKHGYDVLEASNGADGVTLAKAEQ
FT                   PDLVLMDVVMPGVNGFQATRQITRDEDTKHIPVVIVSTKDQATDRVWGKRQGAIDYLIK
FT                   PIEEKQLIDVIKQFLN"
FT   gene            681466..682002
FT                   /gene="cheW"
FT                   /locus_tag="ABBFA_00650"
FT                   /old_locus_tag="CTY05_00650"
FT   CDS_pept        681466..682002
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cheW"
FT                   /locus_tag="ABBFA_00650"
FT                   /old_locus_tag="CTY05_00650"
FT                   /product="Chemotaxis protein CheW"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:Q56311"
FT                   /protein_id="ATY43107.1"
FT                   /translation="MAANGFIELLRLSKRGNKNYASVQNEAQRWSGIAFEMRGQYFVAP
FT                   LGEVSEVIYPPKYTPVPNTQSWVKGLANIRGRLLSVSDLAHFISGQRSSFSSTQKVLCI
FT                   SHHDQYVGLVVDQVLGIQHFNKKSFFSQSSDLEENLKEYCQGYFHQHNQHWHVFLFSRL
FT                   LQNPHYMNASTKFIN"
FT   gene            682049..684127
FT                   /gene="pctA"
FT                   /locus_tag="ABBFA_00651"
FT                   /old_locus_tag="CTY05_00651"
FT   CDS_pept        682049..684127
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pctA"
FT                   /locus_tag="ABBFA_00651"
FT                   /old_locus_tag="CTY05_00651"
FT                   /product="Methyl-accepting chemotaxis protein PctA"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:G3XD24"
FT                   /protein_id="ATY43108.1"
FT                   /translation="MGFKLKKKSGNRGATGKSSVNFIAKIQSKIEQFASLFGESEKSKP
FT                   ILYAALLCLVCALISLAYLFYNVPRHNQLIRSLGELRLLSQTISKQATEATESGSQEAI
FT                   TKLQQSKKDFDENLLEIENIHGKSTDEYQKVEKIWGEVSKNIDLISSHQRVLNQLYDTN
FT                   ISISETVPEIQAEYNLMVDQMARQGLPSSQVIIAKNQVFIAERILRSINSVLSGTDGNV
FT                   STSDFSVDIETFGTYLNAELNGNAELGVDRIADPALRESLESIKSEYDKVLKSAAATVL
FT                   KNGSQIVNVRQASSQIFSKSDVMLESLGHLSDVARKNWLTLFLGAVLILSLGGLIFSVF
FT                   KLITLRSVMDKQRVARLQEEYDRNQNAILRLLDEIADLADGDLRSYATVSEDFTGAIAD
FT                   SINFAIDQLRDLVSRIHETSQEVARYTQDTQSITNQLAEASEHQAQEIAGASTAMNEMA
FT                   QSIDQVSANASESAEVAQRSVQIASNGAQVVNRSIEGMDTIREQIQETSKRIKRLGESS
FT                   QEIGNIVSLINDIADQTNILALNAAIQASMAGEAGRGFAVVADEVQRLAERSASATKQI
FT                   ETLVKTIQTDTNEAVISMEQTTTEVVRGANLAKDAGIALDEIQKVSGDLAKLIASISDA
FT                   AKLQSASASHIATTMTVVQEITSQTTTATFDTARSVSELANMAESLRESVTDFKLPD"
FT   gene            684274..688794
FT                   /gene="cheA"
FT                   /locus_tag="ABBFA_00652"
FT                   /old_locus_tag="CTY05_00652"
FT   CDS_pept        684274..688794
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cheA"
FT                   /locus_tag="ABBFA_00652"
FT                   /old_locus_tag="CTY05_00652"
FT                   /product="Chemotaxis protein CheA"
FT                   /EC_number="2.7.13.3"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:P29072"
FT                   /protein_id="ATY43109.1"
FT                   /translation="MKEILKTLTEAMTLPEDSYSEQDAEFLEIFIEEIEEIFVDLQPLI
FT                   NKWMQSENIATLTEIRRHFHTLKGSGRMIGAKSSAELAWTVEDTLNRVINQSLQLTPTI
FT                   QSYVQLVFKFYFLKLVDNFKQKRAHTLDFKPLILLGQQLQQQQSLEPALEELLQLSNTL
FT                   TAETVTGLELDYIEQDSLAEPIIQATHTEIEINLDETLTLFMEEAEEHLATIHQFLDQE
FT                   LHQYDSYNALIRALHTLRGSSAMAQVETIFEASTKVEHLFKILLQEELSSHSEEILLLQ
FT                   EYREFVRDSLELLSRYSSSEQLEARLQQFNQSWDSYVEQHGDRTDPLMPSHGLVSQLLQ
FT                   LDVSELLDAELDFEKGIRNEFPDYLERLSEQADLLLQHTHSQAMLGLHEYTSQLKESYE
FT                   VLLDKPALLQSDYIFEIYQKAHQQLIQLFDALAAGQRVGVVKQHQSILEELKLYTQYIP
FT                   DLSNDLPQQDSTSFEPISNIEPEPEVVATVENFSDSADWAVLGQSVQQDRQYISSTQVN
FT                   RNFDADLLDIFLEEAEELLEGIDTDLNIWVGEQENFAALNNLMRYLHTLKGGANMVQAT
FT                   YLGLIAHELESIYERLIQKQLVATSDLIDFIRLVQDDLADRLQIMREQQLDYAAPYTIN
FT                   ALKRAGQNSNFQPLPVVEAFDTESEVFSEQEVISEVIIDEIPVELEPALAELETHHDQV
FT                   FDTAVTELATPVEVITSVTSQENEVAADEQDIEAVVEQTFLEEATELLEMAESLLKQWF
FT                   EQRTNRSILLQLQRAVHSLKGGARMVGLEAVQAIAYQLENAFEQFALHHFNSNIYDHLL
FT                   ESAIAWLKDAIFNHNYQHFDGLQQSLENIQFFETTIQIPSKLTRADLFSSEPVMTFIQG
FT                   DGTEPPPMMGAWEQTERLDQNNEMIRVSADLIEKMIDLSGENSINRSRIEMDLSQFSHT
FT                   LVEMELAIQRLADQLRRMEGELETQIIAKHGIEHSRYTDFDPLEMDQYSSLNQLSKSLA
FT                   ESASDLVDFKNTLSDKIRDTESLLLQQSRIQAEIQEGLMRTRLVPFSRLLPRLQRIVRQ
FT                   TSTALNRPAELFVNNTEGELDRNILERLVTPLEHMLRNAIDHGLEDRAQRQQANKPETG
FT                   RIELNIQRQGTDVVVVFSDDGQGIDVEKVRQKAFLAGLIKPEQDLEQQDILQLIFHPGL
FT                   STAEQVTQISGRGVGLDVVQSDIKSLGGHVSVESVYGQGTTFTIRVPTTVAVSDALMVK
FT                   VADQQFAIPLAQIDRIIRVSPASLEQYFESPQELFEYENKRYPLRYLSEFVGNQPIPRL
FT                   NGVMYSLPVLMIKANNGQTVALLVDQLIGSRAQIVVKPIGQQFSSIGAIAGATILGDGQ
FT                   VCLILDGQNIARQIQSTQRHKQLSEAVYRQREFDERRLIMIVDDSVTVRKVTSRLLERQ
FT                   GYDVVTAKDGVDAIEQLENIKPDLMLLDIEMPRMDGFEVLNLVRHHDMHQYMPIIMITS
FT                   RTGEKHRERAFLLGVSQYMGKPFQEEELLENIDALLVASDSEVKS"
FT   gene            688791..689255
FT                   /locus_tag="ABBFA_00653"
FT                   /old_locus_tag="CTY05_00653"
FT   CDS_pept        688791..689255
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABBFA_00653"
FT                   /old_locus_tag="CTY05_00653"
FT                   /product="hypothetical protein"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /protein_id="ATY43110.1"
FT                   /translation="MKGSVNTSLIANMDQQELQHLITVSTGFIDAYIIECNDQIPMLLP
FT                   QNIVLSAMDVKNGVKHIEWHDVKLPVYSVHNAIDQHTVALVIEGEDISQRFALICKTMP
FT                   VSTRLRISEIVDEMDEHEAEQHPAVFKYVRMQDQRYYIPNLEYIEKLLGL"
FT   gene            689493..690902
FT                   /gene="hemN_1"
FT                   /locus_tag="ABBFA_00654"
FT                   /old_locus_tag="CTY05_00654"
FT   CDS_pept        689493..690902
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemN_1"
FT                   /locus_tag="ABBFA_00654"
FT                   /old_locus_tag="CTY05_00654"
FT                   /product="Oxygen-independent coproporphyrinogen-III
FT                   oxidase"
FT                   /EC_number="1.3.98.3"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:P32131"
FT                   /protein_id="ATY43111.1"
FT                   /translation="MTNIVTMDIVSIKNFIQKNKVRHLSNKVLHTHPSPKMWKTDLKEE
FT                   ENNYFLLNTDAQYKSINLYLGIPYCIPTDPPHCGFCLFPTQDYKGKREMDFYLDFLSRE
FT                   AHLYKEFYQGAKLESLYVGGGTPNLLQPNDYMKLTKVVSSLFPDAGISSPIEMTLEGIP
FT                   QLFNEDKIRAIKDAGFNRVSMGVQQVNDELIATSGRKQTRKQVFDAIELFHKYSLSCNV
FT                   DLIYDWPNQTVEAMLRDLESIVQSGIKHITHYELNIAGRSDFATKQKQNTPSIEKKIEM
FT                   YNIAKQFLISKGYKQKTVYDWEKEDNNQLISEKYLYEDNLRDCLDANGQSKMTTMSGLG
FT                   YAAVNMRLQPNSSSIKSVSAMNHRNLTEYYNAISLNKLPVERMFVHDTEDVKLIWIFQA
FT                   LQEMKINTKKYEKIFNSDIKLDYKPIWDALVEEGWVEHNDEYIKLINEGEFYTPLIQAL
FT                   LSQPRIKSLQQ"
FT   gene            690910..691791
FT                   /locus_tag="ABBFA_00655"
FT                   /old_locus_tag="CTY05_00655"
FT   CDS_pept        690910..691791
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABBFA_00655"
FT                   /old_locus_tag="CTY05_00655"
FT                   /product="Alpha/beta hydrolase family protein"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="protein motif:Pfam:PF12697.1"
FT                   /protein_id="ATY43112.1"
FT                   /translation="MSIHKELHILKTDDHGEFALWEVAKSENTLIKKEAIFLSHGAFSD
FT                   KTVCMGIADYLANHGYICFILEWRGHGTSPKTDIPFNFETVALYEYKTAFHYIYHNFNI
FT                   ASLHCVTHSGGGLCLTMFLINYPEYLKNIQSITFIACQAFGAVNNSFDFIKLFSAKLIV
FT                   KGLGQIPANKFKLGRVNESYYTMRPWFNWNLKQNFISEFKNIDYKKHMSSIRVPIYSIS
FT                   GTGDKFIAPVKGCYKYLKAFKNQDNVFREFGCSNNNLENYSHSRIVLSQNAAKEVWPTI
FT                   LQWIDKNSKEVL"
FT   gene            complement(691929..693062)
FT                   /gene="dapE"
FT                   /locus_tag="ABBFA_00656"
FT                   /old_locus_tag="CTY05_00656"
FT   CDS_pept        complement(691929..693062)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dapE"
FT                   /locus_tag="ABBFA_00656"
FT                   /old_locus_tag="CTY05_00656"
FT                   /product="Succinyl-diaminopimelate desuccinylase"
FT                   /EC_number="3.5.1.18"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:Q9JYL2"
FT                   /protein_id="ATY43113.1"
FT                   /translation="MNHSDTLSLSLELLQQPSVTPIDHTCQTIMADRLAKVGFHIEPMR
FT                   FGDVDNLWARRGTEGPVFCFAGHTDVVPTGRLDAWNSDPFAPEIRDGKLYGRGSADMKT
FT                   ALAAMVVASERFVAKHPNHKGSIAFLITSDEEGPAVNGTVKVIETLEKRNEKITWCLVG
FT                   EPSSTHKLGDIVKNGRRGSLNAVLKVQGKQGHVAYPHLARNPIHEASPALAELCQTVWD
FT                   NGNEYFPATSFQISNIHAGTGATNVIPGALEVTFNFRYSTEVTAEQLKQRVHEILDKHG
FT                   LQYEIVWNLSGLPFLTPVGELVNAAQTAILNVTGTETELSTSGGTSDGRFIAPTGAQVL
FT                   ELGVLNATIHQINEHVDVHDLDPLTDIYEQILENLLA"
FT   gene            complement(693188..693328)
FT                   /locus_tag="ABBFA_00657"
FT                   /old_locus_tag="CTY05_00657"
FT   CDS_pept        complement(693188..693328)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABBFA_00657"
FT                   /old_locus_tag="CTY05_00657"
FT                   /product="entericidin A"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="protein motif:CLUSTERS:PRK09810"
FT                   /protein_id="ATY43114.1"
FT                   /translation="MKKVLVASVMVAFVLTGCNTFKGFGQDVSKAGDAVTNTAQKTENK
FT                   M"
FT   gene            complement(693430..694338)
FT                   /locus_tag="ABBFA_00658"
FT                   /old_locus_tag="CTY05_00658"
FT   CDS_pept        complement(693430..694338)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABBFA_00658"
FT                   /old_locus_tag="CTY05_00658"
FT                   /product="hypothetical protein"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /protein_id="ATY43115.1"
FT                   /translation="MNIASIKTSYFEPWLQFSHPMVRQLAFTIASPNLLSQLPCSLTIR
FT                   HSFQLHTDKNWEQHFQNYLPRLKQLDEAPEPLLQFMSRLKSTRLGLRFENLLWFWLQED
FT                   QYHPYQLLGHSIQKIDGAKTLGELDFLVLNQNTQEIEHWEVALKYYLGEGQLNLEQWIG
FT                   LNRQDTLSKKLYHFTDKQFQFSEALGFKVQQRFAVLKGQLYLPLNLPQEQPIPEWVNLK
FT                   RRLGTWGTEIPKSDFYRLERHEWLCPHQKASSNTAYWWTDGLYCQNINETRFYMFRHPA
FT                   LLSLKPSLIKNNGVLQETTSL"
FT   gene            694443..694811
FT                   /gene="ybaN"
FT                   /locus_tag="ABBFA_00659"
FT                   /old_locus_tag="CTY05_00659"
FT   CDS_pept        694443..694811
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybaN"
FT                   /locus_tag="ABBFA_00659"
FT                   /old_locus_tag="CTY05_00659"
FT                   /product="Inner membrane protein YbaN"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:P0AAR5"
FT                   /protein_id="ATY43116.1"
FT                   /translation="MRTLFWRTLVVIFITLGIIGAILPGMPTTVFLILAAWAASKGWPQ
FT                   MDAWLLNHPKYGITLRDWRANGTVPRKAKWIATIMMTASGILMLFTSAPFGVKIFTDTT
FT                   MLVVAIWLWLRPEPKLKD"
FT   gene            694962..695465
FT                   /locus_tag="ABBFA_00660"
FT                   /old_locus_tag="CTY05_00660"
FT   CDS_pept        694962..695465
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABBFA_00660"
FT                   /old_locus_tag="CTY05_00660"
FT                   /product="L,D-transpeptidase catalytic domain"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="protein motif:Pfam:PF03734.8"
FT                   /protein_id="ATY43117.1"
FT                   /translation="MSQFKLEDADILIDLANQTLSLPKHNKFYVVSTGKNGIGEQENTG
FT                   KTPRGWHRVVKKFGMQSPKNTVFIARQPTGEVYNSELAAQFPERDWILSRILWLDGLEE
FT                   GFNKGEGHDTMQRYIYIHGTPDKEPMGVPMSHGCIRMRNEEIIELFDLVSEDALVYLSE
FT                   QSLT"
FT   gene            695672..695747
FT                   /locus_tag="ABBFA_00661"
FT                   /old_locus_tag="CTY05_00661"
FT   tRNA            695672..695747
FT                   /locus_tag="ABBFA_00661"
FT                   /old_locus_tag="CTY05_00661"
FT                   /product="tRNA-Val"
FT                   /note="tRNA-Val(tac)"
FT                   /inference="COORDINATES:profile:Aragorn:1.2"
FT   gene            695772..695848
FT                   /locus_tag="ABBFA_00662"
FT                   /old_locus_tag="CTY05_00662"
FT   tRNA            695772..695848
FT                   /locus_tag="ABBFA_00662"
FT                   /old_locus_tag="CTY05_00662"
FT                   /product="tRNA-Asp"
FT                   /note="tRNA-Asp(gtc)"
FT                   /inference="COORDINATES:profile:Aragorn:1.2"
FT   gene            695896..695972
FT                   /locus_tag="ABBFA_00663"
FT                   /old_locus_tag="CTY05_00663"
FT   tRNA            695896..695972
FT                   /locus_tag="ABBFA_00663"
FT                   /old_locus_tag="CTY05_00663"
FT                   /product="tRNA-Asp"
FT                   /note="tRNA-Asp(gtc)"
FT                   /inference="COORDINATES:profile:Aragorn:1.2"
FT   gene            695994..696069
FT                   /locus_tag="ABBFA_00664"
FT                   /old_locus_tag="CTY05_00664"
FT   tRNA            695994..696069
FT                   /locus_tag="ABBFA_00664"
FT                   /old_locus_tag="CTY05_00664"
FT                   /product="tRNA-Val"
FT                   /note="tRNA-Val(tac)"
FT                   /inference="COORDINATES:profile:Aragorn:1.2"
FT   gene            696109..696185
FT                   /locus_tag="ABBFA_00665"
FT                   /old_locus_tag="CTY05_00665"
FT   tRNA            696109..696185
FT                   /locus_tag="ABBFA_00665"
FT                   /old_locus_tag="CTY05_00665"
FT                   /product="tRNA-Asp"
FT                   /note="tRNA-Asp(gtc)"
FT                   /inference="COORDINATES:profile:Aragorn:1.2"
FT   gene            696252..696327
FT                   /locus_tag="ABBFA_00666"
FT                   /old_locus_tag="CTY05_00666"
FT   tRNA            696252..696327
FT                   /locus_tag="ABBFA_00666"
FT                   /old_locus_tag="CTY05_00666"
FT                   /product="tRNA-Val"
FT                   /note="tRNA-Val(tac)"
FT                   /inference="COORDINATES:profile:Aragorn:1.2"
FT   gene            complement(696542..697327)
FT                   /locus_tag="ABBFA_00667"
FT                   /old_locus_tag="CTY05_00667"
FT   CDS_pept        complement(696542..697327)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABBFA_00667"
FT                   /old_locus_tag="CTY05_00667"
FT                   /product="hypothetical protein"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="protein motif:CLUSTERS:PRK10494"
FT                   /protein_id="ATY43118.1"
FT                   /translation="MQVSKWIRIFLAVIGSILFLDGLFLAFLNKIHVGTLVPLVLGAFF
FT                   CLYALFYYHLERFFFYHYRLHTLWRFGWLCFWIWLIGLGYFFNFIKENKDASQNLPAVK
FT                   AIIVLGSGVENGQPSAILAKRLDTAAPVALSQPQAKVILTGGLDFSEKESEALVMSRYL
FT                   EQHFHIAKDRMILEDKSTSTELNLKNSKPLLEQAHINANQPIAIVTSDFHTPRAAAIAK
FT                   KQGYTQVYMVAAETPLITRYNAWLREYFAYASGWLLNEY"
FT   gene            complement(697454..700000)
FT                   /gene="cysJ"
FT                   /locus_tag="ABBFA_00668"
FT                   /old_locus_tag="CTY05_00668"
FT   CDS_pept        complement(697454..700000)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysJ"
FT                   /locus_tag="ABBFA_00668"
FT                   /old_locus_tag="CTY05_00668"
FT                   /product="Sulfite reductase [NADPH] flavoprotein
FT                   alpha-component"
FT                   /EC_number="1.8.1.2"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:O32214"
FT                   /protein_id="ATY43119.1"
FT                   /translation="MFKKFLFQIHWFLGISAGLILSIMGVTGAIYSYDQQILKWVNTDS
FT                   YVVQVQSSPKLTPAQLYQHFTTIQPEIKINSITIAKDPTASSVVNIEKEGERRGYNMMV
FT                   NPYTAQVLPEVQGRKLLLLIQQIHRNLTAGEFGKQITGACALMLIYFVLSGLYLRWPKK
FT                   HSARQWLAVKPKLKGRNFIWDLHAVVGTWVIVFYLLFACTGLYWSYDWWRSGMFKVLGV
FT                   EQPKMQGHGGSGRNKDQFPKIQLDNAQLITALNQTWSGFNNQIGRDYSTLTVNLPKKDD
FT                   GKIELSFVDATPQHERARNQAVYNYKTANIEKMELYEDKKLNQKIMSSMLPVHRGSFFG
FT                   PVYQFVAMLASLAMPLFFVTGWMLYLKRRKQKKLTQAARQSLAGHYIDQNAKPWLITYA
FT                   TQTGVAEQLAWSTATSLQEAHQPVQVKSVQQLTEVDLQQHEQILFVISTYGTGEAPDLA
FT                   SNFAKKLLKTNLRLQHVKYAVLALGSKEYPDTYCSFGHTVDEWLKNNGAKALFDIIEVD
FT                   NANPTDIQNWNQALVKATKLDLHAVNIEKVFDNWTLQQRDLLNPNSLGQPAYNIELTAS
FT                   HEAVWQAGDIAEIQPGNSPERINKFLQHHHILKNAVVDSLQVSIEKALWNKDLTGEIEP
FT                   FANLDHLLEQLPTLPTREYSIASIPSQQVLRLVVRQQYDESGDLGLGSGWLTQHTEINQ
FT                   NVALRIRTNESFHLIDDNRPIICIGNGTGIAGLMSLLHTRTRHNYTDNWLIFGERQRAH
FT                   DFFYASTIEAWQTMGMLKRLDLAFSRDQEQRVYVQDIIRQNAAELVNWIERGAVLYVCG
FT                   SIDGMASGVDQALIHILGEEQVDELRQQGRYRRDVY"
FT   gene            complement(700158..700733)
FT                   /locus_tag="ABBFA_00669"
FT                   /old_locus_tag="CTY05_00669"
FT   CDS_pept        complement(700158..700733)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABBFA_00669"
FT                   /old_locus_tag="CTY05_00669"
FT                   /product="hypothetical protein"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /protein_id="ATY43120.1"
FT                   /translation="MTAKTLYAYTLQPVPYEVSEAEQRNAQLLIWRSTNKISTKIWAIM
FT                   GVILALAILGLIFIKNYSTVICWVAIVCVVLYYLGRKYGLEWYVKRKMNEFPVQEIKGI
FT                   RLGVQPHGIVMRQQMGLQEGVGTIGWKNIYEWYNTPDFILVNFKVKDPKGQEQQGAYIL
FT                   PKRMDSKNFSFNTIRKHLKESVGEPKTL"
FT   gene            complement(700834..702912)
FT                   /gene="yccS_2"
FT                   /locus_tag="ABBFA_00670"
FT                   /old_locus_tag="CTY05_00670"
FT   CDS_pept        complement(700834..702912)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yccS_2"
FT                   /locus_tag="ABBFA_00670"
FT                   /old_locus_tag="CTY05_00670"
FT                   /product="Inner membrane protein YccS"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:P75870"
FT                   /protein_id="ATY43121.1"
FT                   /translation="MPYFLGHQLATIPLTLGVVAAGLSDIDDRFSVRIMNLIYTYIGFF
FT                   ITAASVQLLFPYPMLFALGLIASCIGWILLGSLGRRYATISYGCLVVSVYTMLGVHLFD
FT                   QWYIQPALLVAGAAWYGLIATISFLLFPVRQLQDKLAASYASLGDFLFAKSNLFDVDMT
FT                   PASYQQSMIDLSLENGKLITIFNDLKTALLTRLKGDRGQKGTRRSLHYYFVAQDIHERA
FT                   DSAHIDYQKLAKIFQHSDILFRFQRILAIQGKACQELNECILQRKPYIHNKRFKQSFEN
FT                   LRLSLVKLRDDQQYDLLWVNALFALYRNLKSIDSQLLNLETEQHIQSDKVKQAENQLKD
FT                   DDLKGWNDIVVRIKQNLTPESVLFRHAIRVSIVLFIGYVFIQMTHIEYGYWIMLTALFV
FT                   SQPNFNATKRRLRLRIVGTLVGIIVGLSIVFLVPSVEGQLVMLILSGVLFFELRSKQYA
FT                   QATAFITILALINFNLDGSAVAAAIPRFIDTLIGCALAWFGVTFIWPDWKFRRLPRSIR
FT                   RSLQAQCNYLAEVVKQYHEGHNHALNYRIVRRAAHNTDAEVASLISTLATEPDFDPTRK
FT                   SDIFEFLCLNHTFLSYIAALGAHREKIQDQAVLNVLDQALDDIQGALLRDEMPDLTAQN
FT                   MLQTIRQRLSQNDEDDQKSLIILQQLSLMLSVLNRFSMLKQRLSHDLDNDASELASL"
FT   gene            703136..704350
FT                   /gene="bcr_1"
FT                   /locus_tag="ABBFA_00671"
FT                   /old_locus_tag="CTY05_00671"
FT   CDS_pept        703136..704350
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bcr_1"
FT                   /locus_tag="ABBFA_00671"
FT                   /old_locus_tag="CTY05_00671"
FT                   /product="Bicyclomycin resistance protein"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:P28246"
FT                   /protein_id="ATY43122.1"
FT                   /translation="MSEQTAQRQYSIGWIMLLALLTALGPLSIDMYLPALPQMAHDFGV
FT                   STQMVANTLPAYFFGLAIGQLVYGPLSDRIGRKKPLYFGLALYAVASLFCVLATNEWSL
FT                   IAARILQALGGCVGVVMARAAIRDRLDVQGSAQAFSSMMIVMGLAPILAPMIGAWILIW
FT                   FPWQAIFIALSIVGAICWLCVHFFFKETLAVDKRLKLSLYQVATLYGAIFKDASFRLPM
FT                   FAGCLTGAALFCYISSAPAVFMDQYGLNQQEFAYVFGLNAFGIMLMSSLNKHLTTRVEI
FT                   TKRLKAGSMVQVTGASIVLIAGLISAAPLWLVMLGLFLAISGIGLTGPNAMALAMSKQG
FT                   ARAGTASAIMGSMQFACGLLGGVLLNFLIWSASLNMGVMMVLFTLSGFIVVLKAIRQAK
FT                   SQSLS"
FT   gene            complement(704378..705082)
FT                   /locus_tag="ABBFA_00672"
FT                   /old_locus_tag="CTY05_00672"
FT   CDS_pept        complement(704378..705082)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABBFA_00672"
FT                   /old_locus_tag="CTY05_00672"
FT                   /product="nitroreductase A"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="protein motif:CLUSTERS:PRK10765"
FT                   /protein_id="ATY43123.1"
FT                   /translation="MNLEQVRLVDEAITSRHSVRAFLSTPIEPEVIKDILRVASRAPSG
FT                   TNTQPWKVYVVTGHKRDEMVERVCAAQIEVSKNPELAEQYKETFAYYPEKWVSPFIDRR
FT                   RENGWGLYGLLDIKKGEKEKMAAQQLRNFKLFDAPVGIFFTVNKAMGIGSKMDIAMMIQ
FT                   NVMVAAKARGLDTCPQAAWNHFHPLVLDILGAADDEELVCAIALGHADPEHIVNTFITP
FT                   REPVENFAVFLD"
FT   gene            705593..705796
FT                   /locus_tag="ABBFA_00673"
FT                   /old_locus_tag="CTY05_00673"
FT   CDS_pept        705593..705796
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABBFA_00673"
FT                   /old_locus_tag="CTY05_00673"
FT                   /product="hypothetical protein"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /protein_id="ATY43124.1"
FT                   /translation="MSLPLINKQFMKQGLAITIATMKMNVTHATTEPQEIQQLGTDLNA
FT                   LFFNEKEKGTDSRVMTMACYSL"
FT   gene            706219..707694
FT                   /gene="alsT"
FT                   /locus_tag="ABBFA_00674"
FT                   /old_locus_tag="CTY05_00674"
FT   CDS_pept        706219..707694
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="alsT"
FT                   /locus_tag="ABBFA_00674"
FT                   /old_locus_tag="CTY05_00674"
FT                   /product="Amino-acid carrier protein AlsT"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:Q45068"
FT                   /protein_id="ATY43125.1"
FT                   /translation="MNEQLNATLMSWVQFFNEPLWDFLVIFLLAVGIFYTVLTGAVQIR
FT                   MFLQSIRVMKSSRTEGEDEHGLTPFQAFVTGLASRVGVGNIAGVAIAIAIGGPGAVFWM
FT                   WVTAVLGMSSAFIESTLAQLFKVRDSNSKQFRGGPAYYITQGLRSKTFGVIFALALIFT
FT                   YGFVFNSVQINAIANASSHAWGWDKANLIAHLGGVDLEISWVGLALVVMVALAIFGGIK
FT                   RIAKFAEMFVPLKAGLYLSVALYIALSNYAILPDVLKLIVTEAFHFNAAAGGFFGAAVS
FT                   MAMMQGIKRGLFSNEAGMGSAPNAAAASDVKHPVNQGLVQMLGVFVDTFIVCTSTAIII
FT                   LVSGVYQDAGFVGVELTQRALETQVGHWGADFLAVLLFLFCYSAVLGNYAYAESNVQFI
FT                   NNNPKVMFIFRIFVLVMVYFGAIGSVPLVWSMADLFMGIMATINLVAILLLTPMARTLL
FT                   KDYRAQLKQGIKEPVFKINKYPELKKKVDSDIW"
FT   gene            707899..708834
FT                   /gene="rssA_1"
FT                   /locus_tag="ABBFA_00675"
FT                   /old_locus_tag="CTY05_00675"
FT   CDS_pept        707899..708834
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rssA_1"
FT                   /locus_tag="ABBFA_00675"
FT                   /old_locus_tag="CTY05_00675"
FT                   /product="NTE family protein RssA"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:P0AFR0"
FT                   /protein_id="ATY43126.1"
FT                   /translation="MVLAGCQTTSHLSALKPQTAEAYSRFVDQPFAQLKKQHKKPVVAL
FT                   VLGSGGARGYAHIGVIEVLEQHGIRPDFIVGTSAGSIVGAIYASGKTPDELRDTALKMK
FT                   AADVRDISIGLKGFFDGKKVEDYVNQQVNNLPLEKMKIPMYVVATELKHGTKTVFNYGN
FT                   TGQAVRASASIPSMFVPTKIGKSEYVDGGLVSPVPVEVARDLGADVIIAVDILAQPIYT
FT                   ETSNVWGLFNQNINIMQGRLAAEELQYADVVIQPDLREKAHIFDVKGREATMKAGIDAA
FT                   NAKLSDIQFAIDEKIAEQNLSTDGLSAQTQ"
FT   gene            709032..710267
FT                   /gene="tdcB_1"
FT                   /locus_tag="ABBFA_00676"
FT                   /old_locus_tag="CTY05_00676"
FT   CDS_pept        709032..710267
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tdcB_1"
FT                   /locus_tag="ABBFA_00676"
FT                   /old_locus_tag="CTY05_00676"
FT                   /product="L-threonine dehydratase catabolic TdcB"
FT                   /EC_number="4.3.1.19"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:Q7A5L8"
FT                   /protein_id="ATY43127.1"
FT                   /translation="MIQQQVKNEFPTLEDIHAAAERLDGLVVKTPFVFSETISKTLGAE
FT                   MWLKFENLQFTASFKERGALNKLLSLSEQEKQHGVIAASAGNHAQGVAYHAQRTGVTAT
FT                   IVMPKSTPNVKVQRVREYGARVILHGQDFSEAAAEMHRVAQEESLTIIHPFDDAEIIAG
FT                   QGTIALEMLEAVPDLDILVVPIGGGGLISGIAIAAKSINPKIKIIGVQSVVYPSMAKLL
FT                   CNYQLAVSMGSTVAEGIAVKTPGELTTQIAKHFVDDIVVVTEDMIEEAIALLLNIEKTV
FT                   CEGAGATGIAAIMSRPDLFLGHKVGVVLSGGNIDTRVMVSVLQRHLTRTGRMVRIRVEL
FT                   PDNPGALARLTAIIAEQGGNIYELRHERFAATSRAKESAVSVDIELKSAPDLEPLIQAM
FT                   QLEGYIVRKEEI"
FT   gene            710504..711700
FT                   /gene="sbmA"
FT                   /locus_tag="ABBFA_00677"
FT                   /old_locus_tag="CTY05_00677"
FT   CDS_pept        710504..711700
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sbmA"
FT                   /locus_tag="ABBFA_00677"
FT                   /old_locus_tag="CTY05_00677"
FT                   /product="Peptide antibiotic transporter SbmA"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:P0AFY6"
FT                   /protein_id="ATY43128.1"
FT                   /translation="MFKSFFPSPRYFFISAVIWLALNMVLWYTGGDHWGQYLGFPQGYA
FT                   DVELPIGVSRFWSPAFLWFYLWFLVSTALFASFWKIISNNPWQRWSIWGSAFILFNIWF
FT                   SVQVSVAINAWYVPFWDLIQQMLSSGGGDLSALYSETLVFLYIAMVAVTLAVINAFFTS
FT                   HYVFRWRTAMNEYYTEHWEKLRHIEGASQRVQEDTMRFATILEDLGVELVKAVITLIAF
FT                   LPILFQLSKHVPVLPIVGELEHSLVWAAIVWSIFGTVLLMVVGIKLPGLQFNNQKVEAA
FT                   YRKELVYGEDHADRAKPATLRELFSNVRKNYFRLYFHYAYFNMTAIWYGQLDILYNLVV
FT                   LFPSIAAGKLTLGLIQQIANVFGRVRESFQYLITSWKTIIELLSIYKRLKAFESILHK"
FT   gene            complement(711739..712488)
FT                   /locus_tag="ABBFA_00678"
FT                   /old_locus_tag="CTY05_00678"
FT   CDS_pept        complement(711739..712488)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABBFA_00678"
FT                   /old_locus_tag="CTY05_00678"
FT                   /product="hypothetical protein"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /protein_id="ATY43129.1"
FT                   /translation="MKKLNFLLFTVFTSLTSSAYAEVKSFTPHFPKFYSSAATRKADNQ
FT                   FYPLGEAKFLNGVTVPFYGVTAQSPTENGLLKDFEICTPKSCRFNFKIEAQHAKQLKLL
FT                   ALPETGLVLVPQSWHDVQANAGANGTGFALIMSPDQKQAIELYDSSFCVGCGLPNATLY
FT                   FPELLKESLENEYGGFKDPKNLINIVHPSKKVAFFSYQIPQVNNKTHGIAKYDDKDTFN
FT                   YKEIQVTLDKSQQFLVGPILNFYNATH"
FT   gene            712613..713680
FT                   /locus_tag="ABBFA_00679"
FT                   /old_locus_tag="CTY05_00679"
FT   CDS_pept        712613..713680
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABBFA_00679"
FT                   /old_locus_tag="CTY05_00679"
FT                   /product="hypothetical protein"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /protein_id="ATY43130.1"
FT                   /translation="MKNILSICCLAVISSYSFAQDIKGFSFSHQEWEISCSNTGTCKAA
FT                   GYQNEENGDNPASILLTRKAGPKQPVQIEFALSDYEQSIPANQLKNIHFYINGKDLGMV
FT                   GVDGTELPIMGKLNSSQVNAVLQQSKQKTEIVFKNAQHEWKISDEGMTAVLLKMDDFQK
FT                   RIGTVGALVKKGSANETKVLMPEPKLLVKRIKTSNKPYLTLQPKNKQYQAIHRSLIAAK
FT                   PNPKEDGFCEGVYGGNSNGAEPQKIELYKLTNKKVLATTLCWRGAYNEGYGAWVLDESL
FT                   NGKAAFVTESASDFDSGIISSAQKGRGIGDCWASEEWVWDGKSFVHTKDMWTGMCKGLA
FT                   AGGVWELDRIESVVK"
FT   gene            713764..714282
FT                   /locus_tag="ABBFA_00680"
FT                   /old_locus_tag="CTY05_00680"
FT   CDS_pept        713764..714282
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABBFA_00680"
FT                   /old_locus_tag="CTY05_00680"
FT                   /product="hypothetical protein"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /protein_id="ATY43131.1"
FT                   /translation="MSRHLYAIARRKFSHLSRSICVAATVLGATQIAMAGPTVDQLSDC
FT                   LVKATTASDKTTVLQWTFTALAAHPDLKAFSNVTPEQKDQLDQKLAQVLQRIIVEQCSA
FT                   QTKAVIQAEGVKAVGEAFQQLGQSAGEDIVKDPAVKQQLQGTLRYIDLNKLVTTFLTPE
FT                   IWNKLGITR"
FT   gene            complement(714361..714939)
FT                   /gene="yraA"
FT                   /locus_tag="ABBFA_00681"
FT                   /old_locus_tag="CTY05_00681"
FT   CDS_pept        complement(714361..714939)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yraA"
FT                   /locus_tag="ABBFA_00681"
FT                   /old_locus_tag="CTY05_00681"
FT                   /product="Putative cysteine protease YraA"
FT                   /EC_number="3.2.-.-"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:O06006"
FT                   /protein_id="ATY43132.1"
FT                   /translation="MSKKILMLVGDYAEDYETMVPFQFLTGLGYTVHAVCPNKKNGDHI
FT                   ATAIHDFEGEQTYSEKRGHNFTINYDFDAVNTEDYVGLVIPGGRAPEYLRMNERVVEIV
FT                   RDFDRVKKPIAAVCHGAQLLAAADILKDRLCSAYPACAAEVKLAGGQYADIAVTDAVTD
FT                   GHLVTAPAWPAHPAWLAQFVKVLGAKISI"
FT   gene            complement(715109..716578)
FT                   /gene="gatB"
FT                   /locus_tag="ABBFA_00682"
FT                   /old_locus_tag="CTY05_00682"
FT   CDS_pept        complement(715109..716578)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gatB"
FT                   /locus_tag="ABBFA_00682"
FT                   /old_locus_tag="CTY05_00682"
FT                   /product="Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
FT                   subunit B"
FT                   /EC_number="6.3.5.-"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:Q3KI28"
FT                   /protein_id="ATY43133.1"
FT                   /translation="MAEAQKLKLIDGWEVVIGIEIHTQLATNSKIFSGSSTEFGQDPNT
FT                   QASLVDLAMPGVLPVLNEKVVELAIRFGLGIDAYIDQASVFARKNYFYPDSPKGYQISQ
FT                   MDNPIVGLGHIDIQLEDGTTKRIGVTRAHLEEDAGKSVHDQFEGMSGIDLNRAGTPLLE
FT                   IVSEPDMRSVEEAVAYIKAIHTLVRWLGISDGNMAEGSFRADCNVSLRRPGQPFGTRCE
FT                   LKNLNSFRFIEQAINVEIERQMEILEWGGEIDQETRLFDPNKMETRSMRSKEEANDYRY
FT                   FPDPDLLPVIIPDEQIEAIKATMPELPAARRARFIADFGVTEYDAHVLTLSREMADFYE
FT                   AVVAAAGGAKQGKIAANWVMGEFSGALNKAGLELTDSPVSAEQLGGMIARIVDNTISGK
FT                   IAKQVFGFMWESEGKSADDIIAEKGLKQETDTGAIEAIIKEVLAANEKMVEEYKSGKEK
FT                   AFNGLVGQVMKASKGKANPAQVNELMKKLIG"
FT   gene            complement(716578..718056)
FT                   /gene="gatA_1"
FT                   /locus_tag="ABBFA_00683"
FT                   /old_locus_tag="CTY05_00683"
FT   CDS_pept        complement(716578..718056)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gatA_1"
FT                   /locus_tag="ABBFA_00683"
FT                   /old_locus_tag="CTY05_00683"
FT                   /product="Glutamyl-tRNA(Gln) amidotransferase subunit A"
FT                   /EC_number="6.3.5.-"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:Q4ZNS7"
FT                   /protein_id="ATY43134.1"
FT                   /translation="MTDLHRLSIRELAEGLSQAKFSSRELTEHYLKRIAKIDPQVKSYV
FT                   TVTPEQALREADAADAALKAGNATALTGIPLAHKDIFCTKGIKTTAGSKMLDNFISPYD
FT                   ATVVEKTKAAGLVTLGKVNMDEFAMGSTSESSYVGATSNPWALDHVPGGSSGGSAAAVA
FT                   ADLAPFATGTDTGGSIRQPASFCGLTGLKPTYGRVSRFGIIAYASSLDQAGPMARSAED
FT                   CAYLMNVIAGHDAKDSTSVKKEVDDYVANLNNTSVKGLRIGIPKQYFNVAGLDADVKAR
FT                   VEESLKKLEEMGAALVEIDLNMTEAYVPTYYLIAPAEASSNLSRYDGVRYGYRCENPAD
FT                   LMDLYKRSRSEGFGPEVQRRILIGTYALSAGYYDAYYVKAQKVRRLIQQDFLKAFENVD
FT                   VIAAPAAPTTAYKIGASLDPVEMYLGDIYTIAVNLAGLPAINAPVGFDKDNLPVGLQLI
FT                   GNYWSESQLLSIVHQYQQNTDWHTKRAAIAEENA"
FT   gene            complement(718110..718424)
FT                   /gene="gatC"
FT                   /locus_tag="ABBFA_00684"
FT                   /old_locus_tag="CTY05_00684"
FT   CDS_pept        complement(718110..718424)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gatC"
FT                   /locus_tag="ABBFA_00684"
FT                   /old_locus_tag="CTY05_00684"
FT                   /product="Glutamyl-tRNA(Gln) amidotransferase subunit C"
FT                   /EC_number="6.3.5.-"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:O67904"
FT                   /protein_id="ATY43135.1"
FT                   /translation="MSTSDAQHSADLNAQTVSAIANLARLSLNDTQSAEYAQSLNKILG
FT                   MMETLKGIDTEGVEPLKSPFDNPQPLRADVVTESNHRDEYQAVAPATQDGLYLVPRVIE
FT                   "
FT   gene            718558..719598
FT                   /gene="mreB"
FT                   /locus_tag="ABBFA_00685"
FT                   /old_locus_tag="CTY05_00685"
FT   CDS_pept        718558..719598
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mreB"
FT                   /locus_tag="ABBFA_00685"
FT                   /old_locus_tag="CTY05_00685"
FT                   /product="Rod shape-determining protein MreB"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:P0A9X4"
FT                   /protein_id="ATY43136.1"
FT                   /translation="MILKRLIGLFSPDLAIDLGTANTLIYAPGRGIILNEPTVVAIRHS
FT                   GSQKIVAAVGLDAKQMLGRTPANISAIRPMKDGVIADFEVTETMLNQFIGKVHEKRLFP
FT                   PAPRVVVCVPCKSTLVERRAIREAVFNAGARDVRLIEEPMAAAIGAGMPVEQACGSMVV
FT                   DVGGGTTEIAIISLQGCVYADSLRIGGDVFDEQIINYVRKAHGCVIGETTAEIIKKEVG
FT                   MAVSDGTTLEIEVRGRNLAEGVPRAITVTSDEITQAISDPLQSIVSAVKSALEQTPPEL
FT                   SSDIAERGIVLTGGGALLRNLDKLLAQETGLPVVVAEDPLTCVTRGGGKVLEFFDNPNH
FT                   DMLFVG"
FT   gene            719615..720472
FT                   /gene="mreC"
FT                   /locus_tag="ABBFA_00686"
FT                   /old_locus_tag="CTY05_00686"
FT   CDS_pept        719615..720472
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mreC"
FT                   /locus_tag="ABBFA_00686"
FT                   /old_locus_tag="CTY05_00686"
FT                   /product="Cell shape-determining protein MreC"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:P16926"
FT                   /protein_id="ATY43137.1"
FT                   /translation="MQPNIFSRQPPSFRSFIIAVITCLVVLFFDWRMPYVIQPARDVLY
FT                   AAYNPIYALASYPVLSREWLNQQTKSETQLRRENTAMQAELLQAQVRLQKLSELSAENT
FT                   RLRGLLDTPLIIDGRMEIAEVIGTDADPLRHIIIINRGAMDHLKVGQTVLDDKGIMGQI
FT                   INVYPHSSRVMLLSDKEHSLSVRLERTGMRAIVSGTGDLGRLKMEYVPTSANIQVGDKV
FT                   LSSGLGEHFPAGYAVGTVAKIRRHNSGEFAEIDVTPAAQLATGHHVVVLFSDSLAKEQP
FT                   YADR"
FT   gene            720459..720950
FT                   /locus_tag="ABBFA_00687"
FT                   /old_locus_tag="CTY05_00687"
FT   CDS_pept        720459..720950
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABBFA_00687"
FT                   /old_locus_tag="CTY05_00687"
FT                   /product="rod shape-determining protein MreD"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="protein motif:CLUSTERS:PRK11060"
FT                   /protein_id="ATY43138.1"
FT                   /translation="MPIAKLKREKRKDPLWGIILSIIVGSVLMIYPLSYDISGWRPLFM
FT                   LMIMLFWVVCQPTWCGVWFAFGMGIFTDLLLDAPLGLNALSFVIVTFITRFLIRERRIL
FT                   TFGNLWTIATLVIIAHLAFMWVTQTMGGIHFSIARHWQPLMTSILTWPVIYYCLAKWRI
FT                   "
FT   gene            720938..721498
FT                   /gene="yhdE"
FT                   /locus_tag="ABBFA_00688"
FT                   /old_locus_tag="CTY05_00688"
FT   CDS_pept        720938..721498
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yhdE"
FT                   /locus_tag="ABBFA_00688"
FT                   /old_locus_tag="CTY05_00688"
FT                   /product="Maf-like protein YhdE"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:P25536"
FT                   /protein_id="ATY43139.1"
FT                   /translation="MAHLVLASSSPRRRELLQQLGLNFEIYSPDIDESVHEGELVHQYV
FT                   ERLAREKAQAVLNIFPDSVIIAADTSLGLDGQIIGKPDSKQHAFDIWKQLSGRWHDVFS
FT                   GICIATQQQILSQVVQTQVEFASLTTQDMEDYWATGEPVGKAGAYAIQGIASQYIPKIQ
FT                   GSYSNVVGLPLYEFSQLFKRVKT"
FT   gene            721612..723066
FT                   /gene="rng"
FT                   /locus_tag="ABBFA_00689"
FT                   /old_locus_tag="CTY05_00689"
FT   CDS_pept        721612..723066
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rng"
FT                   /locus_tag="ABBFA_00689"
FT                   /old_locus_tag="CTY05_00689"
FT                   /product="Ribonuclease G"
FT                   /EC_number="3.1.26.-"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:P0A9J0"
FT                   /protein_id="ATY43140.1"
FT                   /translation="MSEELLINVTPMECRVALIENGTVNELYVERTVKRGLVGNIYKGK
FT                   VVRVLPGMQAAFVDIGLSRTAFLHINDMVWPRSQPTPNVFELLHPGQILTVQVMKDMLG
FT                   TKGARLSTDLSIPSRYLVLMPYGNHIGVSQRIESEEERDRLRNIIESIQAEHNLPGSVI
FT                   VRTAAEGVDEAEIAQDMCYLSKLWEYIQRKQVDVAVPSLIFEELPLPQRIIRDLASEET
FT                   AKIYVDSREIHGKLREFVDEFVPNMQSRLIHYPGERPLFDLYNVEEDIQKALQTRVALK
FT                   SGGYLMIDQTEAMTTIDVNTGSYVGGRSLEDTVFKTNMEATQVIARQLRLRNLGGIIII
FT                   DFIDMQEAIHREEVMRQFEKMLERDHAKTKITQVSELGLVEMTRKRTRESLEHLLCESC
FT                   PTCQGRGFVKTAETVCYEIFREILRYTRAFESTSGFTVVAHPSVIDRLLTAEAPAVADL
FT                   EHFINRVIKFQVENLYTQEQYDIILS"
FT   gene            723206..723379
FT                   /locus_tag="ABBFA_00690"
FT                   /old_locus_tag="CTY05_00690"
FT   CDS_pept        723206..723379
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABBFA_00690"
FT                   /old_locus_tag="CTY05_00690"
FT                   /product="hypothetical protein"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /protein_id="ATY43141.1"
FT                   /translation="MNVSENLISNGLKHVLESTPVNSCYMLNDQGKEVPITTAMIRSVC
FT                   HQLLNQCRAIKK"
FT   gene            complement(723409..724794)
FT                   /gene="wax-dgaT"
FT                   /locus_tag="ABBFA_00691"
FT                   /old_locus_tag="CTY05_00691"
FT   CDS_pept        complement(723409..724794)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="wax-dgaT"
FT                   /locus_tag="ABBFA_00691"
FT                   /old_locus_tag="CTY05_00691"
FT                   /product="O-acyltransferase WSD"
FT                   /EC_number="2.3.1.20"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:Q8GGG1"
FT                   /protein_id="ATY43142.1"
FT                   /translation="MRPLHPIDFIFLSLEKRQQPMHVGGLFLFEIPENAPETFVHDLVE
FT                   EIRQSKSIPVPPFNNRLNGLFWDEDEEFDIDHHFRHIALPHPGRIRELLVYISQQHSSL
FT                   IDRAKPLWTCDIIEGIEGNRFAMYFKIHHAMVDGVAGMRLIEKSLSKTPQEKHVVPLWC
FT                   VESKRTKRLKVPKPSTSKIKSILGGIKSQLEVTPKVMQELSQTIFKEMGKNPDYVSTFQ
FT                   APVSILNQRVSASRRFAAQSFELSRLRKISKALGVTINDVVLAVCSGALREYLISHNSL
FT                   PKKPLIAMVPASLRTDDSDVSNRITMILANLGTHKDQPLERLEIIRRSMQNSKQRFSRM
FT                   TANEILNYSAVVYGPAGLNIMSGMLPKRQAFNLVISNVPGPREPLYWNGAKLDALYPAS
FT                   IVMDGQALNITMTSYLDKLEVGLTACRNALPKMQNLLTHLEDEIQRFEEIIEEKQLKHH
FT                   SAS"
FT   gene            complement(724965..725699)
FT                   /gene="cysH"
FT                   /locus_tag="ABBFA_00692"
FT                   /old_locus_tag="CTY05_00692"
FT   CDS_pept        complement(724965..725699)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysH"
FT                   /locus_tag="ABBFA_00692"
FT                   /old_locus_tag="CTY05_00692"
FT                   /product="Phosphoadenosine phosphosulfate reductase"
FT                   /EC_number="1.8.4.8"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:O05927"
FT                   /protein_id="ATY43143.1"
FT                   /translation="MTVIPTIDIVDALAAEYAAKSPREILELALSQQGEIAISFSGAED
FT                   VVLIDMASRLGKPFRVFSLDTGRLHPETYQFIETVRKHYNINIEICFPDAEAVQSMVNE
FT                   KGLFSFFKDGHQECCGIRKVQPLRKKLATLDGWITGQRKDQSPGTRTEIPVVQADAGFS
FT                   GPGKQLIKYNPLANWSSADVWSYIRMMEIPYNPLHERGFVSIGCEPCTRPVLPNQHERE
FT                   GRWWWEEATQKECGLHAGNLKK"
FT   gene            725884..726501
FT                   /locus_tag="ABBFA_00693"
FT                   /old_locus_tag="CTY05_00693"
FT   CDS_pept        725884..726501
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABBFA_00693"
FT                   /old_locus_tag="CTY05_00693"
FT                   /product="haloacid dehalogenase-like hydrolase"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="protein motif:Pfam:PF12710.1"
FT                   /protein_id="ATY43144.1"
FT                   /translation="MEIVCLDLEGVLVPEIWINFAKKTGIKELEATTRDIPDYDVLMTQ
FT                   RLNILKQHGLGLKDIQEVIAEMGPLPGAKEFVEWVSNHFQLVILSDTFYEFAHPLMKQL
FT                   GWPTIFCHKLETDENGMITAYKLRQPDQKRESVKALHGLNFRVIAAGDSYNDTTMLGEA
FT                   DHGFLFDAPANVIAEFPQFPAINGYDALKEAIRSVSQRNIPA"
FT   gene            complement(726569..727999)
FT                   /locus_tag="ABBFA_00694"
FT                   /old_locus_tag="CTY05_00694"
FT   CDS_pept        complement(726569..727999)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABBFA_00694"
FT                   /old_locus_tag="CTY05_00694"
FT                   /product="Outer membrane protein transport protein
FT                   (OMPP1/FadL/TodX)"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="protein motif:Pfam:PF03349.10"
FT                   /protein_id="ATY43145.1"
FT                   /translation="MKLKHLSTAMILATLPATGVFAAALDRSGQSMSAFFQPGNYFEAG
FT                   ISVLDPDVAGKEAGSSATRRDIGDMANDYYFPSAALKLQINDQFSFGLLYDQPFGADAE
FT                   YSGNNVFVSQPGSDSVLSATAIDGIVTKKATEALQAQGLPVNDQTLALAKGQVLASPQF
FT                   KQLAGALAAANNYLGNGGTKVKVDTQNLSFVFGYQPTKNFNFYAGPVLQTVKGNVSLRG
FT                   QAYSLYNGYDADIKETTGAGWLAGAAYQIPEIALRASVTYRSEIDHKVDINENLSLLNF
FT                   PGLTSVLTGLDVPASKLQAINSSGKTTITTPQSVNLDFQTGIMADTVAFANVRWVNWKD
FT                   FSIQPYKFGKVSEAVGGLVGRPNGFNLVEYSDDQWSVNAGVGRKLNDKWAGNVSVGWDS
FT                   GAGNPVTTLGPTEGYWNVGLGVQYSPTPQTFIAGGVKYFWLGDAKAQTGAQAGSDQYVA
FT                   DFSDNNAIAYGLKLGYKF"
FT   gene            complement(728598..729296)
FT                   /gene="kefF_1"
FT                   /locus_tag="ABBFA_00695"
FT                   /old_locus_tag="CTY05_00695"
FT   CDS_pept        complement(728598..729296)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kefF_1"
FT                   /locus_tag="ABBFA_00695"
FT                   /old_locus_tag="CTY05_00695"
FT                   /product="Glutathione-regulated potassium-efflux system
FT                   ancillary protein KefF"
FT                   /EC_number="1.6.5.2"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:P0A754"
FT                   /protein_id="ATY43146.1"
FT                   /translation="MNILIVHAHPEPLSFTTSLKTTAQQTFKKLGHQVEISDLYAMQFN
FT                   PVASKEDFLELNQPDYFNYALEQRNATKQQLLATDIQAEIDKVKRADLIILNFPLYWTS
FT                   VPAILKGWIDRVFVSGLFYGGKRFYNHGGMAGKKAMLCLTLGGRTHMFGENSIHGPIEH
FT                   YLSPIQRGTLAYTGFEVLPPFIAYHVPYISQEARETILEDYVTYLTHLDQLEPLKFPKL
FT                   EEFDEKLYPL"
FT   gene            729460..730317
FT                   /locus_tag="ABBFA_00696"
FT                   /old_locus_tag="CTY05_00696"
FT   CDS_pept        729460..730317
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABBFA_00696"
FT                   /old_locus_tag="CTY05_00696"
FT                   /product="hypothetical protein"
FT                   /note="Arabinose-binding domain of AraC transcription
FT                   regulator, N-term"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="protein motif:Pfam:PF12625.1"
FT                   /protein_id="ATY43147.1"
FT                   /translation="MTPELPGTYINLLAEIVKRRGISCEQFLEGSGVTPEQLKKPYWYV
FT                   EFNTLNNLLEHAIQLTHEPALAGYLALEMKASCYGSVGMAAMVSANLEEALKILEQFIG
FT                   SRCDAFKPELKQEQDDVYWSIHQPLKSFQLSSDATIFLLLGFVHIAKHLTGLSSLGTVQ
FT                   LNMPEPLGFSKIKDKLGVSCLFEQKHNIWIFPKEYLMQPILTADPMLAPLLKAQCKKDI
FT                   DKLKLRSGWKAEISQVIKKLLINSQGEILKVKQVAQMMNMSERSLQRYLAIENTSFSAL
FT                   VDLT"
FT   gene            730354..730494
FT                   /locus_tag="ABBFA_00697"
FT                   /old_locus_tag="CTY05_00697"
FT   CDS_pept        730354..730494
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABBFA_00697"
FT                   /old_locus_tag="CTY05_00697"
FT                   /product="DNA-binding transcriptional regulator AraC"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="protein motif:CLUSTERS:PRK10572"
FT                   /protein_id="ATY43148.1"
FT                   /translation="MSIEAVALSLGYADTPHFTRAFKRWMGVTPKYYQTQLKLKNLEIR
FT                   E"
FT   gene            complement(730537..731529)
FT                   /locus_tag="ABBFA_00698"
FT                   /old_locus_tag="CTY05_00698"
FT   CDS_pept        complement(730537..731529)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABBFA_00698"
FT                   /old_locus_tag="CTY05_00698"
FT                   /product="Fatty acid desaturase"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="protein motif:Pfam:PF00487.18"
FT                   /protein_id="ATY43149.1"
FT                   /translation="MNAQVSVTDLFSREEIQELTEPSDAYGAWAVASTWAVIGGTFASL
FT                   IMMWDYLPSWGKLLACMLALAVLAGRQLCLAILMHDASHKSLFKNKKINDFVGDWLCAR
FT                   PIWNDLQKYRVHHVRHHAKTSTPDDPDLSLVAGFPVSKKSLTRKFLRDLTGITGLKFSL
FT                   GRVLMDLDVMKWTVANDQIWLDRSDKNFVDYAKSIAKNSTGAIATNLLLYGVFKACGQQ
FT                   RFYWLWPLAYLTPFPLFLRIRSMAEHAGMQTSNTALTNTRTTRAGWIARSFVAPIHVNY
FT                   HMEHHLMASVPYFKLPRMHKILRERGHVPTPPSYFEVIHTLSSKQELTN"
FT   gene            complement(731636..732436)
FT                   /locus_tag="ABBFA_00699"
FT                   /old_locus_tag="CTY05_00699"
FT   CDS_pept        complement(731636..732436)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABBFA_00699"
FT                   /old_locus_tag="CTY05_00699"
FT                   /product="hypothetical protein"
FT                   /note="PaaX-like protein C-terminal domain"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="protein motif:Pfam:PF08223.5"
FT                   /protein_id="ATY43150.1"
FT                   /translation="MKNTKINARHLIIDLFLSSAYPQLSIKQILVAAKLFNLSENGIRV
FT                   ATTRLLNEGMIQSVERGIYQLSPSAKDWAKVILNRKNGIKQTKEWQQHYLAVFTGTLGR
FT                   IDRTALKKRERALRQFGFKELETGIYIRPDNLAYSFEKTCDELVLAGLEKEAKICIIQH
FT                   VDSTTLKQIFSLWDTKQLEKNYEMYSRDITHWLENYAHSPLNDAAVKALLLGRETIALL
FT                   MNDPLLPAPFVNESARNQFAQDVQQLDAIGQKLWKKIYEQELNL"
FT   gene            732792..733610
FT                   /gene="uppP"
FT                   /locus_tag="ABBFA_00700"
FT                   /old_locus_tag="CTY05_00700"
FT   CDS_pept        732792..733610
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="uppP"
FT                   /locus_tag="ABBFA_00700"
FT                   /old_locus_tag="CTY05_00700"
FT                   /product="Undecaprenyl-diphosphatase"
FT                   /EC_number="3.6.1.27"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:P60932"
FT                   /protein_id="ATY43151.1"
FT                   /translation="MENFEVIKALFLGFVEGLTEFLPISSTGHLILFGHIIDFHSDGGR
FT                   VFEVVIQLGAILAVCWLYRQKIINLIKGFFSGDVESRHFAISVLIAFSPAVIIGVLAVD
FT                   FIKSVLFSPIVVAIALIVGALIIFWVESKQFEHKTDDATKITFKQALLVGLAQCVAMIP
FT                   GTSRSGATIVGGMFAGLSRKAATEFSFFLAMPTMLGAATFDLIKNADVLTSDNMVNIGV
FT                   GFVAAFIAALLVVKALVLFVERHTLRVFAWYRIVLGVIILIAAMFFNLSA"
FT   gene            733769..734662
FT                   /gene="virF"
FT                   /locus_tag="ABBFA_00701"
FT                   /old_locus_tag="CTY05_00701"
FT   CDS_pept        733769..734662
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="virF"
FT                   /locus_tag="ABBFA_00701"
FT                   /old_locus_tag="CTY05_00701"
FT                   /product="Virulence regulon transcriptional activator VirF"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:P0C2V5"
FT                   /protein_id="ATY43152.1"
FT                   /translation="MQQNDLTKSLVEAFLYLAPQEGLYPTHISNITLMRVDHSTQPVAV
FT                   LQEPSIVLVIQGVKRAYMGKDIFKFQQGQCLFISIAIPFDCDTLVEREPMLAIAIKFEP
FT                   QMMAELATKMDKEQRPLIEDFDNKEIKLSCGLNIIEMNSVISDVALRLLNLLRSKQDTA
FT                   ILGEQVKRELIYRVLQAGGSDFIQNLSAIMSRSGVIYTICEIIQRDYYRNLTVQELAKQ
FT                   AGMSVSLFHQAFKKVTNYSPLQYIKITRLHKARELILNNQMGVAEAAYEVGYVSASQFS
FT                   REFKRLFGVPPKLSTN"
FT   gene            734709..735707
FT                   /gene="ppsC"
FT                   /locus_tag="ABBFA_00702"
FT                   /old_locus_tag="CTY05_00702"
FT   CDS_pept        734709..735707
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ppsC"
FT                   /locus_tag="ABBFA_00702"
FT                   /old_locus_tag="CTY05_00702"
FT                   /product="Phthiocerol synthesis polyketide synthase type I
FT                   PpsC"
FT                   /EC_number="2.3.1.41"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:P96202"
FT                   /protein_id="ATY43153.1"
FT                   /translation="MNLPTTMKIVEITVPGGPEVLKLQDSNVPVPQADEVLIEVKAAGI
FT                   NRPDVLQRMGLYPMPKGVTQIPGLEVAGVVVAVGEQVQQFKVGDKVCALTNGGGYAEYC
FT                   AVTATQVLPIPENLSFTQAAAIPETFFTVWANLFDIGRLKKDETALIHGGASGIGTTAL
FT                   AICHALGIKTFATVGSEDKVEALSDLTTAINYKTQDFEQEILNHTQEQGVDVILDIVGG
FT                   SYFQKNLNLLKRDGRLVIIGFMGGRIAKEFDLQKLILKRATITGSTMRARNSQEKAQIA
FT                   QSLHEHVWPLLEQGKCLPQIYKTYAFSDVQSAHACMEQGDHIGKIVLEMNA"
FT   gene            735910..736785
FT                   /gene="hchA_1"
FT                   /locus_tag="ABBFA_00703"
FT                   /old_locus_tag="CTY05_00703"
FT   CDS_pept        735910..736785
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hchA_1"
FT                   /locus_tag="ABBFA_00703"
FT                   /old_locus_tag="CTY05_00703"
FT                   /product="Molecular chaperone Hsp31 and glyoxalase 3"
FT                   /EC_number="4.2.1.130"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:P64313"
FT                   /protein_id="ATY43154.1"
FT                   /translation="MNTPASNDKNPTPDLAEDNAFFPSPYSLSQYTSPKTDYDGTTYPT
FT                   PYAGNKKVLMIATDERYIQMQNGKFFSTGNHPVEMLLPMFHLDNAGFEIDVATLSGNPA
FT                   KLEMWAMPKQEQVVLDTFQKYADKLKNPLKLADILENVVGENSPYAAVFIPGGHGVLAK
FT                   IPHSLEVKKVLKWAVEQDKFIITLCHGPASLLAAAVDEQPENYIFKDYQICVFPDSLDK
FT                   GANIDIGYMPGALPWLVGENLEKLGVKILNTGITGQCHRDRKLLTGDSPLASNNLGKLA
FT                   AETLLAEVKD"
FT   gene            complement(736798..736871)
FT                   /locus_tag="ABBFA_00704"
FT                   /old_locus_tag="CTY05_00704"
FT   tRNA            complement(736798..736871)
FT                   /locus_tag="ABBFA_00704"
FT                   /old_locus_tag="CTY05_00704"
FT                   /product="tRNA-Arg"
FT                   /note="tRNA-Arg(cct)"
FT                   /inference="COORDINATES:profile:Aragorn:1.2"
FT   gene            complement(736948..738303)
FT                   /gene="aroP_2"
FT                   /locus_tag="ABBFA_00705"
FT                   /old_locus_tag="CTY05_00705"
FT   CDS_pept        complement(736948..738303)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroP_2"
FT                   /locus_tag="ABBFA_00705"
FT                   /old_locus_tag="CTY05_00705"
FT                   /product="Aromatic amino acid transport protein AroP"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:P15993"
FT                   /protein_id="ATY43155.1"
FT                   /translation="MTNESSTLQRGLKNRHIQLIAMGGAIGTGLFLGSAQVIQSAGPSI
FT                   ILGYAIGGLIAFLIMRHLGEMIVEEPVAGSFSHFAYKYWGKFPGFLAGWNYWMLYVLVA
FT                   MSELTAVAKYINYWWPHIPAWTSVLFFFVVITAINLTNVKFYGESEFWLAIIKVAAVIS
FT                   MIVFGLYLLFTADVGSSISFSNLWSHGGFFPNGFSGLFYMLAFLMFAFGGIELIGMAAA
FT                   EAKDPKKTIPKAINQVVFRILIFYIGSLAILLSLVPWNQLDLGGLDKSPFVMIFSQMGI
FT                   GWAAHLLNFIILTAALSVYNSGMFANSRMLYGLAQQGNAPKIFKKVNKQGVPVPAVLLS
FT                   ALLIFGCVLLNYFVPEDALSHLMYIVVGALVLNWAMISMTHLKFKSAMKKLGQKTHFPA
FT                   LWAPFSNYLVLGFIAVVLYIMWSQGFKESVMMIPIWIILMFILFKVLNAKEQ"
FT   gene            738683..739870
FT                   /gene="mii"
FT                   /locus_tag="ABBFA_00706"
FT                   /old_locus_tag="CTY05_00706"
FT   CDS_pept        738683..739870
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mii"
FT                   /locus_tag="ABBFA_00706"
FT                   /old_locus_tag="CTY05_00706"
FT                   /product="3-methylitaconate isomerase"
FT                   /EC_number="5.3.3.6"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:Q0QLE6"
FT                   /protein_id="ATY43156.1"
FT                   /translation="MSFVPQIKIPATYMRGGTSKGVFFKLDDLPEKAQVAGQARDQLLL
FT                   RVIGSPDPYGKQIDGMGGATSSTSKTVILAKSTQPDHDVDYLFGQVSIDQAFVDWSGNC
FT                   GNLTAAVGSFAISNGLVDADRIPENGLCTVRIWQKNIQKTIIAHVPITNGQVQETGDFE
FT                   LDGVTFPAAEVQIEFLDPADDGEEGGDMFPTGNVVDQLDVPEIGSFQATFINAGIPTIF
FT                   LNAEDLGYEGTELQDHINGDAAALARFEKIRAYGAVQMGLIKDISEAAARQHTPKIAFV
FT                   SKPKNYTASSGKNVSENDVDLLVRALSMGKLHHAMMGTAAVAIGTAAAIPGTLVNLAAG
FT                   GGEREAVRFGHPSGTLRVGAQAELTNGQWVVKKAIMSRSARVLMEGWVRVPGDSF"
FT   gene            740029..740940
FT                   /gene="ispA"
FT                   /locus_tag="ABBFA_00707"
FT                   /old_locus_tag="CTY05_00707"
FT   CDS_pept        740029..740940
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ispA"
FT                   /locus_tag="ABBFA_00707"
FT                   /old_locus_tag="CTY05_00707"
FT                   /product="Farnesyl diphosphate synthase"
FT                   /EC_number="2.5.1.10"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:P22939"
FT                   /protein_id="ATY43157.1"
FT                   /translation="MSSLSQVNADVLKQAQQRIQQDLLTTLAAFSIPEPLKSAVHHAVM
FT                   LGGKRVRPALCYATASLQDNPNFAAARRAAVAVELIHCYSLAHDDLPCMDNDLLRRGQP
FT                   TCHVAFGEDTALLAGDILQSMAFEVLGSRLFDEQGQGTDAAIVLKQIQILATASSKMVC
FT                   GQVLDLQAEAKQISQDELENIHRNKTGALIQAAIMMGAVTIFSGTDQAIPKLRQYGQAI
FT                   GLAFQVQDDILDITSSTETLGKTAGKDEQVQKSTYPALMGLEQAQIYAKELHDQAFEAL
FT                   AHFGENAKELVEISQFLLARTN"
FT   gene            741000..741368
FT                   /locus_tag="ABBFA_00708"
FT                   /old_locus_tag="CTY05_00708"
FT   CDS_pept        741000..741368
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABBFA_00708"
FT                   /old_locus_tag="CTY05_00708"
FT                   /product="hypothetical protein"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="protein motif:CLUSTERS:PRK10250"
FT                   /protein_id="ATY43158.1"
FT                   /translation="MNGEQLHQLAIEAARNLPFSEQTYPFGPEYEVFKILEKIFMLTVE
FT                   VSGVKMINVKCDPYKSQEYQELYPFIIPGYHMNKKHWISIKPHKNLTSDFLRDLIGDSY
FT                   DLVVKKLPLKDQKRLNNQ"
FT   gene            complement(741435..742289)
FT                   /gene="hflK"
FT                   /locus_tag="ABBFA_00709"
FT                   /old_locus_tag="CTY05_00709"
FT   CDS_pept        complement(741435..742289)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hflK"
FT                   /locus_tag="ABBFA_00709"
FT                   /old_locus_tag="CTY05_00709"
FT                   /product="Modulator of FtsH protease HflK"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:P0ABC7"
FT                   /protein_id="ATY43159.1"
FT                   /translation="MPVGTIIVLAFLAFVAVTIFKGVRIVPQGYKWIVQRLGKYHSTLN
FT                   PGLNFVIPYIDDVAYKVTTKDIVLDIPSQEVITRDNAVLLMNAVAYINLTTPEKAVYGI
FT                   ENYTWAIQNLVQTSLRSIVGEMDLDDALSSRDHIKAKLKAAISDDISDWGITLKTVEIQ
FT                   DIQPSSTMQAAMEAQAAAERQRRATVTKADGEKQAAILEADGRLEASRRDAEAQVVLAE
FT                   ASQKAIEMVTSAVGDKEIPVAYLLGEQYVKAMQEMAKSSNAKTVVLPADVLNTIRGIMG
FT                   KHN"
FT   gene            complement(742318..742779)
FT                   /locus_tag="ABBFA_00710"
FT                   /old_locus_tag="CTY05_00710"
FT   CDS_pept        complement(742318..742779)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABBFA_00710"
FT                   /old_locus_tag="CTY05_00710"
FT                   /product="hypothetical protein"
FT                   /note="NfeD-like C-terminal, partner-binding"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="protein motif:Pfam:PF01957.12"
FT                   /protein_id="ATY43160.1"
FT                   /translation="MEFVVEPWHWFVLGILLILSELILPAFAALWFGIAAIMVCFLYWL
FT                   FPDISLTTQIVLWIVLSVLCTLLWFKFIKPLSIDKTKAGLPREATIGQIGMVIQTGLAH
FT                   DQIIVRFPMPILGADEWNCRSTTPVKVGDRVRVIDISGNDLIVQPHSTS"
FT   gene            complement(742885..743802)
FT                   /gene="rssA_2"
FT                   /locus_tag="ABBFA_00711"
FT                   /old_locus_tag="CTY05_00711"
FT   CDS_pept        complement(742885..743802)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rssA_2"
FT                   /locus_tag="ABBFA_00711"
FT                   /old_locus_tag="CTY05_00711"
FT                   /product="NTE family protein RssA"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:P0AFR0"
FT                   /protein_id="ATY43161.1"
FT                   /translation="MKIAQFASIGFISLALFGCDKFSKTPTPTTSIKAREPVIALALGG
FT                   GGAKGFSHIGVIKVLESHGIKPKIVTGTSAGSFVGSIYASGQTPYQLQNLALKLQESDI
FT                   RDLTLNRQGIILGQKLQDYVNRNVGNKPIEKFPIRFAAVATRLDNGQKADFIKGNAGQA
FT                   VRASCSIPNVFVPATIGKQKYVDGGLVSPIPVKTARDMGADIVIAVDISARPAGNRPAN
FT                   MWGLLDQTINIMGQQSINEELKQANVVIQPKVGHLGTLDLKSSNEAILEGEKAAQGQIR
FT                   QIETAIANFKKSPAAFKPAPRPKF"
FT   gene            complement(743870..744496)
FT                   /locus_tag="ABBFA_00712"
FT                   /old_locus_tag="CTY05_00712"
FT   CDS_pept        complement(743870..744496)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABBFA_00712"
FT                   /old_locus_tag="CTY05_00712"
FT                   /product="Acyltransferase"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="protein motif:Pfam:PF01553.15"
FT                   /protein_id="ATY43162.1"
FT                   /translation="MEQHFPNLPSQVPQRGNALSRALFKKLFLAQGWTIEGEVPNFPKA
FT                   VAIISPHTSNIDGWYGFLAIFGLGIQITVLGKDSLFKPPFKRVLDWAGVIPVKRDSANG
FT                   LTEQVVATIQQYDKIWIGMAPEGTRKKAKKMKSGFYHIAAKANIPIVMFSFDYDRKTIH
FT                   CLGYLTPSGNYDEDLAKIFERYEGKISPKNRNWLAEPLQNLVKKT"
FT   gene            744624..745871
FT                   /locus_tag="ABBFA_00713"
FT                   /old_locus_tag="CTY05_00713"
FT   CDS_pept        744624..745871
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABBFA_00713"
FT                   /old_locus_tag="CTY05_00713"
FT                   /product="muropeptide transporter"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="protein motif:CLUSTERS:PRK11010"
FT                   /protein_id="ATY43163.1"
FT                   /translation="MFRQQNLYLLLFSLYWAQGLPVGFMTHALPVILRAEGVSLAHIGG
FT                   FGLLMLPWSIKIFWAPWVDRHAISHLGHYRSWILPAQFLTVGVLCILSFFPIQVLDQPL
FT                   YLFIFFITLLFMNLTGATQDIATDALAVNLLQHDQQHWGNTFQVVGSRLGFIVGGGAVL
FT                   WCLDWLSWQPTFLLLAALVFINTLPILLFKEPSHTSHSPHQYSQPSLVTKIKAYLGYFS
FT                   QNKELRSWLIVLITFKVADGLAGPLLKPLMVDMGLSFTQIGIYITMLGAVAALLGALIA
FT                   GWMLKHFSRSTALMTFSILKIMSLGGYAYLAYAYEQKIKINAWLIYAVNALEDAFAAML
FT                   LVVMLTLVMHYSRKNYAGTDFTFQVSVMATVSGGLYSFSGVIADALGYFHYLIAIVSIA
FT                   VLFLIPIYLWKDAKTV"
FT   gene            746417..747721
FT                   /locus_tag="ABBFA_00714"
FT                   /old_locus_tag="CTY05_00714"
FT   CDS_pept        746417..747721
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABBFA_00714"
FT                   /old_locus_tag="CTY05_00714"
FT                   /product="hypothetical protein"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /protein_id="ATY43164.1"
FT                   /translation="MDLFLNRKSFVVKSLAITVTALMMSGANAATSDKEEIRKLRQEVE
FT                   ALKALVQEQRQVQQQQQQVQQQQQVQLAEVKAQPQPVAAPASPLAGFKSKAGADVNLYG
FT                   FVRGDANYIIEGADNDFGDVSKSDGKTHDKLRATAKTTRLGLDFNTPVGDDKVGGKIEV
FT                   DFAGSTTDSNGSLRIRHAYLTYNNWLFGQTTSNFLSNHAPEMIDFSTNIGGGTKRVPQV
FT                   RYNYKLGPTTQLFVSAEKGDSTTSVTGDSIKYSLPALTAKITQGYAEGRGSASARVLVE
FT                   NYKSQLADDDKTGWGVAVGTDFKVSDPLKLFADASYVVGDNSYLYGSNSPYAVDGNSIE
FT                   QNEFVAVQVGGTYKILPNLRSTLAYGAQFSDDGTDYARLNASANEKVQQAWINFIYTPV
FT                   KPIDLGVEYVNGKRDTFDGKSYKDNRVGLMAKYSF"
FT   gene            747950..749551
FT                   /gene="eptA"
FT                   /locus_tag="ABBFA_00715"
FT                   /old_locus_tag="CTY05_00715"
FT   CDS_pept        747950..749551
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="eptA"
FT                   /locus_tag="ABBFA_00715"
FT                   /old_locus_tag="CTY05_00715"
FT                   /product="Phosphoethanolamine transferase EptA"
FT                   /EC_number="2.7.-.-"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:P36555"
FT                   /protein_id="ATY43165.1"
FT                   /translation="MFNLIIAIWLGAILNIGFYHQVHTLTPYFGVKAILFLAATLVILV
FT                   ATYYAVLQILNWKWTAKIFAILLIFIGGFSSYFVNTLGVIISPDQIQNMVQTDVSEVTD
FT                   LISLRFVLWTVFFVILPIFLITQVKFKQEKVSRLLLKKVFSLVASFAVVGVLLFTYYVD
FT                   FAAIFREHRDLKGMISPQNSISSLMSYYHKKAPKKNLPLVIYGQDAHQVQRVQKNLPKL
FT                   MILVVGETARAESFSLNGYAKNTNPELSKQDIFNFSQVSSCGTATAVSVPCMFSGMPRV
FT                   DYDEQLASHREGLLDIAKRAGYQVTWIDNNSGCKGACDRVEQYQIPENLKKKWCKDGEC
FT                   YDDILIDSLKQYLATIAKDDDRPRLIVLHQVGSHGPAYYKRAPEAYQPFKPTCDTNAIQ
FT                   GCSQTELLNSYDNTIVYTDHVLSQMINTLKEISKYQTGLWYLSDHGESTGEHGLYLHGS
FT                   PYAIAPSQQTHVPMIMWFSESWKQRNLAQVNCLSQQTKQKLSQDNLFPSLLSLLDVKTQ
FT                   VINPQLDMLHSCAHVN"
FT   gene            749566..750240
FT                   /gene="qseB_1"
FT                   /locus_tag="ABBFA_00716"
FT                   /old_locus_tag="CTY05_00716"
FT   CDS_pept        749566..750240
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="qseB_1"
FT                   /locus_tag="ABBFA_00716"
FT                   /old_locus_tag="CTY05_00716"
FT                   /product="Transcriptional regulatory protein QseB"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:P52076"
FT                   /protein_id="ATY43166.1"
FT                   /translation="MTKILMIEDDFMIAESTITLLQYHQFEVEWVNNGLDGLAQLAKTK
FT                   FDLILLDLGLPMMDGMQVLKQIRQRAATPVLIISARDQLQNRVDGLNLGADDYLIKPYE
FT                   FDELLARIHALLRRSGVEAQLASQDQLLESGDLVLNVEQHIATFKGQRIDLSNREWAIL
FT                   IPLMTHPNKIFSKANLEDKLYDFDSDVTSNTIEVYVHHLRAKLGKDFIRTIRGLGYRLG
FT                   QS"
FT   gene            750266..751600
FT                   /gene="qseC_1"
FT                   /locus_tag="ABBFA_00717"
FT                   /old_locus_tag="CTY05_00717"
FT   CDS_pept        750266..751600
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="qseC_1"
FT                   /locus_tag="ABBFA_00717"
FT                   /old_locus_tag="CTY05_00717"
FT                   /product="Sensor protein QseC"
FT                   /EC_number="2.7.13.3"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:P45336"
FT                   /protein_id="ATY43167.1"
FT                   /translation="MHYSLKKRLIWGTSIFSVILGCILIFSAYKVALQEVDEILDTQMK
FT                   YLAERTAEHPLKTVSSKFDFHKTYHEEDLFIDIWAYKDQAHLSHHLHLLVPPVEQAGFY
FT                   SHKTAQGIVRTYVLPLKDYQIQVSQQERVREAFAWELAGSMFIPYLIILPFAIFALAAI
FT                   IRRGLKPIDDFKNELKERDSEELTPIEVHDYPQELLPTIDEMNRLFERISKAQNEQKQF
FT                   IADAAHELRTPVTALNLQTKILLSQFPEHESLQNLSKGLARIQHLVTQLLALAKQDVTL
FT                   SMVEPTGYFQLNDVALNCVEQLVNLAMQKEIDLGFVRNEPIEMHSIEPTVHSIIFNLID
FT                   NAIKYTPHQGVINISVYTDQDHYACIQIEDSGAGIDPENYDKVLKRFYRVHHHLEVGSG
FT                   LGLSIVDRATQRLGGTLTLDKSLELGGLSVLVKLPKVLHLHETRA"
FT   gene            complement(751601..752200)
FT                   /locus_tag="ABBFA_00718"
FT                   /old_locus_tag="CTY05_00718"
FT   CDS_pept        complement(751601..752200)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABBFA_00718"
FT                   /old_locus_tag="CTY05_00718"
FT                   /product="PAP2 superfamily protein"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="protein motif:Pfam:PF01569.15"
FT                   /protein_id="ATY43168.1"
FT                   /translation="MYLIQPWIDSTGHFFNRDNWYLERLNHEIVKQIITAVYVIFFGLW
FT                   LASFKLKKLKPYRWQYGYMFFVSMLGSSIVGLIKSQSAHACPWNMVHPNTLGSYIWDFS
FT                   AKHGHCFPGGHASAGFILMTGYFVYRLEQPKRAYFYLFSGILLGFMMGWAQMMRGAHFL
FT                   SHNLWTGWVVWAINILFYAICIHRFEFEKQVKQELT"
FT   gene            complement(752452..753639)
FT                   /gene="amtB_1"
FT                   /locus_tag="ABBFA_00719"
FT                   /old_locus_tag="CTY05_00719"
FT   CDS_pept        complement(752452..753639)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="amtB_1"
FT                   /locus_tag="ABBFA_00719"
FT                   /old_locus_tag="CTY05_00719"
FT                   /product="Ammonia channel precursor"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:P69681"
FT                   /protein_id="ATY43169.1"
FT                   /translation="MQNVDLFFLLLGAVLVLAMHAGFAFLELGTVRHKNQVNALSKILT
FT                   DFALSAIAYFFVGYYISYGQHFFHEGTVLSNDHGYNLMRCFFLLTFAAAIPAIISGGIA
FT                   ERAKMRSQAIATLALVALVYPFFEGMVWNGNYGLQKWLETTFGAAFHDFAGSVVVHAMG
FT                   GWIALAAVILLGARSGRYKKDGRVSAHPPSSIPFLALGSWILIVGWFGFNVMSAQRVDA
FT                   ISGLVAINSLMAMVGGTITANAIGKNDPGFLHNGPLAGLVAICAGSDIVHPVSALVIGG
FT                   AAGAMFVYLFTYTQNKLKVDDVLGVWPLHGVCGAFGGIAVGIFGQKWLGGLGGVSFISQ
FT                   LIGTALAIAIALAGGFIVYGILKATIGIRLSQEDEFRGADLSIHKISANSEEGMF"
FT   gene            complement(753942..754823)
FT                   /gene="cmpR_1"
FT                   /locus_tag="ABBFA_00720"
FT                   /old_locus_tag="CTY05_00720"
FT   CDS_pept        complement(753942..754823)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cmpR_1"
FT                   /locus_tag="ABBFA_00720"
FT                   /old_locus_tag="CTY05_00720"
FT                   /product="HTH-type transcriptional activator CmpR"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:Q55459"
FT                   /protein_id="ATY43170.1"
FT                   /translation="MTFTQLEIFALIAELKSFTATAEKLGISQSAVSHALKSLEQQWGI
FT                   NLISRTQSDIELTTGQQLLTHVKELLSISDTLEKEVAAIHGLNEGTLRIGSFGASSSIY
FT                   LLPEILETFRQRYPKIEIYIDEGEDKEVAQWLLERRIEVGFLIMPDERFDTFPLIEDRF
FT                   VALIPSGYPLAQQLYIDPAHLENCPFIMTMAGSRHQVELILKNFNVKPDIKFYVSQILS
FT                   IVSMVHNQLGISIVSDMVLTKELLSLYPNVVKRPFKPNLKRSIGLAVKNKKHISPAVKA
FT                   FIEVAQEVWSDH"
FT   gene            754940..755845
FT                   /locus_tag="ABBFA_00721"
FT                   /old_locus_tag="CTY05_00721"
FT   CDS_pept        754940..755845
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABBFA_00721"
FT                   /old_locus_tag="CTY05_00721"
FT                   /product="Membrane transport protein"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="protein motif:Pfam:PF03547.12"
FT                   /protein_id="ATY43171.1"
FT                   /translation="MNSIVLSLFPLVALIASGYLFKKYHFFSDEFWAGAEKLNYYILFP
FT                   ALLFSTLSTAKIDLQSLSAAIIVMLIVVLAVTAFLYILRMFWQIAPARFGVHVQSMVRF
FT                   NTYIGLALVTSLFKSEGMAILAILLALCIPLVNVISVLALTSKEHMAIKPVLIALLKNP
FT                   LIASCVVGAAVNALHIPIWEGFTQFIKLFSVSSLPLGLLCVGAALQFLQIKKDIVVLAA
FT                   DTFARLLAVPALAYMVCMWFSLPSLQTQILVIFFALPTASASYILTKVLGGDSQLMAAV
FT                   ISFQTLCAAVTLPLVIWWLS"
FT   gene            755973..756989
FT                   /locus_tag="ABBFA_00722"
FT                   /old_locus_tag="CTY05_00722"
FT   CDS_pept        755973..756989
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABBFA_00722"
FT                   /old_locus_tag="CTY05_00722"
FT                   /product="hypothetical protein"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /protein_id="ATY43172.1"
FT                   /translation="MSFDLKVSLQQRSEPSAQQKKLNRLIDKIEQQKVSLSTWQNAQAE
FT                   IQQHIRQKLMPVYNDLHIVLFQQLEQLWNILHSHEFSKADIQQFDEKIAQLAQMLKRSK
FT                   MLSAEQLELVKQIDTFYQQHAGESVKKNKKAQPIEFEYEENADKGSEFEEEFEKYAAEQ
FT                   QQAREQAKQQRQQQKREQAEQMAAQSLKTVYLKIAAMIHPDREQDETKKEEKTELFQQA
FT                   SQAYEKQDLFYLLKLQLQLEQNKGLGAKELSAEQLRFYKLALDAQSQQLESQITEILDS
FT                   FQLAKNVKAEHVHISDVYKAVDADCAELKQQVKWEKERLKHMKKESGVEMLLGHGVL"
FT   gene            757121..757807
FT                   /locus_tag="ABBFA_00723"
FT                   /old_locus_tag="CTY05_00723"
FT   CDS_pept        757121..757807
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABBFA_00723"
FT                   /old_locus_tag="CTY05_00723"
FT                   /product="hypothetical protein"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /protein_id="ATY43173.1"
FT                   /translation="MGISAGGLAVPFNGTMENAIELVSGWKNRTINVVSLSERTDFDTR
FT                   YDNCISLKIFNNVLIIYHADFLFSAMDDHSLWAKRFKESNLTEWVLFFAAYDSGGTYGY
FT                   SFFQYGKFVRSVFQMVDDFKIEGRLSELEQKIINSPVFFEYFNEEDESEYLDLEGLKAN
FT                   DLLDANGDIQEWADCYKCYYFEDEYVAEHDLASRFLSEMVTEYVGCDFFYDTEYDQIYL
FT                   EFIQDY"
FT   gene            complement(757874..760753)
FT                   /gene="valS"
FT                   /locus_tag="ABBFA_00724"
FT                   /old_locus_tag="CTY05_00724"
FT   CDS_pept        complement(757874..760753)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="valS"
FT                   /locus_tag="ABBFA_00724"
FT                   /old_locus_tag="CTY05_00724"
FT                   /product="Valine--tRNA ligase"
FT                   /EC_number="6.1.1.9"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:P07118"
FT                   /protein_id="ATY43174.1"
FT                   /translation="MTDAQTAQNIATTYDPTEIEKKWYKTWEEQGYFKPSGHGESFCIM
FT                   IPPPNVTGSLHMGHGFNNAIMDALTRYNRMMGKNTLWQPGTDHAGIATQMVVERQLGLQ
FT                   GITRHDLGREKFIEKVWEWKEQSGGTITKQIRRLGSSVDWSRERFTMDEGLSNAVKEVF
FT                   VRLHEDGLIYRGKRLVNWDPKLQTALSDLEVESKEEKGSLWHFKYFFEDKSVKTQDGKD
FT                   YLVVATTRPETLLGDTAVAVHPEDERYAHLVGKNIVLPITGRLIPIVADDYVEKDFGTG
FT                   CVKITPAHDFNDYELGKRNSLPIINIFNKNAEVLGEFEYIAKAGEQISKTITAPADYAG
FT                   LERFEARKKLVAQAEAEGWLDQIQPYDLKAPRGDRSGVIIEPLLTDQWYVKIAPLAEPA
FT                   IEAVQDGRIKFVPEQYSNMYMAWMRDIQDWCISRQLWWGHRIPAWYDADGNIYVGRSEE
FT                   EVRAKNNIAADVELKQDEDVLDTWFSSALWTFSTLGWPEQTPELKTFHPTDVLVTGFDI
FT                   IFFWVARMIMMTMHFMKNEDGSSQIPFKTVYVHGLVRDGEGQKMSKSKGNVLDPLDLID
FT                   GIDLESLVAKRTTGLMNPKDAAKIEKSTRKEFPEGINAYGTDAVRFTFCALANTGRDIK
FT                   FDLKRVEGYRNFCNKIWNATRFVLMNVEGQTVGQQARPDLWELPEQWIISRLQKAEAAV
FT                   HQAFATYRLDLAAQAIYDFIWNEYCDWYVELTKPVLNDAEVSEERKAEVRRVLLAVMEA
FT                   SLRLAHPLMPYLTEEIWQTLAPMLGQGGPTIMTAQYPIPEQAKINEQAEADMQWLQGLI
FT                   GAVRNIRGEMGLGNARLLPVLLQNTSDAEREQIIRIEALFKALAKVESIEFLNQDQEPP
FT                   LSCSSVVSHASVFVPMKGLIDPKAELARLQKDLDKIQKQHDQIANKLANEGFVSKAPAA
FT                   VVEGEKAKLAEFAAQLEKVKANMEQIAAL"
FT   gene            760950..761627
FT                   /locus_tag="ABBFA_00725"
FT                   /old_locus_tag="CTY05_00725"
FT   CDS_pept        760950..761627
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABBFA_00725"
FT                   /old_locus_tag="CTY05_00725"
FT                   /product="hypothetical protein"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /protein_id="ATY43175.1"
FT                   /translation="MSYKVFLKISDSTYTQFASIREKLHAGVRESQSKVLGDVLSDLSC
FT                   EIIEQVFSVLLKDEQDNSTMTQKQRYESEKVLQQILDTFRKYMPWSVSFFGNERLLPLV
FT                   DYMTSLMKEREQDVYITYPITPQLVQQAQTLTEQIREGNMQSVEKAFQTLIQIVDLGVT
FT                   SLVREPKKRLKFNLVVDKTLNGVINMTTHLGYKRLEKLGTQVDQTTATHYINHFLAFMH
FT                   QAA"
FT   gene            761653..762459
FT                   /gene="fabG_1"
FT                   /locus_tag="ABBFA_00726"
FT                   /old_locus_tag="CTY05_00726"
FT   CDS_pept        761653..762459
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fabG_1"
FT                   /locus_tag="ABBFA_00726"
FT                   /old_locus_tag="CTY05_00726"
FT                   /product="3-oxoacyl-[acyl-carrier-protein] reductase FabG"
FT                   /EC_number="1.1.1.100"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:Q9KQH7"
FT                   /protein_id="ATY43176.1"
FT                   /translation="MAKLDTLQNKVVWITGASSGLGKALAGEFALQGAQVILTSRRFEE
FT                   LEEVRVGLLHPDQHLSVVADITNQEQVQEAYEQILKAKGRIDWLINNAGLSQRALIQDT
FT                   TMATERAIMEVDYFSQVALTKTVLPTMLKQKSGRVVFVSSVAGLLGTQYRASYSAAKAA
FT                   IHMWANSLRAEVADQGVEVSVIFPGFVKTNVSFNALNGAGQPQGHQDEAIENGLEADVF
FT                   AEQSVKALMQGQEYIVVGGTKEKLGVMVSRMSPKLLYKMIRKTKVK"
FT   gene            762514..762948
FT                   /locus_tag="ABBFA_00727"
FT                   /old_locus_tag="CTY05_00727"
FT   CDS_pept        762514..762948
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABBFA_00727"
FT                   /old_locus_tag="CTY05_00727"
FT                   /product="hypothetical protein"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /protein_id="ATY43177.1"
FT                   /translation="MDQDYHRILEVITRFQLVFDQKNWDAFDELLADQLEVDYLQFRGE
FT                   PLCVVSCHEYKGSRQQALSHLRLQHNLSNPLIRIEQDQAWLECNYQIYRFSENDYFHSF
FT                   GRYYFTLAKQQGIWKITGICQHLTKNIGNPRIHFSAMGQC"
FT   gene            complement(762945..763379)
FT                   /locus_tag="ABBFA_00728"
FT                   /old_locus_tag="CTY05_00728"
FT   CDS_pept        complement(762945..763379)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABBFA_00728"
FT                   /old_locus_tag="CTY05_00728"
FT                   /product="hypothetical protein"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="protein motif:CLUSTERS:PRK00967"
FT                   /protein_id="ATY43178.1"
FT                   /translation="MDNLIFQLVIFLILFSIGWAFGRHIEQKHLNELLEKEQQFAHIRI
FT                   DTNRFATSDQLGHFISSNVVISHDYFKYVLASIKNILGGRLTSYESIVERARREAIVRL
FT                   KQQAQSVGANHIMGVRLSTTELGMQGGMVEVFAYGTAVKD"
FT   gene            complement(763387..763737)
FT                   /locus_tag="ABBFA_00729"
FT                   /old_locus_tag="CTY05_00729"
FT   CDS_pept        complement(763387..763737)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABBFA_00729"
FT                   /old_locus_tag="CTY05_00729"
FT                   /product="hypothetical protein"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="protein motif:CLUSTERS:PRK00967"
FT                   /protein_id="ATY43179.1"
FT                   /translation="MLLSNLESVPGHQILKQLDVVYGSTVRSKHVGRDLMASLKNIVGG
FT                   ELTGYTELLEESRQEAMQRMIVKAQQLGANAIVGIRFSTSNIAQGASELFVYGTAVVVQ
FT                   PQAPHLPDPFNA"
FT   gene            complement(763847..765301)
FT                   /gene="oprM_1"
FT                   /locus_tag="ABBFA_00730"
FT                   /old_locus_tag="CTY05_00730"
FT   CDS_pept        complement(763847..765301)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="oprM_1"
FT                   /locus_tag="ABBFA_00730"
FT                   /old_locus_tag="CTY05_00730"
FT                   /product="Outer membrane protein OprM precursor"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:Q51487"
FT                   /protein_id="ATY43180.1"
FT                   /translation="MQKVWSISGRSIAVSALALALAACQSMRGPEPVVKTDIPQSYAYN
FT                   SASGTSIAEQGYKQFFADPRLLEVIDLALANNRDLRTATLNIERAQQQYQITQNNQLPT
FT                   IGASGSAIRQVSQSRDPNNPYSTYQVGLGVTAYELDFWGRVRSLKDAALDSYLATQSAR
FT                   DSTQISLISQVAQAWLNYSFATANLRLAEQTLKAQLDSYNLNKKRFDVGIDSEVPLRQA
FT                   QISVETARNDVANYKTQIAQAQNLLNLLVGQPVPQNLLPTQPVKRIAQQNVFTAGLPSD
FT                   LLNNRPDVKAAEYNLSAAGANIGAAKARLFPTISLTGSAGYASTDLSDLFKSGGFVWSV
FT                   GPSLDLPIFDWGTRRANVKISETDQKIALSDYEKSVQSAFREVNDALATRANIGERLTA
FT                   QQRLVEATNRNYTLSNARFRAGIDSYLTVLDAQRSSYAAEQGLLLLQQANLNNQIELYK
FT                   TLGGGLKANTSDTVVHQPSSAELKKQ"
FT   gene            complement(765301..768477)
FT                   /gene="mexB_1"
FT                   /locus_tag="ABBFA_00731"
FT                   /old_locus_tag="CTY05_00731"
FT   CDS_pept        complement(765301..768477)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mexB_1"
FT                   /locus_tag="ABBFA_00731"
FT                   /old_locus_tag="CTY05_00731"
FT                   /product="Multidrug resistance protein MexB"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:P52002"
FT                   /protein_id="ATY43181.1"
FT                   /translation="MAQFFIHRPIFAWVIALVIMLAGILTLTKMPIAQYPTIAPPTVTI
FT                   AATYPGASAETVENTVTQIIEQQMNGLDGLRYISSNSAGNGQASIQLNFEQGVDPDIAQ
FT                   VQVQNKLQSATALLPEDVQRQGVTVTKSGASFLQVIAFYSPDNNLSDSDIKDYVNSSIK
FT                   EPLSRVAGVGEVQVFGGSYAMRIWLDPAKLTSYQLTPSDIATALQAQNSQVAVGQLGGA
FT                   PAVQGQVLNATVNAQSLLQTPEQFKNIFLKNTASGAEVRLKDVARVELGSDNYQFDSKF
FT                   NGKPAAGLAIKIATGANALDTAEAVEQRLSELRKNYPTGLADKLAYDTTPFIRLSIESV
FT                   VHTLIEAVILVFIVMFLFLQNWRATIIPTLAVPVVVLGTFAVINIFGFSINTLTMFAMV
FT                   LAIGLLVDDAIVVVENVERVMSEDHTDPVTATSRSMQQISGALVGITSVLTAVFVPMAF
FT                   FGGTTGVIYRQFSITLVTAMVLSLIVALTFTPALCATILKQHDPNKEPSNNIFARFFRS
FT                   FNNGFDRMSHSYQNGVSRMLKGKIFSGVLYAVVVALLVFLFQKLPSSFLPEEDQGVVMT
FT                   LVQLPPNATLDRTGKVIDTMTNFFMNEKDTVESIFTVSGFSFTGVGQNAGIGFVKLKDW
FT                   SKRTTPETQIGSLIQRGMALNMIIKDASYVMPLQLPAMPELGVTAGFNLQLKDSSGQGH
FT                   EKLIAARNTILGLASQDKRLVGVRPNGQEDTPQYQINVDQAQAGAMGVSIAEINNTMRI
FT                   AWGGSYINDFVDRGRVKKVYVQGDAGSRMMPEDLNKWYVRNNKGEMVPFSAFATGEWTY
FT                   GSPRLERYNGVSSVNIQGTPAPGVSSGDAMKAMEEIIGKLPSMGLQGFDYEWTGLSLEE
FT                   RESGAQAPFLYALSLLIVFLCLAALYESWSIPFSVLLVVPLGVIGAIVLTYLGMIIKGD
FT                   PNLSNNIYFQVAIIAVIGLSAKNAILIVEFAKELQEKGEDLLDATLHAAKMRLRPIIMT
FT                   TLAFGFGVLPLALSTGAGAGSQHSVGFGVLGGVLSATFLGIFFIPVFYVWIRSIFKYKP
FT                   KTINTQEHKS"
FT   gene            complement(768490..769740)
FT                   /gene="acrA"
FT                   /locus_tag="ABBFA_00732"
FT                   /old_locus_tag="CTY05_00732"
FT   CDS_pept        complement(768490..769740)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acrA"
FT                   /locus_tag="ABBFA_00732"
FT                   /old_locus_tag="CTY05_00732"
FT                   /product="Multidrug efflux pump subunit AcrA precursor"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:P0AE06"
FT                   /protein_id="ATY43182.1"
FT                   /translation="MMSAKLWAPALTACALATSIALVGCSKGSDEKQQAAAAQKMPPAE
FT                   VGVIVAQPQSVEQSVELSGRTSAYQISEVRPQTSGVILKRLFAEGSYVREGQALYELDS
FT                   RTNRATLENAKASLLQQQANLASLRTKLNRYKQLVSSNAVSKQEYDDLLGQVNVAEAQV
FT                   AAAKAQVTNANVDLGYSTIRSPISGQSGRSSVTAGALVTANQTDPLVTIQQLDPIYVDI
FT                   NQSSAELLRLRQQLSKGSLNNSNNTKVKLKLEDGSTYPIEGQLAFSDASVNQDTGTITL
FT                   RAVFSNPNHLLLPGMYTTAQIVQGVVPNAYLIPQAAITRLPTGQAVAMLVNAKGVVESR
FT                   PVETSGVQGQNWIVTNGLKAGDKVIVDGVAKVKEGQEVSAKPYQAQPANSQGAAPNAAK
FT                   PAQSGKPQAEQKAASNA"
FT   gene            complement(769765..770391)
FT                   /locus_tag="ABBFA_00733"
FT                   /old_locus_tag="CTY05_00733"
FT   CDS_pept        complement(769765..770391)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABBFA_00733"
FT                   /old_locus_tag="CTY05_00733"
FT                   /product="phosphatidylglycerophosphatase B"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="protein motif:CLUSTERS:PRK10699"
FT                   /protein_id="ATY43183.1"
FT                   /translation="MPYLLLCIGCVFLGLGVLGLFVPSLQSLDLLTVQTLSHHRLDYLN
FT                   SITTFLARVGGMPFVCFLSFLVCMYLAWYKKYITVIFISLGVIGSITMGWLLKWCVNRP
FT                   RPPEAYHIVESYGASFPSAHSVYASTLACLAMIMLCHKHNINSPYIVLISCLWFVCMGL
FT                   SRIYAGVHFPTDVLAGWGIGFIWIALLWLWLLQTQSRLSRKQIYF"
FT   gene            complement(770576..772636)
FT                   /locus_tag="ABBFA_00734"
FT                   /old_locus_tag="CTY05_00734"
FT   CDS_pept        complement(770576..772636)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABBFA_00734"
FT                   /old_locus_tag="CTY05_00734"
FT                   /product="Site-specific recombinase"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="protein motif:Pfam:PF10136.3"
FT                   /protein_id="ATY43184.1"
FT                   /translation="MHINFSEHFFKIQKQLENPQAVIDENILIDLVSALRPSDPQDTDE
FT                   IEQKIQAFIDSLLLTPTAPALLQTFLLRLINQYKQVSLYADSGILSLDGFWNQLGQRLG
FT                   SHFLPLIEDASQLKILIGKIFYLESDSIWLNNVDDKDWATLFGLIGQSNSNVDEKHAIQ
FT                   REMIKAITVLSYRISGIGLYPEFINAQPELTEYESPFLVQNREIIEFIEKYKKQDISSN
FT                   DIAVLPPPDASQAFVMLEQCRDVVLKIRRATKRIGVSLSLTYLLSLLEQCLDRIELLLY
FT                   LVVDDSEGRYVSLGNLISDLTKAHYSEKSVRSLLSTTSELIAFQVTENASRTGEHYVST
FT                   DTKGFWGMYKAAAGAGVIIACMASLKILAARMTMAPLMQAFTFSMNYSLGFILIHVLHF
FT                   TVATKQPAMTAAALAATVQQRKGSKTAQIAELAALIINIIRTQFIAILGNISIAIPTAA
FT                   LITFAWQFYLDEPLLTHTKATYLLHSLNPFTSLAVPHAAIAGVCLFLSGLIAGYFDNMA
FT                   VYRKVGPRLKAHRRLRNLFGQERLNRFAEYIERNLGALAGNFLFGVMLGSMGTIGFILG
FT                   LPLDIRHIAFASANFIQGLMTINGSPDIGLIIVSFLGVLCIGLTNLFVSFTLTIIVALR
FT                   ARRVRFEQWKPLAKLVMTHFLTRPSDFFWPPKQPLELEENAQANSGKKAEH"
FT   gene            complement(772651..773628)
FT                   /gene="sdsA"
FT                   /locus_tag="ABBFA_00735"
FT                   /old_locus_tag="CTY05_00735"
FT   CDS_pept        complement(772651..773628)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sdsA"
FT                   /locus_tag="ABBFA_00735"
FT                   /old_locus_tag="CTY05_00735"
FT                   /product="All-trans-nonaprenyl-diphosphate synthase
FT                   (geranyl-diphosphate specific)"
FT                   /EC_number="2.5.1.84"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:O24743"
FT                   /protein_id="ATY43185.1"
FT                   /translation="MVIDFKQDILAPVATDFAAMDHLINEGISSKVGLVMSVSKHVVEA
FT                   GGKRMRPIMCLLAARACGLDNMQNAQRLAAIIEMLHTATLVHDDVVDESGLRRGRPTAN
FT                   ATWNNQTAVLVGDFLIARAFDLLVDLNNMTLLKDFSTGTCEIAEGEVLQLQSQHQPDTT
FT                   EETYLKIIHGKTSRLFELATEGAAILAGQEAYREPLRLFAGHFGNAFQIIDDILDYTSD
FT                   AETLGKNIGDDLMEGKPTLPLISALAHSTGEEHAIIRRSIATGGVDQLPKVIEIVQKSG
FT                   ALDYCQRRAQEETEAALQALSILPDTPYRQALINLTRLALHRIQ"
FT   gene            774072..774383
FT                   /gene="rplU"
FT                   /locus_tag="ABBFA_00736"
FT                   /old_locus_tag="CTY05_00736"
FT   CDS_pept        774072..774383
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplU"
FT                   /locus_tag="ABBFA_00736"
FT                   /old_locus_tag="CTY05_00736"
FT                   /product="50S ribosomal protein L21"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:P0AG48"
FT                   /protein_id="ATY43186.1"
FT                   /translation="MYAVIQSGGKQHRVVEGETLKVELLKAESGATITFDDVLMVVNGD
FT                   NIQIGAPVVAGAKVTAEVIGHGRHDKIRIIKMRRRKHYRKQQGHRQWFTELKITGISG"
FT   gene            774402..774659
FT                   /gene="rpmA"
FT                   /locus_tag="ABBFA_00737"
FT                   /old_locus_tag="CTY05_00737"
FT   CDS_pept        774402..774659
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmA"
FT                   /locus_tag="ABBFA_00737"
FT                   /old_locus_tag="CTY05_00737"
FT                   /product="50S ribosomal protein L27"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:Q9HVL7"
FT                   /protein_id="ATY43187.1"
FT                   /translation="MATKKAGGSTKNGRDSNPKMLGVKVYGGQTVTAGNIIVRQRGTEF
FT                   HAGANVGMGRDHTLFATADGVVKFEVKGQFGRRYVKVETV"
FT   gene            774900..775595
FT                   /gene="lolA"
FT                   /locus_tag="ABBFA_00738"
FT                   /old_locus_tag="CTY05_00738"
FT   CDS_pept        774900..775595
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lolA"
FT                   /locus_tag="ABBFA_00738"
FT                   /old_locus_tag="CTY05_00738"
FT                   /product="Outer-membrane lipoprotein carrier protein
FT                   precursor"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:Q3KA81"
FT                   /protein_id="ATY43188.1"
FT                   /translation="MNMLRKTMCAITLSASVLAPVMSTTAFAAPVAAPEQQAIGNLVNQ
FT                   LSGLQRLTADFEQTTKANTKTVAQKKGLSAQHMNQTFKGSMKVERPGKFYWETVSPSKQ
FT                   TIVTSGKTVWIYDPDLQQAVRQSLDDQVADTPALLLSGNTNQIMKSYRVTQPDKSKLYF
FT                   TLFPKKEDGAFQSLTISFGANKAPTLMVLQDSLGQTTYVRFKNVKVNASIPASTFNFTP
FT                   PKGTDIIDQ"
FT   gene            775723..776511
FT                   /locus_tag="ABBFA_00739"
FT                   /old_locus_tag="CTY05_00739"
FT   CDS_pept        775723..776511
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABBFA_00739"
FT                   /old_locus_tag="CTY05_00739"
FT                   /product="hypothetical protein"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /protein_id="ATY43189.1"
FT                   /translation="MQLYDKKIIFILPMLAAMVAVSGCQPKSTAKDEQPASSASVKEQK
FT                   QAEVPVIQAKVVPVKLPKPKVCLEDGCTEYDFQTVQTNQKWINDYFTNRIKKADPNAFA
FT                   NLADKPVEVPEGEPSSSQSAIYVRYLGQNYNLATFAFQTYSYSAGAAHGMSHQEFVNFD
FT                   LLNKKHITVEELIKPDVEKQLVDALFDANTNWLQEHNISREKLQLSDNFYYGANGIVFV
FT                   YPIYELASYAEGMSELTLPYFEAAKYIKPEYLPSVPNYNL"
FT   gene            776630..777901
FT                   /gene="serS"
FT                   /locus_tag="ABBFA_00740"
FT                   /old_locus_tag="CTY05_00740"
FT   CDS_pept        776630..777901
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="serS"
FT                   /locus_tag="ABBFA_00740"
FT                   /old_locus_tag="CTY05_00740"
FT                   /product="Serine--tRNA ligase"
FT                   /EC_number="6.1.1.11"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:P0A8L1"
FT                   /protein_id="ATY43190.1"
FT                   /translation="MIDPKLLRNNIEVVNAGLAKRGVQLDVQEWASLETRRKDLQSKTE
FT                   KLQAERNAGAKQVGQIKKSGGDASEIMARMQAIGDEIKAAEVALSELQNEIEQKALSIP
FT                   NLPDESVPAGKDENDNVEISKWGTPRQFDFEIKDHTDLGEWMGGLEFETATKLTGSRFS
FT                   VLKGPLARLQRALTQFMLDTHTLKNGYTEAYVPYLVNADSLRGTGQLPKFEEDLFKLQG
FT                   EKEYYLIPTAEVPVTNFVRDEIIDADRLPLKYAAHTPCFRSEAGSYGRDTRGLIRQHQF
FT                   DKVEMVQIVKPETSMQALEELTAHAEGILQALGLPYRKILLCGGDMGFGATKTYDLEVW
FT                   VPSQNTYREISSCSNMGDFQARRMKARYRMDQKKTELVHTLNGSGLAVGRTLLAVMENY
FT                   QREDGSIEIPEVLRPYMGGATFID"
FT   gene            777969..779342
FT                   /gene="cysG"
FT                   /locus_tag="ABBFA_00741"
FT                   /old_locus_tag="CTY05_00741"
FT   CDS_pept        777969..779342
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysG"
FT                   /locus_tag="ABBFA_00741"
FT                   /old_locus_tag="CTY05_00741"
FT                   /product="Siroheme synthase"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:P0AEA8"
FT                   /protein_id="ATY43191.1"
FT                   /translation="MDIFPISLKLQQQRCLIVGGGHIALRKATLLAKAGAIIDVVAPAI
FT                   EDQLLQLIKTTGGEPFIEAFAEKFLSTPYRLVIAATNDAEVNKTVFEQCEARNLLVNSV
FT                   DDIPHCRFMVPAIIDRSPLIVSVASNGTSPVLSRQIRTQLETSIPHGMGKLAEFSGKWR
FT                   NQVKEKISNPDERRIFWENLYASPLKEQVFNDNLDVADSMLEQALQEWKAPKGEVYLVG
FT                   AGPGDPELITLKALRLMQQADVVIYDRLVSAPILELCRRDATKIYVGKARSNHSVPQEG
FT                   INALLVDYAKKGKRVCRLKGGDPFIFGRGGEEIQELFQAGVPFQVVPGITAASGCSAYA
FT                   GIPLTHRDYAQSVRFLTGHLKEGSPELPWNELVYENQTLVLYMGLVGLERICEQLIAHG
FT                   QRPDMPVALISKGTTPEQKVVVGSLADIASKVTEHQIHAPTLTIIGEVVRLREQLQWN"
FT   gene            779419..779892
FT                   /gene="trmL"
FT                   /locus_tag="ABBFA_00742"
FT                   /old_locus_tag="CTY05_00742"
FT   CDS_pept        779419..779892
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trmL"
FT                   /locus_tag="ABBFA_00742"
FT                   /old_locus_tag="CTY05_00742"
FT                   /product="tRNA (cytidine(34)-2'-O)-methyltransferase"
FT                   /EC_number="2.1.1.207"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:Q74Y93"
FT                   /protein_id="ATY43192.1"
FT                   /translation="MIHVVLYEPEIPANTGNIIRLCANTGAQLHLVKPLGFELDDKKLK
FT                   RAGLDYHEWARMQIWDNIELCRADLKAKGVEHIFPLTTKGSATPHTVDLNRPVALLMGP
FT                   ETRGLPEHVRLMFPQEQWIRLPMAENSRSLNLSNATAVIVYEAWRQQGFKKLG"
FT   gene            complement(779942..780322)
FT                   /gene="yybR_2"
FT                   /locus_tag="ABBFA_00743"
FT                   /old_locus_tag="CTY05_00743"
FT   CDS_pept        complement(779942..780322)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yybR_2"
FT                   /locus_tag="ABBFA_00743"
FT                   /old_locus_tag="CTY05_00743"
FT                   /product="putative HTH-type transcriptional regulator YybR"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:P37486"
FT                   /protein_id="ATY43193.1"
FT                   /translation="MNECLKYNIFQQHCPARLFFEKIADKWVLLILNILEHETQHFNLL
FT                   KKNIEGISPKVLSQKLKMLERDGFIERKIQDTSPIRVDYSLTPLGQNVAAMAYQLKEWA
FT                   ETNIEQVLAAQIIYDEKILDQA"
FT   gene            780439..780999
FT                   /gene="pnpB_1"
FT                   /locus_tag="ABBFA_00744"
FT                   /old_locus_tag="CTY05_00744"
FT   CDS_pept        780439..780999
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pnpB_1"
FT                   /locus_tag="ABBFA_00744"
FT                   /old_locus_tag="CTY05_00744"
FT                   /product="p-benzoquinone reductase"
FT                   /EC_number="1.6.5.2"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:C1I202"
FT                   /protein_id="ATY43194.1"
FT                   /translation="MSNSNIAVVYFSGYGHTKVVAETFANEINAQLIQINQEGNITDQD
FT                   WETLNNAKGIVFGAPTYMGTAPWQFKKFADATSKVWFTRGWQDKVFAGFTNSASLNGDK
FT                   QVTLIQLQTLASQHGGIWVSLGLLPANTKDATREDVNNLGGSVGLLVQSPSDASVDEVP
FT                   TGDLETAKVYAKRVQAIVNKIYG"
FT   gene            complement(781039..782439)
FT                   /gene="plaP"
FT                   /locus_tag="ABBFA_00745"
FT                   /old_locus_tag="CTY05_00745"
FT   CDS_pept        complement(781039..782439)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="plaP"
FT                   /locus_tag="ABBFA_00745"
FT                   /old_locus_tag="CTY05_00745"
FT                   /product="Low-affinity putrescine importer PlaP"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:P0AA47"
FT                   /protein_id="ATY43195.1"
FT                   /translation="MRITPLTNLSGTKPTAKLQKNLVLWHIIIIGLAYIQPLTLFDTFG
FT                   LVSERSGGHVPTSYIFALVAILLTSISYGHMIKRYPSSGSAYTYAQKSIHPNVGFMVGW
FT                   SSWLDYLLSPLVNIILADIYLRALFPEVNNWLWVIGLTALMTVINLFGARFVARFNSTI
FT                   VVIQLGVIFYFVYQVYILLTQGVYADGTLNPDKAELWSLTPFWNDMTSISALIGGATVL
FT                   CFSFTGFDALSSLAEETKDAEKTLPKAIFSTALLAGIIFIVSTYFIQLYFPSNPNIYFK
FT                   PLDESQPVMVAAIGSIAFKTLVLYFAVVAVMASGISAHAGVSRLMYVMGRDGVINKKLF
FT                   GHISPRLHTPTYNILIVGVVALSAGFLDLEHIVNLISFGALTAFSFVNFSVISRYALRD
FT                   GKNKSIKDIINYIIVPTLGFASVFLMWLEIDKLALQIGLAWAVFGVGYLAYKTKGFKYN
FT                   APQHNEHE"
FT   gene            complement(782690..783874)
FT                   /gene="dhaT_1"
FT                   /locus_tag="ABBFA_00746"
FT                   /old_locus_tag="CTY05_00746"
FT   CDS_pept        complement(782690..783874)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dhaT_1"
FT                   /locus_tag="ABBFA_00746"
FT                   /old_locus_tag="CTY05_00746"
FT                   /product="1,3-propanediol dehydrogenase"
FT                   /EC_number="1.1.1.202"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:Q59477"
FT                   /protein_id="ATY43196.1"
FT                   /translation="MAKPYYEFFCPVKVIAGNAALEHIPFELATLGAKCPLIITDKGVR
FT                   ANGLLNPIEAAFSTTDAVIGHVFDDVPPDSSLEVVRLAAEAYRTNKCDAIIAVGGGSVI
FT                   DTSKATNILVSEGGDDLLQYSGAHNLPKPLKPFFVIPTTSGTGSEVTMVAVVSDTQKNV
FT                   KLAFASYYLMPHAAILDPRMTLTLPPHLTAMTGMDALTHCVEAYTCMAANPLSDAYASA
FT                   GIKKISENLFNVLENPNDSQGRLELAQASTMAGIAFSNSMVGLVHSLGHALGAVAHLPH
FT                   GLCMNLFLPYVLEYNKQVNGKKIGELLLPLAGADIYAQTPATQRADRAIATILAMRDRL
FT                   FSLTKLPRTLRETGKVTEAQLDEVAEKALNDGSIIYNPKEASLKDLREILQKAW"
FT   gene            complement(783876..784325)
FT                   /locus_tag="ABBFA_00747"
FT                   /old_locus_tag="CTY05_00747"
FT   CDS_pept        complement(783876..784325)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABBFA_00747"
FT                   /old_locus_tag="CTY05_00747"
FT                   /product="hypothetical protein"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /protein_id="ATY43197.1"
FT                   /translation="MASQVDSEIQEEVSKFPVHFVLSMNVFPNGPAFFARVTEDKQLEL
FT                   LKKAEKKPDLTITFKHVTHAFLVFSFQESTAQAFANDRMIADGDVSAAIRLVRCLNKME
FT                   SLILPKLVASLAVKEYPTELTLKEKFNQAANIYLKVAKSYFKRSA"
FT   gene            complement(784490..785143)
FT                   /gene="lipB"
FT                   /locus_tag="ABBFA_00748"
FT                   /old_locus_tag="CTY05_00748"
FT   CDS_pept        complement(784490..785143)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lipB"
FT                   /locus_tag="ABBFA_00748"
FT                   /old_locus_tag="CTY05_00748"
FT                   /product="Octanoyltransferase"
FT                   /EC_number="2.3.1.181"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:P60720"
FT                   /protein_id="ATY43198.1"
FT                   /translation="MSLDKPTLIIRQWNDLQDYQSKFESMKNLTNQRDENTADELWLLQ
FT                   HHEVLTQGQAGKPEHILIPSNIPVVQTDRGGQVTWHGPGQLVAYFMFDLNRLKWNVRTL
FT                   VSFAEQFMIDVLKKYNIEAYAKPDAPGVYVDGRKIGSLGFKIRRGCSYHGLALNLDCAL
FT                   TGFQTINPCGYAGLEMVRIQDLVTPYPSFEQLCQDFIEYIKATGYFNDPEVKIE"
FT   gene            complement(785327..785614)
FT                   /locus_tag="ABBFA_00749"
FT                   /old_locus_tag="CTY05_00749"
FT   CDS_pept        complement(785327..785614)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABBFA_00749"
FT                   /old_locus_tag="CTY05_00749"
FT                   /product="hypothetical protein"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="protein motif:CLUSTERS:PRK00341"
FT                   /protein_id="ATY43199.1"
FT                   /translation="MLDRTPSRELREDLWVFPMDYPIKLIGDAGEELRIAVVDILVKHF
FT                   PDFDQTTLKVQESRTGKYHSLTAQLRFDELEQVHALYADLAACPQIRTAL"
FT   gene            complement(785712..787598)
FT                   /gene="rpoD"
FT                   /locus_tag="ABBFA_00750"
FT                   /old_locus_tag="CTY05_00750"
FT   CDS_pept        complement(785712..787598)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoD"
FT                   /locus_tag="ABBFA_00750"
FT                   /old_locus_tag="CTY05_00750"
FT                   /product="RpoD"
FT                   /note="RNA polymerase sigma factor RpoD"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:P00579"
FT                   /protein_id="ATY43200.1"
FT                   /translation="MSDMHSPTSQVAALISRGKEQGYLTYAEVNDHLPDSITESEQIED
FT                   IIQMLQDVGIPVHERAPESDDTMFGESADATDEVAEEEAAAVLASVENEPGRTTDPVRM
FT                   YMREMGTVELLTREGEISIAKRIEEGIRDVLNSIAYWPNAVEVVLKEYNDFLTGERRLA
FT                   DILSGYLDPETDEDIPEVLEDVEELEEEDESSTKSTKEVKLDDDDEEEESEGDDDSEGD
FT                   SGPDPEVAKVRFAELEAAWAQTKAVIEKHGRNSPEANEALESLATVFMMFKFTPRLFDI
FT                   ISEMIRGTHEQIRANEREIMRYAVRRGRMDRNQFRTSFPKQESNPAWLDEQIAKAPAEI
FT                   KAHLEKVRPDVLAFQQKIADIEKELGLNVSEIKDISKRMAIGEAKARRAKKEMVEANLR
FT                   LVISIAKKYTNRGLQFLDLIQEGNIGLMKAVDKFEYRRGYKFSTYATWWIRQAITRSIA
FT                   DQARTIRIPVHMIETINKINRVSRQLLQEMGREPTPEELGERLEMDEVKVRKVLKIAKE
FT                   PISMETPIGDDEDSHLGDFIEDQNITSPIDAATSEGLKEATREVLENLTEREAKVLKMR
FT                   FGIDMPTDHTLEEVGKQFDVTRERIRQIEAKALRKLRHPSRSEHLRSFLEND"
FT   gene            787957..788163
FT                   /locus_tag="ABBFA_00751"
FT                   /old_locus_tag="CTY05_00751"
FT   CDS_pept        787957..788163
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABBFA_00751"
FT                   /old_locus_tag="CTY05_00751"
FT                   /product="hypothetical protein"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /protein_id="ATY43201.1"
FT                   /translation="MSSTDFELDDNYGDDDDVGFDESSGKISAKESLEKRRLIDDLLAQ
FT                   RRLERELKDFDYDLDDDDLDDED"
FT   gene            788239..788763
FT                   /locus_tag="ABBFA_00752"
FT                   /old_locus_tag="CTY05_00752"
FT   CDS_pept        788239..788763
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABBFA_00752"
FT                   /old_locus_tag="CTY05_00752"
FT                   /product="hypothetical protein"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /protein_id="ATY43202.1"
FT                   /translation="MSALDLDQLSEYLDGDHNEYGLDFAATHGFLCAIAVGPQFDRWLD
FT                   ELFEGNQKKVPAEIIQQIKVWLESIRQDLANENGIEFPFEVEEADVESSLGDWSVGFVD
FT                   AMFLNEEAWFAPEYEEQLVDLTLPIMVFSGIDEEDPQMESFRRNGQLMDELAEEIPDNL
FT                   NELYLMYHTPN"
FT   gene            complement(788886..789818)
FT                   /locus_tag="ABBFA_00753"
FT                   /old_locus_tag="CTY05_00753"
FT   CDS_pept        complement(788886..789818)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABBFA_00753"
FT                   /old_locus_tag="CTY05_00753"
FT                   /product="putative rhodanese-related sulfurtransferase"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="protein motif:CLUSTERS:PRK00142"
FT                   /protein_id="ATY43203.1"
FT                   /translation="MNATVEQLAPVEQQATAGWVVAALYQFKEVQDPADLQQRLLDLVK
FT                   TINLCGTLIVAGEGINGTVAGDREAIDTIHQFLLNEGFNAMEYKESHSSDKPFRKMKIK
FT                   LKKEIVTLGVEVKPRDLVGHYLDPKEWNELIARDDVILIDTRNDYEYKAGTFKGAIDPK
FT                   TETFREFPEYVKKELEQHKDKKIAMFCTGGIRCEKSTSLLLQEGFKEVYHLKGGILKYL
FT                   EETPPDESLWEGECFVFDGRTAVTHGVEEGANIKCHACGWPLTPEESALPSYEHGVSCL
FT                   YCIDKTTEKQKAGFRMRQSQIAAAKRKRL"
FT   gene            789930..790415
FT                   /locus_tag="ABBFA_00754"
FT                   /old_locus_tag="CTY05_00754"
FT   CDS_pept        789930..790415
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABBFA_00754"
FT                   /old_locus_tag="CTY05_00754"
FT                   /product="hypothetical protein"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /protein_id="ATY43204.1"
FT                   /translation="MSSDHRMLSLTPCAGRCSTVFGDQVCRGCRRFNHEVIQWNTYTAE
FT                   QRLAVWKRLDDQLDQILVPMLPQANLQHVEGFILGKRVRLMEGASKGRKLYHALKICEK
FT                   NKHLAHDSGLGISEAQVKQVWTEFERRILALAKASYELAWLRADGISHHLLNMFEEE"
FT   gene            complement(790485..791759)
FT                   /gene="gltA"
FT                   /locus_tag="ABBFA_00755"
FT                   /old_locus_tag="CTY05_00755"
FT   CDS_pept        complement(790485..791759)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gltA"
FT                   /locus_tag="ABBFA_00755"
FT                   /old_locus_tag="CTY05_00755"
FT                   /product="GltA"
FT                   /EC_number="2.3.3.1"
FT                   /note="Citrate synthase"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:P0ABH7"
FT                   /protein_id="ATY43205.1"
FT                   /translation="MSEATGKKAVLHLDGKEIELPIYSGTLGPDVIDVKDVLASGHFTF
FT                   DPGFMATASCESKITFIDGDKGILLHRGYPIDQLATQADYLETCYLLLNGELPTAEQKV
FT                   EFDAKVRAHTMVHDQVSRFFNGFRRDAHPMAIMVGVVGALSAFYHNNLDIEDINHREIT
FT                   AIRLIAKIPTLAAWSYKYTVGQPFIYPRNDLNYAENFLHMMFATPADRDYKVNPVLARA
FT                   MDRIFTLHADHEQNASTSTVRLAGSTGANPYACISAGISALWGPAHGGANEAVLKMLDE
FT                   IGSVENVAEFMEKVKRKEVKLMGFGHRVYKNFDPRAKVMKQTCDEVLEALGINDPQLAL
FT                   AMELERIALNDPYFVERKLYPNVDFYSGIILKAIGIPTEMFTVIFALARTVGWISHWLE
FT                   MHSGPYKIGRPRQLYTGEVQRDIKR"
FT   gene            792723..793115
FT                   /gene="sdhC"
FT                   /locus_tag="ABBFA_00756"
FT                   /old_locus_tag="CTY05_00756"
FT   CDS_pept        792723..793115
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sdhC"
FT                   /locus_tag="ABBFA_00756"
FT                   /old_locus_tag="CTY05_00756"
FT                   /product="Succinate dehydrogenase cytochrome b556 subunit"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:P69054"
FT                   /protein_id="ATY43206.1"
FT                   /translation="MKSNRPVNLSMGQVLAVNLRSPVAIASILHRLSGVIVFLLVPVLL
FT                   WILDKSLSSPEGFDYVKNVVFGNILVRFVVWVFVAGLIFHFIAGVKHLLADLGFAEELQ
FT                   SGRIAATISLILSVVAIIAAFVWIMF"
FT   gene            793115..793480
FT                   /gene="sdhD"
FT                   /locus_tag="ABBFA_00757"
FT                   /old_locus_tag="CTY05_00757"
FT   CDS_pept        793115..793480
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sdhD"
FT                   /locus_tag="ABBFA_00757"
FT                   /old_locus_tag="CTY05_00757"
FT                   /product="Succinate dehydrogenase hydrophobic membrane
FT                   anchor subunit"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:P51057"
FT                   /protein_id="ATY43207.1"
FT                   /translation="MKSATGLTGSGSRDWFIQRVSAVVLAAYTVVLFGWILCKGGFDYQ
FT                   QWAGFMMTLPMKIFSLLAILSLIAHAWIGMWQVFTDYVTTRQMGPSAKGLRLVLTTAVI
FT                   IAVFVYAIWGIQIFWAN"
FT   gene            793493..795328
FT                   /gene="sdhA_1"
FT                   /locus_tag="ABBFA_00758"
FT                   /old_locus_tag="CTY05_00758"
FT   CDS_pept        793493..795328
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sdhA_1"
FT                   /locus_tag="ABBFA_00758"
FT                   /old_locus_tag="CTY05_00758"
FT                   /product="Succinate dehydrogenase flavoprotein subunit"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:P0AC41"
FT                   /protein_id="ATY43208.1"
FT                   /translation="MGAINPKEDYSNIQNLTFDAVIVGGGGSGMRASYQLAQAGLKVAV
FT                   LTKVFPTRSHTVAAQGGIGASLGNMQEDNWHFHFYDTVKGSDWLGDQDAIEFMCREAPK
FT                   VVYELEHLGMPFDRNADGTIYQRPFGGHSANYGDKPVPRACAAADRTGHALLHTLYQSN
FT                   VKMGTQFFVEWIALDLIRNEAGDVLGVTAIDQETGNIAVFQAKATLFATGGAGRVYRAS
FT                   TNAYINTGDGLGMAARAGIPLQDMEFWQFHPTGVAGAGVLLTEGCRGEGAILRNKDGEP
FT                   FMERYAPTLKDLAPRDFVSRSMDQEIKEGRGCGPKGDYILLDMTHLGADTIMKRLPSVF
FT                   EIGKKFANVDITKEPIPVVPTIHYQMGGIPTNMHGQVCLPEPGTDNYTKPVKGFYAIGE
FT                   CSCVSVHGANRLGTNSLLDLVVFGKAAGEHIIDYVTKHHGDEYAPLPTNVLEQTLARVR
FT                   KLDESTSGENAQEVADAIRDIVQDHAGVFRTQALLDKGVKEILALEPRVRNIHLKDKSK
FT                   VFNTARVEALEVENLYEVAKATLISAAARKECRGAHTVVDYELPADHPTYSYGRRDDEW
FT                   MKHTLWYSSDNRLEYKPVRFKPLTVDPIPPAPRTF"
FT   gene            795343..796053
FT                   /gene="sdhB"
FT                   /locus_tag="ABBFA_00759"
FT                   /old_locus_tag="CTY05_00759"
FT   CDS_pept        795343..796053
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sdhB"
FT                   /locus_tag="ABBFA_00759"
FT                   /old_locus_tag="CTY05_00759"
FT                   /product="Succinate dehydrogenase iron-sulfur subunit"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:P07014"
FT                   /protein_id="ATY43209.1"
FT                   /translation="MSRGTRTFEIYRYDPDKDKAPYMQTFKLELTDKHRMLLDALLALK
FT                   VQDETLTFRRSCREGICGSDGVNINGKNGLACLQNLNDLPEKIVIRPLPGLPVVKDLVV
FT                   DMNQFYDQYDKIQPFLINNQPAPPKERLQSPEEREHLNGLYECILCACCSTSCPSFWWN
FT                   PDKFLGPSALLNAYRFIIDSRDTATAERLARLDDPFSLFRCKGIMNCVSVCPKGLNPTK
FT                   AIGHIRNMLLDQAG"
FT   gene            796624..799464
FT                   /gene="sucA"
FT                   /locus_tag="ABBFA_00760"
FT                   /old_locus_tag="CTY05_00760"
FT   CDS_pept        796624..799464
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sucA"
FT                   /locus_tag="ABBFA_00760"
FT                   /old_locus_tag="CTY05_00760"
FT                   /product="2-oxoglutarate dehydrogenase E1 component"
FT                   /EC_number="1.2.4.2"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:P0AFG3"
FT                   /protein_id="ATY43210.1"
FT                   /translation="MQEVADALRLDTELSADSAAYIEELYEQYLTSPTSVAEDWRQYFD
FT                   KYPKGDQPHSAVREQFLLLGRNANRVQPVVQSTVSTEHERRQIGVLQLIAAYRNRGHQK
FT                   AKLDPLGLAKREDIPDLDLSAHGLTKSDLDTVFNTGNLEIGKSEATLAEMIEAMEAIYC
FT                   GSIGVEYMHIVDTKEKRWIQQRLESARGKFNFSNEQKKGFLERLTAAEGLEKYLGNKYV
FT                   GAKRFGVEGGESFIPMVNEIIQRAGAVGCKEVVIGMPHRGRLNLLVNIMGKNPADLFGE
FT                   FEGKALHKKGSGDVKYHQGFSSNVMTPGGEVHLALAFNPSHLEIVGPVVEGSVRARQVR
FT                   RRDIGGDDVLPVIVHGDAAFAGQGVNMETFQMSQTRGYTVGGTVHIIVNNQVGFTTSDP
FT                   RDARSTEYCTDVAKMIQAPIFHVNGDDPEAVIFATQLAHDFRHEFRKDVVIDLFCYRRR
FT                   GHNEADEPSGTQPLMYQVIAKKATTRTLYADQLVQEKVLDRAEADQMVEDYRADLEAGN
FT                   HVANALILEPNTKMFVDWTPYLGHEYTDDWDTSFDINRLKELGEGMSKLPEGFVMQRQV
FT                   QKVIEDRVKMQTGETPLNWGAAETLAYATLLDEDYLVRITGEDVGRGTFSHRHAKLHNQ
FT                   VDGSTYIPLCHVKENQPRFAIYDSLLSEEAVLAFEYGYATTIPKSLIIWEAQFGDFVNC
FT                   AQVVIDQFIASGETKWERVCGLTMLLPHGFEGQGPEHSSARLERFLQLCAEDNMQVITP
FT                   TTPAQIFHALRRQAVRPIRKPLIVMSPKSLLRHKLATSTLEELAHGSFQTVIDEIDQIN
FT                   KSDVTRLVLCGGKVYYDLLEKRREQNLTNVAIVRIEQLYPYPEQRLAEILAAYPNVKEL
FT                   VWAQEEPKNQGAWLFIAPRLYDDILKSGKQIRISFAGREASAAPACGSPYLHAKQQAQL
FT                   INDALAIEAEQSGDSQ"
FT   gene            799464..800660
FT                   /gene="sucB"
FT                   /locus_tag="ABBFA_00761"
FT                   /old_locus_tag="CTY05_00761"
FT   CDS_pept        799464..800660
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sucB"
FT                   /locus_tag="ABBFA_00761"
FT                   /old_locus_tag="CTY05_00761"
FT                   /product="Dihydrolipoyllysine-residue succinyltransferase
FT                   component of 2-oxoglutarate dehydrogenase complex"
FT                   /EC_number="2.3.1.61"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:P20708"
FT                   /protein_id="ATY43211.1"
FT                   /translation="MATEIKAPVFPESVADGTIATWHKKVGEPVSRDEVICDIETDKVV
FT                   LEVVAPADGSLVAIIKGEGDTVLSDEVIAQFEAGAGAAAAAPAAVEQAVAQTQAGAAPV
FT                   VERNEAVSDQAPAVRKALTESGIAASDVQGTGRGGRITKEDVANHQAKPAANVTPLSVA
FT                   VGERIEKRVPMTRLRKRVAERLLAATQETAMLTTFNEVNMKPIMELRKQYKDAFEKRHG
FT                   ARLGFMSFFVKAATEALKRYPAVNASIDGDDIVYHGYYDIGVAVSSDRGLVVPVLRDTD
FT                   RMSYAEVEAGIAAYAAKARDGKLSIEEMTGGTFTITNGGTFGSLLSTPILNQPQTGILG
FT                   MHKIQERPMAVNGQVEILPMMYLALSYDHRMIDGKEAVGFLVAIKELLEEPAKLILDL"
FT   gene            800723..802156
FT                   /gene="lpdG"
FT                   /locus_tag="ABBFA_00762"
FT                   /old_locus_tag="CTY05_00762"
FT   CDS_pept        800723..802156
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lpdG"
FT                   /locus_tag="ABBFA_00762"
FT                   /old_locus_tag="CTY05_00762"
FT                   /product="Dihydrolipoamide dehydrogenase"
FT                   /EC_number="1.8.1.4"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:P31052"
FT                   /protein_id="ATY43212.1"
FT                   /translation="MSQQFDLVVIGGGPGGYEAAIRAAQLGFKVACIEKRIHNGKPSLG
FT                   GTCLNVGCIPSKALLDSSHRYEDTVHHLADHGITTGEVNFDLAKLLARKDKIVDQLTGG
FT                   IDQLLKGNGIEWLKGTGKLLAGKKVEFVPHEGETQILEPKYVILASGSVPVNIPVAPVD
FT                   QDIIVDSTGALNFPEVPKRLGVIGAGVIGLELGSVWRRLGAEVVVFEAMDAFLPMADKA
FT                   LSKEYQKILTKQGLDIRIGAKVSGTEVNGREVTVKYTQAGEDKEQTFDKLIVCVGRKAY
FT                   AEGLLAEDSGIKLTERGLVEVNDHCATSVEGVYAIGDLVRGPMLAHKAMEEGVMAVERI
FT                   HGHAAQVNYDTIISVIYTHPEAAWVGLTEEQAKEKGHEVKTGQFGFAVNGRALAAGEGA
FT                   GFVKFVADAKTDRLLGMHVIGPAASDIVHQGMIALEFVSSVEDLQLMTFGHPTFSEVVH
FT                   EAALAVDGRAIHAIQRKRK"
FT   gene            802304..803470
FT                   /gene="sucC"
FT                   /locus_tag="ABBFA_00763"
FT                   /old_locus_tag="CTY05_00763"
FT   CDS_pept        802304..803470
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sucC"
FT                   /locus_tag="ABBFA_00763"
FT                   /old_locus_tag="CTY05_00763"
FT                   /product="Succinyl-CoA ligase [ADP-forming] subunit beta"
FT                   /EC_number="6.2.1.5"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:Q883Z4"
FT                   /protein_id="ATY43213.1"
FT                   /translation="MNLHEYQAKALLKEYGMPVQEGILATNADEAVAAFEQLGGKFAVM
FT                   KAQVHAGGRGKAGGVKVAKSKEDVIEFANNIIGTRLVTYQTDANGQPVNSIIVAEDVYP
FT                   VERELYLGAVVDRSSRRITFMASTEGGVEIEKVAEETPEKIIKVEVDPLVGLQPFQARE
FT                   VAFALGLKDKQIGQFVKIMTAAYQAFVENDFALFEINPLSVRENGEILCVDAKVGIDSN
FT                   ALYRLPKVAALRDKSQENERELKASEFDLNYVALEGNIGCMVNGAGLAMATMDIIKLYG
FT                   GQPANFLDVGGGATKERVIEAFKIILADTSVQGVLINIFGGIVRCDMIAEAIIAAVQEV
FT                   NVTVPVVVRLEGNNAELGAKLLDESGLKLISANGLSDAAEKVVAAVKA"
FT   gene            803485..804375
FT                   /gene="sucD"
FT                   /locus_tag="ABBFA_00764"
FT                   /old_locus_tag="CTY05_00764"
FT   CDS_pept        803485..804375
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sucD"
FT                   /locus_tag="ABBFA_00764"
FT                   /old_locus_tag="CTY05_00764"
FT                   /product="Succinyl-CoA ligase [ADP-forming] subunit alpha"
FT                   /EC_number="6.2.1.5"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:P0AGE9"
FT                   /protein_id="ATY43214.1"
FT                   /translation="MSVLINKDTKVLVQGFTGKNGTFHSAQALDYGTKVVGGVTPGKGG
FT                   TTHLDLPVFNTMKEAVRETNADASVIYVPAPFVLDSIVEAVDSGVGLIVVITEGVPTID
FT                   MLKAKRYLETNGNGTRLVGPNCPGVITPGECKIGIMPGHIHQPGRIGIISRSGTLTYEA
FT                   VAQTTKLGLGQSTCIGIGGDPIPGMNQIEALQLFQDDPDTDAIIMIGEIGGTAEEEAAE
FT                   FIKSNVTKPVVGYIAGVTAPKGKRMGHAGAIISGGQGTAEEKFAAFEKAGMAYTRSPAE
FT                   LGSTMLQVLKEKGLA"
FT   gene            804499..804693
FT                   /locus_tag="ABBFA_00765"
FT                   /old_locus_tag="CTY05_00765"
FT   CDS_pept        804499..804693
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABBFA_00765"
FT                   /old_locus_tag="CTY05_00765"
FT                   /product="hypothetical protein"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /protein_id="ATY43215.1"
FT                   /translation="MSREELIYCIEKFIDKNDISIKNTQRIEVLLDDLNSEEEIIESMF
FT                   LILALYVLKVMSTCMVKMK"
FT   gene            805017..805748
FT                   /locus_tag="ABBFA_00766"
FT                   /old_locus_tag="CTY05_00766"
FT   CDS_pept        805017..805748
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABBFA_00766"
FT                   /old_locus_tag="CTY05_00766"
FT                   /product="hypothetical protein"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /protein_id="ATY43216.1"
FT                   /translation="MYAKISSVILFCILISGCATNPEKLQTPVELTCIFLKEPLSTTGL
FT                   YGPLNVEWTTRLERGPYWSEKIDEKGTFFRGAPGSISIRSPDYPSIPGQPAATDGGFYL
FT                   PKDPKEPVKIYRYFTTKAVPVEVPSDNVTCNTLAYTKEPASHKVSLVSFATAGTVGGVT
FT                   GAIIGKNFSSGNMSYGQATGAGAAGGAIGGLIVAAIINAEVGKIIGGLPIKESSFMEKL
FT                   RELGAKREPLKQISLLPPSSP"
FT   gene            complement(806544..807557)
FT                   /gene="trpS2"
FT                   /locus_tag="ABBFA_00767"
FT                   /old_locus_tag="CTY05_00767"
FT   CDS_pept        complement(806544..807557)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trpS2"
FT                   /locus_tag="ABBFA_00767"
FT                   /old_locus_tag="CTY05_00767"
FT                   /product="Tryptophan--tRNA ligase 2"
FT                   /EC_number="6.1.1.2"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:Q9RVD6"
FT                   /protein_id="ATY43217.1"
FT                   /translation="MSNVDQRPIILTGDRPTGQLHLGHFVGSLRSRVGLQDSHHQHLLL
FT                   ADAQALTDNADNPDKVRRNILEVALDYLAVGIDPTKTTICVQSCLPALNELTMLYLNFV
FT                   TVARLERNPTIKSEIQMRGFERDIPAGFLCYPVAQAADITAFKATVVPVGEDQIPMIEQ
FT                   TNEIVRRVNRQIGQDLLPECKALLSNMARLPGFDGKAKMSKSLGNTIVLNASDKDIKKA
FT                   VNAMYTDPNHLRIEDPGQVEGNIVFTYLDAFDPNKEEVEELKAHYRRGGLGDGTVKKRL
FT                   EGVLKELITPIRERREELAKDPDYIMDVLRQGTDKCRIITQQTLDEVKDGLGLFKF"
FT   gene            807765..808688
FT                   /gene="yedI"
FT                   /locus_tag="ABBFA_00768"
FT                   /old_locus_tag="CTY05_00768"
FT   CDS_pept        807765..808688
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yedI"
FT                   /locus_tag="ABBFA_00768"
FT                   /old_locus_tag="CTY05_00768"
FT                   /product="Inner membrane protein YedI"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:P46125"
FT                   /protein_id="ATY43218.1"
FT                   /translation="MASGLLLLLDDIATILDDVALMSKMAAKKTAGVLGDDLALNAQQV
FT                   TGVRADRELPIVWKVAKGSFVNKLILVPLALLISVIAPWLINPLLMLGGLFLCYEGVEK
FT                   VLHTITHKKASTSEEAQKEFDSEELDLATFEKDKVKGAIRTDFILSAEIVVISLGTVAT
FT                   ATLMTKVSVLSIIAVVMTIGVYGLVGMIVKIDDLGLYLTKQAASFKQTIGRGLLAFAPL
FT                   LMKLLSIVGTIAMFLVGGGIINHTIPLLHHVTENTVDHVETIPAVGNIIGALTPTLINF
FT                   AIGIVAGAIVLLVVSLIQKMWPKASS"
FT   gene            808718..809617
FT                   /locus_tag="ABBFA_00769"
FT                   /old_locus_tag="CTY05_00769"
FT   CDS_pept        808718..809617
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ABBFA_00769"
FT                   /old_locus_tag="CTY05_00769"
FT                   /product="Putative neutral zinc metallopeptidase"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="protein motif:Pfam:PF04228.7"
FT                   /protein_id="ATY43219.1"
FT                   /translation="MRWRDRRVSTNVEDRRGGGGVRAGGISIIGLVVAFVAWKFFGVDP
FT                   QQAYQATQQVTASQQSNATAPESLTAEQKEASDFVGTVLADTEDTWTPIFKQLGKTYTP
FT                   PTLVLFSGIAQSGCGTAQSAMGPFYCPADQKVYIDTEFFKDMREQMGISGEQNQTELSR
FT                   QDQAGDFAQAYVVAHEVGHHVQTLLGISSQVQQARAQVSQREGNQLSVRQELQADCLAG
FT                   IWANHNQQRTQFLEQGDVEEAMDAAQKIGDDYLQKRATGQVVPDSFTHGSSEQRMHWFQ
FT                   VGLKTGDINQCDTFNNSI"
FT   gene            809855..811357
FT                   /gene="nhaP"
FT                   /locus_tag="ABBFA_00770"
FT                   /old_locus_tag="CTY05_00770"
FT   CDS_pept        809855..811357
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nhaP"
FT                   /locus_tag="ABBFA_00770"
FT                   /old_locus_tag="CTY05_00770"
FT                   /product="Na(+)/H(+) antiporter NhaP"
FT                   /inference="ab initio prediction:Prodigal:2.6"
FT                   /inference="similar to AA sequence:UniProtKB:G3XD29"
FT                   /protein_id="ATY43220.1"
FT                   /translation="MGNFFLLQAFTVVFALSIATTIFNKRILGFPQAIGVPLVSAIFVF
FT                   ILQWGASLLNGNQFITINIHNIEEAVRHIDFYDFLINGVICFILTSSALKFKISDLRSY
FT                   WKQISILATIALVICAVLFGSLLYGFQLLVGHHVPILVLLLLGAALGATDPIGIKGVLS
FT                   SIRAPHHLIVKLEGESLFNDAMCIALFMTLLNVLQGEHFSLVATLEALLYEIVVAVGIG
FT                   WAFGIGTLRLLRGKHEMESLILTTALLASGAYLVALFAHASAPIACVIGGLIVGNKWKE
FT                   IREEREIREVNHFWHTVEGIINSFLFTLIGLELFILDLNFSLILGGIVAFFILHISRFA
FT                   ANFMSFAFFPTMRKTKSYNGSLTILSWGGVRGGISLALILAVANIPALSPYSSILIGYT
FT                   FISVLLSGVVCGLGLPAVMNAFYYNPNEETEGLKGFYQKLCHKMNRRGFQYIVGEDALG
FT                   RETITIFNPDVIVDQKTEDGIATMHDPNKLQEVKRFESPDNF"