(data stored in ACNUC17686 zone)

EMBL: CP001175

ID   CP001175; SV 1; circular; genomic DNA; STD; PRO; 2976212 BP.
XX
AC   CP001175;
XX
PR   Project:PRJNA29409;
XX
DT   29-DEC-2008 (Rel. 98, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 7)
XX
DE   Listeria monocytogenes HCC23, complete genome.
XX
KW   .
XX
OS   Listeria monocytogenes HCC23
OC   Bacteria; Firmicutes; Bacilli; Bacillales; Listeriaceae; Listeria.
XX
RN   [1]
RP   1-2976212
RX   DOI; 10.1128/JB.05236-11.
RX   PUBMED; 21602330.
RA   Steele C.L., Donaldson J.R., Paul D., Banes M.M., Arick T., Bridges S.M.,
RA   Lawrence M.L.;
RT   "Genome sequence of lineage III Listeria monocytogenes strain HCC23";
RL   J. Bacteriol. 193(14):3679-3680(2011).
XX
RN   [2]
RP   1-2976212
RA   Steele C.L., Donaldson J.R., Banes M.M., Arick T., Lawrence M.L.;
RT   ;
RL   Submitted (30-SEP-2008) to the INSDC.
RL   College of Veterinary Medicine, Mississippi State University, 240 Wise
RL   Center Drive, Mississippi State, MS 39762, USA
XX
DR   MD5; 81cfd7c594ce7f2b62aa49b853438ada.
DR   BioSample; SAMN02603154.
DR   COMPARE-RefGenome; HCC23.
DR   EnsemblGenomes-Gn; EBG00001206715.
DR   EnsemblGenomes-Gn; EBG00001206716.
DR   EnsemblGenomes-Gn; EBG00001206717.
DR   EnsemblGenomes-Gn; EBG00001206718.
DR   EnsemblGenomes-Gn; EBG00001206719.
DR   EnsemblGenomes-Gn; EBG00001206720.
DR   EnsemblGenomes-Gn; EBG00001206721.
DR   EnsemblGenomes-Gn; EBG00001206722.
DR   EnsemblGenomes-Gn; EBG00001206723.
DR   EnsemblGenomes-Gn; EBG00001206724.
DR   EnsemblGenomes-Gn; EBG00001206725.
DR   EnsemblGenomes-Gn; EBG00001206726.
DR   EnsemblGenomes-Gn; EBG00001206727.
DR   EnsemblGenomes-Gn; EBG00001206728.
DR   EnsemblGenomes-Gn; EBG00001206729.
DR   EnsemblGenomes-Gn; EBG00001206730.
DR   EnsemblGenomes-Gn; EBG00001206731.
DR   EnsemblGenomes-Gn; EBG00001206732.
DR   EnsemblGenomes-Gn; EBG00001206733.
DR   EnsemblGenomes-Gn; EBG00001206734.
DR   EnsemblGenomes-Gn; EBG00001206735.
DR   EnsemblGenomes-Gn; EBG00001206736.
DR   EnsemblGenomes-Gn; EBG00001206737.
DR   EnsemblGenomes-Gn; EBG00001206738.
DR   EnsemblGenomes-Gn; EBG00001206739.
DR   EnsemblGenomes-Gn; EBG00001206740.
DR   EnsemblGenomes-Gn; EBG00001206741.
DR   EnsemblGenomes-Gn; EBG00001206742.
DR   EnsemblGenomes-Gn; EBG00001206743.
DR   EnsemblGenomes-Gn; EBG00001206744.
DR   EnsemblGenomes-Gn; EBG00001206745.
DR   EnsemblGenomes-Gn; EBG00001206746.
DR   EnsemblGenomes-Gn; EBG00001206747.
DR   EnsemblGenomes-Gn; EBG00001206748.
DR   EnsemblGenomes-Gn; EBG00001206749.
DR   EnsemblGenomes-Gn; EBG00001206750.
DR   EnsemblGenomes-Gn; EBG00001206751.
DR   EnsemblGenomes-Gn; EBG00001206752.
DR   EnsemblGenomes-Gn; EBG00001206753.
DR   EnsemblGenomes-Gn; EBG00001206754.
DR   EnsemblGenomes-Gn; EBG00001206755.
DR   EnsemblGenomes-Gn; EBG00001206756.
DR   EnsemblGenomes-Gn; EBG00001206757.
DR   EnsemblGenomes-Gn; EBG00001206758.
DR   EnsemblGenomes-Gn; EBG00001206759.
DR   EnsemblGenomes-Gn; EBG00001206760.
DR   EnsemblGenomes-Gn; EBG00001206761.
DR   EnsemblGenomes-Gn; EBG00001206762.
DR   EnsemblGenomes-Gn; EBG00001206763.
DR   EnsemblGenomes-Gn; EBG00001206764.
DR   EnsemblGenomes-Gn; EBG00001206765.
DR   EnsemblGenomes-Gn; EBG00001206766.
DR   EnsemblGenomes-Gn; EBG00001206767.
DR   EnsemblGenomes-Gn; EBG00001206768.
DR   EnsemblGenomes-Gn; EBG00001206769.
DR   EnsemblGenomes-Gn; EBG00001206770.
DR   EnsemblGenomes-Gn; EBG00001206771.
DR   EnsemblGenomes-Gn; EBG00001206772.
DR   EnsemblGenomes-Gn; EBG00001206773.
DR   EnsemblGenomes-Gn; EBG00001206774.
DR   EnsemblGenomes-Gn; EBG00001206775.
DR   EnsemblGenomes-Gn; EBG00001206776.
DR   EnsemblGenomes-Gn; EBG00001206777.
DR   EnsemblGenomes-Gn; EBG00001206778.
DR   EnsemblGenomes-Gn; EBG00001206779.
DR   EnsemblGenomes-Gn; EBG00001206780.
DR   EnsemblGenomes-Gn; EBG00001206781.
DR   EnsemblGenomes-Gn; EBG00001206782.
DR   EnsemblGenomes-Gn; EBG00001206783.
DR   EnsemblGenomes-Gn; EBG00001206784.
DR   EnsemblGenomes-Gn; EBG00001206785.
DR   EnsemblGenomes-Gn; EBG00001206786.
DR   EnsemblGenomes-Gn; EBG00001206787.
DR   EnsemblGenomes-Gn; EBG00001206788.
DR   EnsemblGenomes-Gn; EBG00001206789.
DR   EnsemblGenomes-Gn; EBG00001206790.
DR   EnsemblGenomes-Gn; EBG00001206791.
DR   EnsemblGenomes-Gn; EBG00001206792.
DR   EnsemblGenomes-Gn; EBG00001206793.
DR   EnsemblGenomes-Gn; EBG00001206794.
DR   EnsemblGenomes-Gn; EBG00001206795.
DR   EnsemblGenomes-Gn; EBG00001206796.
DR   EnsemblGenomes-Gn; EBG00001206797.
DR   EnsemblGenomes-Gn; EBG00001206798.
DR   EnsemblGenomes-Gn; EBG00001206799.
DR   EnsemblGenomes-Gn; EBG00001206800.
DR   EnsemblGenomes-Gn; EBG00001206801.
DR   EnsemblGenomes-Gn; EBG00001206802.
DR   EnsemblGenomes-Gn; EBG00001206803.
DR   EnsemblGenomes-Gn; EBG00001206804.
DR   EnsemblGenomes-Gn; EBG00001206805.
DR   EnsemblGenomes-Gn; EBG00001206806.
DR   EnsemblGenomes-Gn; EBG00001206807.
DR   EnsemblGenomes-Gn; EBG00001206808.
DR   EnsemblGenomes-Gn; EBG00001206809.
DR   EnsemblGenomes-Gn; EBG00001206810.
DR   EnsemblGenomes-Gn; EBG00001206811.
DR   EnsemblGenomes-Gn; EBG00001206812.
DR   EnsemblGenomes-Gn; EBG00001206813.
DR   EnsemblGenomes-Gn; EBG00001206814.
DR   EnsemblGenomes-Gn; EBG00001206815.
DR   EnsemblGenomes-Gn; EBG00001206816.
DR   EnsemblGenomes-Gn; EBG00001206817.
DR   EnsemblGenomes-Gn; EBG00001206818.
DR   EnsemblGenomes-Gn; EBG00001206819.
DR   EnsemblGenomes-Gn; EBG00001206820.
DR   EnsemblGenomes-Gn; EBG00001206821.
DR   EnsemblGenomes-Gn; EBG00001206822.
DR   EnsemblGenomes-Gn; EBG00001206823.
DR   EnsemblGenomes-Gn; EBG00001206824.
DR   EnsemblGenomes-Gn; EBG00001206825.
DR   EnsemblGenomes-Gn; EBG00001206826.
DR   EnsemblGenomes-Gn; EBG00001206827.
DR   EnsemblGenomes-Gn; EBG00001206828.
DR   EnsemblGenomes-Gn; EBG00001206829.
DR   EnsemblGenomes-Gn; EBG00001206830.
DR   EnsemblGenomes-Gn; EBG00001206831.
DR   EnsemblGenomes-Gn; EBG00001206832.
DR   EnsemblGenomes-Gn; EBG00001206833.
DR   EnsemblGenomes-Gn; EBG00001206834.
DR   EnsemblGenomes-Gn; EBG00001206835.
DR   EnsemblGenomes-Gn; EBG00001206836.
DR   EnsemblGenomes-Gn; EBG00001206837.
DR   EnsemblGenomes-Gn; EBG00001206838.
DR   EnsemblGenomes-Gn; EBG00001206839.
DR   EnsemblGenomes-Gn; EBG00001206840.
DR   EnsemblGenomes-Gn; EBG00001206841.
DR   EnsemblGenomes-Gn; EBG00001206842.
DR   EnsemblGenomes-Gn; EBG00001206843.
DR   EnsemblGenomes-Gn; EBG00001206844.
DR   EnsemblGenomes-Gn; EBG00001206845.
DR   EnsemblGenomes-Gn; EBG00001206846.
DR   EnsemblGenomes-Gn; EBG00001206847.
DR   EnsemblGenomes-Gn; EBG00001206848.
DR   EnsemblGenomes-Gn; EBG00001206849.
DR   EnsemblGenomes-Gn; EBG00001206850.
DR   EnsemblGenomes-Gn; EBG00001206851.
DR   EnsemblGenomes-Gn; EBG00001206852.
DR   EnsemblGenomes-Gn; EBG00001206853.
DR   EnsemblGenomes-Gn; EBG00001206854.
DR   EnsemblGenomes-Gn; EBG00001206855.
DR   EnsemblGenomes-Gn; EBG00001206856.
DR   EnsemblGenomes-Gn; LMHCC_R001.
DR   EnsemblGenomes-Gn; LMHCC_R002.
DR   EnsemblGenomes-Gn; LMHCC_R003.
DR   EnsemblGenomes-Gn; LMHCC_R004.
DR   EnsemblGenomes-Gn; LMHCC_R005.
DR   EnsemblGenomes-Gn; LMHCC_R006.
DR   EnsemblGenomes-Gn; LMHCC_R007.
DR   EnsemblGenomes-Gn; LMHCC_R008.
DR   EnsemblGenomes-Gn; LMHCC_R009.
DR   EnsemblGenomes-Gn; LMHCC_R010.
DR   EnsemblGenomes-Gn; LMHCC_R011.
DR   EnsemblGenomes-Gn; LMHCC_R012.
DR   EnsemblGenomes-Gn; LMHCC_R013.
DR   EnsemblGenomes-Gn; LMHCC_R014.
DR   EnsemblGenomes-Gn; LMHCC_R015.
DR   EnsemblGenomes-Gn; LMHCC_R016.
DR   EnsemblGenomes-Gn; LMHCC_R017.
DR   EnsemblGenomes-Gn; LMHCC_R018.
DR   EnsemblGenomes-Gn; LMHCC_T001.
DR   EnsemblGenomes-Gn; LMHCC_T002.
DR   EnsemblGenomes-Gn; LMHCC_T003.
DR   EnsemblGenomes-Gn; LMHCC_T004.
DR   EnsemblGenomes-Gn; LMHCC_T005.
DR   EnsemblGenomes-Gn; LMHCC_T006.
DR   EnsemblGenomes-Gn; LMHCC_T007.
DR   EnsemblGenomes-Gn; LMHCC_T008.
DR   EnsemblGenomes-Gn; LMHCC_T009.
DR   EnsemblGenomes-Gn; LMHCC_T010.
DR   EnsemblGenomes-Gn; LMHCC_T011.
DR   EnsemblGenomes-Gn; LMHCC_T012.
DR   EnsemblGenomes-Gn; LMHCC_T013.
DR   EnsemblGenomes-Gn; LMHCC_T014.
DR   EnsemblGenomes-Gn; LMHCC_T015.
DR   EnsemblGenomes-Gn; LMHCC_T016.
DR   EnsemblGenomes-Gn; LMHCC_T017.
DR   EnsemblGenomes-Gn; LMHCC_T018.
DR   EnsemblGenomes-Gn; LMHCC_T019.
DR   EnsemblGenomes-Gn; LMHCC_T020.
DR   EnsemblGenomes-Gn; LMHCC_T021.
DR   EnsemblGenomes-Gn; LMHCC_T022.
DR   EnsemblGenomes-Gn; LMHCC_T023.
DR   EnsemblGenomes-Gn; LMHCC_T024.
DR   EnsemblGenomes-Gn; LMHCC_T025.
DR   EnsemblGenomes-Gn; LMHCC_T026.
DR   EnsemblGenomes-Gn; LMHCC_T027.
DR   EnsemblGenomes-Gn; LMHCC_T028.
DR   EnsemblGenomes-Gn; LMHCC_T029.
DR   EnsemblGenomes-Gn; LMHCC_T030.
DR   EnsemblGenomes-Gn; LMHCC_T031.
DR   EnsemblGenomes-Gn; LMHCC_T032.
DR   EnsemblGenomes-Gn; LMHCC_T033.
DR   EnsemblGenomes-Gn; LMHCC_T034.
DR   EnsemblGenomes-Gn; LMHCC_T035.
DR   EnsemblGenomes-Gn; LMHCC_T036.
DR   EnsemblGenomes-Gn; LMHCC_T037.
DR   EnsemblGenomes-Gn; LMHCC_T038.
DR   EnsemblGenomes-Gn; LMHCC_T039.
DR   EnsemblGenomes-Gn; LMHCC_T040.
DR   EnsemblGenomes-Gn; LMHCC_T041.
DR   EnsemblGenomes-Gn; LMHCC_T042.
DR   EnsemblGenomes-Gn; LMHCC_T043.
DR   EnsemblGenomes-Gn; LMHCC_T044.
DR   EnsemblGenomes-Gn; LMHCC_T045.
DR   EnsemblGenomes-Gn; LMHCC_T046.
DR   EnsemblGenomes-Gn; LMHCC_T047.
DR   EnsemblGenomes-Gn; LMHCC_T048.
DR   EnsemblGenomes-Gn; LMHCC_T049.
DR   EnsemblGenomes-Gn; LMHCC_T050.
DR   EnsemblGenomes-Gn; LMHCC_T051.
DR   EnsemblGenomes-Gn; LMHCC_T052.
DR   EnsemblGenomes-Gn; LMHCC_T053.
DR   EnsemblGenomes-Gn; LMHCC_T054.
DR   EnsemblGenomes-Gn; LMHCC_T055.
DR   EnsemblGenomes-Gn; LMHCC_T056.
DR   EnsemblGenomes-Gn; LMHCC_T057.
DR   EnsemblGenomes-Gn; LMHCC_T058.
DR   EnsemblGenomes-Gn; LMHCC_T059.
DR   EnsemblGenomes-Gn; LMHCC_T060.
DR   EnsemblGenomes-Gn; LMHCC_T061.
DR   EnsemblGenomes-Gn; LMHCC_T062.
DR   EnsemblGenomes-Gn; LMHCC_T063.
DR   EnsemblGenomes-Gn; LMHCC_T064.
DR   EnsemblGenomes-Gn; LMHCC_T065.
DR   EnsemblGenomes-Gn; LMHCC_T066.
DR   EnsemblGenomes-Gn; LMHCC_T067.
DR   EnsemblGenomes-Tr; EBT00001776203.
DR   EnsemblGenomes-Tr; EBT00001776204.
DR   EnsemblGenomes-Tr; EBT00001776205.
DR   EnsemblGenomes-Tr; EBT00001776206.
DR   EnsemblGenomes-Tr; EBT00001776207.
DR   EnsemblGenomes-Tr; EBT00001776208.
DR   EnsemblGenomes-Tr; EBT00001776209.
DR   EnsemblGenomes-Tr; EBT00001776210.
DR   EnsemblGenomes-Tr; EBT00001776211.
DR   EnsemblGenomes-Tr; EBT00001776212.
DR   EnsemblGenomes-Tr; EBT00001776213.
DR   EnsemblGenomes-Tr; EBT00001776214.
DR   EnsemblGenomes-Tr; EBT00001776215.
DR   EnsemblGenomes-Tr; EBT00001776216.
DR   EnsemblGenomes-Tr; EBT00001776217.
DR   EnsemblGenomes-Tr; EBT00001776218.
DR   EnsemblGenomes-Tr; EBT00001776219.
DR   EnsemblGenomes-Tr; EBT00001776220.
DR   EnsemblGenomes-Tr; EBT00001776221.
DR   EnsemblGenomes-Tr; EBT00001776222.
DR   EnsemblGenomes-Tr; EBT00001776223.
DR   EnsemblGenomes-Tr; EBT00001776224.
DR   EnsemblGenomes-Tr; EBT00001776225.
DR   EnsemblGenomes-Tr; EBT00001776226.
DR   EnsemblGenomes-Tr; EBT00001776227.
DR   EnsemblGenomes-Tr; EBT00001776228.
DR   EnsemblGenomes-Tr; EBT00001776229.
DR   EnsemblGenomes-Tr; EBT00001776230.
DR   EnsemblGenomes-Tr; EBT00001776231.
DR   EnsemblGenomes-Tr; EBT00001776232.
DR   EnsemblGenomes-Tr; EBT00001776233.
DR   EnsemblGenomes-Tr; EBT00001776234.
DR   EnsemblGenomes-Tr; EBT00001776235.
DR   EnsemblGenomes-Tr; EBT00001776236.
DR   EnsemblGenomes-Tr; EBT00001776237.
DR   EnsemblGenomes-Tr; EBT00001776238.
DR   EnsemblGenomes-Tr; EBT00001776239.
DR   EnsemblGenomes-Tr; EBT00001776240.
DR   EnsemblGenomes-Tr; EBT00001776241.
DR   EnsemblGenomes-Tr; EBT00001776242.
DR   EnsemblGenomes-Tr; EBT00001776243.
DR   EnsemblGenomes-Tr; EBT00001776244.
DR   EnsemblGenomes-Tr; EBT00001776245.
DR   EnsemblGenomes-Tr; EBT00001776246.
DR   EnsemblGenomes-Tr; EBT00001776247.
DR   EnsemblGenomes-Tr; EBT00001776248.
DR   EnsemblGenomes-Tr; EBT00001776249.
DR   EnsemblGenomes-Tr; EBT00001776250.
DR   EnsemblGenomes-Tr; EBT00001776251.
DR   EnsemblGenomes-Tr; EBT00001776252.
DR   EnsemblGenomes-Tr; EBT00001776253.
DR   EnsemblGenomes-Tr; EBT00001776254.
DR   EnsemblGenomes-Tr; EBT00001776255.
DR   EnsemblGenomes-Tr; EBT00001776256.
DR   EnsemblGenomes-Tr; EBT00001776257.
DR   EnsemblGenomes-Tr; EBT00001776258.
DR   EnsemblGenomes-Tr; EBT00001776259.
DR   EnsemblGenomes-Tr; EBT00001776260.
DR   EnsemblGenomes-Tr; EBT00001776261.
DR   EnsemblGenomes-Tr; EBT00001776262.
DR   EnsemblGenomes-Tr; EBT00001776263.
DR   EnsemblGenomes-Tr; EBT00001776264.
DR   EnsemblGenomes-Tr; EBT00001776265.
DR   EnsemblGenomes-Tr; EBT00001776266.
DR   EnsemblGenomes-Tr; EBT00001776267.
DR   EnsemblGenomes-Tr; EBT00001776268.
DR   EnsemblGenomes-Tr; EBT00001776269.
DR   EnsemblGenomes-Tr; EBT00001776270.
DR   EnsemblGenomes-Tr; EBT00001776271.
DR   EnsemblGenomes-Tr; EBT00001776272.
DR   EnsemblGenomes-Tr; EBT00001776273.
DR   EnsemblGenomes-Tr; EBT00001776274.
DR   EnsemblGenomes-Tr; EBT00001776275.
DR   EnsemblGenomes-Tr; EBT00001776276.
DR   EnsemblGenomes-Tr; EBT00001776277.
DR   EnsemblGenomes-Tr; EBT00001776278.
DR   EnsemblGenomes-Tr; EBT00001776279.
DR   EnsemblGenomes-Tr; EBT00001776280.
DR   EnsemblGenomes-Tr; EBT00001776281.
DR   EnsemblGenomes-Tr; EBT00001776282.
DR   EnsemblGenomes-Tr; EBT00001776283.
DR   EnsemblGenomes-Tr; EBT00001776284.
DR   EnsemblGenomes-Tr; EBT00001776285.
DR   EnsemblGenomes-Tr; EBT00001776286.
DR   EnsemblGenomes-Tr; EBT00001776287.
DR   EnsemblGenomes-Tr; EBT00001776288.
DR   EnsemblGenomes-Tr; EBT00001776289.
DR   EnsemblGenomes-Tr; EBT00001776290.
DR   EnsemblGenomes-Tr; EBT00001776291.
DR   EnsemblGenomes-Tr; EBT00001776292.
DR   EnsemblGenomes-Tr; EBT00001776293.
DR   EnsemblGenomes-Tr; EBT00001776294.
DR   EnsemblGenomes-Tr; EBT00001776295.
DR   EnsemblGenomes-Tr; EBT00001776296.
DR   EnsemblGenomes-Tr; EBT00001776297.
DR   EnsemblGenomes-Tr; EBT00001776298.
DR   EnsemblGenomes-Tr; EBT00001776299.
DR   EnsemblGenomes-Tr; EBT00001776300.
DR   EnsemblGenomes-Tr; EBT00001776301.
DR   EnsemblGenomes-Tr; EBT00001776302.
DR   EnsemblGenomes-Tr; EBT00001776303.
DR   EnsemblGenomes-Tr; EBT00001776304.
DR   EnsemblGenomes-Tr; EBT00001776305.
DR   EnsemblGenomes-Tr; EBT00001776306.
DR   EnsemblGenomes-Tr; EBT00001776307.
DR   EnsemblGenomes-Tr; EBT00001776308.
DR   EnsemblGenomes-Tr; EBT00001776309.
DR   EnsemblGenomes-Tr; EBT00001776310.
DR   EnsemblGenomes-Tr; EBT00001776311.
DR   EnsemblGenomes-Tr; EBT00001776312.
DR   EnsemblGenomes-Tr; EBT00001776313.
DR   EnsemblGenomes-Tr; EBT00001776314.
DR   EnsemblGenomes-Tr; EBT00001776315.
DR   EnsemblGenomes-Tr; EBT00001776316.
DR   EnsemblGenomes-Tr; EBT00001776317.
DR   EnsemblGenomes-Tr; EBT00001776318.
DR   EnsemblGenomes-Tr; EBT00001776319.
DR   EnsemblGenomes-Tr; EBT00001776320.
DR   EnsemblGenomes-Tr; EBT00001776321.
DR   EnsemblGenomes-Tr; EBT00001776322.
DR   EnsemblGenomes-Tr; EBT00001776323.
DR   EnsemblGenomes-Tr; EBT00001776324.
DR   EnsemblGenomes-Tr; EBT00001776325.
DR   EnsemblGenomes-Tr; EBT00001776326.
DR   EnsemblGenomes-Tr; EBT00001776327.
DR   EnsemblGenomes-Tr; EBT00001776328.
DR   EnsemblGenomes-Tr; EBT00001776329.
DR   EnsemblGenomes-Tr; EBT00001776330.
DR   EnsemblGenomes-Tr; EBT00001776331.
DR   EnsemblGenomes-Tr; EBT00001776332.
DR   EnsemblGenomes-Tr; EBT00001776333.
DR   EnsemblGenomes-Tr; EBT00001776334.
DR   EnsemblGenomes-Tr; EBT00001776335.
DR   EnsemblGenomes-Tr; EBT00001776336.
DR   EnsemblGenomes-Tr; EBT00001776337.
DR   EnsemblGenomes-Tr; EBT00001776338.
DR   EnsemblGenomes-Tr; EBT00001776339.
DR   EnsemblGenomes-Tr; EBT00001776340.
DR   EnsemblGenomes-Tr; EBT00001776341.
DR   EnsemblGenomes-Tr; EBT00001776342.
DR   EnsemblGenomes-Tr; EBT00001776343.
DR   EnsemblGenomes-Tr; EBT00001776344.
DR   EnsemblGenomes-Tr; LMHCC_R001-1.
DR   EnsemblGenomes-Tr; LMHCC_R002-1.
DR   EnsemblGenomes-Tr; LMHCC_R003-1.
DR   EnsemblGenomes-Tr; LMHCC_R004-1.
DR   EnsemblGenomes-Tr; LMHCC_R005-1.
DR   EnsemblGenomes-Tr; LMHCC_R006-1.
DR   EnsemblGenomes-Tr; LMHCC_R007-1.
DR   EnsemblGenomes-Tr; LMHCC_R008-1.
DR   EnsemblGenomes-Tr; LMHCC_R009-1.
DR   EnsemblGenomes-Tr; LMHCC_R010-1.
DR   EnsemblGenomes-Tr; LMHCC_R011-1.
DR   EnsemblGenomes-Tr; LMHCC_R012-1.
DR   EnsemblGenomes-Tr; LMHCC_R013-1.
DR   EnsemblGenomes-Tr; LMHCC_R014-1.
DR   EnsemblGenomes-Tr; LMHCC_R015-1.
DR   EnsemblGenomes-Tr; LMHCC_R016-1.
DR   EnsemblGenomes-Tr; LMHCC_R017-1.
DR   EnsemblGenomes-Tr; LMHCC_R018-1.
DR   EnsemblGenomes-Tr; LMHCC_T001-1.
DR   EnsemblGenomes-Tr; LMHCC_T002-1.
DR   EnsemblGenomes-Tr; LMHCC_T003-1.
DR   EnsemblGenomes-Tr; LMHCC_T004-1.
DR   EnsemblGenomes-Tr; LMHCC_T005-1.
DR   EnsemblGenomes-Tr; LMHCC_T006-1.
DR   EnsemblGenomes-Tr; LMHCC_T007-1.
DR   EnsemblGenomes-Tr; LMHCC_T008-1.
DR   EnsemblGenomes-Tr; LMHCC_T009-1.
DR   EnsemblGenomes-Tr; LMHCC_T010-1.
DR   EnsemblGenomes-Tr; LMHCC_T011-1.
DR   EnsemblGenomes-Tr; LMHCC_T012-1.
DR   EnsemblGenomes-Tr; LMHCC_T013-1.
DR   EnsemblGenomes-Tr; LMHCC_T014-1.
DR   EnsemblGenomes-Tr; LMHCC_T015-1.
DR   EnsemblGenomes-Tr; LMHCC_T016-1.
DR   EnsemblGenomes-Tr; LMHCC_T017-1.
DR   EnsemblGenomes-Tr; LMHCC_T018-1.
DR   EnsemblGenomes-Tr; LMHCC_T019-1.
DR   EnsemblGenomes-Tr; LMHCC_T020-1.
DR   EnsemblGenomes-Tr; LMHCC_T021-1.
DR   EnsemblGenomes-Tr; LMHCC_T022-1.
DR   EnsemblGenomes-Tr; LMHCC_T023-1.
DR   EnsemblGenomes-Tr; LMHCC_T024-1.
DR   EnsemblGenomes-Tr; LMHCC_T025-1.
DR   EnsemblGenomes-Tr; LMHCC_T026-1.
DR   EnsemblGenomes-Tr; LMHCC_T027-1.
DR   EnsemblGenomes-Tr; LMHCC_T028-1.
DR   EnsemblGenomes-Tr; LMHCC_T029-1.
DR   EnsemblGenomes-Tr; LMHCC_T030-1.
DR   EnsemblGenomes-Tr; LMHCC_T031-1.
DR   EnsemblGenomes-Tr; LMHCC_T032-1.
DR   EnsemblGenomes-Tr; LMHCC_T033-1.
DR   EnsemblGenomes-Tr; LMHCC_T034-1.
DR   EnsemblGenomes-Tr; LMHCC_T035-1.
DR   EnsemblGenomes-Tr; LMHCC_T036-1.
DR   EnsemblGenomes-Tr; LMHCC_T037-1.
DR   EnsemblGenomes-Tr; LMHCC_T038-1.
DR   EnsemblGenomes-Tr; LMHCC_T039-1.
DR   EnsemblGenomes-Tr; LMHCC_T040-1.
DR   EnsemblGenomes-Tr; LMHCC_T041-1.
DR   EnsemblGenomes-Tr; LMHCC_T042-1.
DR   EnsemblGenomes-Tr; LMHCC_T043-1.
DR   EnsemblGenomes-Tr; LMHCC_T044-1.
DR   EnsemblGenomes-Tr; LMHCC_T045-1.
DR   EnsemblGenomes-Tr; LMHCC_T046-1.
DR   EnsemblGenomes-Tr; LMHCC_T047-1.
DR   EnsemblGenomes-Tr; LMHCC_T048-1.
DR   EnsemblGenomes-Tr; LMHCC_T049-1.
DR   EnsemblGenomes-Tr; LMHCC_T050-1.
DR   EnsemblGenomes-Tr; LMHCC_T051-1.
DR   EnsemblGenomes-Tr; LMHCC_T052-1.
DR   EnsemblGenomes-Tr; LMHCC_T053-1.
DR   EnsemblGenomes-Tr; LMHCC_T054-1.
DR   EnsemblGenomes-Tr; LMHCC_T055-1.
DR   EnsemblGenomes-Tr; LMHCC_T056-1.
DR   EnsemblGenomes-Tr; LMHCC_T057-1.
DR   EnsemblGenomes-Tr; LMHCC_T058-1.
DR   EnsemblGenomes-Tr; LMHCC_T059-1.
DR   EnsemblGenomes-Tr; LMHCC_T060-1.
DR   EnsemblGenomes-Tr; LMHCC_T061-1.
DR   EnsemblGenomes-Tr; LMHCC_T062-1.
DR   EnsemblGenomes-Tr; LMHCC_T063-1.
DR   EnsemblGenomes-Tr; LMHCC_T064-1.
DR   EnsemblGenomes-Tr; LMHCC_T065-1.
DR   EnsemblGenomes-Tr; LMHCC_T066-1.
DR   EnsemblGenomes-Tr; LMHCC_T067-1.
DR   EuropePMC; PMC2996996; 20846431.
DR   EuropePMC; PMC3019230; 21126366.
DR   EuropePMC; PMC3133316; 21602330.
DR   EuropePMC; PMC3156400.
DR   EuropePMC; PMC3318424; 22252871.
DR   EuropePMC; PMC4536003; 26484097.
DR   EuropePMC; PMC4609684; 26311854.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00002; 5_8S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00011; RNaseP_bact_b.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00038; PrfA.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00080; yybP-ykoY.
DR   RFAM; RF00162; SAM.
DR   RFAM; RF00167; Purine.
DR   RFAM; RF00168; Lysine.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00230; T-box.
DR   RFAM; RF00234; glmS.
DR   RFAM; RF00380; ykoK.
DR   RFAM; RF00504; Glycine.
DR   RFAM; RF00515; PyrR.
DR   RFAM; RF00522; PreQ1.
DR   RFAM; RF00555; L13_leader.
DR   RFAM; RF00557; L10_leader.
DR   RFAM; RF00558; L20_leader.
DR   RFAM; RF00559; L21_leader.
DR   RFAM; RF00615; LhrA.
DR   RFAM; RF00616; LhrC.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01457; rli22.
DR   RFAM; RF01459; rliE.
DR   RFAM; RF01460; rliH.
DR   RFAM; RF01462; rli26.
DR   RFAM; RF01463; rli27.
DR   RFAM; RF01465; rli31.
DR   RFAM; RF01466; rli34.
DR   RFAM; RF01467; rli36.
DR   RFAM; RF01468; rli32.
DR   RFAM; RF01469; rli33.
DR   RFAM; RF01471; rliB.
DR   RFAM; RF01472; rli40.
DR   RFAM; RF01473; rli41.
DR   RFAM; RF01474; rli42.
DR   RFAM; RF01475; rli45.
DR   RFAM; RF01478; rli47.
DR   RFAM; RF01479; rli48.
DR   RFAM; RF01480; rli52.
DR   RFAM; RF01481; rli53.
DR   RFAM; RF01482; AdoCbl_riboswitch.
DR   RFAM; RF01483; rli56.
DR   RFAM; RF01484; rli59.
DR   RFAM; RF01485; rli61.
DR   RFAM; RF01486; rli62.
DR   RFAM; RF01487; rliI.
DR   RFAM; RF01488; rli49.
DR   RFAM; RF01489; sbrA.
DR   RFAM; RF01490; rli51.
DR   RFAM; RF01491; rli54.
DR   RFAM; RF01492; rli28.
DR   RFAM; RF01493; rli37.
DR   RFAM; RF01494; rliD.
DR   RFAM; RF01708; L17DE.
DR   RFAM; RF01749; pan.
DR   RFAM; RF01766; cspA.
DR   RFAM; RF01776; RatA.
DR   RFAM; RF01854; Bacteria_large_SRP.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   SILVA-LSU; CP001175.
DR   SILVA-SSU; CP001175.
XX
CC   Bacteria available on request from Mark Lawrence
CC   (lawrence@cvm.msstate.edu).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2976212
FT                   /organism="Listeria monocytogenes HCC23"
FT                   /strain="HCC23"
FT                   /serotype="4a"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:552536"
FT   gene            21..93
FT                   /locus_tag="LMHCC_T056"
FT   tRNA            21..93
FT                   /locus_tag="LMHCC_T056"
FT                   /product="tRNA-Thr"
FT                   /note="tRNA-Thr-1"
FT   gene            246..1133
FT                   /locus_tag="LMHCC_0002"
FT   CDS_pept        246..1133
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0002"
FT                   /product="transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38368"
FT                   /protein_id="ACK38368.1"
FT                   /translation="MKEKKQRIIKSAKEVFQKQGYLKTSVQDMVDAAGISKGTFYNYFT
FT                   SKEELAIVIFKQEYSVLHQRLEYTMGLDGTKKDNFTECLKIIIHFYTENGEILNITFSQ
FT                   TMIDDDFNAFLQNVRLKNMEWVKNQLLEVYGKETEPYINDITMLLSGMAAMYVFASGSK
FT                   NVDSGLIERAIPYVVRRLDALVKDILESGEIVFTEADTENLVPDQTMIRKKRLAKLRGA
FT                   LEELNVGIENADIDDSDKWQYKESMNALVGEINNNEAPRDFMVQGTLLYLKQHVPASLT
FT                   KEVNKLEACVNGLL"
FT   gene            1234..2715
FT                   /locus_tag="LMHCC_0003"
FT   CDS_pept        1234..2715
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0003"
FT                   /product="lincomycin resistance protein LmrB"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38369"
FT                   /protein_id="ACK38369.1"
FT                   /translation="MNSTAVERPVDVNGKSYSRSLLVVTMIIGAFVAILNQTLLATALP
FT                   MIMDDLHITAATGQWLTTAFLLTNGIMIPITALLIEKISSKTLFITAMTVFTIGTIIAS
FT                   VAGSFPVLLTGRIVQAAGAGIMMPLLQTIFLLIFPREKRGAAMGLMGLVIAFAPAIGPT
FT                   LSGWIVDSYDWRVLFLILIPIAVIDIILAFFGMKKVVKLTDTKIDFLSIVMSSIGFGSL
FT                   LYGFSSAGNDGWGDTTVITMLIVGVVVIGLFVWRQLVIDNPMLELHVFKYPVFSLSVIL
FT                   GSIVTMAMIGAEIVLPLYIQTIRGESALQSGLLLLPGAIIMGIMSPITGIIFDKIGAKW
FT                   LTITGVTILTIGTIPFMFLTMDTPLWYIVVFYAVRFFGISMAMMPVSTAGMNALPNHLI
FT                   NHGSAVNNTIRQIAGSIGTAVLITVLTNVTKDNMPGKALMATDPASFAQKAQDASLDGM
FT                   RAAFMVAAIFAAIGMILSLFLKNKKQEPIVKEYTK"
FT   gene            complement(2765..3607)
FT                   /locus_tag="LMHCC_0004"
FT   CDS_pept        complement(2765..3607)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0004"
FT                   /product="protein of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38370"
FT                   /protein_id="ACK38370.1"
FT                   /translation="MTKQLLVLQSDFGISDGAVSAMYGVINSVSKDLQIYDLTHQIPQF
FT                   NIWEASYRLLQTVTYWPKDTIFVSIVDPGVGSKRRSVAVLTEDGHYIITPDNGTLTHIA
FT                   HYGTIKEVRLIDEEKNRLPKSGASHTFHGRDIFAYTAARLAAGVINFEDIGPAATPDSI
FT                   VSLSLSDSYLEGEQAFGTIDIIDRPFGNLWTNIRRTDFLQLGANYGDSIEVLIKHHDRV
FT                   VYKNFVTYSRSFADLRIGEALIYVNSLDNLGLGINQGSFVDAYSVGTGTSWKVTLKKV"
FT   gene            4105..7092
FT                   /locus_tag="LMHCC_0005"
FT   CDS_pept        4105..7092
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0005"
FT                   /product="formate dehydrogenase Alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38371"
FT                   /protein_id="ACK38371.1"
FT                   /translation="MGAKVSVQINGVARDVVEGTRILDYLNAEGIQHPHICYSEQIGPI
FT                   QSCDTCMCEVDGELVRACSTNLTDGMEIKTNSELAKDAQLEAMDRILENHLLYCTVCDN
FT                   NNGNCKVHNTTELLGVEKQDRPYREKGYLNDFSHPFYRYDPDQCILCGRCVEACQQVQV
FT                   NETLSIDWERSQPRVIWDDDRPANLSSCVSCGLCATVCPCNALMEKSMLGQAGFMTGLD
FT                   EDMLEPMIDMVKKVEPNYQTVFAVSEMEAAMRETRTKKTKTVCTFCGVGCTFEVWTKDR
FT                   KILKVEPTGEGPVNKFATCVKGKFGWDFVNSEKRITTPLIREGNEFVPASWEDAIHLVA
FT                   TKLREIQAKYGNDSIGFISSSKTTNEENYLMQKLARQVFETNNIDNCSRYCQAPASDGL
FT                   TRTVGIGADSGTVEDIETAGLVIIVGASPADGHPVLASRIKRAQKTRGQKLIVSDLRKH
FT                   EMAERSDLFIHPKQGTDFVWLTAVAKYMIDQGWHDEVFMENRISNVADYLAFLEPFTLE
FT                   YAEKETGLSVETLKKVAQMVHEADGTAVCWGMGVTQNIAGSHTSSAIANLLLVTGNFGR
FT                   HGAGAYPLRGHNNVQGACDMGSLPNVLPGIQPLGNDEVRARFEEAYGVSISPEPGLKNN
FT                   EMLDAIEAGTLHSMYVIGEEMAWVDSNSNHVQEILASLDFFVVQDVFLSKTAQFADVVF
FT                   PAAPSLEKEGTFTNTERRVQRLYEVLEPLGDSKPDWWIIQEVARACGRTDWNYDHPSEI
FT                   MDEIASLAPFFAGVRYDRMQGFNSLVWPVSADGKDMPLLYEERFNFPDGKAQFSTLPYI
FT                   APITFPEEYNLTLNNGRLLEQFHEGNLTDKSKGLDYKLPEVFVEVSHELAKERDLESGS
FT                   LVRLSSPYGRIKLRAVVTERMKGNEVYVPMHSVSSETAVNLLTSSAGDVRTKTPAYKQT
FT                   KVNLTVLEKTGKNPLPDHNPRNRKRFPQNGAEVERKWSREDYQPISKVNCACGGNCGCG
FT                   GKGRNH"
FT   gene            7092..7568
FT                   /locus_tag="LMHCC_0006"
FT   CDS_pept        7092..7568
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0006"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38372"
FT                   /protein_id="ACK38372.1"
FT                   /translation="MAEPISTIRDTKKTPEELEQERLEQMKADIAEQDSGFVEIVETVK
FT                   LLQESGALEALNSAIKARGDITKTFLNEWRKEPMTNAINNIMISSKLLTDTKPEQTEEM
FT                   IANLKNAAKKAEESAKKEEIMGMLAMMKALKDPDINRALRYGITFLKEVGQTLK"
FT   gene            7630..8415
FT                   /gene="fdhD"
FT                   /locus_tag="LMHCC_0007"
FT   CDS_pept        7630..8415
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fdhD"
FT                   /locus_tag="LMHCC_0007"
FT                   /product="formate dehydrogenase family accessory protein
FT                   FdhD"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38373"
FT                   /protein_id="ACK38373.1"
FT                   /translation="MDIVSHQKIRRFEAGTFQEIESSVATEYPLTIYVNDQELVTIVCT
FT                   PEYLEDLVVGFLTSEGIIRGPGDIDSVDIIEATGHAKVSANFVNKFNAKYRGKRYITSC
FT                   CGKSRENFYFQSDASLVNVKQNGSLQLTTNTIFRLMEKFEQNSATFHQTGGVHNAALCS
FT                   SAEIIYSRMDIGRHNALDKIYGRALQDGTATENKAIIFSGRISSEILVKTAKLGCGIIL
FT                   SRSAPTELAINMAEELNITTVGFIRGDRLNVYSGFERIT"
FT   gene            8462..9139
FT                   /locus_tag="LMHCC_0008"
FT   CDS_pept        8462..9139
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0008"
FT                   /product="alkaline phosphatase synthesis transcriptional
FT                   regulatory proteinphoP"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38374"
FT                   /protein_id="ACK38374.1"
FT                   /translation="MKQILVVDDDRHILKLVGHYLRAEGFRVLEAIDGIEAEKIVETEQ
FT                   VHLAVIDVMMPNMDGFELCQKMRASFPDIPVIMLTAKDALADKSRGFEVGTDDYVTKPF
FT                   EPEELVFRIRALLRRSNQASEVKINIGNITIDQKSYGIKIGNQERMIPVKEFELLYQLA
FT                   SYPGRIFTREELIERIWQRDYDGSDRTVDVHIKRLRDHFDEEKDGIRIVTVRGVGYKLE
FT                   EAT"
FT   gene            9136..10515
FT                   /locus_tag="LMHCC_0009"
FT   CDS_pept        9136..10515
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0009"
FT                   /product="sensor histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38375"
FT                   /protein_id="ACK38375.1"
FT                   /translation="MKSLYSRIVVTMLVVILSSSLLGFFFANIYYQIKLKPFNDEKTAK
FT                   IAKEVQQFYESNATISLNEYLENVGELGYELYLTDGAEKSTYFGGAFRKKDLPDKTIKQ
FT                   VLDGETYHGIDSFDTGIFITGFFDNDVRNTIGVPVQADGKQLALFIRQDPEQQFGELRI
FT                   FFAMILIFTSIISILFVLISGRYIVNPVVKLTNATKKIRKGNYDVALEVRRKDEIGQLA
FT                   DSFAKMASELEKSEAARQEFVANVSHELQSPLTSMQGFARLLGSGTLTEKEQAEYLTVL
FT                   SEETTRLSSLTKQLLTLASLDQESELRKKEPVHLAKQWRQLIQMTEWSWREKELTINLD
FT                   LADVNYTGDAELLYQVWSNLLTNAIKFTPQGGNIQIHLYEEGTNVFVEVQDSGVGISKS
FT                   DMAKIFERFYKANQSRTREEGSSGLGLSICQKIITLHHGEITVQSSPEKGTTFTVKLPK
FT                   N"
FT   gene            10594..11682
FT                   /locus_tag="LMHCC_0010"
FT   CDS_pept        10594..11682
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0010"
FT                   /product="ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38376"
FT                   /protein_id="ACK38376.1"
FT                   /translation="MFLALRELKHSKLRYILIGLIMVLIAWLVLFVTGLANGLANDNGA
FT                   AISSNKATYYVLQKDSDNRLTRSNLTASETESVAKQVKKSESTNLGVQMGTITPPDKDK
FT                   KTDITYFGIDKTGFMKPAISEGTEPQKTTEVVADISLKESGYKLGSKLKDSATGEEFTI
FT                   TAFTKNNTFSHSPVIFVGWDAWKLVHQTNQAAEGEYNAVALDVSESTAKNLSLGSMKLS
FT                   SSKEVLQGIPGYSEEQGSLLMMIAFLFVIAAFVLAAFFYVITIQKINQFGILKAVGART
FT                   AYLGRSIVTQVVFLSVVSLLIGNGLTFGLAAILPASMPFTLSPVLAIGCSALFLVVAVI
FT                   GSMLSLYRVAKVDALEAIGRAN"
FT   gene            11682..12353
FT                   /locus_tag="LMHCC_0011"
FT   CDS_pept        11682..12353
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0011"
FT                   /product="macrolide export ATP-binding/permease protein
FT                   MacB"
FT                   /EC_number="3.6.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38377"
FT                   /protein_id="ACK38377.1"
FT                   /translation="MTLIMKNISKNYQDGEQVIEVLKNVSLEVAQGEFVAIVGPSGAGK
FT                   STFLSIAGALLSPTEGEIAIGGTTLNNMSEKALTKVRLDKVGFIFQGANLIPYLSVRDQ
FT                   LLVIAELSGEKGSAAKERADKLLQELGLTARQNNYPESLSGGEKQRVAIARALMNDPDI
FT                   ILADEPTASLDANRGHKVVQMIADEVKRKNKAAIMVTHDERVLDLVDRVIRIEDGYLKA
FT                   E"
FT   gene            12705..15026
FT                   /locus_tag="LMHCC_0013"
FT   CDS_pept        12705..15026
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0013"
FT                   /product="listeria-Bacteroides repeat domain
FT                   (List_Bact_rpt) family"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38379"
FT                   /protein_id="ACK38379.1"
FT                   /translation="MKRKISLLIAVGIILLQLSADPFAIWASENNGNNANAAETATKYK
FT                   VILDVQGNLTITEELEAGELIKTNPAIPVVEGYAFWGWYDQPNGQGVRWTPTGLPMPGH
FT                   DLHLYGYFTIKTYTATLISEERTATQPVVYQNKINEPTKPVKDGYTFIGWYDAETGGKK
FT                   WDFANDLMPGKNITLYARFASKTYPMTFDNGGVTTTETVDYDGLAEEPTTPTKAGYTFD
FT                   GWYDAETGGKKWDFAQDKMPANPVTLYARFTMNNYTATFNNDGTTTTQTVDYQEALTEP
FT                   TEPTKDGYTFDGWYDAQTGGTKWNFATNKMPANNITLYARYSVKSYTATFDKEGTTTTQ
FT                   TANYDSLLTEPAAPTKDGYTFDGWYDAETGGTKWNFATNKMPAKNVTLYARFTVKSYTA
FT                   TFDKDGTTTTQTVNYDSLIQEPTAPTKDGYTFTGWYDAETGGNKWDFAANKMPAKNVTL
FT                   YARFSTNAYTATFDKEGTTTTQAVDYDSLLTEPTAPTKDGYTFDGWYDAETGGTKWNFA
FT                   TNKMPAKNMTLYARFSLKAYTATFNVEDTTTTQAVDYDALIEEPTAPTKEGHTFDGWYD
FT                   AETGGSKWDFAANKMPAKDVTLYARFTVKSYTVTLNGEAVTTQTVDYLGLLQEPTAPIK
FT                   AGYTFDGWYDAETGGNKWDFATNKMPANDLALYARFTKNPVAPVDPVDPVNPIQPSDPS
FT                   DPSDPSDPAHQDDPIDNILPATEKTNITAAVKPANDPVKITKQSKKLPKTGDQENILYL
FT                   LIGLLLIAGTFGYIKKMSHK"
FT   gene            complement(15017..15148)
FT                   /locus_tag="LMHCC_0012"
FT   CDS_pept        complement(15017..15148)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0012"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38378"
FT                   /protein_id="ACK38378.1"
FT                   /translation="MLNRADFRYFFQQFPIDTNLTSKRGKKAAYEHRASYAASNFYL"
FT   gene            15434..17518
FT                   /locus_tag="LMHCC_0014"
FT   CDS_pept        15434..17518
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0014"
FT                   /product="cell wall surface anchor family protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38380"
FT                   /protein_id="ACK38380.1"
FT                   /translation="MKRKLSLIIVAGMILFQSFSAYPLATFAADTKPLKATLQAGSTYA
FT                   SAFPDANLAKVVAQAATGSDDITQVATQDDLDKVVTLTANSKEIANLAGIDLLRNVTSI
FT                   NLSDNKITTVSLKGDITLPNVTSINLRGNDLTTIDIQDQPKLVKVFCDTQDSAELTEVV
FT                   LKNLPDLKVAGGVSDASGDTIDFSKTRTLTKMTLENLPAMAGALALSECSMTEVTVKNL
FT                   PLAINITIYDNKVKTLAGLEDLPLITRIYASKNEITELDSLKSFPEVANIAITNNHVSV
FT                   LPEELKTKLPKLTYINASDQTITLPEQTVASNLVLDNSIKNFGQVATANSISDKGTYKD
FT                   NQITWTAANLKDVNTVDYGFSESVSQSPIDGTFSGKVTVPLKKVDLPVITARDEIYYDK
FT                   NANISEQVFLSNVAASVTEGATITSDYDTVVDFTKGGTYEVTLNAKNSAGFEAEPVKVK
FT                   VHINKALAPVITANPEISYMVFAEVTEADFLKNIQASTNDGSVITSDFGTVVKLNEAGD
FT                   YTVTLKSVNSDDVDAKPVQVTVRITPKPTPILANVVFDIDDVQTTEAIVVEGFITEPAA
FT                   PTKDGYTFDGWYDAKTGGNKWNFATNKMPAAGITLYAQFSKIVNNDPQTGGGTTVTENN
FT                   NGGLSDPPANTNNKAKDQNKKSQTGKHPATGDSQNMLYLLAGLLLVGVSLRIFKKSYSK
FT                   "
FT   gene            complement(17566..17856)
FT                   /locus_tag="LMHCC_0015"
FT   CDS_pept        complement(17566..17856)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0015"
FT                   /product="YneC family protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38381"
FT                   /protein_id="ACK38381.1"
FT                   /translation="MIHIEAKIQVKPDFIESFLKEVELVIQGSLSEAGNHGYELVRSVK
FT                   TPSTFYLLEKWADEAAIQFHNSTEHYKRFKREIPAFLASPTEVDVLTKNKK"
FT   gene            complement(17869..18741)
FT                   /locus_tag="LMHCC_0016"
FT   CDS_pept        complement(17869..18741)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0016"
FT                   /product="lipoprotein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38382"
FT                   /protein_id="ACK38382.1"
FT                   /translation="MKKYFITIMILLFGALILSACQNDEAESSEPPKVDLKDQIPIILI
FT                   HGSGGDTHSLDEMADQLMNEYKTSNEAMAMSINSDGDITFQGELTKDAKRPIIKFAFDQ
FT                   NQATPDDWSKWLKIAMTDLKSRYGFTQMDGVGHSNGGLALTYFAEDYPSDKEVPTLRKL
FT                   VAIGSPFNDLDPNDNGKDLAFKTLPNSTPQLDYFMEKQTDINPNLEVLAIAGELSEDNP
FT                   TDGIVPTNSSLATRLFVAGNAKAYIEDVQVGESAVHQTLHETPKSIEKTHWFLEEFKTD
FT                   ETVIQLDYK"
FT   gene            18856..19683
FT                   /locus_tag="LMHCC_0017"
FT   CDS_pept        18856..19683
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0017"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38383"
FT                   /protein_id="ACK38383.1"
FT                   /translation="MANLAIDTVITDMDGTLLVKKGDQIHPLNKEVLMDWQAGGKKLFL
FT                   ATGRLDLAILPFIHELKIKTPVISCNGGLVRDFTTGEILYKSNIELDLVHTILETLEPL
FT                   GVNYHIYTTERILGPTNTGKIAFFNELNKTLPENEQVPITLTTDPFSVLREGEFPLKVL
FT                   VIESDLEKRAEIKAALEGLPLSVLASASNLIDIMNEGIDKAKGLTYLADNGYIDLDSTI
FT                   AFGDNENDVGMIELAEIGVAMENGIPLALEKADKIAKHHDIGGLGLFMQEEIL"
FT   gene            19851..20762
FT                   /locus_tag="LMHCC_0018"
FT   CDS_pept        19851..20762
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0018"
FT                   /product="zinc transporter ZitB"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38384"
FT                   /protein_id="ACK38384.1"
FT                   /translation="MAHNHDHAHGHNHNHAHNANKKSLFISFILIATFMIVEVIGGIMT
FT                   NSLALLSDAGHMLSDAVALGLSLAAFKFGEKAASSDKTYGYKRFEILAAFLNGLTLVGI
FT                   SVFIFYEAIGRFFDPPQVIGAGMMTISVIGLLVNILVAWILMKGDTSENLNMRSAFLHV
FT                   LGDLLGSVGAIIAALLIIFLGWNIADPIASVIVAALILVSGWRVLKDAIHILMEGKPAN
FT                   VDTEEIKTFFQQQDGVKEVHDLHVWAITSDFNALTAHLTVCEDADRDKILADIEHYLQE
FT                   NFSLEHSTIQLEGNHAHHHHCN"
FT   gene            20811..21083
FT                   /locus_tag="LMHCC_0019"
FT   CDS_pept        20811..21083
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0019"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38385"
FT                   /protein_id="ACK38385.1"
FT                   /translation="MEEQVDLGHFLKKTFIAVVAVTLVFIGVLAMFTIIGVIIAIPLLK
FT                   KASKMLLSTKEDSDHTHSHGGKLKIKCPACHAKMKFKDSELLDEK"
FT   gene            21180..22178
FT                   /locus_tag="LMHCC_0020"
FT   CDS_pept        21180..22178
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0020"
FT                   /product="alcohol dehydrogenase, zinc-dependent"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38386"
FT                   /protein_id="ACK38386.1"
FT                   /translation="MKAVGLTKASTGFVDIEIDQPVPGSHDLLVKIKAISINPVDTKQL
FT                   EATKLSGEEVRILGWDAVGEVVDTGSDVTLFKTGQDVYFAGDVTRPGAYAEFTLIDERL
FT                   VGLKPQKLTVEEAAAMPLTTITAWEALFERLGITENDKGKAILIINGAGGVGSIATQLA
FT                   ANAGLEVIATASRAETIEWTKKHGANYVINHRENIPKQLNELGFEQSVDFILCLHNTNA
FT                   HWDVMQEVIRPQGKICSIVELAEPVKMTLLKDKSATFSYEFMFTRSKYNTEDKIKQHEI
FT                   LTEAAQMLDAGELTTTLNQVLSPVNAATIEEAHKIISSGKMIGKLVVKGLE"
FT   gene            22181..22705
FT                   /locus_tag="LMHCC_0021"
FT   CDS_pept        22181..22705
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0021"
FT                   /product="riboflavin biosynthesis protein RibD C-domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38387"
FT                   /protein_id="ACK38387.1"
FT                   /translation="MSEKQVALYIAVSLDGYIADENGSVEWLESIDSEGDAGYEAFFDN
FT                   VDTVVMGRTTYQQIFSLTDTFPYSKKDVYVFSNTKAGTKDEYADFVAGTVDTWLNNIDG
FT                   EKIWLVGGAKLVQQFLKEKAIDRFVITIAPIILGKGIPLFEEDREHALELEEVTRFGQF
FT                   AQLTYKNLEEN"
FT   gene            22706..23338
FT                   /locus_tag="LMHCC_0022"
FT   CDS_pept        22706..23338
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0022"
FT                   /product="isochorismatase hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38388"
FT                   /protein_id="ACK38388.1"
FT                   /translation="MKIAAFDIDAQKGFTPLCPDELPVSGGDKIVPELNFMASLASIRI
FT                   GSKDAHPQNAVWVVDSKDEMLAKLEYPNADRTWVRHCEPGTKGFELLDGLPVVTDYDYF
FT                   IWKGMEPDIHPYGACYHDIVEQLSTGVLEYLREQKVDLVLVGGLAFDFCVKTTVIQLSR
FT                   AGFSVLVYLPATRALSEQGFDETKEQLANTEKVQLIETREELVAYCQ"
FT   gene            23362..23976
FT                   /locus_tag="LMHCC_0023"
FT   CDS_pept        23362..23976
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0023"
FT                   /product="membrane protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38389"
FT                   /protein_id="ACK38389.1"
FT                   /translation="MRKVGIFPSMIILFTVGISAVLYPLLPSEVAVHFGTDFSPDMFMQ
FT                   KWLGLILIPFLMIMFTGTEYYGKEKVNQESLLEFEYCFRLLLVLLTIIQMSIIVYALGY
FT                   DIPTGRFSLVTAGAFMFVVAAYIQYSKKLFKFLTMIGFKKIDAWSRNLLRKITTVTLNI
FT                   AGTICFILALFMRNDPSYLMLAMLMTMCVIVVGSGVYLNKK"
FT   gene            24022..24138
FT                   /locus_tag="LMHCC_0024"
FT   CDS_pept        24022..24138
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0024"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38390"
FT                   /protein_id="ACK38390.1"
FT                   /translation="MVAEVLREFGRKSVIFLRNQKALTKEEEKYCIKQPEKW"
FT   gene            24111..25772
FT                   /locus_tag="LMHCC_0025"
FT   CDS_pept        24111..25772
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0025"
FT                   /product="bacterial extracellular solute-binding protein,
FT                   family 5"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38391"
FT                   /protein_id="ACK38391.1"
FT                   /translation="MHKTARKMVVALSLLCLLALTACQSGNKGENEKVTSDKKAKVVNI
FT                   METSGIPNASPTLADNSVSFRVINQIFEGLYRLDKNGKPALALAASEPEEKDGGKTLIF
FT                   KIREDANWSNGDPVTAHDFEYAWKKVVDPKTAAAYGPQMEEIVKNATQILKGEMSPDEL
FT                   GIKALDDKTLQIELENPVPIFKELLTTGTFFPENQAFVEKQGDRYGTKSDTLISNGPYK
FT                   LENWNGTNMTWDYVKNPTYWDKKNVPTEKIHVTVVKDTNAALNLYNTNKLDRVELDGEF
FT                   VKQYKDDKNFHKEATGRSVYMKMNQGKDGVKTDLANLNLRRGLAMAIDKTGMVNTLLAN
FT                   GSKALNGDVPGDIMFDPETKEDYRKQNGDLLKFDQQEATNAWKQGLKEIGKTELTLTLT
FT                   SGDTSLQRKQTEFIQNQLEENLPGLTIKLKNVTNQASFQADVTQDFELLLGGWGGDYQD
FT                   PLTYLNLFLTNSPGNHTGFSDAKYDELVLGAKGKLSADPEKRWQALLEAEQILLKDNAV
FT                   LIPLYQGGRAYLQKSNLKNYTTYPIGSENYKWIEKN"
FT   gene            25926..26249
FT                   /locus_tag="LMHCC_0028"
FT   CDS_pept        25926..26249
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0028"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38392"
FT                   /protein_id="ACK38392.1"
FT                   /translation="MKKGLFGLLAAIFVLTMVVIEFSAPIGSAANTYYVTIKNDGKEVT
FT                   KSKFKGYSFQESCLDNQGNSHKVNFMSTTQLKKNKQYKIVVQDNELLVQAKEINSVPLA
FT                   SSK"
FT   gene            26272..26472
FT                   /locus_tag="LMHCC_0029"
FT   CDS_pept        26272..26472
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0029"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38393"
FT                   /protein_id="ACK38393.1"
FT                   /translation="MNSFWKIFFTVILGFIALNIVLDIVGITLHFLFPVLILGGIGYLL
FT                   YRMWGNSPKRPSRDNEDRYNW"
FT   gene            26791..27627
FT                   /locus_tag="LMHCC_0030"
FT   CDS_pept        26791..27627
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0030"
FT                   /product="biotin/lipoate A/B protein ligase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38394"
FT                   /protein_id="ACK38394.1"
FT                   /translation="MNIDNTLLKQDVWRFIDNTTINPAFDAIQSFATDDTLCRSVGARI
FT                   APSTVRGWVHEKTVSLGIQDSKLPDIDKGIAFLQEQGYRVVVRNSGGLAVVLDSGVLNL
FT                   SMVLPDAERGIAIERGYETMFTLIKDMFVDCNEVIEAKEIEDSYCPGSYDLSIQGKKFA
FT                   GISQRRMAKGVAVQIYLAIDGDQTARSELIRDFYTISGKAKQTKYTFPNVNPDVMGSLS
FT                   DLMKTDISLNDTLVRLFNSLRHYAGELVSGTLTPEELDLFPAYYERLIARNDKVLT"
FT   gene            27642..28964
FT                   /locus_tag="LMHCC_0031"
FT   CDS_pept        27642..28964
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0031"
FT                   /product="HD domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38395"
FT                   /protein_id="ACK38395.1"
FT                   /translation="MSYLTEKLLEEKVFKDPVHGYVHVSDKIIWDLIATKEFQRLRRIH
FT                   QLGTTSLTFHGAEHSRFNHSLGVYEIVRQIIDVTFANEPQLDPEERMVALCAALLHDLG
FT                   HGPFSHAFEKVFGTDHEAYTQEIIIGDTEVSDVLMRVGEEFPLKVAAIIKKNYPNQTLV
FT                   KLISSQIDADRMDYLLRDAYYTGVSYGKFDLERILRVLRPSPDGNGVIVKYSGMHAVED
FT                   YIMSRYQMYQQVYFHPVSRSGEVLLWKILERAKKLYCAGYEFQVTPIQVLPFFVNEVSL
FT                   KDYVVLDDIVLMYYFSIWQEEEDPILSDLCSRFLNRRLLRYINYDPKEDAELYAELKGL
FT                   LEKADIDPSYYLVIDSSSDLPYDYYLPGVGSGKDPIKLLMGNGELRELSTESPVVEAIG
FT                   RERRTDIKLYYPLDFIESGDVDQAITERMIALIHAHSLKEK"
FT   gene            complement(28999..29184)
FT                   /locus_tag="LMHCC_0032"
FT   CDS_pept        complement(28999..29184)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0032"
FT                   /product="conserved domain protein"
FT                   /EC_number="5.3.2.-"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38396"
FT                   /protein_id="ACK38396.1"
FT                   /translation="MPFVTIQFLEGRSDDQKKALVSEVTEVVSKNLKAPKENIHVILEE
FT                   MKKTDYGVGGVRKSDI"
FT   gene            29258..29911
FT                   /locus_tag="LMHCC_0033"
FT   CDS_pept        29258..29911
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0033"
FT                   /product="peptidase, M50 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38397"
FT                   /protein_id="ACK38397.1"
FT                   /translation="MPSFLAYPLEMIPYVLVTLLIAFTIHEWAHALVALAFGDDTAKNQ
FT                   GRLSLNPVVHIDLFGLLMILIAGFGWAKPTPVNRFKLKKRRLGSILVSLAGPVSNLLLA
FT                   MIGVGFYALFLNYSFFTYGSVAETFLMIFVQLNLVLFVFNLIPLPPLDGYQILVEFLPM
FT                   SARAKLEPLERYAMLIFLVVALTPISEFTIQPIFNTVIPFVLNVILTIFGLTSF"
FT   gene            29989..30438
FT                   /locus_tag="LMHCC_0034"
FT   CDS_pept        29989..30438
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0034"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38398"
FT                   /protein_id="ACK38398.1"
FT                   /translation="MTANQMERKKVTIHITNVIRQMDAEEKSDMSVSGVFYRDKGNRYL
FT                   HYEEKQLAGTIRTVLKIADNELLLMRSGAVNMRMHFFRDNRRSTASVDSGAGKLQLESE
FT                   LVSMEELYENKPDVLSEVAFQYDLLSHGEYIGSYTVLMKIEEDAE"
FT   gene            30435..32105
FT                   /gene="argS"
FT                   /locus_tag="LMHCC_0035"
FT   CDS_pept        30435..32105
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argS"
FT                   /locus_tag="LMHCC_0035"
FT                   /product="arginyl-tRNA synthetase"
FT                   /EC_number="6.1.1.19"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38399"
FT                   /db_xref="GOA:B8DBE8"
FT                   /db_xref="InterPro:IPR001278"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR005148"
FT                   /db_xref="InterPro:IPR008909"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR035684"
FT                   /db_xref="InterPro:IPR036695"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8DBE8"
FT                   /protein_id="ACK38399.1"
FT                   /translation="MNVMQENQIKLIAHIKQAVVQAVGLEEAEVPEILLEVPKDKKHGD
FT                   YSTNIAMQLARVAKKAPRQIAESIVPELKKDNKLIKEVEIAGPGFINFYLDNAYLTDLV
FT                   PVILTEDKQYGESDFGKGEKFQIEFVSANPTGDLHLGHARGAAIGDSLANIMKMAGFDV
FT                   SREYYINDAGNQINNLVLSAEARYFEALGLDSEFPEDGYRGADIISLGKDLAAKYGDKY
FT                   VHTSEEERRSVFRVDALAFETGKLRADLEEFRVSFDEWFSETSLYEENKVLPALERLRE
FT                   NGYIYEQDGATWLRTTDFEDDKDRVLIKSDGSYTYFLPDIAYHLNKLERGFDVLIDIWG
FT                   ADHHGYIPRMRAAIEALGYSPNQLEVEIIQLVHLFEDGVQVKMSKRTGKSVTMRDLIEE
FT                   VGLDATRYFFAMRSSDTHMNFDMSLAKSTSNDNPVYYVQYAHARISSILRSGKEQGLEV
FT                   TKDADMSLLQTEAEYDLLKVLGEFADVVAEAATKRAPHRIVRYLNDLASAFHRFYNSNK
FT                   VLDMDNLEVTKARLALIKTAQITLRNGLTLLGVSAPEKM"
FT   gene            32471..33007
FT                   /gene="rpoE"
FT                   /locus_tag="LMHCC_0036"
FT   CDS_pept        32471..33007
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoE"
FT                   /locus_tag="LMHCC_0036"
FT                   /product="DNA-directed RNA polymerase, delta subunit"
FT                   /EC_number="2.7.7.6"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38400"
FT                   /protein_id="ACK38400.1"
FT                   /translation="MDLKNLTQEERSELSLIDVAHFILEQRKETILFPELVKEIQAFLG
FT                   LKDAEIRERLVQFYTDMNIDGNFISLGNNTWGLRAWYPMDAIDEEVQTQTTPKKKRKSD
FT                   DDDDEDEEILDDDVDYDDEEIVEELGEEEISLADVLLDEEEDDDDHLPDGIEGDLATVE
FT                   DDYTDGDYTEDPEDK"
FT   gene            33375..34973
FT                   /gene="pyrG"
FT                   /locus_tag="LMHCC_0037"
FT   CDS_pept        33375..34973
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrG"
FT                   /locus_tag="LMHCC_0037"
FT                   /product="CTP synthase"
FT                   /EC_number="6.3.4.2"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38401"
FT                   /protein_id="ACK38401.1"
FT                   /translation="MTKYIFVTGGVVSSIGKGITAASLGRLLKNRGLSVTIQKFDPYIN
FT                   VDPGTMSPYQHGEVYVTDDGAETDLDLGHYERFIDINLNKYSNVTTGKVYSEVIKKERR
FT                   GDYLGGTVQVIPHITNELKDRVFRAARMTNSDIIITEIGGTVGDIESLPFLEAIRQIKS
FT                   DVGAENVLYIHTTLIPYIKAAGEMKTKPTQHSVKELRSLGIQPNIIVVRTEQPVSQEMK
FT                   DKIALFCDIKASEVIESRDEETLYNVPLSLQKQKMDDIVLEHLQLEAPQAEMTDWKNLV
FT                   HRVKNLSKKVRIGLVGKYVSLQDAYLSVAEALRHAGYDHDAEIEIDWIDSEKVTKENVA
FT                   EIMKDVDGILVPGGFGDRAIEGKIAAIEYARVNKVPYFGICLGMQLATVEFARNVLGLE
FT                   GAHSAEIEPETKHNIIDLLPEQKNIENMGGTLRLGLYPARIKQGTKAEAAYGTTLVEER
FT                   HRHRYEFNNEYREQMEEAGMIVSATSPDGRLVEVVELADHPWFVACQYHPEFISRPNRP
FT                   QSLFKDFVGAALNNK"
FT   gene            complement(35022..35603)
FT                   /locus_tag="LMHCC_0039"
FT   CDS_pept        complement(35022..35603)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0039"
FT                   /product="internalin B"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38402"
FT                   /protein_id="ACK38402.1"
FT                   /translation="MEGQLWYRVRTSTTFIGWTKASNLTTTTPYDKIEYDKGVTAYARV
FT                   KTAPGNAVWTKPYRTEGSKPVNQLSVYQGKNMRILREAKTVITTWYQFSIDGKVIGWVD
FT                   TRALDTFYKQSMEKDTNLTRYVIANKVNEAYYKVPVVDADVRWGTLAAYKGQKLTVDKQ
FT                   ATVEGQLWYRIRTSSTFIGWTKASNLSATK"
FT   gene            complement(35648..36838)
FT                   /locus_tag="LMHCC_0040"
FT   CDS_pept        complement(35648..36838)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0040"
FT                   /product="autolysin"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38403"
FT                   /protein_id="ACK38403.1"
FT                   /translation="MKKLVKSAVVFTSLAFIGVSATMITEKASAASTETVQSVDDQSIY
FT                   IPQGVRDGTATEEHDGFEDGTNSVLKSVPLLRATTGYPDVNSYIKSNKFSTASIEKQLK
FT                   SQFPKFNYRNGYGKPEGVVIHETANNSSTIEGEISYMSRNYNNAFVHSFVDKSRIIQIH
FT                   PTENGVWGAGQYANARFIQVELVRSKTFDEFARSINNYAYYAAYLLDQYKLPVDSAHSD
FT                   GKGTVWSHDAVTRYLGGTTHTDPVSYFNQWGYNFNSFVTLINEKYKAIQASKVTYDKIE
FT                   YDKGVTAYARVKTAPGNAVWTRPYKTEGAKLVNQLSVYQGKNMRILREAKTPITTWYQF
FT                   SIDGKTIGWVDTRALDTFYKQSMETPANLTRYVASNKTGEAYTKFLLRTRMLDGAL"
FT   gene            37167..38072
FT                   /locus_tag="LMHCC_0041"
FT   CDS_pept        37167..38072
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0041"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38404"
FT                   /protein_id="ACK38404.1"
FT                   /translation="MIIYNPAAGKNKFRKLLPDAERILTEADLEVTLVPSTPKPKSTTE
FT                   IARHAAESGYDIVIAAGGDGTVNEVVNGLMQVEKRPKLGILPVGTTNDYARALNVAKDP
FT                   LEALHIIATQETIRVDIGKANENEFFINNAAGGRITEITYAVKESMKSKWGRLAYLFSG
FT                   LTVLPKLSPVNVEISYNNEIFKGEILLFFVNKSNSVGGMETLCPPAELNSGMFELLILK
FT                   KVSPKKLFQLFASIKKGTHLSSSDVIHARTGKVEVKSDADLNVSYDGVYGGKAPYILEV
FT                   IPEALEVFADEKRISARLRG"
FT   gene            38240..39094
FT                   /gene="fba"
FT                   /locus_tag="LMHCC_0042"
FT   CDS_pept        38240..39094
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fba"
FT                   /locus_tag="LMHCC_0042"
FT                   /product="fructose-1,6-bisphosphate aldolase, class II"
FT                   /EC_number="4.1.2.13"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38405"
FT                   /protein_id="ACK38405.1"
FT                   /translation="MPIVNMTDMLKKALAGKYAVGQFNINNLEWTQAILKAAEAEKAPV
FT                   ILGVSEGAAKYMGGFKTVVKMTEGLVEDLKITVPVAIHLDHGSSFDSCKAAIDAGFSSV
FT                   MIDGSHHPIDENIAMTKQVVDYAHAKGVSVEAEIGTVGGDEDGVTGGINYADPQECLRV
FT                   VKEANIDALAAALGSVHGPYHGEPVLGFDEMKEISELTGAPLVLHGGSGIPEHQIKKAI
FT                   ELGHSKINVNTECQIVWTAAVREKLATDDKVYDPRKVIGPGVDAIIKTVSEKIQEFGSN
FT                   GKA"
FT   gene            39416..40699
FT                   /locus_tag="LMHCC_0043"
FT   CDS_pept        39416..40699
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0043"
FT                   /product="glycosyl transferase, group 1 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38406"
FT                   /protein_id="ACK38406.1"
FT                   /translation="MNIGIFTDTYSPQISGVATSIMIMENELRKQGHTVYIFTTTDPNA
FT                   DRESEEGRVFRLPSIPFVFFPERRVAIAGMNKFIKLVGRLDLDIIHTHTEFSLGLLGKR
FT                   IAKKYHIPSIHTYHTMYVDYLHYIAKGKILTPTMVGKMTKSFCDSYDAIITPTAKVRHH
FT                   LEEQGIHKLMYTVPTGTDISSFAPVEKQQIIELKKSLGIGENDPVILSLGRIAHEKNID
FT                   AIINAMPEVLQTKTTAKLVIVGDGPVRKDLEKLVEEKQLADHVIFTGAVDWENISLYYQ
FT                   LGDLFVSASTTETQGLTYAEAMAASLPVVAKRDESIEGFLSDRETAFLFDEDSELASLL
FT                   INILSDKNTATLVATNGRVKVESISADQFGINIESTYNEVREIYRVKRQNGTIKVKPTL
FT                   IKSKIASQVFSLSSSTHVQRKERSSRRD"
FT   gene            40707..41717
FT                   /locus_tag="LMHCC_0044"
FT   CDS_pept        40707..41717
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0044"
FT                   /product="glycosyl transferase CpoA"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38407"
FT                   /protein_id="ACK38407.1"
FT                   /translation="MLSSAEKVKGQGVASAYRELVNLLEERYKNEIDMKINSFEKSDIT
FT                   HYHTVDFRFFLSTFFKKKRGVRVGYVHFLPETMEGSLKLPWIARVVFYKYLIGFYKRMD
FT                   EIVVVNPSFIPKLTAYNIPEEKIHYIPNFVSKKSFFPISKGEKELARAKYEIPADKFTV
FT                   IGIGQVQHRKGVLDFIEVAKKLPDVQFVWAGGFSFGKITSGYEELKKIYDNPPSNVKFI
FT                   GIVDRSEMNACINMADVFFMPSYNELFPMAILEAMSCDVPILLRNLDLYEEILDGYYVK
FT                   EVDNPGFIRAIERLENDTDYYNEMLQASKRGATYYSEDRLAAIWLDFYQGLLTKE"
FT   gene            41723..42796
FT                   /locus_tag="LMHCC_0045"
FT   CDS_pept        41723..42796
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0045"
FT                   /product="integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38408"
FT                   /protein_id="ACK38408.1"
FT                   /translation="MSGDAKKNLFNIAIVLAISIGFIIWQFQGVDISTFFASMLKVNPW
FT                   WLLAAFAAMFIYWFLEAVVLQTASKPANKDQRFFSSFRITMIGQFFNTITPMATGGQPA
FT                   QLVMLTKQGMDAGRGSSVLLVKFIIYQAMVVLNFLVILIFGIHYLMTGVTQLKFLVLLG
FT                   FGVHVLVIAALILVGRSQKFTTKLVHVLLIPTRLFMKKEKVANLRNTLDEKIITFHEES
FT                   SRIGKDWKLIVRCCFYTTLQLWIYFSIPFFILQAIGVTGIGLYMAITYHAFIIMFATVM
FT                   PTPGGAGGAEYTFTLLFGMLLGPAKLLMALVLWRIITYYSCIVFGAGALLIKDTASKKI
FT                   KPRIEALAKAPAKNIPQ"
FT   gene            42865..44184
FT                   /gene="murA"
FT                   /locus_tag="LMHCC_0046"
FT   CDS_pept        42865..44184
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murA"
FT                   /locus_tag="LMHCC_0046"
FT                   /product="UDP-N-acetylglucosamine
FT                   1-carboxyvinyltransferase"
FT                   /EC_number="2.5.1.7"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38409"
FT                   /protein_id="ACK38409.1"
FT                   /translation="MDNEKVLQASGKKGTFVTDKLIIQGGKKLAGTLQVDGAKNSAVAL
FT                   IPAAILAESEVVLEGLPDISDVHTLYNILEELGGTVRYDNKTAVIDPTDMISMPLPSGN
FT                   VKKLRASYYLMGAMLGRFKKAVIGLPGGCYLGPRPIDQHIKGFEALGAKVTNEQGAIYL
FT                   RADELKGARIYLDVVSVGATINIMLAAVRAKGKTVIENAAKEPEIIDVATLLTNMGAII
FT                   KGAGTDTIRITGVDHLHGCHHTIIPDRIEAGTFMVLAAASGKGVRIENVIPTHLEGIIA
FT                   KLTEMGVPMDIEEDAIFVGEVEKIKKVDIKTYAYPGFPTDLQQPLTALLTRAEGSSVIT
FT                   DTIYPSRFKHIAEIERMGGKFKLEGRSAVISGPVQLQGSKVTATDLRAGAALVIAALLA
FT                   DGETEIHGVEHIERGYSKIIEKLSAIGANITRSSAAETKL"
FT   gene            44289..45560
FT                   /gene="rho"
FT                   /locus_tag="LMHCC_0047"
FT   CDS_pept        44289..45560
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rho"
FT                   /locus_tag="LMHCC_0047"
FT                   /product="transcription termination factor Rho"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38410"
FT                   /protein_id="ACK38410.1"
FT                   /translation="MAKLSIAYLESLTIKEIYALAKEHKIAYYSKLTKRELIFALLKSN
FT                   AEKEGFFFMEGVLEIIPNEGFGFLRPINYSSSSEDIYISASQIRRFELRTGDKVSGKVR
FT                   PPKENERYFGLLHVEAVNGENPEVAKERVHFPGLTPLYPDRQIHLETGKNPISTRTIDL
FT                   ISPIGFGQRGLIVAPPKAGKTVLLKEIANAITTNHPESELIVLLIDERPEEVTDIERSV
FT                   KADVVSSTFDEVPENHIKVAELVLERAMRLVEQKRDVVILMDSITRLARAYNLVIPPSG
FT                   RTLSGGIDPAAFHRPKRFFGAARNIEEGGSLTILATALVDTGSRMDDVIYEEFKGTGNM
FT                   ELHLDRQLAERRVFPAIDMRRSGTRKEELLLSKERLEQLWKIRKAMPKQSDGLDISERF
FT                   VRYLKKTENNEAFYELLQEEMFKK"
FT   gene            45671..46030
FT                   /locus_tag="LMHCC_0048"
FT   CDS_pept        45671..46030
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0048"
FT                   /product="cell wall teichoic acid glycosylation protein
FT                   GtcA"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38411"
FT                   /protein_id="ACK38411.1"
FT                   /translation="MGGFTTVINIVTFWLCTYVLNWDYRIANTIAFIASVLFAYFSNKK
FT                   FVFDSYTPTWKDRLREASSFFGFRCLTYIIDILVMILLISYLSVDELWAKIWTNIIVLV
FT                   LNYVFSKWIIFKVQK"
FT   gene            46132..46377
FT                   /gene="rpmE"
FT                   /locus_tag="LMHCC_0049"
FT   CDS_pept        46132..46377
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmE"
FT                   /locus_tag="LMHCC_0049"
FT                   /product="ribosomal protein L31"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38412"
FT                   /db_xref="GOA:B8DBG1"
FT                   /db_xref="InterPro:IPR002150"
FT                   /db_xref="InterPro:IPR027493"
FT                   /db_xref="InterPro:IPR034704"
FT                   /db_xref="InterPro:IPR042105"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8DBG1"
FT                   /protein_id="ACK38412.1"
FT                   /translation="MKTGIHPEYRPVVFVDTSTDFKFLSGSTKSSSETIKWEDGNEYPL
FT                   LRVEISSDSHPFYTGKQKHATADGRVDRFNKKYGLK"
FT   gene            46599..47885
FT                   /locus_tag="LMHCC_0050"
FT   CDS_pept        46599..47885
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0050"
FT                   /product="homoserine dehydrogenase (HDH)"
FT                   /EC_number="1.1.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38413"
FT                   /protein_id="ACK38413.1"
FT                   /translation="MEAKLQVGVLGFGTVGSGVIHILEEHQEKISQVTGYHISVKKVLV
FT                   RDLEKNRRYETKGFELTTNPSDVLDDPEIAVVVEVMGSITTAREYILQALKAGKHVVTA
FT                   NKDLIALHGDELVAVAQANNCDLFYEASVAGGIPILRTIVNSLAADKIQKVMGIVNGTT
FT                   NFMLTKMTTEKKSYEDVLAEAQALGFAESDPTNDVDGIDAARKMVIMTRLAFGMNVNLD
FT                   NVETNGIRGISPEDIDVAYQLGYKIKLVGTAEETNGTVNVNVGPVLLPKAHPLAGVNYE
FT                   NNAVFVTGAAVGETMFYGPGAGELPTATSVVSDLITVAKNSRLGTNGNAFNSYKHETKH
FT                   TPKEQVFSKYYLRLTMDDKTGTFLKLTQIFAEAGVGFDKILQQPYDDFTATVVIVTHST
FT                   SQAQLEQAIARVKDEPEMQMLAKYSVVEG"
FT   gene            47888..48943
FT                   /gene="thrC"
FT                   /locus_tag="LMHCC_0051"
FT   CDS_pept        47888..48943
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thrC"
FT                   /locus_tag="LMHCC_0051"
FT                   /product="threonine synthase"
FT                   /EC_number="4.2.3.1"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38414"
FT                   /protein_id="ACK38414.1"
FT                   /translation="MYKGLLEKYKEYLPVTDKTPMISLAEGNTPLIPLPNLSKELGVTL
FT                   YGKYEGLNPTGSFKDRGMVMAVAKAKEEGAEAVICASTGNTSAAAAAYATRAGLKAYIV
FT                   IPEGKVALGKLAQAVMYGADIISIQGNFDEALKSVRELAETEAVTLVNSVNPYRLEGQK
FT                   TAAFEICEQLGSAPDVLAIPVGNAGNISAYWKGFKEWNEAKASGLPRMHGFEAEGAAAI
FT                   VQGKPIDNPETIATAIRIGNPASWGLAEAARDESGGYIHSVTDDEIVNAYKKIAAQDGV
FT                   FIEPGSAASLAGVIQHVANGTIKKGETVVCVFTGNGLKDPDTAMSVHEIPISHVDDIEA
FT                   MRTHLRSGVKA"
FT   gene            48943..49809
FT                   /gene="thrB"
FT                   /locus_tag="LMHCC_0052"
FT   CDS_pept        48943..49809
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thrB"
FT                   /locus_tag="LMHCC_0052"
FT                   /product="homoserine kinase"
FT                   /EC_number="2.7.1.39"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38415"
FT                   /db_xref="GOA:B8DBG4"
FT                   /db_xref="InterPro:IPR000870"
FT                   /db_xref="InterPro:IPR006203"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8DBG4"
FT                   /protein_id="ACK38415.1"
FT                   /translation="MRIRVPATTANLGPGFDSCGLALTLYLTLDIGAEADSWYIEHNIG
FT                   GGIPHDETNVIIETALNLAPNLTPHHLVMTCDIPPARGLGSSSAAVVAGIELANTLAEL
FT                   NLSKEEKVRIAAEIEGHPDNVAPAVLGNWVVGAKLDGEDFYVRHLFPDCALIAFIPKAE
FT                   LLTSESRGVLPDTLPFKEAVQASSIANVMIAAILRNDMTLAGEMMERDLWHEKYRSQLV
FT                   PHLTQIRDVAKSQGAYAACLSGAGPTVLVFAPRNLANKLQTSLQTLEIDADVLLLDVEG
FT                   SGAEVFR"
FT   gene            49921..50496
FT                   /gene="tdk"
FT                   /locus_tag="LMHCC_0053"
FT   CDS_pept        49921..50496
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tdk"
FT                   /locus_tag="LMHCC_0053"
FT                   /product="thymidine kinase"
FT                   /EC_number="2.7.1.21"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38416"
FT                   /protein_id="ACK38416.1"
FT                   /translation="MAQLFFRYGSMNSGKTIEILKVAHNYEEQNKTVAIFTSGIDDRDQ
FT                   VGFISSRIGLKREATPIFSDTDIFEIVANIKPKPNCVLLDESQFLEKEHVFQLAKIVDE
FT                   LNIPVIAYGLKNDFRNELFEGSKYLLLYADKLEEMKTICWFCAKKATMVLRVDDKGKPV
FT                   YTGEQIMIGGNDHYYPVCRKCHANPPIK"
FT   gene            50519..51595
FT                   /gene="prfA"
FT                   /locus_tag="LMHCC_0054"
FT   CDS_pept        50519..51595
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prfA"
FT                   /locus_tag="LMHCC_0054"
FT                   /product="peptide chain release factor 1"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38417"
FT                   /db_xref="GOA:B8DBG6"
FT                   /db_xref="InterPro:IPR000352"
FT                   /db_xref="InterPro:IPR004373"
FT                   /db_xref="InterPro:IPR005139"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8DBG6"
FT                   /protein_id="ACK38417.1"
FT                   /translation="MYDRLQAVEDRYDELNELLSDPDVVSDPKRLRDLSKEQSGITATV
FT                   ETYREYKNVNEQINETKELLGEKLDDEMREMAKEEFAELQKEKADLEERLKLLLVPKDP
FT                   NDDKNVILEIRGAAGGDEAALFAGDLFRMYSKYAESRGWKVEIMDANPTGIGGYKEIIA
FT                   MMNGNDAFSRMKYENGAHRVQRVPETESGGRIHTSTATVAILPEAEEVEIELHDKDIRT
FT                   DTFASTGAGGQSVNTTMSAVRLTHIPTGIVVSMQDERSQLKNKDKAMKVLRARVYDKFE
FT                   REAREEYDANRKSAVGTGDRSERIRTYNYPQNRVTDHRIGLTIQKLDQIMEGKLDEIID
FT                   ALILEDQTSKLEHLNDAN"
FT   gene            51582..52433
FT                   /gene="hemK"
FT                   /locus_tag="LMHCC_0055"
FT   CDS_pept        51582..52433
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemK"
FT                   /locus_tag="LMHCC_0055"
FT                   /product="protein-(glutamine-N5) methyltransferase, release
FT                   factor-specific"
FT                   /EC_number="2.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38418"
FT                   /protein_id="ACK38418.1"
FT                   /translation="MTQISQLLKNAEAILLEKGLDQNAAEILLETRMGLSRSELWMEIN
FT                   RELEPNHEKQFEEDFARYLAGEPVQYILKTAPFYGYDFLVTEDVLIPRPETEELVACAE
FT                   DFLKKHSVKNVLDVCTGSGIIAIALKKAFPEISMTASDISAPALAVAKKNALLLNADVR
FT                   FVETDLLEAFKQNEERFDMIVANPPYISEAEKAEMSDYVLKNEPSLALFAENDGLAIYE
FT                   RFVDNLKYVLNSSFWVGVEIGYTQGERVKQLFEKSYPHSTIIIHKDINSKDRYVTCSNI
FT                   LV"
FT   gene            52734..53771
FT                   /locus_tag="LMHCC_0056"
FT   CDS_pept        52734..53771
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0056"
FT                   /product="Sua5/YciO/YrdC/YwlC family protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38419"
FT                   /protein_id="ACK38419.1"
FT                   /translation="MQTIHWKITKQQSNQAIYQEAAELLQNGECVAFPTETVYGLGADA
FT                   TNQAAIQKIYAAKGRPSDNPLIVHIARLDQMNSFVASYPPKAIQLMEKFWPGPLTVILP
FT                   LKKDSLAANVSAGLSTVGVRMPEHPVSLALINAANVPVAAPSANRSGKPSPTTADHVIE
FT                   DLDGKIAGIIDGGATGVGLESTVIDCSLEMPIILRPGGITKEQIEQVIGPVDISTNNTK
FT                   ETEKPKAPGMKYTHYAPKAPVYLIEGSTPFWQKEINKVEAANKKLGILATKELIDQLTT
FT                   SAAVETTGSIKALDEIATSLYKGLRAFDHADVDIIFAEVYPETELGAAIMNRLEKAAGN
FT                   RRITE"
FT   gene            53768..54175
FT                   /locus_tag="LMHCC_0057"
FT   CDS_pept        53768..54175
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0057"
FT                   /product="low molecular weight phosphotyrosine protein
FT                   phosphatase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38420"
FT                   /protein_id="ACK38420.1"
FT                   /translation="MNVLFVCTGNTCRSPLAEKILQDLRPDLDVRSAGTRALDGDAISG
FT                   NSRQILAQMNLPTTHQAKKVTEADIDWADQIYVMTQKHQVELKSLFPKASDKIQLISED
FT                   KTDIPDPYGGSIEQYEITYYELKSAISERFL"
FT   gene            54311..55552
FT                   /gene="glyA"
FT                   /locus_tag="LMHCC_0058"
FT   CDS_pept        54311..55552
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glyA"
FT                   /locus_tag="LMHCC_0058"
FT                   /product="serine hydroxymethyltransferase"
FT                   /EC_number="2.1.2.1"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38421"
FT                   /db_xref="GOA:B8DBH0"
FT                   /db_xref="InterPro:IPR001085"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR019798"
FT                   /db_xref="InterPro:IPR039429"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8DBH0"
FT                   /protein_id="ACK38421.1"
FT                   /translation="MVYLQKQDKEVFDAIKLELGRQRANIELIASENFVSEQVMEAMGS
FT                   VLTNKYAEGYPGKRYYGGCEFVDIVEDLARDRAKKLFGAEYANVQPHSGAQANMAVYHT
FT                   VLEPGDTVLGMNLSHGGHLTHGSPVNFSGVLYNFVEYGVREDTKEIDYDIVREAALKHK
FT                   PKMIVAGASAYPRKIDFAKFREIADEVGAYLMVDMAHIAGLVAAGLHQNPVPYADFTTT
FT                   TTHKTLRGPRGGMILAKAEWEQKLNKSIFPGIQGGPLMHVIAAKAVAFGEALQPEFTAY
FT                   CEQIIRNSKKLAETLQANDVAVLTGGSDNHLLLIDLKPLGLTGKAAEKVLDEVGITVNK
FT                   NTIPFETESPFVTSGIRVGVAAVTTRGFDEVAIEKVGVLISEVLHNLENEEVLADVKAR
FT                   VATLTNEYPLYPSL"
FT   gene            55690..56319
FT                   /gene="upp"
FT                   /locus_tag="LMHCC_0059"
FT   CDS_pept        55690..56319
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="upp"
FT                   /locus_tag="LMHCC_0059"
FT                   /product="uracil phosphoribosyltransferase"
FT                   /EC_number="2.4.2.9"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38422"
FT                   /db_xref="GOA:B8DBH1"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005765"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR034332"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8DBH1"
FT                   /protein_id="ACK38422.1"
FT                   /translation="MANVHVINHPLVQHKLTIIRDKNTGTKAFRELVDEVATLMAYEIT
FT                   RDMELEDIQVETPLQTTTAKTLTGKKLGIVPILRAGLGMQDGILKLIPAAKVGHVGLYR
FT                   DHDTLEPVEYFVKLPSDVEERLFIVVDPMLATGGSAIMAIDCLKKRGARNMKFMCLVAA
FT                   PEGVKALQDAHPDVEIYVAGLDEKLDENGYIRPGLGDAGDRLFGTK"
FT   gene            56438..57577
FT                   /locus_tag="LMHCC_0060"
FT   CDS_pept        56438..57577
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0060"
FT                   /product="UDP-N-acetylglucosamine 2-epimerase"
FT                   /EC_number="5.1.3.14"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38423"
FT                   /protein_id="ACK38423.1"
FT                   /translation="MAKIKVMSIFGTRPEAIKMAPLVLALEKEPETFESTVVITAQHRE
FT                   MLDQVLEIFDIKPDIDLDIMKKGQTLADITSRVMNGINEVIAAENPDIVLVHGDTTTSF
FT                   AAGLATFYQQKMLGHVEAGLRTWNKYSPFPEEMNRQLTGVMADMHFSPTKQAKENLLAE
FT                   GKDPATIFVTGNTAIDALKTTVQKDYHHPILENLGDHRLILMTAHRRENLGEPMQGMFE
FT                   AVREIVESREDVELVYPMHLNPAVREKAMSILGGHERIHLIEPLDAIDFHNFLRKSYLV
FT                   FTDSGGVQEEAPGMGVPVLVLRDTTERPEGIEAGTLKLIGTNKENLIKEALDLLDNKEN
FT                   HDKMARAANPYGDGFAANRILAAIKSQFEKTGRPEDFVV"
FT   gene            complement(57838..57954)
FT                   /locus_tag="LMHCC_0061"
FT   CDS_pept        complement(57838..57954)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0061"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38424"
FT                   /protein_id="ACK38424.1"
FT                   /translation="MVKEFDTIIRKFRDRKFFSQEKERKKQPDSLIMSCILI"
FT   gene            58585..58806
FT                   /locus_tag="LMHCC_0062"
FT   CDS_pept        58585..58806
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0062"
FT                   /product="AtpI"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38425"
FT                   /protein_id="ACK38425.1"
FT                   /translation="MTRALAENRSFYGMGMPFRMGSVLFATIIATQLPEYFHVYSMVIG
FT                   LGLAYAIIFLDFFVYSMYRRKKFLKREG"
FT   gene            59041..59529
FT                   /locus_tag="LMHCC_0063"
FT   CDS_pept        59041..59529
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0063"
FT                   /product="ATP synthase, A subunit"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38426"
FT                   /protein_id="ACK38426.1"
FT                   /translation="MLGITLLMFIFVANMLGLPFQIAINDEVWWRSPTADPIVTLTLAI
FT                   MVLGLTHYYGIKMRGFKHYFVGTYFSPMKFLFPLKLVEEFANTLTLGLRLYGNIFAGEV
FT                   LLTIIATQLAHMNIFVGVLAIIPALLWQGFSIFIGAIQAYIFTMLTMVYMSHKVSDEH"
FT   gene            59601..59819
FT                   /gene="atpE"
FT                   /locus_tag="LMHCC_0064"
FT   CDS_pept        59601..59819
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpE"
FT                   /locus_tag="LMHCC_0064"
FT                   /product="ATP synthase F0, C subunit"
FT                   /EC_number="3.6.3.14"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38427"
FT                   /protein_id="ACK38427.1"
FT                   /translation="MSLGVIAAAIAVGLGALGAGIGNGLIVSKTVEGVARQPEARSMLQ
FT                   TIMFIGIGLVEALPIIAVVIAFMVLNK"
FT   gene            59907..60419
FT                   /gene="atpF"
FT                   /locus_tag="LMHCC_0065"
FT   CDS_pept        59907..60419
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpF"
FT                   /locus_tag="LMHCC_0065"
FT                   /product="ATP synthase F0, B subunit"
FT                   /EC_number="3.6.3.14"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38428"
FT                   /protein_id="ACK38428.1"
FT                   /translation="MLQPHLVIGSAFTFGDAFFTLFAFSILLVLIRIYAWKPLMGIMKE
FT                   REEHIGSEIDAAEESRAQAEQLLAEQKSVLQQARVESQTMIENAKQLGEKEREEIVKTA
FT                   RRESERIKEEAKSDIAREKEDAISALREQVGSLSVLIASKVIEKNLDEKEQSNLIQDYI
FT                   ERLGDDK"
FT   gene            60416..60955
FT                   /gene="atpH"
FT                   /locus_tag="LMHCC_0066"
FT   CDS_pept        60416..60955
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpH"
FT                   /locus_tag="LMHCC_0066"
FT                   /product="ATP synthase F1, delta subunit"
FT                   /EC_number="3.6.3.14"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38429"
FT                   /db_xref="GOA:B8DBH8"
FT                   /db_xref="InterPro:IPR000711"
FT                   /db_xref="InterPro:IPR026015"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8DBH8"
FT                   /protein_id="ACK38429.1"
FT                   /translation="MSKDLEVAGRYANALFQVAQDKDLVDVFSEELTELKAALNANKDF
FT                   VKLLENPTFTTEQKKNLASAVFEKINPTLRDFIYLLIDRSREDYLSVIADVYQKRVNDL
FT                   NGVADADVYSVVPLSEQELTALSRVFAAKMNKTKLNIQNHIDKSLLGGVKVVIGTRIYD
FT                   DSLKTKLKDMERQIKA"
FT   gene            60982..62496
FT                   /gene="atpA"
FT                   /locus_tag="LMHCC_0067"
FT   CDS_pept        60982..62496
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpA"
FT                   /locus_tag="LMHCC_0067"
FT                   /product="ATP synthase F1, alpha subunit"
FT                   /EC_number="3.6.3.14"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38430"
FT                   /protein_id="ACK38430.1"
FT                   /translation="MSIKAEEISSIIKQQIENYHSELKVSDVGTVTYIGDGIARAHGLD
FT                   NAMAGELLEFSNGVMGMAQNLETNDVGIIILGPYTEIREGDEVRRTGKIMEVPVGEALI
FT                   GRVVNSLGQPVDGLGPIETTGTRPIEAVAPGVMQRQSVNEPLQTGIKAIDALVPIGRGQ
FT                   RELIIGDRQTGKTSVAIDTILNQADQDMICIYVAIGQKESTVRNAVETLRHHGALDYTI
FT                   VVTAAASQPAPLLYLAPYAGVAMAEEFMYNGKHVLVVYDDLSKQAAAYRELSLLLRRPP
FT                   GREAYPGDVFYLHSRLLERAAKLNDSLGGGSITALPFVETQAGDISAYIPTNVISITDG
FT                   QIFLQSDLFFSGVRPAINAGLSVSRVGGSAQIKAMKTVAGTLRLDLAAYRELESFSQFG
FT                   SDLDAATRAKLERGKRTVEVLKQDLHKPLKVEKQVLILYALVHKYLDDVPVHDVLRFES
FT                   EMNTWFDHNHPELLEEIRTTKKLPDEAKLEAALKEFKNTFVPSEEK"
FT   gene            62534..63406
FT                   /gene="atpG"
FT                   /locus_tag="LMHCC_0068"
FT   CDS_pept        62534..63406
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpG"
FT                   /locus_tag="LMHCC_0068"
FT                   /product="ATP synthase F1, gamma subunit"
FT                   /EC_number="3.6.3.14"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38431"
FT                   /db_xref="GOA:B8DBI0"
FT                   /db_xref="InterPro:IPR000131"
FT                   /db_xref="InterPro:IPR023632"
FT                   /db_xref="InterPro:IPR035968"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8DBI0"
FT                   /protein_id="ACK38431.1"
FT                   /translation="MASLIDIKQRITSTRKTSQITKAMQMVSAAKLGRAESNARSYEPY
FT                   VSKIKDVVTHVASTGNSSDHPMLVSRPVHRTGYIVLTSDTGLAGSYNSSVIKEVFQEIN
FT                   KKHTSSDEYAIITVGRSARDFFKARQMNVVLEVQGITDHPIFAEIKDIASNTVQMFEDG
FT                   VYDEVFIYYNHHINSISSELRKEQLLPLTEFHEKGKETDVDLTTYEFEPSEQEILEVLL
FT                   PQYVESLIFGALLDAKAAEHAARMTAMRSATDNASDLISDLSLQYNRARQAAITQEITE
FT                   IVGGAAALE"
FT   gene            63467..64888
FT                   /gene="atpD"
FT                   /locus_tag="LMHCC_0069"
FT   CDS_pept        63467..64888
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpD"
FT                   /locus_tag="LMHCC_0069"
FT                   /product="ATP synthase F1, beta subunit"
FT                   /EC_number="3.6.3.14"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38432"
FT                   /protein_id="ACK38432.1"
FT                   /translation="MSKGQVIQVMGPVVDVKFEGGNLPEIYNALVIEYKSDAEEAPTSQ
FT                   LTLEVAIQLGDDVVRTIAMASTDGVQRGMEVIDTGSPITVPVGTVTLGRVFNVLGNTID
FT                   LDEPLPSDIKRNKIHREAPTFDQLATTTEILETGIKVVDLLAPYLKGGKIGLFGGAGVG
FT                   KTVLIQELIHNIAQEHGGISVFAGVGERTREGNDLYFEMKDSGVIEKTAMVFGQMNEPP
FT                   GARMRVALTGLTIAEYFRDEEHQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTL
FT                   ATEMGQLQERITSTNVGSVTSIQAIYVPADDYTDPAPATTFAHLDATTNLERKLTEQGI
FT                   YPAVDPLASTSRALSPDIVGEEHYAVATEVQRLLQRYKELQDIIAILGMDELSDEDKQS
FT                   VSRARRVQFFLSQNFHVAEQFTGQKGSYVPVKETVKGFKDLLAGKYDHIPEDAFRSVGR
FT                   IEDVLEKAKDMGVEV"
FT   gene            64910..65314
FT                   /gene="atpC"
FT                   /locus_tag="LMHCC_0070"
FT   CDS_pept        64910..65314
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpC"
FT                   /locus_tag="LMHCC_0070"
FT                   /product="ATP synthase F1, epsilon subunit"
FT                   /EC_number="3.6.3.14"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38433"
FT                   /db_xref="GOA:B8DBI2"
FT                   /db_xref="InterPro:IPR001469"
FT                   /db_xref="InterPro:IPR020546"
FT                   /db_xref="InterPro:IPR020547"
FT                   /db_xref="InterPro:IPR036771"
FT                   /db_xref="InterPro:IPR036794"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8DBI2"
FT                   /protein_id="ACK38433.1"
FT                   /translation="MGSLNVSIVTPDGPVYEGVAQMVIARTKAGELGILPGHVPLVAPL
FT                   KIDIVRLKVESGEEWVAVNGGFMEVNGEEVNILADTAEREQDIDIDRAEKAKQRAEEEL
FT                   SRAKEQKVDEVLAQLALQRAINRIHAKEHN"
FT   gene            65436..65672
FT                   /locus_tag="LMHCC_0071"
FT   CDS_pept        65436..65672
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0071"
FT                   /product="conserved hypothetical integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38434"
FT                   /protein_id="ACK38434.1"
FT                   /translation="MYNIIMESPYVIIISHLLFIVITFWALQAINYEKFIKKNHVTQAR
FT                   LLFVIISIVLGYTLSNFFLDYLAASKQLINFFG"
FT   gene            65854..67146
FT                   /gene="murA"
FT                   /locus_tag="LMHCC_0072"
FT   CDS_pept        65854..67146
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murA"
FT                   /locus_tag="LMHCC_0072"
FT                   /product="UDP-N-acetylglucosamine
FT                   1-carboxyvinyltransferase"
FT                   /EC_number="2.5.1.7"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38435"
FT                   /protein_id="ACK38435.1"
FT                   /translation="MEKIIVRGGKQLNGSVKMEGAKNAVLPVIAATLLASKGTSVLKNV
FT                   PNLSDVFTINEVLKYLNADVSFVNDEVTVDATGEITSDAPFEYVRKMRASIVVMGPLLA
FT                   RTGSARVALPGGCAIGSRPVDLHLKGFEAMGAVVKIENGYIEATAEKLVGAKVYLDFPS
FT                   VGATQNIMMAATLAEGTTVIENVAREPEIVDLANFLNQMGARVIGAGTEVIRIEGVKEL
FT                   TATEHSIIPDRIEAGTFMIAAAITGGNVLIEDAVPEHISSLIAKLEEMGVQIIEEENGI
FT                   RVIGPDKLKAVDVKTMPHPGFPTDMQSQMMVIQMLSEGTSIMTETVFENRFMHVEEMRR
FT                   MNADMKIEGHSVIISGPAKLQGAEVAATDLRAAAALILAGLVADGYTQVTELKYLDRGY
FT                   NNFHGKLQALGADVERVDDSKIDVTNLASLF"
FT   gene            67309..68304
FT                   /locus_tag="LMHCC_0073"
FT   CDS_pept        67309..68304
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0073"
FT                   /product="Rod shape-determining protein MreB"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38436"
FT                   /protein_id="ACK38436.1"
FT                   /translation="MAKDVGIDLGTANVLIHVKGRGIVVNEPAVVAINNKTGQVLAVGA
FT                   EARDMVGRTPGDITAIKPMKDGVIADFDIVQEMLRFFIQKLNLKTFFSRPRILICCPTN
FT                   ITSVEQKAIREVAEKSGGKQVFLEEEPKVAAIGAGMDIFEPSGNMIIDIGGGTADVAVL
FT                   SMGDIVTSQSVKVAGNKWDTDILNYVKRKYNVLIGERTAENIKVTIGTANQGAKEEKME
FT                   IRGRDLVSGLPKTISITSSEVEEAIHDSLHLMVLAAKQVLEQTPPELSADIIDRGIIMT
FT                   GGGSLLHGLDELMSEQLKVPVLITENPLDVVALGTGILLDSLTNKKRNRF"
FT   gene            68326..68760
FT                   /gene="fabZ"
FT                   /locus_tag="LMHCC_0074"
FT   CDS_pept        68326..68760
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fabZ"
FT                   /locus_tag="LMHCC_0074"
FT                   /product="beta-hydroxyacyl-(acyl-carrier-protein)
FT                   dehydratase FabZ"
FT                   /EC_number="4.2.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38437"
FT                   /db_xref="GOA:B8DBI6"
FT                   /db_xref="InterPro:IPR010084"
FT                   /db_xref="InterPro:IPR013114"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8DBI6"
FT                   /protein_id="ACK38437.1"
FT                   /translation="MLDIKKIKEILPHRYPFLLVDRVISVEDGKKVTAIKNVTANEEFF
FT                   NGHFPEYPVMPGVLIVEALAQTSGIAMMQNEANKGKIGLFAGIDGCRFKRQVVPGDQLL
FT                   LEAEITRMRGAIAKAKVKATVEGDLVCEAEIMFALSDLPK"
FT   gene            69012..69377
FT                   /locus_tag="LMHCC_0075"
FT   CDS_pept        69012..69377
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0075"
FT                   /product="single-strand binding protein family"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38438"
FT                   /protein_id="ACK38438.1"
FT                   /translation="MINQVTLVGRLTKEPELKWTTEDRAVLNLTLALNRFGKNKRIDND
FT                   ADFIQCVIWGKRAEATAEFCSKGQLVGVVGELQSRNYLNKEEQKIYITEVLVHQIRYLS
FT                   SRNKDERVINIPQEEDE"
FT   gene            69767..70588
FT                   /locus_tag="LMHCC_0076"
FT   CDS_pept        69767..70588
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0076"
FT                   /product="LysM domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38439"
FT                   /protein_id="ACK38439.1"
FT                   /translation="MKKTVVAIAAGLIIAGSGSTQAFAAEYKVQDGDSLWKISNENNVS
FT                   IKQLKEDNNLSSDIIFPNQTLQVNGSEKKATTNNNSEYTVVAGDTLGHIAIDNGVTVNQ
FT                   LKSWNNLSSDLIIVGQKLSIGNKVEASENNATANNSANNKVTEQPKEEKAAPATQKSTS
FT                   SNEASSNSSSSAQGNVSKELTVTATAYSKSEPGMSHMTATGIDLNDNSRVIAVDPSVIP
FT                   LGSKVYVEGYGQAIAADTGGAIKGNKIDVHLNSVQEVNNWGVKQVKVQILD"
FT   gene            70715..70828
FT                   /locus_tag="LMHCC_0077"
FT   CDS_pept        70715..70828
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0077"
FT                   /product="teichoic acid biosynthesis protein A"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38440"
FT                   /protein_id="ACK38440.1"
FT                   /translation="MNKQEISILNIPFYNTTQAGFVEELYTVAKDGGAVLL"
FT   gene            70825..71448
FT                   /locus_tag="LMHCC_0078"
FT   CDS_pept        70825..71448
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0078"
FT                   /product="putative N-acetylmannosaminyltransferase
FT                   (UDP-N-acetylmannosamine transferase)
FT                   (N-acetylglucosaminyldiphospho-undecaprenol
FT                   N-acetyl-beta-D-mannosaminyltransferase) (Major
FT                   teichoicacid biosynthesis protein A)"
FT                   /EC_number="2.4.1.187"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38441"
FT                   /protein_id="ACK38441.1"
FT                   /translation="MTANPEIVMHARTDKEFEAILRQADYIVPDGIGIIMASEKLGEPL
FT                   TERVTGYDTMVGLLNKPLRCYFLGAKPEISKVVESKVNEKFPQAVVCGVHHGYFDVLES
FT                   EMIAKEILLAKPDVIFVALGSPAQEKWILSQIANFEKGIFIGVGGSFDVLTDNVKRAPK
FT                   IWIKLRLEWVYRLLSNPSRWRRFFAIPQFMLAIRKERKRLKKGE"
FT   gene            71449..72573
FT                   /gene="menC"
FT                   /locus_tag="LMHCC_0079"
FT   CDS_pept        71449..72573
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="menC"
FT                   /locus_tag="LMHCC_0079"
FT                   /product="O-succinylbenzoic acid (OSB) synthetase"
FT                   /EC_number="4.2.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38442"
FT                   /protein_id="ACK38442.1"
FT                   /translation="MYFREARLIHAELPLITPFKTSYGELKSKDFYIIELVNENGVCGY
FT                   GELEAFPLPDYTEETLDTAISIVRQHLLPLLAQKEIHAPEDIHQMFSWIQGNEMAKAAV
FT                   ELAVWDVFAKSEMCSLAKMIGAEKDSIAVGVSVGLQEDTEALVRLVSQYVDAGYERVKL
FT                   KIAPNKDIQFVEAVRKKFPNLSLMADANSAYNREDFFLLKELDHFHLEMIEQPFGTKDF
FT                   VDHAWLQEKLTTRICLDENIRSLDDVRQAHLLGSCQAVNLKLARVGGMSEALKIAEYCS
FT                   DNNLLVWCGGMLEAGIGRAHNIALAARAEFTFPGDISASNRYFNEDIISPAFILNQGKI
FT                   TVPTGRGIGVALDLGVLQKYTKSTEGILLNKGWS"
FT   gene            72599..73633
FT                   /locus_tag="LMHCC_0080"
FT   CDS_pept        72599..73633
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0080"
FT                   /product="probable undecaprenyl-phosphate
FT                   N-acetylglucosaminyl 1-phosphatetransferase
FT                   (UDP-GlcNAc:undecaprenyl-P GlcNAc 1-Ptransferase)"
FT                   /EC_number="2.7.8.-"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38443"
FT                   /protein_id="ACK38443.1"
FT                   /translation="MISFAVGIIMVPIIRKFAFRINAVDTPRERHKHTKVTATLGGLAI
FT                   FISFSVGMLLAPIDKSGFLPIYFGALIIITTGFIDDIFDLSPKWKMLGQIIAALCVTVW
FT                   GDITINFINVPFYGQLDFGYFAIPISIIWIVAIVNALNLIDGLDGLAGGISIIALMTIA
FT                   GMALLLKDAFVAPVALILVAAVAAFLIYNFPPASIFMGDTGALFLGYMIAVLSLMGFKN
FT                   VTFISLLVPLIILGVPLSDTFFAIVRRLKERMPISSADRSHIHHRLMALGFTEKQTVLL
FT                   IYCMALLFSMTGFVFSFSTAWGAMLLLLLLIFSIEIIVEFIGLIGEDYRPILNLLQKIH
FT                   RKRK"
FT   gene            complement(73672..74730)
FT                   /locus_tag="LMHCC_0081"
FT   CDS_pept        complement(73672..74730)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0081"
FT                   /product="putative membrane-bound protein LytR"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38444"
FT                   /protein_id="ACK38444.1"
FT                   /translation="MNKGTDDSRRSSKKYKRRRKILFWILIPVMCLVLAGVGYGTYLFS
FT                   KTKLAADNSYDNVRNGKASTLRTNDVEPIKDSFSILIIGVDTSTTRAANGNPRSDSLIL
FT                   ATFNVKDARVEMTSIPRDSYVHIEDSAKEIDKYTKINAAHAYGGPELTMKTVEEEFKIP
FT                   IDYYVRFDFDAFLKIIDALDGIDVDVPVNFTEQDSKDNANAITLKKGPQHLNAEQALAL
FT                   ARTRHIDSDIERGKRQQLIIKSIVSEATSVSSVSKYSDIIEVVGDNMKTNLTFNQMLSI
FT                   AKFGMTNKIDIKSLNLKGDSNPMDGIYYYKLNESSVQSISNEFADELGIKQPFPGATPY
FT                   SDESSSTASSSN"
FT   gene            complement(74906..75451)
FT                   /locus_tag="LMHCC_0082"
FT   CDS_pept        complement(74906..75451)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0082"
FT                   /product="acetyltransferase, gnat family"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38445"
FT                   /protein_id="ACK38445.1"
FT                   /translation="MSTNIFIQLPDSISTERTILRKTSIADATTLFDIWSDDEVAQFMN
FT                   IEKFSTILQAEEMIQAIENEPTACRYTIFTTEDSLHAIGSLGINDINKTNQTIEIGYEL
FT                   AKSHWRQGFMFEILTTFLTTVKPYLPYKMITAKVLPENTASTKLLKKLGFELITTGQEL
FT                   DLHSGKICEISNYQMLLN"
FT   gene            complement(75453..76088)
FT                   /locus_tag="LMHCC_0083"
FT   CDS_pept        complement(75453..76088)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0083"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38446"
FT                   /protein_id="ACK38446.1"
FT                   /translation="MLDHYLTIHSDGKHEIIIEKSRFICHIKRVTTENEAQSFIQAIKK
FT                   EHRDATHNCSAYIIGENDQFQKAHDDGEPSGTAGVPMLEVLKKKSLKNVAAVVTRYFGG
FT                   TKLGAGGLVRAYGSAVSEAIQAIGIVECKLATIVECSFAYPLLGKIENALEQKEYQIDQ
FT                   KEFTEKVVLHIFVDNDELQDFVNWITELSNGQLEYKEGPQKYREKDVT"
FT   gene            76473..77159
FT                   /locus_tag="LMHCC_0084"
FT   CDS_pept        76473..77159
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0084"
FT                   /product="transcriptional regulatory protein DegU (Protease
FT                   production enhancerprotein)"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38447"
FT                   /protein_id="ACK38447.1"
FT                   /translation="MALKIMIVDDHQLFREGIKRILELEDSFEVVAEAENGKNIVAKVR
FT                   EYKPDIVLMDINMPTVNGLDATEMLVRQFPSIKVIVLTIHDTDEYVTEALRAGAVGYLL
FT                   KEMDAHELVEAVKIVDNGGAYIHPRVAIKLIREYRHLASTNTSQGVYGYQQPEVKMPLH
FT                   ILTHRECEVLQLLTDGKSNRGIGETLFISEKTVKNHVSSILQKMKVNDRTQAVVTAIKH
FT                   GWVYIR"
FT   gene            77180..78031
FT                   /locus_tag="LMHCC_0085"
FT   CDS_pept        77180..78031
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0085"
FT                   /product="degV family protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38448"
FT                   /protein_id="ACK38448.1"
FT                   /translation="MNEKIAVVTDSTTYLPDEVKEQLRINVVPLSVIIDGKSYREGEEL
FT                   SAADFYRKVKEAENFPTSSQPAPGEFIQLFEQLKEQGFDTVISIHLSSGISGTFQNAAS
FT                   AGELIEGLNVVAYDSELSCMAQGMFAVKAAEMALANEPLDKIIQELDKIKQAQDAYFMV
FT                   DDLNNLQRGGRLNGAQALVGSLLQIKPILHFNDKQIVLFEKVRTQKKALKRIEDILQTA
FT                   IQNKTAEKAYVIHGNDPEKGEAWLAQLEAKFPEVTFELSYFGPVIGTHLGEGALGLTWS
FT                   IK"
FT   gene            78227..79546
FT                   /locus_tag="LMHCC_0086"
FT   CDS_pept        78227..79546
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0086"
FT                   /product="ComF operon protein 1 (ATP-dependent helicase
FT                   comFA)"
FT                   /EC_number="3.6.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38449"
FT                   /protein_id="ACK38449.1"
FT                   /translation="MDIFPGRLYQEREIESKDELREIAAIETNKCFRCGNTNAHLFGKM
FT                   SCASCKRDNCIYCRNCIVMGRVNSCQKLYYQEVRLLKATERALLRWEGILSQGQQKASE
FT                   SVVVSLKEKSDMLLWAVAGSGKTEMMFEGMDWALRQGFRICVASPRVDVCLELYPRLQA
FT                   VFPSIDMICLYGDSEDNYQGEQFVIATTHQLIRFYETFQVIFIDEVDAFPYAKDPFLEY
FT                   AVRKARTKEGSTIIITATPEKKWQEECLEGKRKFVKIPGRYHRKKLPVPRTCWIGPWKK
FT                   MLAKGEITPKLIQWMNGVEQKNQPALIFFPEIDAMNKFAEALENKGYDRPVTVHSADEL
FT                   RKEKVGWLREGKIKLLLTTTILERGVTFTDVQVAVFGSEGRIFTEAALVQISGRAGRKL
FT                   SHPTGDVCFFHYGKTIEMKRAIAHIQKMNQQGMIEGMLDD"
FT   gene            79539..80195
FT                   /locus_tag="LMHCC_0087"
FT   CDS_pept        79539..80195
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0087"
FT                   /product="ComF operon protein 3"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38450"
FT                   /protein_id="ACK38450.1"
FT                   /translation="MINCLLCFQPIKQGASWEISWLFKQTSICCDECLAGFEKLIGPLC
FT                   KTCSKESSDSICEDCENRTRFLDSNISIYRYNDFAKEYMKKFKFQGDYEIGAIFKKDLS
FT                   DFLADKKEIIVPIPVSETRKLERGFNQTTAMLKQSGIIYEELLAKKHTEKQSKKTKKER
FT                   LASEQAFYFSGEGNCELTEVILFDDIYTTGSTLNRAAQILKESGANKVSALTIFR"
FT   gene            80389..80952
FT                   /locus_tag="LMHCC_0088"
FT   CDS_pept        80389..80952
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0088"
FT                   /product="ribosomal subunit interface protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38451"
FT                   /protein_id="ACK38451.1"
FT                   /translation="MLKYNIRGENIEVTEPIRDYVEKKIDKLERYFTETPDANVHVNLK
FT                   VYSDKNAKVEVTIPLPNLVLRAEETSGDLYASIDLIVDKLERQIRKHKTKVNRKFRDKG
FT                   AERDYFAYSDVNGSTPPEENESDFDLEIVRTKQFSLKPMDSEEAVLQMNLLGHSFYVYT
FT                   DAETNGTNIVYSRKDGKYGLIETN"
FT   gene            81182..83695
FT                   /gene="secA"
FT                   /locus_tag="LMHCC_0089"
FT   CDS_pept        81182..83695
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secA"
FT                   /locus_tag="LMHCC_0089"
FT                   /product="preprotein translocase, SecA subunit"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38452"
FT                   /protein_id="ACK38452.1"
FT                   /translation="MAGLLKKIFESGKKDVKYLERKADEIIALADETAALSDDALREKT
FT                   VEFKERVQKGETLDDLLVEAFAVAREGAKRALGLYPFKVQLMGGIVLHEGNIAEMKTGE
FT                   GKTLTATLPVYLNALSGEGVHVVTVNEYLAHRDAEEMGVLYNFLGLSVGLNLNALSSTE
FT                   KREAYACDITYSTNNELGFDYLRDNMVVYKEEMVQRPLAFAVIDEVDSILVDEARTPLI
FT                   ISGEAEKSTILYVRANTFVRTLTEEEDYTVDIKTKSVQLTEDGMTKGENYFDVENLFDL
FT                   ENTVILHHIAQALKANYTMSLDVDYVVQEDEVLIVDQFTGRIMKGRRFSEGLHQALEAK
FT                   EGVTIQNESKTMATITFQNYFRMYKKLAGMTGTAKTEEEEFRDIYNMRVIEIPTNKVII
FT                   RDDRPDLIFTTIEAKFNAVVEDIAERHAKGQPVLVGTVAIETSELISSKLKRKGIKHDV
FT                   LNAKQHEREADIIKNAGERGAVVIATNMAGRGTDIKLGEGTIEAGGLAVIGTERHESRR
FT                   IDNQLRGRSGRQGDPGVTQFYLSMEDELMRRFGSDNMKSMMERFGMAEDAIQSKMVSRA
FT                   VESAQRRVEGNNFDSRKQVLQYDDVLRQQREVIYKQRYEVINAENSLREIIEQMIQRTV
FT                   NFIVSSNASSHEPEEAWNLQGIIDYVDANLLPEGTITLEDLQNRTSEDIQNLILDKIKA
FT                   AYDEKETLLPPEEFNEFEKVVLLRVVDTKWVDHIDAMDHLRDGIHLRAYGQIDPLREYQ
FT                   SEGFEMFEAMVSSIDEDVARYIMKAEIRQNLEREQVAKGEAINPAEGKPEAKRQPIRKD
FT                   QHIGRNDPCPCGSGKKYKNCHGKEA"
FT   gene            83864..84778
FT                   /gene="prfB"
FT                   /locus_tag="LMHCC_0090"
FT   CDS_pept        83864..84778
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prfB"
FT                   /locus_tag="LMHCC_0090"
FT                   /product="peptide chain release factor 2, programmed"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38453"
FT                   /protein_id="ACK38453.1"
FT                   /translation="MEVRIAELEDQMLDPNFWNDQQAAQKVINESNGYKETYQAFHALE
FT                   EEQESMEISLELLKEEADEDLQEELEKDIKAYMATISEFELKLMLSDPYDKNNAILELH
FT                   PGAGGTESQDWGSMLLRMYQRWSEKKGFKVEMLDYQAGDEAGIKSVTLLIKGHNAYGYL
FT                   KAEKGVHRLVRISPFDSSGRRHTSFVSVDVMPELDDDIEIEVRTEDLKIDTYRATGAGG
FT                   QHINTTDSAVRMTHIPSGIVVTCQSERSQLKNREQAMKMLKTKLYQKEQEEKERELAEI
FT                   RGEQKKLVGEAKFVPMFSTLTPW"
FT   gene            84885..85748
FT                   /locus_tag="LMHCC_0091"
FT   CDS_pept        84885..85748
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0091"
FT                   /product="YitT family protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38454"
FT                   /protein_id="ACK38454.1"
FT                   /translation="MANKRKKQPLSPVVSKLIEYVYVVIGAALIALAFNVLLLPNHVAS
FT                   GGVSGISTIINYLTGWNPAFIQWAFNIPLFLAGLFFLGYQFGLKTFVGTMLLPFFVYLT
FT                   QGLEPWTHEPLVAALFGGVLVGMGLGIVFRGKASTGGTDVAAQILHKYSHLTLGICVAL
FT                   IDGFVVISAMFVFDIESGLYALVGLFATSKTIDLVQVGLNQSKTVFIISENQEAIRQAI
FT                   LFKIDRGITRLSAKGGYTEDDKQILLCVIAQSEFSRLKEVIKEIDPEAFVVVMSASEVM
FT                   GEGFTS"
FT   gene            86253..86939
FT                   /gene="ftsE"
FT                   /locus_tag="LMHCC_0092"
FT   CDS_pept        86253..86939
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsE"
FT                   /locus_tag="LMHCC_0092"
FT                   /product="cell division ATP-binding protein FtsE"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38455"
FT                   /protein_id="ACK38455.1"
FT                   /translation="MILMEDVYKKYPNGITAANGLNINIGEGEFVYVVGPSGAGKSTFI
FT                   KMIYREERATKGKIIVDKFDLINMKNREIPYLRRNVGVVFQDYKLLQSKTVYENIAYAM
FT                   EVVETEPSVIKERVMEVLDLVNLKHKVRMLPDELSGGEQQRISIARSIANMPKVLIADE
FT                   PTGNLDPDTSWEIMNILEEISNRGTTIVMATHNKEIVNTLKHRVVAIENGRIVRDEQQG
FT                   EYGYEI"
FT   gene            86929..87813
FT                   /locus_tag="LMHCC_0093"
FT   CDS_pept        86929..87813
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0093"
FT                   /product="putative Cell division protein FtsX-like protein"
FT                   /note="putative Cell division protein FtsX homolog"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38456"
FT                   /protein_id="ACK38456.1"
FT                   /translation="MKFRTVGRHIRESFKSLYRNGWMTFAAASAVTVTLILVSVFFAIL
FT                   INMNKLATDVENNVQINVHISLSADKKQQQELEKNIEKIDGVDSVSFSSKDDELKKLVG
FT                   AYGKNFELFKQDNPLYDVFVVEAKEPTQTKTIAKKVEKLKYVDNVEYGEKTVDKLFDTL
FT                   KWGRYAGIILSIGLLLTAMFLISNTIKIAIFSRRREIEIMKLVGATNWFIRWPFVLEGA
FT                   WLGLIGSIVPVVLTFIGYVNIYNLVNPKLVTSSLSLLPPTPFAYQISGLIIAIGVLIGI
FT                   WGSVISIRRFLKV"
FT   gene            87889..89082
FT                   /locus_tag="LMHCC_0094"
FT   CDS_pept        87889..89082
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0094"
FT                   /product="NLP/P60 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38457"
FT                   /protein_id="ACK38457.1"
FT                   /translation="MKKNTFIAISLAAVISLTPAFTTNVFADVNTDIQNQDKKINDIKS
FT                   KKSDLQSDLSGLVADLEKAQEKAKSLQGEFDKTGKELKKLNEDIKSINERIKERENVLK
FT                   ERARAMQKTSNSNAYLEVILDAENLSDLVGRVSAVNQLVDSDKSILEDQQNDEKALKTK
FT                   QTAVKKKQEEQATAIHEYEAQQNKIEAQKAEKEAIVAQLASDQASAENAKAGLVSERDK
FT                   AAKEATARATALREATSSNVGQTTNTASTSSNKSEAKVESASNSSAPSSAAPSSGGYSA
FT                   MIAAANAQLGKPYSLGASGPSAFDCSGFTSYAFRAAGVSLPRTSGGQYAAASKISASQA
FT                   KPGDLVFFNYGSGIAHVGIYVGGGQMINAQNNGVKYDNITSGYWAKYLVGYGRVANF"
FT   gene            89202..90506
FT                   /locus_tag="LMHCC_0095"
FT   CDS_pept        89202..90506
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0095"
FT                   /product="peptidase, M48 family"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38458"
FT                   /protein_id="ACK38458.1"
FT                   /translation="MFKKYGVATALSLLIISAPLTGAHADTINDMQKRQNEIEQKKSEL
FT                   DKNIDSKNSELNHLESAEKDAAKELESLLKSIDDTNKKLKEQEDKVSSENDKLKKLKKE
FT                   MEELRNDIRDRQKVLDNRARAIQTTGTATSYLDMIFEADDFKELVDRVTVVSAIVKADQ
FT                   NIMQDQKDDQDKLKVAETTSEKKLENLKVLAVELEVSKNNMESQKQEKNDLVMALANKK
FT                   DLTKNEQTLLASEQGALTDEEKRLASNIAGEKAKQEAAIKAAEEKRMQEAASSAKNSTV
FT                   VKQPSSSSNGATETVSSGGGQFIKPASGILTSGFSERTNPVTGKYESHKGQDIAGGGTI
FT                   TVSAAASGTVVFSGFGASGSGFGGYGYVVKIDHGNGFQTLYGHMRAGSLKVVTGQQVSQ
FT                   GQPIGIMGSTGQSTGQHLHFEIHKNGIPVDPAPYI"
FT   gene            90630..92078
FT                   /gene="cls"
FT                   /locus_tag="LMHCC_0097"
FT   CDS_pept        90630..92078
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cls"
FT                   /locus_tag="LMHCC_0097"
FT                   /product="cardiolipin synthetase"
FT                   /EC_number="2.7.8.-"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38459"
FT                   /db_xref="GOA:B8DBK8"
FT                   /db_xref="InterPro:IPR001736"
FT                   /db_xref="InterPro:IPR022924"
FT                   /db_xref="InterPro:IPR025202"
FT                   /db_xref="InterPro:IPR027379"
FT                   /db_xref="InterPro:IPR030874"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8DBK8"
FT                   /protein_id="ACK38459.1"
FT                   /translation="MGLLAYLLVILLILNVFFAAVTVFLERRDTSATWAWLLVLTFVPI
FT                   FGFIIYLIFGRKLSGKKIFDWKGQEKIGIQESTANQIEMIRQKEFPFSDPNVKKHRDLI
FT                   YLLLVNDGAILTQDNEVELFVDGHEKFDALIADIENAKDHIHLIYYIFHSDELGNRLMR
FT                   VLERKAAEGLNVKIIYDAMGSRTTKKSFFRTFQKNGGLVRPFFPSKLPLINFRLNYRNH
FT                   RKLAIIDGDVGYIGGFNIGDEYLGASKKFGYWRDTHLRVHGKAVYAMQTRFIMDWNSAS
FT                   STHKIDYKARYFPTFHGKGHTSMQIVSSGPDSEWQQIKNGYIKMINAAKKTIYLQSPYF
FT                   IPDASLLEAIKIAALSGVDVRVMIPNKPDHAFVYRATTNYAGELMETGAKIFIYDNGFI
FT                   HAKTLVVDGEIASVGTANMDFRSFRLNFEVNAFIYEKQMVQKLEDAFLEDILKSYQLTP
FT                   ELYAKRSLWIKFKEAVSRLLSPIL"
FT   gene            92289..93281
FT                   /locus_tag="LMHCC_0098"
FT   CDS_pept        92289..93281
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0098"
FT                   /product="membrane protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38460"
FT                   /protein_id="ACK38460.1"
FT                   /translation="MFGLAISVVTSLIGFGVMIEWVAIFNAVACFLLVVGMFRLSSTAF
FT                   TIGITSLIFYFCYYFDVNLAPFTNTAFTYDSIFIDNFMVSMTFLLAVLLFIEAFLIQYT
FT                   SAKNPSPSLRKSKRGKLVGSFQLRKLWFVPIVMFIPGEVFTKIFEWWPVFAIGSQSYSL
FT                   IILPLFIGFQQQVQAQLPEEASRKIAVEVTTLATIIAVAGLCGIVMPVLTLFAFMFAVI
FT                   GRFWISYRHYRLEKLSPKKFGPQPDGLVVLGARAATPSARLNLKAGEKITEVNSQPVHT
FT                   REELYEALNLNRAFCKLKVIDNAGEPRFEQTALYENESFELGLLLVEPR"
FT   gene            93432..94142
FT                   /locus_tag="LMHCC_0099"
FT   CDS_pept        93432..94142
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0099"
FT                   /product="alkaline phosphatase synthesis transcriptional
FT                   regulatory proteinphoP"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38461"
FT                   /protein_id="ACK38461.1"
FT                   /translation="MVKILVVDDEASIVTLLQFNIEKAGFDVVTAEDGRSGYELALSEK
FT                   PDLIVLDLMLPEMDGIEVTKKLRQDKVNVPILMLTAKDEELDKIIGLELGADDYMTKPF
FT                   SPREVVARIKAILRRTEGKAEIIEEITEDSEATILIGDLKILPDSYEVYLQDDLLDLTP
FT                   KEFELLLFLANHRGKVFSRDQLLDTVWNYDYVGETRIVDVHVSHLRDKIELDTKQPKYI
FT                   KTIRGFGYKMENVK"
FT   gene            94142..95917
FT                   /locus_tag="LMHCC_0100"
FT   CDS_pept        94142..95917
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0100"
FT                   /product="histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38462"
FT                   /protein_id="ACK38462.1"
FT                   /translation="MKKLWLKIGLSFFILFFVVMVIVGVFSGELMKSTYLNMKESQLED
FT                   DAKILLQTTNMENLDLDKDAATIQKSLNPLGEDIDARITVIDSEGDVVADTKKDPEKLD
FT                   NHMNRPEVTDILKKGESVGISIRESDSLGYSMLYVAVPVKHQGKTDGVLRISISLESVD
FT                   AAVAKLWGNLALIFGIALVIIAAISVFIARKITRPVREIIEVSTDLANHKYDSRIHGKI
FT                   SGELQDLSISVNTLAESLETQMFEIKQNEQRLNAIVQNLVSGVMLINVDKQVIMTNRTM
FT                   YQILGETEITGKPFYEVIKSFALSQLIEGTFETKTIQQKEIILYFPREMILDASVSPIL
FT                   GENGEITGIILLLHDITQIRHLENVRSEFVTNVSHELKTPVTALKGFAETLLDGAMYDE
FT                   VLLKKFLTIIKEESDRLHRLIMDILALSRIEQNPVAENVELVDVDEVIEQSARTIFEMA
FT                   TEKNIRVTIPEKTSASVMIETDRDKLQQIIINLLSNAINYTPVDGKVEVKLIEQEAEVI
FT                   IEVTDNGIGIPAKDIDRVFERFYRVDKARSRHSGGTGLGLSIVKHLVENCGGRIEVESQ
FT                   EEVGSTFRVTLPKKA"
FT   gene            96173..97081
FT                   /locus_tag="LMHCC_0101"
FT   CDS_pept        96173..97081
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0101"
FT                   /product="phosphate ABC transporter, phosphate-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38463"
FT                   /protein_id="ACK38463.1"
FT                   /translation="MKKKYLGIVAMLAAVMLVFAACGSDSSSSDKANGSTKGDKEVSGS
FT                   LTAVGSTALQPLVEAASKEFINTNPKAQINVQGGGSGTGLTQVQQGAVEIGNSDVFAEE
FT                   KDGVDASKLVDHRVAVVGMAPVVNKDVGVKNITKQQLIDIFTGKTTNWKDVGGKDEKIT
FT                   IINRAEGSGTRATFEKWGLDGKTPVKAQEQDSSGTVRKIVSETPGAISYLAFSYIDASV
FT                   VGLSLDGVEPTEDKVATNDWKIWSYEHMYTNGEPKGLTKTFLKYMTSDEVQNNIVPQLG
FT                   YQSIKSMKVERDASGKLTDVK"
FT   gene            97148..98098
FT                   /gene="pstC"
FT                   /locus_tag="LMHCC_0102"
FT   CDS_pept        97148..98098
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pstC"
FT                   /locus_tag="LMHCC_0102"
FT                   /product="phosphate ABC transporter, permease protein PstC"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38464"
FT                   /protein_id="ACK38464.1"
FT                   /translation="MGGERSLRDLEAIKEKKLTQTSKKAHLETRGKIITFICISIMVIA
FT                   AASILFFVISKGLATFTVNKVSFVDFITGTDWNPSQKDANGNPLVGALPMIIGSFAVTL
FT                   FAACIAGPLAIGAAIFMVEISPKFGKKILQPVMELLVGIPSVVYGFIGLSVVVPFIRDH
FT                   ISGSGFGIAAATVVLTVMILPTVTSLSVDAIKSVPRHYREASLALGATRFQTIWKVVLR
FT                   SSRSGILTAIVFGMARAFGEALAVQMVIGNSAVIPTSLFEPASTLTSILTMGMGNTVMG
FT                   TLDNNILWSLAMVLLAMSLFFIIVIRFIGRRRKVK"
FT   gene            98095..98979
FT                   /gene="pstA"
FT                   /locus_tag="LMHCC_0103"
FT   CDS_pept        98095..98979
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pstA"
FT                   /locus_tag="LMHCC_0103"
FT                   /product="phosphate ABC transporter, permease protein PstA"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38465"
FT                   /protein_id="ACK38465.1"
FT                   /translation="MNVKTKDKIATGVFYAIAVLIVIILAGLLGYILVKGVPQLSWKFL
FT                   TTPPQSFQAGGGIGPEIWNSFYMLVITMIISVPISLGAGIYMAEYARKNWITDLIRTTI
FT                   EVLSSLPSIVVGLFGFLVFVIQMGWSFSVISGALTLTIFNLPLLIRVVEEALNAIPNTQ
FT                   REAGLALGLSRWETITRVLVPAALPAIITGVILAAGRVFGEAAALIFTAGQSTPILDFT
FT                   DWNPVNPASPLNIFRPAETLAVHIWKINGEGIMPDAQAVSDGASAVLILSVLLFNVLAR
FT                   LLGKFVYKRMTSS"
FT   gene            99007..99822
FT                   /gene="pstB"
FT                   /locus_tag="LMHCC_0104"
FT   CDS_pept        99007..99822
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pstB"
FT                   /locus_tag="LMHCC_0104"
FT                   /product="phosphate ABC transporter, ATP-binding protein"
FT                   /EC_number="3.6.3.27"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38466"
FT                   /protein_id="ACK38466.1"
FT                   /translation="MLTKKPEINTILQTTPDPHSLPAAMATEDLHVYYGDNHAIKGVDL
FT                   TFPENKVTALIGPSGCGKSTYLRALNRMNDEIDGCRMEGQILYDGININRKEVDLYNVR
FT                   KEIGMVFQKPNPFTKSIYENVAFGLKRHGMKNKKEIMERVEKSLRRAALWDEVKDDLGK
FT                   SALSLSGGQQQRLCIARAVAMQPKVLLLDEPASALDPISTSKIEDLINELKNKYTIIIV
FT                   THNMQQAARVSDYTSFFYLGEVVEFSGTSELFTNPQEKQTEDYISGNFG"
FT   gene            99837..100616
FT                   /gene="pstB"
FT                   /locus_tag="LMHCC_0105"
FT   CDS_pept        99837..100616
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pstB"
FT                   /locus_tag="LMHCC_0105"
FT                   /product="phosphate ABC transporter, ATP-binding protein"
FT                   /EC_number="3.6.3.27"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38467"
FT                   /protein_id="ACK38467.1"
FT                   /translation="MTTETAEKVEYIIETKDVDLFYGSKQALQKIALNIKKNQVTALIG
FT                   PSGCGKSTFLRTLNRMNDLIPNVKTTGEIHIGGENVQDPKIDMVNLRKKVGMVFQQANP
FT                   FPFSIYDNVAYGPRMHGIKDKKVLDEIVERSLRQAALWEEVHDRLDRSAIGMSGGQQQR
FT                   LCIARVLAVKPDVILMDEPTSALDPISTAKVEDLILELKKDYTIVIVTHNMQQASRISD
FT                   ETAFFLNGHIVEFADTTSIFTNPAEKETEDYISGRFG"
FT   gene            100629..101288
FT                   /gene="phoU"
FT                   /locus_tag="LMHCC_0106"
FT   CDS_pept        100629..101288
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phoU"
FT                   /locus_tag="LMHCC_0106"
FT                   /product="phosphate transport system regulatory protein
FT                   PhoU"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38468"
FT                   /protein_id="ACK38468.1"
FT                   /translation="MVVRKIFTEQLNDLHQHLMEMGMLANEAIFKAVKSLVHRDTELAK
FT                   QVVAEDKAINNMELSLEQRSFELIALQQPVGMDLRKIVTVLKTSSDLERIGDHAVSIAK
FT                   TAILIGESKVLKPIPEIPEMGEIVKAMLQDVLKAYLAEDEVAAREIAARDNEVDKLHKI
FT                   VYQKCIHFMQEEPEHIEDVSQLLLVSQYIERIGDYVTNVCEWIVYLKSGEIEDLNR"
FT   gene            101556..101861
FT                   /locus_tag="LMHCC_0107"
FT   CDS_pept        101556..101861
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0107"
FT                   /product="transcriptional regulator, ArsR family"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38469"
FT                   /protein_id="ACK38469.1"
FT                   /translation="MENAKQSLDEETLFSVTQIFKALSDPTRVQILSLLQDREYSVNEI
FT                   ARTLAFNQTTVSHQLRFLKNLRLVKSRREGTTIYYMQDDNHVLELLTQAIRHVHHH"
FT   gene            101967..102353
FT                   /locus_tag="LMHCC_0108"
FT   CDS_pept        101967..102353
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0108"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38470"
FT                   /protein_id="ACK38470.1"
FT                   /translation="MKKLSPMQKFIVITGIIVMIIIAVLAVVWNNNLTVVIGLSIAQFI
FT                   IIQFVCYVGIYSHMKVGTARGTKLFSWGILTTLLFSAIIFIFATDNFRTYSAAMIALIG
FT                   YAAALMMREIENTNPANKKQKREE"
FT   gene            102375..103022
FT                   /locus_tag="LMHCC_0109"
FT   CDS_pept        102375..103022
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0109"
FT                   /product="HD domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38471"
FT                   /protein_id="ACK38471.1"
FT                   /translation="MGIHQYFQSLSDLENIYRCPGKFKYQEHSVAEHSYKVTSIAQFFG
FT                   AVEEEAGNEVNWRALYEKALNHDYSELFIGDIKTPVKYATTELREMLSEVEESMTKNFI
FT                   EREIPETYQPIYHHLLKEGKDSTLEGKILAISDKVDLLYESFGEIQKGNPENIFVEIYS
FT                   EALATIYQYREMASVKYFLKEILPDMLAEKGIEKTELPQLTTEITTKALRDA"
FT   gene            103043..103282
FT                   /locus_tag="LMHCC_0110"
FT   CDS_pept        103043..103282
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0110"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38472"
FT                   /protein_id="ACK38472.1"
FT                   /translation="MDQIISALIFPCLLVILFARITYNRYVALLLMVILIAASAKLGYT
FT                   SSMWLIIIDAFSMTIGFVLATYMLRRLKKSGSDF"
FT   gene            103534..105510
FT                   /gene="uvrB"
FT                   /locus_tag="LMHCC_0111"
FT   CDS_pept        103534..105510
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="uvrB"
FT                   /locus_tag="LMHCC_0111"
FT                   /product="excinuclease ABC, B subunit"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38473"
FT                   /protein_id="ACK38473.1"
FT                   /translation="MKDKFELVSKYSPQGDQPRAIEQLVAGLKKGLKHQTLLGATGTGK
FT                   TFTVSNVIQEVNKPTLVMAHNKTLAGQLYSEFKEFFPNNAVEYFVSYYDYYQPEAYVPQ
FT                   SDTYIEKDASINDEIDKLRHSATAALFERRDVIIIASVSCIYGLGSPIEYGEMLVSLRV
FT                   GMEISRDQLLRKLVDIQYDRNDIDFQRGRFRVRGDVVEIFPASRDEHCMRIEFFGDEIE
FT                   RIREVDALTGEIIGEREHVSIFPASHFVTRPDIMKKAIVNIKAELEDRLQVLRADNKLL
FT                   EAQRLEQRTNYDLEMMEEMGYCSGIENYSRHLSLRPAGVTPYTLLDYFPDDFQMVIDES
FT                   HVTMPQIRGMFNGDQARKQMLVDHGFRLPSALDNRPLRLEEFEKHINQIMFISATPGPY
FT                   ELEKNPDVIEQIIRPTGLLDPIVEIRPIQGQIDDLMDEINDRVEKNERVLITTLTKKMS
FT                   EDLTNYLKEAGVKVQYLHSEVKTLERIEIIRDLRLGVYDVIVGINLLREGIDLPEVSLV
FT                   AILDADKEGFLRSERSLIQTMGRAARNENGRVIMYADKMTDSMRNSIGETERRRKIQIE
FT                   YNEKHGITPKTIKKEIRGIIAATSAADEREAVKQHDLSKMSKKERDVFIEGMEHEMKEA
FT                   AKALDFERAAELRDALLEIKAEG"
FT   gene            105518..108388
FT                   /gene="uvrA"
FT                   /locus_tag="LMHCC_0112"
FT   CDS_pept        105518..108388
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="uvrA"
FT                   /locus_tag="LMHCC_0112"
FT                   /product="excinuclease ABC, A subunit"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38474"
FT                   /protein_id="ACK38474.1"
FT                   /translation="MDKEKIVIQGARAHNLKNIDVEIPRDKLVVMTGLSGSGKSSLAFD
FT                   TIYAEGQRRYVESLSAYARQFLGQMDKPDVDLIEGLSPAISIDQKTTSRNPRSTVGTVT
FT                   EIHDYLRLLYARVGHPVCPNHGIEITSQTIEQMVDRVLEYPEKTRIQIMAPIVSGKKGT
FT                   HKKTIEEIKKEGYVRIRVDGEIYDINDEIEIEKNKKHSIEIIIDRIVIKEGINTRLYDS
FT                   IEAALRLADGYAVVDIMGDKELLFSEHYACPYCGFSVGELEPRMFSFNSPFGACPTCDG
FT                   LGTKLEVDVDTVIPDRSLSLNEGAIIPWRPISSQYYPQMLASACKEFGIDMDTPLEKLS
FT                   KEELDIILNGSKDKEFYFEYKNDFGMTRETWIPFEGILPNIERRYRETNSDFTRDQMAQ
FT                   YMTDLPCPSCKGYRLKEETLSVKVNDHHIGQISEFSINEALDFFDSLDFSEKETQIAAP
FT                   IFKEVRARLGFLKNVGLDYLTMSRAAGTLSGGEAQRIRLATQIGSRLTGVLYILDEPSI
FT                   GLHQRDNDRLISTLQSMRDIGNTLIVVEHDEDTMMAADYLIDIGPGAGEHGGRIVAAGT
FT                   PEEVAKNKNSITGDYLSGKKFIPVPAKRRKGNGLELEIIGAKANNLKNVNAKIPLATFS
FT                   CVTGVSGSGKSSLVNEVLRKALARKLNRNHAKPGEHKEIKGIENLEKIINIDQSPIGRT
FT                   PRSNPATYTGAFDDIRDLFASTNEAKVRGYKKGRFSFNVKGGRCEACKGDGIIKIEMHF
FT                   LPDVYVPCEVCHGKRYNGETLDIRYKGKNIAEVLEMTVEEGLEYFTNQPRIARKLQTIV
FT                   DVGLGYIRLGQPATTLSGGEAQRVKLASELHKRSNGKSFYILDEPTTGLHADDIGRLLK
FT                   VLQRLVEENGDTVLVIEHNLDVIKQADYLIDLGPEGGDGGGQIIATGTPEKIARSKKSY
FT                   TGKYLKPILERDKERTEERIATAKKK"
FT   gene            108597..109859
FT                   /locus_tag="LMHCC_0113"
FT   CDS_pept        108597..109859
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0113"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38475"
FT                   /protein_id="ACK38475.1"
FT                   /translation="MENERKRILELVKQGIISTEEALTLLENISKKEGKTAANENIRRS
FT                   AAPSEEEQVEKEIEEELSYDYSKGWNNQGNPYTPPKSRKRRPEPAPENRERYEEEDGEN
FT                   SSKDREDSMRNMVNDLSQAGEKIGSFLNSAFKQVKDMPFPFLTSTKIERDFIYHDTTLS
FT                   ILEFEIANGNIEFKPSDSNDIKVHAMIKLFKEYPEDEALKIFFDKTTLRVDEETLRFES
FT                   KSKQIVTNLTVYLPRREYDYVSVKMLNGNFHMDELSGRDLFVKTTNGNISIGTLNATLA
FT                   EIESINGNVRIQNGEIRDVALKTFNGNVAVKGNYYSTNLQTKNGNVNYQLTGNEATFLK
FT                   AKTGAGNIDVVVPAAIGVDGRFHTNLGKLLLDLKDAEILESKTESVSKSIIFTKLPDAA
FT                   DSSLKIEAEATTGSVKIRDVK"
FT   gene            109926..111137
FT                   /locus_tag="LMHCC_0114"
FT   CDS_pept        109926..111137
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0114"
FT                   /product="PspC domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38476"
FT                   /protein_id="ACK38476.1"
FT                   /translation="MDKKLRRSRVDRKVGGVFGGLAEFLGIDATLLRLIYIIITIITMK
FT                   TGIAIIAYIVALFVIPSSDTSNEEVLERHRRRVEEKRNRHLGRNQARQEVREAMRNSHH
FT                   HRRPRQGNAEPIHHGARKKEARPRPVREFNFDSATFRSFTIRVATGDVIIRSWDKEQMK
FT                   IRAVLAVHEKARSIRQLSEEKLWDYFFSQTMLDISPDSFTFESKNELLKTDLVVTIPKR
FT                   LYEQVKIQLLNGNLKYDDTAAEDAIIKTRHGDIRSSGASGKFLSTESADGEIFFKRSTV
FT                   ENVDMSTAKGDIALQGSFHTTIAKAAQGDVEYILENDTSSAADLEAPNGDIRIQIPPTW
FT                   NVDGTLGTKKEKIYFDLKNAKIWDDADRTFVFTQNAEEISMATLQAKVGNGIIKVSELE
FT                   TKNV"
FT   gene            111160..111360
FT                   /locus_tag="LMHCC_0115"
FT   CDS_pept        111160..111360
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0115"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38477"
FT                   /protein_id="ACK38477.1"
FT                   /translation="MKKLYKSSSQKMIAGVCGGIAEYFGIEVTIVRLIWAGAVLFLGTG
FT                   ILLYILAAIIMPKATPESEWE"
FT   gene            111369..111722
FT                   /locus_tag="LMHCC_0116"
FT   CDS_pept        111369..111722
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0116"
FT                   /product="integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38478"
FT                   /protein_id="ACK38478.1"
FT                   /translation="MRWIIGVIINSVLFVALSGFFTSFHVDGFTTALLASFILAILNML
FT                   IRPILLLLTLPINIFTLGLFTFVVNAIMLEMTTFFIGDSFQIDGFGTALILAAIMAFAN
FT                   MIINSVLWGNKEN"
FT   gene            111909..112847
FT                   /gene="hprK"
FT                   /locus_tag="LMHCC_0117"
FT   CDS_pept        111909..112847
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hprK"
FT                   /locus_tag="LMHCC_0117"
FT                   /product="HPr(Ser) kinase/phosphatase"
FT                   /EC_number="2.7.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38479"
FT                   /db_xref="GOA:B8DBM8"
FT                   /db_xref="InterPro:IPR003755"
FT                   /db_xref="InterPro:IPR011104"
FT                   /db_xref="InterPro:IPR011126"
FT                   /db_xref="InterPro:IPR028979"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8DBM8"
FT                   /protein_id="ACK38479.1"
FT                   /translation="MTKSVTVKDLKERLNLELICSETGLERPISTSDLSRPGLELTGFF
FT                   SYYPEDRVQLFGMTEISFSEGMEPEERLKRYKQMCTKRTPAFVISRNLEVPKELVAAAK
FT                   EADIPVLRSRLKTTRLSVYITNYLESRLAPVISMHGVLVDIYGLGVLITGSSGVGKSET
FT                   ALELVKRGHRLVADDNVEIRQEDEMTLIGSSPAIIEHLLEIRGLGIINVMTLFGAGAVR
FT                   SSKKITIVVHLENWDPDKHYDRVGLDQEKTKIFDMDIPKITVPVRPGRNLSVIIEVAAM
FT                   NFRLKNMGYNAAEQFTQDLNNLIGHNSSMND"
FT   gene            112936..113769
FT                   /gene="lgt"
FT                   /locus_tag="LMHCC_0118"
FT   CDS_pept        112936..113769
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lgt"
FT                   /locus_tag="LMHCC_0118"
FT                   /product="prolipoprotein diacylglyceryl transferase"
FT                   /EC_number="2.4.99.-"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38480"
FT                   /db_xref="GOA:B8DBM9"
FT                   /db_xref="InterPro:IPR001640"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8DBM9"
FT                   /protein_id="ACK38480.1"
FT                   /translation="MGNGVQPLDPVAIQIGSISVKWYGVIIASAVVIALLLALSEANKR
FT                   KMDKEIIVDLLIWAIPISIISARIYYVIFEWDFYKNNLGEIVKIWHGGIAIYGALIGAV
FT                   LTAIIFSRIKKISFWQLADVVAPSLIIAQAIGRWGNFMNQEAHGAETTRAFLEGLHLPD
FT                   FIINQMYIDGAYYQPTFLYESLWNVLGFIILLIIRRTKIRRGELFLGYVIWYSFGRFFI
FT                   EGMRTDSLMWGDFRVSQVLSLLLIVLSIGIIIYRRVKMNPPYYMEDKFGKVVKKK"
FT   gene            113812..114465
FT                   /locus_tag="LMHCC_0119"
FT   CDS_pept        113812..114465
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0119"
FT                   /product="pyrophosphatase PpaX"
FT                   /EC_number="3.6.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38481"
FT                   /db_xref="GOA:B8DBN0"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023733"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8DBN0"
FT                   /protein_id="ACK38481.1"
FT                   /translation="MTGKITTLLFDLDGTLINTNELIIKTFQVTLQEFLPDRVFTREDI
FT                   LPFIGPSLMETFREINPAHADEMRAFYREYNLKHHDDLILEYDGVYEAIRALYEEDYKL
FT                   GIVSTKMYDTIMRGLKVTGLDKFFQVVIGLDQVSNAKPDPEGIEMALSLLNATKEEAIM
FT                   IGDNYHDIEAGKNAETLTAGVAWAIKGPEHLAQFQPDFMLEKMSDLLAIVRDEE"
FT   gene            114601..114966
FT                   /locus_tag="LMHCC_0120"
FT   CDS_pept        114601..114966
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0120"
FT                   /product="transferase hexapeptide repeat containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38482"
FT                   /protein_id="ACK38482.1"
FT                   /translation="MGGKRAIYRACLGMEIGEKTAIAYKVMPDLFFPEKIMIGENSIIG
FT                   YHTTILTHEYLLSEYRVGEVVIGRDVMVGANVTILPGTVIGDGAVIAAGALVSVDVPAD
FT                   SFAYGNPLIIKEKVTLT"
FT   gene            115052..116527
FT                   /locus_tag="LMHCC_0121"
FT   CDS_pept        115052..116527
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0121"
FT                   /product="TPR domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38483"
FT                   /protein_id="ACK38483.1"
FT                   /translation="MEKDKKTPAKIYPFYPNGQFYFERGVEAFRDQRIKEAIRYLVRAS
FT                   ELEPGEAVILCQLAICYTEIGQFHKSNQLLRDVLEQRNGNMEYCYYFIANNFAYMKDYR
FT                   RALQYANRYLDSATDGEYTEEAKDLIEVLLEETPFGETIENGFSKLEQEFYSYKKEINR
FT                   YLAEEDSASACDILRKVIDEKPNFWPAYNQLASLYFEQLKEEEGVRVLSDLLARNPGNL
FT                   LGICDLFIYHFYKGNRKEADALYLELRDVLPVLAHHKEKLGLIHAMMGNYEEADDLLEQ
FT                   VADLEVTERSKYYYYRAKSSYYLGVVEGAKMFWHSFLECDLYEDVRFPWEQEADLTNDT
FT                   RLVLDMLQEDDDLTHMLGVYALTISGNRPELVLFHPLLDMSDWSYMEHLLFTNFDYFPD
FT                   GAIEQNGYLIAKAMIILREHGILFNEENMALYKQLFSLVLSDAGKDLILGRYTIETVAS
FT                   AIAKLFLPQLKLQLVEEFECGKCARDIERVLSR"
FT   gene            116606..117565
FT                   /gene="trxB"
FT                   /locus_tag="LMHCC_0122"
FT   CDS_pept        116606..117565
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trxB"
FT                   /locus_tag="LMHCC_0122"
FT                   /product="thioredoxin-disulfide reductase"
FT                   /EC_number="1.8.1.9"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38484"
FT                   /protein_id="ACK38484.1"
FT                   /translation="MASEEKIYDVIIIGAGPAGMTAALYTSRADLDTLMIERGVPGGQM
FT                   VNTAEVENYPGFDSILGPDLSDKMLSGAKQFGAEYAYGDIKEVVDGKEFKTVTAGSKTY
FT                   KARAIIIATGAEHRKLGAAGEEELSGRGVSYCAVCDGAFFKNRELIVVGGGDSAVEEGT
FT                   YLTRYADKVTIVHRRDKLRAQQILQDRAFKDEKVDFIWNSTVEEIVGDGKKVTGAKIVS
FT                   TVDGSESIMPVDGVFIYVGLVPLTKAFLNLGITDDEGYIVTDEEMRTNLPGIFAAGDVR
FT                   AKSLRQIVTATGDGGLAGQNAQKYVEELKESLEAEAAK"
FT   gene            117683..118666
FT                   /gene="galE"
FT                   /locus_tag="LMHCC_0123"
FT   CDS_pept        117683..118666
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="galE"
FT                   /locus_tag="LMHCC_0123"
FT                   /product="UDP-glucose 4-epimerase"
FT                   /EC_number="5.1.3.2"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38485"
FT                   /protein_id="ACK38485.1"
FT                   /translation="MSIVVLGGAGYIGSHAVDELITRGYEVVVIDNLRTGHKESIHKKA
FT                   KFYEGDIRDKAFLSSVFEKETVDGVIHFAASSLVGESMEVPLVYLNNNVYGTQIVLEVM
FT                   EQFGVKHIVFSSSAATYGEPERVPITEDMPTNPESTYGETKLIMEKMMKWCDKAYDMKY
FT                   VALRYFNVAGAKADGSIGEDHKPESHLVPIILQVALGQREKLAIYGDDYNTPDGTCIRD
FT                   YVQVEDLIDAHIKALEYLKNGGESNIFNLGSSNGFSVKEMLEAARSVTGKEIPAEVVPR
FT                   RAGDPGTLIASSDKAREILGWEPTYTDVKDIIATAWKWHVAHPNGY"
FT   gene            118682..119743
FT                   /locus_tag="LMHCC_0124"
FT   CDS_pept        118682..119743
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0124"
FT                   /product="aldose 1-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38486"
FT                   /protein_id="ACK38486.1"
FT                   /translation="MVFIEVIQEQFGEFEGKTVWQWTMVNDHGMRMSVLNYGAIVTSLE
FT                   TKDKFGNLANISLGFTNLDDYLAHSPYFGATLGPVAGRISNGQFKLDGKQFQLTQNEGT
FT                   NHRHGGKLNFSKKIWNVTVEKELDQIVMTFDYCWADGENGYPGNINARMTYTLNNKNEW
FT                   LIDYEAKSDKPTIYNPSNHIYFNLSGETGSTVLQHQLWINSDRFLPIDGESIPIGEKRS
FT                   VENTIFDLRAGRELAEITQSQDQQIKLVGAGLDHAFILKHENGRPDAVLFDPQSGRRLE
FT                   METESDSVLVYTANSLDSTFEIDGRAGPKYAGITMETQGLVDAINQDGFGDIVLRPEKP
FT                   FTSRTAFRFTAES"
FT   gene            119771..121501
FT                   /locus_tag="LMHCC_0125"
FT   CDS_pept        119771..121501
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0125"
FT                   /product="phosphoglucomutase (Alpha-phosphoglucomutase)
FT                   (Glucosephosphomutase) (PGM)"
FT                   /EC_number="5.4.2.2"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38487"
FT                   /protein_id="ACK38487.1"
FT                   /translation="MNWQEEYQKWVANDKLDSALRKQLTNMEANEKELEDSFYRNMEFG
FT                   TAGMRGVLGVGTNRMNIYTIRKASLGLAQFVAENGEEAKKRGIVIAYDPRHMSREFAFE
FT                   SAAVLGHHGVKSYVFDALRPTPELSFAVRHLNAFGGIVITASHNPPEYNGYKIYGEDGG
FT                   QMPPTGASAVIDYINAVEDIFSVEVANQEVLIENGLLEVISEKVDRPYLEKLKEVIVNK
FT                   ELVQERGEDLKIVFTPLHGTGGILGVPALESVGFTNIVKVDEQFVNDPDFGTVKSPNPE
FT                   NREAFLLAIEYGKKFGGDILVGTDPDADRLGVAVRNLDGEYEVLSGNQIGAIILHYLLK
FT                   QKKAQNELPANAAVLKSIVTSNLGTEIAKHYGAEMIEVLTGFKFIAEQIKHFEETGKHT
FT                   FEFGYEESNGYMVKPFTRDKDAIQAVLAIAEVALVSKVEGRTLLEDLDQIYDEFGYYNE
FT                   DLVSLTLSGKDGSQRIKEITSGFREQLPTSMGGFLVERVEDYLRSETTWVATGKTEAIH
FT                   LPTADVIKCYFEDGSWFCLRPSGTEPKIKFYFSIRGESKEESTTKLEKVKADLMQHIEA
FT                   "
FT   gene            121609..122484
FT                   /locus_tag="LMHCC_0126"
FT   CDS_pept        121609..122484
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0126"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38488"
FT                   /db_xref="GOA:B8DBN7"
FT                   /db_xref="InterPro:IPR005337"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8DBN7"
FT                   /protein_id="ACK38488.1"
FT                   /translation="MTSKQLKLVIITGMSGAGKTVAMQSLEDLGYFCVDNLPPSLLPKF
FT                   WELMKESDKMDKIALVMDLRGREFFDSIEPALDELDNTNFITTKILFLEADDKVLVSRY
FT                   KETRRHHPLEPNGSVLDGINAERELLSDLKGRSQLVINTSNMAPRELRERINNEFQTED
FT                   KDVFNVQLMSFGFKYGIPIDADLVFDVRFLPNPHYIDKMRPLTGLDEDVYEYVMKWPET
FT                   QTFLDKLVDLLMFTLPFYKREGKTQLVIAIGCTGGQHRSVALTEFVGKAIQQKYETTIS
FT                   HRDMKRRKGR"
FT   gene            122486..123454
FT                   /locus_tag="LMHCC_0127"
FT   CDS_pept        122486..123454
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0127"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38489"
FT                   /protein_id="ACK38489.1"
FT                   /translation="MKKETKPRVVVIGGGTGLPVILKGLKKKDIHLTAIVTVADDGGSS
FT                   GKIREQMDVLPPGDIRNVMLALSNVDPRVVDLFQYRFAVDGDLSGHVIGNLILTALSQL
FT                   NDSYVDAINVLATVLKIRGKVIPATDQPLILNAEMEDGSIVHGESLIPLQGKHINRVYI
FT                   EPENVKPYPTAVEAVKEADLIVIGPGSLYTSILPNLLLTELADEIIASEAPKVYITNIL
FT                   TQIGETDFFSDADHIKVIHEHVGKSFIDKTLINTTTVPKELLFPEDVAQVEHNAKGMEE
FT                   LGVEAIYQDFLSTEDGLVRHAAEKVADALLAMLPDQTNEKE"
FT   gene            123462..124433
FT                   /locus_tag="LMHCC_0128"
FT   CDS_pept        123462..124433
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0128"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38490"
FT                   /db_xref="GOA:B8DBN9"
FT                   /db_xref="InterPro:IPR003802"
FT                   /db_xref="InterPro:IPR018478"
FT                   /db_xref="InterPro:IPR023054"
FT                   /db_xref="InterPro:IPR027434"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039518"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8DBN9"
FT                   /protein_id="ACK38490.1"
FT                   /translation="MSFASETKKELTHMDVSDSDAKVELAAFIRMNGAISFSSQLVIMD
FT                   VQTENAAIARRMYQLLKDLYEVPIELLVRRKMKLKKNNVYIVRLKSGTRGILEDLRILE
FT                   PPMTFTKSIDRGFVKKRSAKRAYLRGAFLASGSVNNPETSSYHLEIFSVYEEHNEAICA
FT                   LMNQFDLNARTLERKNGFITYLKEAEKITEFLSIIGATSALLHFEDVRIMRDMRNSVNR
FT                   LVNCETANLNKTINAAVRQIDNIKYIQSTVGLEALPERLREIAALRIANEDVTLKELGE
FT                   MLTTGQVSKSGINHRLRKLDQIAERLRSGETPAQVGLKISNS"
FT   gene            124459..125475
FT                   /locus_tag="LMHCC_0129"
FT   CDS_pept        124459..125475
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0129"
FT                   /product="NADPH dehydrogenase (xenobiotic reductase)"
FT                   /EC_number="1.6.99.1"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38491"
FT                   /db_xref="GOA:B8DBP0"
FT                   /db_xref="InterPro:IPR001155"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR023663"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8DBP0"
FT                   /protein_id="ACK38491.1"
FT                   /translation="MSKLFSEYKLKDVTLKNRIVMSPMCMYSVENKDGIATDFHFAHYV
FT                   SRAAGGTGLVILEATAVQEVGRISEFDLGLWNDEQVPALKRLVDGLHYHGAKAGIQLAH
FT                   AGRKAVLPGEIVAPSAIPFDEKSAKPVELTKEAIKEVVADFKRAAYRAKEAGFDVIEIH
FT                   AAHGYLIHQFLSPITNRREDNYGGPAGNRYKILSDIIKAVKEVWDGPIIVRVSATDYAH
FT                   GGLQLEDHIPFAKWMKADGVELIDVSTGGLVNVAPPVFPGYQVPFADEIRRGAGIATGA
FT                   LGLITRGEQAEEILCNERADLIIVGRELLRNPYFAKDAAEQLGETIEGPKQYSRAWK"
FT   gene            125657..127048
FT                   /locus_tag="LMHCC_0130"
FT   CDS_pept        125657..127048
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0130"
FT                   /product="amino acid permease family protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38492"
FT                   /protein_id="ACK38492.1"
FT                   /translation="MTKVNSFFRKKSFHNPATDKHHLNKTLGAFDLTMLGVGAVVGGGI
FT                   FILPGQVASVIAGPGIIISFIIAGIACCLAALCYSEFASKLPVAGSAYTYSYHVFGEGV
FT                   AWILGWSLILEYGLAVAAIASGWSSYMKSLLAGFDLHIPTAISSAYDPSAGTYFDLLAF
FT                   VVVMVIGILLSFGIRESTRVNNIMVLVKIAVVVLFILVGAFYVKPDNWTPFLPFGVQGV
FT                   ITGASTVFFAYIGFDAVSSAAEEVKNPQKNMPIGIISSLAVCTLLYILLSAVLTGVVPY
FT                   TDLVGVSAPVAFALQAINQNWIAGLLSVGAIVGMTTVVLVMSYGGTRLLFAMGRDGLLP
FT                   QSFSKISKNDTPVRNTMIFATVMGLIASTVPMEDLAQLINIGTLFAFAMVSIGIFFLRR
FT                   NPDLNQKGFKTPFYPVVPALSFLLCVYLMLNLSKTTWIAFGIWFVLGILVYVFYGRRHS
FT                   ALRIK"
FT   gene            complement(127096..127692)
FT                   /gene="clpP"
FT                   /locus_tag="LMHCC_0131"
FT   CDS_pept        complement(127096..127692)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="clpP"
FT                   /locus_tag="LMHCC_0131"
FT                   /product="ATP-dependent Clp protease, proteolytic subunit
FT                   ClpP"
FT                   /EC_number="3.4.21.92"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38493"
FT                   /protein_id="ACK38493.1"
FT                   /translation="MNLIPTVIEQTSRGERAYDIYSRLLKDRIIMLGSAIDDNVANSIV
FT                   SQLLFLDAQDPEKDIFLYINSPGGSISAGMAIYDTMNFVKADVQTIGMGMAASMGSFLL
FT                   TAGASGKRFALPNAEIMIHQPLGGAQGQATEIEIAARHILKIKERMNTIMAEKTGQPYE
FT                   VIARDTDRDNFMTAQEAKDYGLIDDIIINKSGLKG"
FT   gene            127849..129285
FT                   /locus_tag="LMHCC_0132"
FT   CDS_pept        127849..129285
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0132"
FT                   /product="chitin-binding protein/carbohydrate-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38494"
FT                   /protein_id="ACK38494.1"
FT                   /translation="MKKMTKIGMFFAVFTLAVVLFQTTASAHGYISKPASRVYLANKGI
FT                   NVGVGSAQYEPQSVEAPKGFPASGPADGSIAGGGKYSLLDAQTANRWAKVDIESGPLTV
FT                   EWTLTAPHRTSSWQYFITKKGWDPNKPLTRASLEPLTTIEADGSVPNALTKQEINIPND
FT                   RSGYYVILGVWNIADTGNAFYQVIDANIINSSVAPAVDNEAPTEPTNLAATTTAKKVSL
FT                   TWTASTDNVGIKGYEILRDGVVIGESQTASYEDTTVNASTAYTYTVRAKDFAGNKSTLS
FT                   SDLSVTTKEAPAVDNEAPTAPKSLMSHGQTDTTIALCWQASTDNVEVKNYEIYRNNVKI
FT                   ATSTKTMFDDTKLVSNTSYKYKVYAVDTSGNRSLVSNEITVNTKPLDPMNTWKSDQIYY
FT                   AGDQIYYKGVLYTAKWWTKGNTPDTSDVWKNESTEIPAWNALKAYNGGDKVIYNGKTYQ
FT                   AKWWVRGAKPDSSSIWTLVN"
FT   gene            129405..129476
FT                   /locus_tag="LMHCC_T005"
FT   tRNA            129405..129476
FT                   /locus_tag="LMHCC_T005"
FT                   /product="tRNA-Arg"
FT                   /note="tRNA-Arg-1"
FT   gene            129673..129891
FT                   /locus_tag="LMHCC_0133"
FT   CDS_pept        129673..129891
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0133"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38495"
FT                   /protein_id="ACK38495.1"
FT                   /translation="MGKSKVIEYTLLTMLLVVALAASIINYWLFWPILILGCLIHAFCM
FT                   IDKKDVLRVDLIIIAALVLLNNFYLYK"
FT   gene            complement(130012..130347)
FT                   /locus_tag="LMHCC_0134"
FT   CDS_pept        complement(130012..130347)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0134"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38496"
FT                   /protein_id="ACK38496.1"
FT                   /translation="MGELGNIETRNGRTSFFDGGLLQYIGWTILGTLVTICTIGICYPW
FT                   ALCMVYGWKINHTVIEGRRLKFQGSAVGLFGHWIKWLFLTIITIGIYGFWVFIKLEDWK
FT                   VKNTIFK"
FT   gene            130578..130976
FT                   /locus_tag="LMHCC_0135"
FT   CDS_pept        130578..130976
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0135"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38497"
FT                   /protein_id="ACK38497.1"
FT                   /translation="MAASLKDRLEKEVRTYSADNDLTVQTIDFLYAGPHMRGRHSLILA
FT                   FTEAGIFTFVFKLSDAEMHFLDGKTVQQIALEKKKLVYRLYIRAVTEEGELEEGKYLVS
FT                   KRVLGRKWHKETLEKLINKNLPLLTATK"
FT   gene            130990..131601
FT                   /locus_tag="LMHCC_0136"
FT   CDS_pept        130990..131601
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0136"
FT                   /product="transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38498"
FT                   /protein_id="ACK38498.1"
FT                   /translation="MMEKKRTRAEELGITRRKILDTARDLFMEKGYRAVSTREIAKIAK
FT                   ITQPALYHHFEDKESLYIEVVRELTQNIQVEMHPIMQTSKAKEEQLHDMLIMLIEEHPT
FT                   NILLMIHDILNEMKPENQFLLYKLWQKTYLEPFQDFFERLENAGELRDGISAETAARYC
FT                   LSTISPLFSGKGSFAQKQTTTEQIDELINLMMFGICKKEV"
FT   gene            131680..133842
FT                   /locus_tag="LMHCC_0137"
FT   CDS_pept        131680..133842
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0137"
FT                   /product="membrane protein, MmpL family"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38499"
FT                   /protein_id="ACK38499.1"
FT                   /translation="MKDGFLSKIASGVGGKKGRFITLGIWIIAIIILQFFFPKAADYKD
FT                   DAAKDLPNSEPSVVAQKLIDDKFAGTDGVPALITWYRSTGLTNEDLVNIQKYSKELTEN
FT                   PVDYQKMAVPYDKMPPVALKQQVSKDGTTFIQTVIMKDSATSDQLTESFKQLESAAKTT
FT                   IGENPFAQKVSADDTLVARTTGPAGISVDASGLFKDADVSLLIGTVLLVLVFLLVIYRS
FT                   PILALIPLIAVGFAYLVITPILGLLAKEGIITYGSQGLSIMTVLLFGAGTDYCLFLISR
FT                   FRSHLHTEKNRFQAFKEAFSGTAGAIALSGLTVMAALLLLLAAEYGSFHNFAVPFSLAI
FT                   FIMMISSLTLVPALLGIFGRVSFWPFVPRTVEMEETRAKKKGKTPKHHKENRFWHKIGE
FT                   MSAKHPVRILIITLIILIGCGIFTTQVKYTYDTLSTFPEDMPSREGFTLISDHFGAGML
FT                   APMEVVVNSKESMKSSLENVDGVASVTGPERSKGYQKYTLILKDNPYSNEAMDVVPKVR
FT                   AAADKGNDVYIAGQTATQYDDRAVTEHDEKVIIPLVIALIAILLLCYLRSITAMLYLVA
FT                   TVLLSFVGALGLGWVIIHYAMGVEAISGLIPLYAFVFIVALGEDYNIFMISSIWKNSKK
FT                   MPLRKAITEGVGQTGGVITSAGLILAGTFGVLTTLPIQLLVQFGLITAIGVLLDTFIVR
FT                   PFLVPSITVLLGKWAFWPGKQHKMTK"
FT   gene            133921..134847
FT                   /locus_tag="LMHCC_0138"
FT   CDS_pept        133921..134847
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0138"
FT                   /product="renal dipeptidase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38500"
FT                   /protein_id="ACK38500.1"
FT                   /translation="MRVIDTHCDALYKLQAGKGKYTFQDAEELDVNFERLMEAKMLLQG
FT                   FAIFLDEDIPVEHKWKKAVEQVNIFKQHVLHKGGIIHHVKKWCDLENLPEDKIGAMLTL
FT                   EGIEPIGRDLDKLTQLLDGGVLSVGLTWNNANLAADGIMEERGAGLTRFGKDIIHLLNE
FT                   RKVFTDVSHLSVKAFWETLEQAEFVIASHSNAKAICSHPRNLDDEQIKAMIEHDAMIHV
FT                   VFYPLFTTNDGVANTEDVIRHIDHICELGGLKNIGFGSDFDGIPEHVKGLEHAGKYQSF
FT                   LETLEKHYTKEEIEGFASRNFLNHLPK"
FT   gene            135005..136348
FT                   /gene="rpoN"
FT                   /locus_tag="LMHCC_0139"
FT   CDS_pept        135005..136348
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoN"
FT                   /locus_tag="LMHCC_0139"
FT                   /product="RNA polymerase sigma-54 factor"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38501"
FT                   /protein_id="ACK38501.1"
FT                   /translation="MRLESNFVQKQQQKQSQKLNMTQQLSQSIAMLQFATADLVAFLED
FT                   KALENPLIEVIPGSDFATDFSYSSRKSTGSSDDTDWLEQIADNKLTLADALKEQLHLMD
FT                   VTQTQKIIVLYLIESLNDNGYLQIDLKDVSAALLMDDSSVLEGLEILQSMEPAGVGARD
FT                   ARECILLQIERSPDAPYIAYDVIQKFFTEFAEKKWKKIAAEMDVSLQDIQEVSDWIQTL
FT                   NPKPGSEFESERVQYVVPDLILLQHEDEFAVSLAKQFLPQVRFQEAYYETMRATEEKDV
FT                   AQFLREKAGEFDWIKKGIEQRENTLQRVGEAIVSHQKAYFLDNSAHLQPLTLKEVAEEL
FT                   GVHESTVSRAVNGKYMETTNGVYELKRFFASGLQKKSSENENTGDISSTTIKKLVQEFV
FT                   AAEDKLKPLSDQKIVDMLAEKEIQVSRRAIAKYRLELNIPSSSKRKRF"
FT   gene            136790..137836
FT                   /locus_tag="LMHCC_0140"
FT   CDS_pept        136790..137836
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0140"
FT                   /product="transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38502"
FT                   /protein_id="ACK38502.1"
FT                   /translation="MSDLINIQKKLLPDVLMIMQKRYQILRSIYFSEPVGRRTLAGMLG
FT                   MSERVLRGEVEFLKAQGLVEIASSGMTVTKEGLVVFRDLENVMNQLSGLHSMEEQLAKK
FT                   LQIKKCLVVQGDSDDTPWVREEMGRVAVEQLDMALTEKRNIVAVMGGSTMATVAEMMTT
FT                   DFAKGRELLFVPGRGGIGEDLDNQANTICDKMATKTNTKHRVLYVPEQLGEEAYRSLLK
FT                   EPAIQEGLRLVQSANAIILGIGDALAMAKRRHTGEDVLEKIIRRKAVGEAFGYYFDEQG
FT                   EVVHKVPTFGLQFEDLAQIPHIIAVAGGTSKAKAIKSYMKSAPKNTILITDEGAAKSLL
FT                   KGSNTLLK"
FT   gene            137869..138879
FT                   /gene="gap"
FT                   /locus_tag="LMHCC_0141"
FT   CDS_pept        137869..138879
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gap"
FT                   /locus_tag="LMHCC_0141"
FT                   /product="glyceraldehyde-3-phosphate dehydrogenase, type I"
FT                   /EC_number="1.2.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38503"
FT                   /protein_id="ACK38503.1"
FT                   /translation="MTVKVGINGFGRIGRLAFRRIQNVEGIEVVAINDLTDAKMLAHLL
FT                   KYDTTQGRFDGEVEVHDGFFNVNGKEVKVLANRNPEELPWGDLGVDIVLECTGFFTAQD
FT                   KAELHIKAGAKKVVISAPATGDMKTIVYNVNHETLDGTETVISGASCTTNCLAPMAKVL
FT                   EDKFGVVEGLMTTIHAYTGDQNTLDAPHPKGDFRRARAAAENIIPNTTGAAKAIGEVLP
FT                   TLKGKLDGAAQRVPVPTGSLTELVTVLDKKVTVDEVNAAMEAASDPETFGYTSDQVVSS
FT                   DIKGMTFGSLFDETQTKVLTVGDQQLVKTVAWYDNEMSYTAQLVRTLEYFAKIAK"
FT   gene            139014..140204
FT                   /gene="pgk"
FT                   /locus_tag="LMHCC_0142"
FT   CDS_pept        139014..140204
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pgk"
FT                   /locus_tag="LMHCC_0142"
FT                   /product="phosphoglycerate kinase"
FT                   /EC_number="2.7.2.3"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38504"
FT                   /db_xref="GOA:B8DD98"
FT                   /db_xref="InterPro:IPR001576"
FT                   /db_xref="InterPro:IPR015824"
FT                   /db_xref="InterPro:IPR015911"
FT                   /db_xref="InterPro:IPR036043"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8DD98"
FT                   /protein_id="ACK38504.1"
FT                   /translation="MAKKVVTDLDLKDKKVLVRVDFNVPMKDGKITNDNRIVAALPTIE
FT                   YILEQNGKAILFSHLGKVKTEEDKEGKSLRPVAARLSELLGKEVKFVPTTRGPELEKAI
FT                   DELKDGEVLLFENTRFEDIDGKKESKNDPELGKYWASLGDVFVNDAFGTAHRAHASNVG
FT                   IASNLESAAGFLMEKEIKFIGGVVDNPARPLVAILGGAKVSDKIGVIENLLTKADKVLV
FT                   GGGMTFTFMAAQGQEIGKSLLEADKVELAKGLLEKAGDKLVLPVDAVVSKEFSNDAPFH
FT                   TVSADSIPADEMGLDIGQATIDLFTKELQGAKTVVWNGPMGVFELSNFAKGTIGVCEAI
FT                   ANLTDATTIIGGGDSAAAAMDLGFADKFTHISTGGGASLEYLEGKELPGVASISDK"
FT   gene            140250..141005
FT                   /gene="tpiA"
FT                   /locus_tag="LMHCC_0143"
FT   CDS_pept        140250..141005
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tpiA"
FT                   /locus_tag="LMHCC_0143"
FT                   /product="triose-phosphate isomerase"
FT                   /EC_number="5.3.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38505"
FT                   /protein_id="ACK38505.1"
FT                   /translation="MRKPIIAGNWKMNKTAAKAGQFAEDVKNNVPSSDAVESVVAAPAL
FT                   FLQELVRLTEGTNLRVAAQNCYFEDEGAFTGEISPFALADLGVSYVIIGHSERREYFHE
FT                   TDEDINKKAHAIFKHGMTPIICCGETLDQREAGQTDTWVRGQIRAALAGLTEEQVIKSV
FT                   IAYEPIWAIGTGKSSTSADANETCAVIRAEVADAVSQKAADAVRIQYGGSVKPENIADY
FT                   LAESDIDGALVGGASLEPASFLALLEAVK"
FT   gene            141007..142539
FT                   /gene="gpmI"
FT                   /locus_tag="LMHCC_0144"
FT   CDS_pept        141007..142539
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gpmI"
FT                   /locus_tag="LMHCC_0144"
FT                   /product="2,3-bisphosphoglycerate-independent
FT                   phosphoglycerate mutase"
FT                   /EC_number="5.4.2.-"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38506"
FT                   /protein_id="ACK38506.1"
FT                   /translation="MSKSPVAIIILDGFGKRAETVGNAVAQANKPNFDRYWANFPHGEL
FT                   KAAGLDVGLPEGQMGNSEVGHTNIGAGRIVYQSLTRIDKAIEEGEFQENKALNNAFTHT
FT                   KENNSDLHLFGLLSDGGVHSHINHLVALLETAKDKGVKNVYIHAFLDGRDVAPQSSLEY
FT                   LETLQKAISDLNYGAIATVSGRFYAMDRDKRWERVEKAYKAIVSAEGEKFEDPIELVKA
FT                   SYANDKNDEFVVPAIITKDGKPVATVKDNDAVIFFNFRPDRAIQLSNAFTDKEWDHFDR
FT                   GADHPKNIKFVTMTLYNPSIDAEVAFEPIEMKNVIGEVLSNEGLSQLRIAETEKYPHVT
FT                   FFMNGGRNEEFPGENRILINSPKVETYDLQPEMSAYEVTDALVEDIKNDKHDAIILNFA
FT                   NPDMVGHSGMLEPTIKAIEAVDENLGRVVDLILEKGGSAIIFADHGNSETMSTPEGKPH
FT                   TAHTTVPVPVIVTKKGVTLREGGRLADVAPTMLDLLGVKKPAEMTGESLIQK"
FT   gene            142674..143966
FT                   /gene="eno"
FT                   /locus_tag="LMHCC_0145"
FT   CDS_pept        142674..143966
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="eno"
FT                   /locus_tag="LMHCC_0145"
FT                   /product="phosphopyruvate hydratase"
FT                   /EC_number="4.2.1.11"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38507"
FT                   /db_xref="GOA:B8DDA1"
FT                   /db_xref="InterPro:IPR000941"
FT                   /db_xref="InterPro:IPR020809"
FT                   /db_xref="InterPro:IPR020810"
FT                   /db_xref="InterPro:IPR020811"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8DDA1"
FT                   /protein_id="ACK38507.1"
FT                   /translation="MSIITEVYAREVLDSRGNPTVEVEVYTEAGAFGRALVPSGASTGE
FT                   YEAVELRDGDKARYLGKGVLKAVENVNDIIADKIIGFDVTDQIGIDKAMIELDGTPNKG
FT                   KLGANAILGVSLAAARAAADELGVHLYEYLGGVNGKVLPVPMMNILNGGEHADNNVDVQ
FT                   EFMVMPVGAPNFKEALRMGAEILHALKAVLKGKGLNTGVGDEGGFAPNLKSNEEALETI
FT                   MQAIKDAGYKPGEEVKLAMDAASSEFYNRETGKYELKGEGVTRTSEEMVTWYEEMITKY
FT                   PIISIEDGLDENDWDGFKLLTERIGDRVQLVGDDLFVTNTTKLKEGIEKGIANSILIKV
FT                   NQIGTLTETLDAIEMAKRAGYTAVISHRSGETEDSTIADIAVATNAGQIKTGAPTRTDR
FT                   VAKYNQLLRIEDNLADLAEYHGNETFYNLKK"
FT   gene            144075..144242
FT                   /locus_tag="LMHCC_0146"
FT   CDS_pept        144075..144242
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0146"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38508"
FT                   /protein_id="ACK38508.1"
FT                   /translation="MKVKNSQASKVLETPKIKDAVVHEKSHPLAEKHSVQKKIINADMP
FT                   QQQFHRRLMK"
FT   gene            144375..145094
FT                   /locus_tag="LMHCC_0147"
FT   CDS_pept        144375..145094
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0147"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38509"
FT                   /protein_id="ACK38509.1"
FT                   /translation="MIAEINGINLFYQIIGKGEPILLIHGNGQNHRSLKRLIDDLSTNH
FT                   QVIAVDSRAHGKSEAGNTPLDFEVMALDMLSLLDYLKIDKYKVIGYSDGGIVALVMGKM
FT                   QPNRQIASVVIGTNYHVNQIRFLPDLFCRVAYGAAFLLAPFSRFFERMKRQLALTIYHP
FT                   HMSEADLQKISAPLLAVVGEYDLISSEDTKKMVHSVQHGEMVIVRNGLHYLPRQKPKQL
FT                   LQLIHSFFSNLSAEIHK"
FT   gene            145277..146020
FT                   /locus_tag="LMHCC_0148"
FT   CDS_pept        145277..146020
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0148"
FT                   /product="carboxylesterase"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38510"
FT                   /protein_id="ACK38510.1"
FT                   /translation="MSADRSFTLKAGNRAVLLLHGFAGTTEDVRELGEILAENGYTVHA
FT                   PNFRGHGDEPAIFLKTTPEMWYEDAVAGYRQLEKDGYNEIAIVGVAMGGVFALKMAESF
FT                   SPKAIVPLCANVNRKMRYIPIENYLTKQLKKQGIVEQEADQMLKNYLPEIDVMTEARAT
FT                   FYKNVARDIEKIHVPTMIGQGCQDEEIDADNANYIFKHIHTNDKQLCFYAGSGHDIVND
FT                   CEKDILEEDLIYFLDDLVWLEEKVV"
FT   gene            146110..146343
FT                   /gene="secG"
FT                   /locus_tag="LMHCC_0149"
FT   CDS_pept        146110..146343
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secG"
FT                   /locus_tag="LMHCC_0149"
FT                   /product="preprotein translocase, SecG subunit"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38511"
FT                   /protein_id="ACK38511.1"
FT                   /translation="MSTVLTVLLIIVSVLLITVIILQPGKSAGLSGAISGGAEQLFGKQ
FT                   KARGLELILHRTTIVLSVVFFAILIALAYFVQ"
FT   gene            146595..147341
FT                   /locus_tag="LMHCC_0150"
FT   CDS_pept        146595..147341
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0150"
FT                   /product="carboxylesterase"
FT                   /EC_number="3.1.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38512"
FT                   /protein_id="ACK38512.1"
FT                   /translation="MKITPPQPFLFEKGKRAVLLLHGFTGSSADVRILGRFLQENDYTC
FT                   YAPQYRGHGVSPDLLLKTGPNDWWEDVLEAYDHLKSLGYTEIAVAGLSLGGLFSLKLGF
FT                   SRPLKGIIAMSTPTRMDSSSPIIQGFLDYVRNYKKLEGKTPEQIDAEMVAYKDAPMNTI
FT                   AKLKDEINGVVAEIDMIYAPIMVVQGEKDDMVDVSGAQLIYDTVESTKKELRWFKESGH
FT                   VITLDKERKEVNQAILTFLDSLDWQE"
FT   gene            147375..149756
FT                   /gene="rnr"
FT                   /locus_tag="LMHCC_0151"
FT   CDS_pept        147375..149756
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rnr"
FT                   /locus_tag="LMHCC_0151"
FT                   /product="ribonuclease R"
FT                   /EC_number="3.1.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38513"
FT                   /protein_id="ACK38513.1"
FT                   /translation="MEQKQMEEKIMNLLTSAPDKTFALEDLEIEIALNNADDFKLMVKA
FT                   LVKLEDSGTIVRSRKNRYALPEKMDLVKGTFRAHERGFGFVLPEEKEMDDIFIPPNEVK
FT                   DAMNGDLVFATITKRKGDNLAEGTIKKIVERKTTQIVGTYMEDLAGTPIVMPDDKRLFG
FT                   EVEIDLEDGLKPVDGHKVIVELTEYATGHARARGVVKSIIGHRNDPGVDILSIIHKHGI
FT                   SIGFPEEVMEQVSKAPDVVDDSDIGNRRDLRDQMIITIDGADAKDLDDAVTVTQLPNGN
FT                   WKLGVHIADVTHYVTEGSPLDVEAQERGTSVYLVDRVIPMLPHKLSNGICSLNPQVDRF
FT                   TMSCEMEIDEEGHVVNHEIFESIIKTTERMTYTDVNDILVENDEALREKYAPIVPMLEK
FT                   MQHLAEILRRKREKRGAIDFDFKEARVVVDEDGHPEAVVMRERSAGEHLIEEFMLAANE
FT                   TVAEHFHWMDVPFIYRIHEDPKEDKLARFFEFITNFGLIVKGTANDIHPAALQQVLEEV
FT                   KGKPEEMVVSTVMLRSMQQAKYDTVSAGHFGLSTDFYTHFTSPIRRYPDLIVHRLIREY
FT                   LINGDVRPETLEKRAEELPEIAEHSSKMERRAVEAERETDELKKTEFMVDKVGERFIGI
FT                   ISSVTNFGLFIELPTTIEGLVHVSAMKGDYFKFHQNQLAMIGERTGQIYRIGDEVEVEV
FT                   TKVDVDAREIDFALRSEGKPGPVSDKQKRQREKPIDKTRNFKSNQKKGRNKRRTGNSDE
FT                   TKPKTERKDDEWYTKPKKKKKKKPFYQGVAKESPKKKKRR"
FT   gene            149772..150236
FT                   /gene="smpB"
FT                   /locus_tag="LMHCC_0152"
FT   CDS_pept        149772..150236
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="smpB"
FT                   /locus_tag="LMHCC_0152"
FT                   /product="SsrA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38514"
FT                   /db_xref="GOA:B8DDA8"
FT                   /db_xref="InterPro:IPR000037"
FT                   /db_xref="InterPro:IPR020081"
FT                   /db_xref="InterPro:IPR023620"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8DDA8"
FT                   /protein_id="ACK38514.1"
FT                   /translation="MPKGDGKLVAQNKKARHDYAIEETFEAGIVLQGTEIKSVRNARVN
FT                   LKDSYARIDKGEIFLHNMHISPYEQGNRYNHDPLRTRKLLLHKKQISRLIGETKESGYS
FT                   IVPLKMYIKDGYAKVLIGVARGKKKYDKRQDLKQKEAKRDIERAFKERQQ"
FT   gene            complement(150296..151204)
FT                   /locus_tag="LMHCC_0153"
FT   CDS_pept        complement(150296..151204)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0153"
FT                   /product="transcriptional activator, Rgg/GadR/MutR family,
FT                   C-domain protein"
FT                   /note="transcriptional activator, Rgg/GadR/MutR family, C-
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38515"
FT                   /protein_id="ACK38515.1"
FT                   /translation="MQNVGDTLKFIRKSKNLTQQEACTGALSRSNYQKIENNKIMPSMD
FT                   RFIQLLLNFNMTLEEFEFVKRDFTPSPKENILYLYSKIITSSETDILLNVISKCDEYLA
FT                   TQNDYFISDIKASLEGILLVEKEHDFELARQKVSYIWDRLSEADELFWNDILILRNIFF
FT                   IFENETAQHIVNRLIKQLKKYRYLHPTLPIEISLHVNRATYLILDEKYELALHYIEQSI
FT                   KIAKQNHYYLQFCMAIAKKGIVLYKLGQKQDGKRFMQRALRVAKFLEEERILNGIKNEI
FT                   DYFLHDELQNLSLNEFTKIDI"
FT   gene            151587..154862
FT                   /locus_tag="LMHCC_0154"
FT   CDS_pept        151587..154862
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0154"
FT                   /product="glycosyl hydrolase, family 31"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38516"
FT                   /protein_id="ACK38516.1"
FT                   /translation="MKRRTRKCSLVFILGILIFSCLSGFGTNVFAMDGEYHSPYGDDDL
FT                   YSVQPTERSPRDPKAGEDVILNITTWPIEDGQNVWVEWTKNGVAQENVTAAYDYNSGNN
FT                   TYWKADLGKFEKGDEITYTTKGSTNGGTAYESGPFTFYVTDWEYVQDVTSVVDNGDSIT
FT                   LNMTATAGDFSPKLYLSFEDLDTLRMELSPTGKETGHAGKTGYTVEDTAEKVTVTTEDL
FT                   SIEIQKSPYRMEVHQADGTLLTSEYTTANSLGWLTDGKNVINQYQNNFMTPSDEAFYGF
FT                   GERYDTINQRGKDVETYVYNEYQDQAQTERTYLAVPFFVSANKYGMYVNSDFHSQFQMA
FT                   SKVEDKYSFVLDNDGDMTNMLDYYVISGKDQNDIVNNYTDITGKTTLLPKWAFGLWMSA
FT                   NEWDRESDVSSALSNAKANDIPATGFVLEQWSDEETYYIWNNATYTAKKNGEAFSYDDF
FT                   TFNGKWTDPKAMVDSVHDAGMNIVLWQVPVLKDDGTVYEQRDNDEAYMIGQGYSADDGT
FT                   GAPYRVPASQWFGNGILLDFTNKDAVDWWTSQREYLLTEVGIDGFKTDGGEMVWGRDTT
FT                   FSNGEKGQEMRNRYPTDYVSSYFDFAKSINPEAVSFSRSGTSGAQKSGIYWSGDQTSTF
FT                   DSFQASLKAGLSASTSGVSYWAWDMAGFTGDYPTAELYKRATAMAAFAPIMQFHSEKSD
FT                   PSPSEERSPWNAVARTGDETILPTFQKYLYTRMNLLPYIYTAAKDTADNGKSMMRQMAM
FT                   DYPEDINARDLDEQYMFGDDLLVAPIVQEGQTEKEVYLPEGEWVDLWNGGIHPGGETIS
FT                   YYADVDTLPVFAKAGAIIPMNMTDGYQLGQNVGNDLKSYDNLTFRVYPSGDSEYSFYDD
FT                   VNGGEMCDISVSEDFANEKVSVDLPAMADETTMQVFSTEPTSVTIDGADVAKADTLGAF
FT                   NEATTGYYYDTVQNLTYVKAAAKDAKQAIVLNGVNHAPYEAEFAHLTNVSTASDHAGYT
FT                   GTGFVAGFDAEKEAVEFDVDAVDGASDYTMEVRYSAGVEDATRTVYINGKKQQITLPKT
FT                   ADWDTWSTIEVPVTLQAGNNQVVFDFEADDTAGINFDHVVFKK"
FT   gene            154923..155867
FT                   /locus_tag="LMHCC_0155"
FT   CDS_pept        154923..155867
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0155"
FT                   /product="leucine rich repeat domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38517"
FT                   /protein_id="ACK38517.1"
FT                   /translation="MKKIIGLAFIAFCCILFAPTIKAQADTVPLPAPIIEAFPVEAIAE
FT                   AIAGELDKDSVNDTITQADLDTMTLIPLPSLGLTGEDLSVLNNEVFTNAIELAIWSNNI
FT                   GELPDLSDALPALENIEANGANITLFPDANYPNLTNADLSQNNFGFNIPKFVGMEALES
FT                   INISDAGLSGYVAEDIWMNMPNLDSLLLNENHLISIPEDIFLSGQLSTHSFANQTATYP
FT                   HTTIKQGENLEVFVPFIYQALDFIAPSKHDLIIIKDNGRTLYEPPYPTYDGSYMYKIET
FT                   AGLQPGEHLLEISLGYNSGEYTGWYDFPVTITE"
FT   gene            155879..159814
FT                   /locus_tag="LMHCC_0156"
FT   CDS_pept        155879..159814
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0156"
FT                   /product="6-a-glucosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38518"
FT                   /protein_id="ACK38518.1"
FT                   /translation="MMKKGMKQVCVSLAVVPLVWLNLGITQPLQVEVKAEETKEKEVKK
FT                   EANTGAAKQLSKEEYAKLSAEEGLGNVLEATVTDNVITLKIDNGDEAEDDYLEISPLAN
FT                   NLLKVNLRPRNIENSPSTPMIDPNATFTAIGVTIDLESDPMIISTDECTLEIAKEPARM
FT                   TFKDKNGKTLLSESADGGIFDGGVRFKRGASDHVYGAYGISFSDGDLGMERDNTAADSN
FT                   KTAQAGQQGNAGGPFMWSTAGYGLLVDSDGGYPYSVSDEEKLEFYYGDTVVEGRRYVKE
FT                   NVEMYLMSGEPEEIMSSYADVTGHTPMMPKWSLGFSNFEWGTNEAEFRENINTYRAKGI
FT                   PIDSFAFDYDWKFYGDPTYGGDYGEFAWNTENFPSAKDTTLKSDMDALGVKMIGITKPR
FT                   VVTNLEDGTATQQGKDAEANGYWYPGQSAYEDYAFPVTVRSIDPYNEDERNWWWSHSED
FT                   ALDKGIVGWWNDETDKVSSNGADYWFGNFTTGFTSEAMYEGQRDYTNERVWQTGRTFYP
FT                   GAQRYSTSTWSGDIGVQWKKGEVIDWANGMQEQPSTMLSTINLGQTKWGMDTGGFNANS
FT                   GQVLNPDPELYSRWMEFSSLVPVFRTHGNQNQQRQPWFYGGTAEEVAKSSMTWRYSMIP
FT                   YMYAYERQAYDSGVGLVQPLTFDNPTDENVVNLTDEWMFGDGLLAAPVLEEGAGSRDIY
FT                   LPAGTWIDYNRGDVYEGNQTISYEVNDDDWTDVPMFVKQGAIMPMQQPQNYVGESAVKT
FT                   IYLDTFASDKETSFTHYDDDGKSFDYEKDTYLKQKMTTSKSADTSTFTIGAKEGSYKAD
FT                   TENYIVKLHGNAAESVQVNGADSKVYDDLSALENADGSGYAVGSDVYGAVTYVKVPAQA
FT                   DADTVITTSGSASVVQTGAYEMETGSNFADTVADKPVAEKTYVDGYDKDGAGTTIYANV
FT                   KDSGDYNVDLTYKNASSDNQALSIFVNGDYVKQTTLKPNTDWSVQSETLPLSAGKNSIS
FT                   YKVVTDTGDKADQVSLDKVNIGFTPTVAKVEAEEADLAGTLKVANDHWFYSGEGFVGGF
FT                   GAAGDEIKFEVDVPADGEYVLNTRTANGTGMPQTLDLYTNGDYNSRVTFPSEGENWNIW
FT                   SDTEKAVNLKAGTNKITFLRDGETTGNVNIDRILVSAEPINSPVQSEVNLLDNGGFERD
FT                   AAATTNWVESHPDGQDKAYGVDSGSGVNPPESPAFGKQSAYFYLPGAYKQTLAQQIAVP
FT                   VNNANYDVEAWVKVSNDDAAKAQMTVNNYDSSDGKTIDLVADDVWHYVTIKDVKVTTGN
FT                   INTSFQMDSPGGTSIHIDNVRVVPSAE"
FT   gene            159865..160923
FT                   /locus_tag="LMHCC_0157"
FT   CDS_pept        159865..160923
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0157"
FT                   /product="leucine rich repeat domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38519"
FT                   /protein_id="ACK38519.1"
FT                   /translation="MKNLFRLFLVFSIVIIGVVSFKAIDASANETDVYPLPARIIDVFP
FT                   DENLAEDMVENFGKKDVTDVITQDDVDAVTSLGLGYFTNYLTDEDLQMLGNAYFTNVTS
FT                   IMIYPTQTMFTCFPDLLTLPKLDTLTANGGLSSEVPPASITVPDYQNYPELKILDFGNR
FT                   PVVGGLPDFSNLTKLENLMMYNCELTSEDVPDFTNLKNLQVVNFEENQFRTEMTDFTHL
FT                   DSLLSMDLSYNYLNVLPPTIVDKITVLAQIGTLPDQNVTLGEDTNVTLPIYTQLDDLGR
FT                   ISGFQEVWIDDAEGKEIYNSFAVNYDEVTQQIIVPTSNLDKGEYKIWIDFNGEHSSSGE
FT                   EVMNYSVKITIN"
FT   gene            161878..162297
FT                   /locus_tag="LMHCC_0158"
FT   CDS_pept        161878..162297
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0158"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38520"
FT                   /protein_id="ACK38520.1"
FT                   /translation="MYRLLSIAFFGIGVICLLFPWMSNGIDATTFELVYEPAYKLIWMQ
FT                   PIIIFGYLGFLCTIFIPKFHQGKNKIIPFIGILILVLGLLNLAVRPLFGFGRITFNILS
FT                   TYFTELVEPAFIIVVIASILSLIMYALYLKTSEDL"
FT   gene            162300..163223
FT                   /locus_tag="LMHCC_0159"
FT   CDS_pept        162300..163223
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0159"
FT                   /product="lipoprotein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38521"
FT                   /protein_id="ACK38521.1"
FT                   /translation="MKKRNFIVGLVVAVSCIIPTTVLAESKEATDSDLKTVFEKEEIKN
FT                   EDKLLDLADKQENVDYIKAAGEKIPIIIDESTAEVTTDALEGVEEELETKTATEVLEVK
FT                   ANEDGEYDAELVSTIFVEVEGDGVISADLVDAVEDSDMDLEENKDIQTEDQSSKYNNFA
FT                   TYLVPMSAWTDTSSTGKKGAKDSVYISAKVYYHQQKKNGNTHVDMNSINYSTSVKKSGG
FT                   KITKRTAKVAQSGMTKFGNKPMLKQTKSLSFSSNSYKYNVIDSWTPISTTNGWVGTQLN
FT                   VASTYKSSSYNTSVNCLILSNPKLGW"
FT   gene            163424..163993
FT                   /locus_tag="LMHCC_0160"
FT   CDS_pept        163424..163993
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0160"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38522"
FT                   /protein_id="ACK38522.1"
FT                   /translation="MRRLKRISIILIAIGFIYLLIVAAIMFSGTRAKPSDNADTVLILG
FT                   AKVNGDPAEPAEVLKERLDAAVTYLNENPTMQVVVSGGQGEDESASEASVMEEYLVNKG
FT                   ITRSRIKIEDKSRRTEENIKYSKEKFNLGKTVIVTSDYHMYRALMLAKRQELDASGLPA
FT                   KSQSVIKIKNMMRETLSITYAWVFDR"
FT   gene            164012..164908
FT                   /locus_tag="LMHCC_0161"
FT   CDS_pept        164012..164908
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0161"
FT                   /product="helix-turn-helix type 11 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38523"
FT                   /protein_id="ACK38523.1"
FT                   /translation="MKLERILAILVMILERKVLASELAEKFEVSTRTIYRDMDTLLYAG
FT                   FPVVALPGKNGGFTMLDTYKLATFTFSEAEKQILLEALEARSEFMLNDSQEILREKITL
FT                   LQTEKPTSKHIFFDSATQHRQQIEAEVKRKVAYIQKAFTTNKQLEITYIAMSGAETTRE
FT                   ISPQKLNLMDGSWYLEAYCHKRAAIRHFKLTRITSLEEISKAIMYVEETEHQPAEMKKI
FT                   VLEFPKNQLGKLLDYFLQEEMETGDDYVRVSFFYDLERNIIPFLLMFGSAVKILEPASL
FT                   QKDYKSEVEKLYFNLNC"
FT   gene            164964..165347
FT                   /locus_tag="LMHCC_0162"
FT   CDS_pept        164964..165347
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0162"
FT                   /product="transcription activator effector binding"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38524"
FT                   /protein_id="ACK38524.1"
FT                   /translation="MILQETKEIFGKKIRANNANFSPIAELWGEVMVDKPAGDIFAVYS
FT                   NYASDYKGDYDLLVGTIDWDEQQSVVIEPGEYLVFSVDNANHKGVEEVWQEIWSRDSEL
FT                   KRAYKTDFEWYHTSGKIEIYISI"
FT   gene            complement(165379..165720)
FT                   /locus_tag="LMHCC_0163"
FT   CDS_pept        complement(165379..165720)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0163"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38525"
FT                   /protein_id="ACK38525.1"
FT                   /translation="MKKIIILIISVLLLGGIIGGVYYFKNANKIGADASYVKITKDPTK
FT                   GKEISFNNNYTLPAYDENGKETEVTFSADKELRKGAYLKLYIKEDKGVTSFEEVPEKEV
FT                   PAKAAEKLK"
FT   gene            165844..166356
FT                   /locus_tag="LMHCC_0164"
FT   CDS_pept        165844..166356
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0164"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38526"
FT                   /protein_id="ACK38526.1"
FT                   /translation="MVRPKNKEELLQQSTTSYQKLMDLIDSIPKEMQQHAFPFEDRDKN
FT                   IRDVVVHLHEWHKMALNWYEVGMRGEKPFMPAEGYTWKTTPALNLVIWKKYQTMGLEEA
FT                   RNLLATTHHEEMRIIAEHSNEELFTKKYYKWTNTTSLGAIFISSTSSHYEWAIKKIRKF
FT                   KKAAGIK"
FT   gene            complement(166379..166789)
FT                   /locus_tag="LMHCC_0165"
FT   CDS_pept        complement(166379..166789)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0165"
FT                   /product="glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38527"
FT                   /protein_id="ACK38527.1"
FT                   /translation="MATRSEQIFINLPVKDLQATVAFFTELGYEFNPQFTDENATQMLI
FT                   GENIFAMLLKEDFFQTFHKEGIADTTKAREVLITITQDSRQAVDTLVDHALKIGAKPAG
FT                   ETQDYDFMYSRSFLDLDNHLWEIAYLDESALQ"
FT   gene            167129..167914
FT                   /locus_tag="LMHCC_0166"
FT   CDS_pept        167129..167914
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0166"
FT                   /product="transcription antiterminator LicT"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38528"
FT                   /protein_id="ACK38528.1"
FT                   /translation="MGRGLAFQKKLGDEVEVSKIEKTFVMETHELSEKLSELLSEIPLK
FT                   HLRVADDVVQYAQETLETDLSDNIYLTLTDHINFAVSRYNQGINLKNALLWEIKRFYHA
FT                   EYLVGMKALDFIEQEVGIRLDEDEAGFIALHIVNARQDGQQMHMTVAMTQIVQDILSIV
FT                   TYHYGMVLDETSLNYTRFITHLQYFAQRLLRKEIVDSGDDFLYEQVQLKYPEAFKCTKK
FT                   IDAYLINTHHTELTRDERVYLTIHIYRVTERNTIIKEEE"
FT   gene            complement(167978..168286)
FT                   /locus_tag="LMHCC_0167"
FT   CDS_pept        complement(167978..168286)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0167"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38529"
FT                   /protein_id="ACK38529.1"
FT                   /translation="MFDLIFPLLLIILGVIYRVNPPKNKESRFSYRTKASLKNEISWQK
FT                   AHQLLGIYWITIGVLLLVLSLTLAFIPMHAFVRSSILLTTSIFAVLLSVILVEKKLQ"
FT   gene            168413..169816
FT                   /locus_tag="LMHCC_0168"
FT   CDS_pept        168413..169816
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0168"
FT                   /product="glutamate decarboxylase"
FT                   /EC_number="4.1.1.15"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38530"
FT                   /protein_id="ACK38530.1"
FT                   /translation="MLYSENDKRKHESYRIPLFGSEEESTSIPKYVLKKEPMEPRIAYQ
FT                   LVKDQLMDEGNARQNLATFCQTYMEKEAEILMAETLEKNAIDKSEYPQTAELENRCVNI
FT                   LADLWNAPKEMAYLGTSTVGSSEACMLGGLAMKFRWRNHAEKRGLDIQAKRPNLIISSG
FT                   YQVCWEKFCVYWDVDMRVVPMDKEHLSIDVDKVFDLVDDYTIGIVGILGITYTGKFDDI
FT                   ALLNEKVEAYNEANEHQLVIHIDGASGAMFTPFVNPELPWDFRLKNVVSINTSGHKYGL
FT                   VYPGVGWILWKDKEYLPKELIFEVSYLGGSMPTMAINFSRSASQIIGQYYNFLRYGFEG
FT                   YREIHEKTKKTALYLAKTVEKSGYFEIINDGANLPIVCYKMKEGLDVEWTLYDLADQLL
FT                   MKGWQVPAYPLPADLSDTIIQRFVCRADLGYNVAEEFAADFADALHNLEHARVLYHDKE
FT                   RNDSYGFTH"
FT   gene            complement(169857..170615)
FT                   /locus_tag="LMHCC_0169"
FT   CDS_pept        complement(169857..170615)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0169"
FT                   /product="tributyrin esterase"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38531"
FT                   /protein_id="ACK38531.1"
FT                   /translation="MAILELNFKSVCLAMQTSVTVILPETDALYHGSIPKYKTLYILHG
FT                   LSNNHTTYVRNTNIERYATEKGLAVVMPAADHSFYSNMVHGRDFFEFVSTELPNVMKNW
FT                   FPLSDKKEDTFIAGHSMGGYGAFKVALTFPEKFQAAASMSGVMDINYIIKEDCFENFST
FT                   RAITGEMASQTGTENDLFHLLETNLQNQVPLPALFQNCGTEDFLYEDNIRFRDFALEKN
FT                   APLEYREGPGDHDWEFWDKSIKEIIDWLPL"
FT   gene            complement(170748..170912)
FT                   /locus_tag="LMHCC_0170"
FT   CDS_pept        complement(170748..170912)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0170"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38532"
FT                   /protein_id="ACK38532.1"
FT                   /translation="MTDNLFPNLAHENCKETMPPVTTEQFKEAAILEKNRKLEEILNIV
FT                   DKNKPSIKK"
FT   gene            171068..172039
FT                   /locus_tag="LMHCC_0171"
FT   CDS_pept        171068..172039
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0171"
FT                   /product="ferrichrome ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38533"
FT                   /protein_id="ACK38533.1"
FT                   /translation="MKKITILTLSITAALLLASCGNDTATDTNNETTKTENKSQAALTI
FT                   TDMAGRDVSFDKKPERIIALTNADMNIIYALGGTVVGRQTTDASGVPDGAKKATEVGNT
FT                   HDLNLEKIASLGADAIVASSEQNLKDVPAMEGVGPKVVLTGANSIDEIKKQTAVLGELL
FT                   GKETKAKELEANIDQKVAEVKKKQQGKKVRSLLVLGAPGSNYAALPSSLSGNVLEIAGG
FT                   ENVAKDFKGVENFPQYASMNVEKIVAADPEVIFLMIHGGDEKETEAAFKKEMKQNEAWN
FT                   STSAVKNDHIVVLPAELFGTNPGIKIDQALDYMTDEINKVDN"
FT   gene            172039..173049
FT                   /locus_tag="LMHCC_0172"
FT   CDS_pept        172039..173049
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0172"
FT                   /product="iron compound ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38534"
FT                   /protein_id="ACK38534.1"
FT                   /translation="MTTVKAHDPRRKRRRITFIVVIILLILAFFYGLTTGSVKITYSDA
FT                   WQTLTGGGSDLANQLIWNLRLPRLLIAFLVGAALAIAGCLLQGVMRNPLADPGVIGVSA
FT                   GGGFVAILMTLAFPALASFVPIGAFLGAFGTAILIYLLAWDRGVSPLRVILSGVAINAF
FT                   IGAMTSGVMVLYSNRVQSVISWMTGTLSGKSWYHLDMIWPYMLVGFVLSGFAIRSSNVL
FT                   LLGDDAAKLLGFSVERHRFFIIMLAAFLSGVAVSVAGLIGFVGLVVPHIFRLIIGNDYK
FT                   YLLPLSALGGALLVGFADTAARSWFGSIELPVGILLAMIGAPFFLFLLQRGRVAS"
FT   gene            173046..173837
FT                   /locus_tag="LMHCC_0173"
FT   CDS_pept        173046..173837
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0173"
FT                   /product="ferrichrome transport ATP-binding protein FhuC"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38535"
FT                   /protein_id="ACK38535.1"
FT                   /translation="MKSALELKNVSFSRKRDFEMKNVSASIPEGKITTLIGPNGSGKST
FT                   MLRLMMRLLTPDSGEIFLNDKNITEIPSKDLAKKMTMLSQAPEGLVDVMVHDLVAYGRL
FT                   PHRSWLSTLQEEDEAVIHWAIKVCNLEELAYRPLHSLSGGERQRAWLAMALAQKTPILL
FT                   LDEPTTYLDIAHQLELLDLLVHLNKEYNLTIVLVLHDLNQAAIYSDYVFVCENGQLVKD
FT                   GSPREVFTTELLRDVFHITADITEKDGKQHIHPLASTRFEY"
FT   gene            173979..175148
FT                   /gene="mrdB"
FT                   /locus_tag="LMHCC_0174"
FT   CDS_pept        173979..175148
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mrdB"
FT                   /locus_tag="LMHCC_0174"
FT                   /product="rod shape-determining protein RodA"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38536"
FT                   /protein_id="ACK38536.1"
FT                   /translation="MARNRKKAVRVDYSIIFLMMLLCVIGLVAIYVAGLVNDQYTNNFL
FT                   LQQSIWIVISTGVVVVIVLFFDYDKLQWAAYYLYGIGNLLLVLVLIVGDERKGSKSWIS
FT                   IGSLGSLQPSELMKSFLILALAKVIWDHNKKYKIHTVSLDMQLLLKIGIVSILPLGLVA
FT                   LQPDLGTILVFIAIIVGMVFLSGVTWKILLPVFSSIALLGGTLIYLVMYNPDFLQKLGF
FT                   KTYQFKRITSWLRPEEDPLGDGMQLLRSMQAIGSGQLQGNGIGNQAIAIPENHNDFIFS
FT                   IIGGNFGFIGGCVLIMLYFLLIYQIIRVALDINIPFYSYICAGVCSMILFHVLENIGMT
FT                   IGLLPITGIPLLFVSYGGSSLLGAFMALGLVLSARYNAPEVNLGKGNRF"
FT   gene            175225..176400
FT                   /gene="mrdB"
FT                   /locus_tag="LMHCC_0175"
FT   CDS_pept        175225..176400
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mrdB"
FT                   /locus_tag="LMHCC_0175"
FT                   /product="rod shape-determining protein RodA"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38537"
FT                   /protein_id="ACK38537.1"
FT                   /translation="MNQQNKLAGRIDYGIVLSMMLLMIISLVSIYSAQLTNNQYDANFV
FT                   VKQAMWFVVSTFAIIVVMQLDYDRLTKWAYYFYGLGLFLLVFVLLFGKEVKGAKSWIVI
FT                   PFLGNIQPSEVVKVILIIVLAKVIWDHNRTYKVHRFSYDAWLLLKIGLFTLIPLILIML
FT                   QPDLGTALVFIAIMSGMILVSGITWKIIVPLFGSIAAIGTALIWMVIYHQNWLTSLGFK
FT                   PYQFDRITTWINPENDPQGGGYQVLRALTAIGSGQISGNGAGYDAIAIPENHNDFIFTI
FT                   VAGDYGFIGASILLAIYFLLIYQIIRVALDVGVPFYSYICTGVVMMLMFHVLENVGMNI
FT                   GLLPITGIPLPFISYGGSALLGNMMAVGLVLGIRFNFKKSMFEVKEENHAS"
FT   gene            176556..176909
FT                   /locus_tag="LMHCC_0176"
FT   CDS_pept        176556..176909
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0176"
FT                   /product="ArsC family protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38538"
FT                   /protein_id="ACK38538.1"
FT                   /translation="MINFYWYPKCSTCKKAKAWLESEHVDFNEVDIKTETPTVEEIQKW
FT                   HEVSGLPIRRFFNTSGIKYRELGLKDKLDTLSPEEAYKLLASDGMLIKRPLTTNGKEVT
FT                   LGFKEEEFEATWK"
FT   gene            176950..177327
FT                   /gene="gcvH"
FT                   /locus_tag="LMHCC_0177"
FT   CDS_pept        176950..177327
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gcvH"
FT                   /locus_tag="LMHCC_0177"
FT                   /product="glycine cleavage system H protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38539"
FT                   /db_xref="GOA:B8DDD3"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR002930"
FT                   /db_xref="InterPro:IPR003016"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR017453"
FT                   /db_xref="InterPro:IPR033753"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8DDD3"
FT                   /protein_id="ACK38539.1"
FT                   /translation="MSLPKDLLYTEEHEWVKADDGSYVIGITDFAQDQLGDIVFVELPE
FT                   VGDTVTKGDSIGSIESVKTVSDFYAPVTGKVVAVNETLEDEPELINSNPYDTGWILKLE
FT                   EVEEADVKALLSSDDYEKVLD"
FT   gene            177413..177697
FT                   /locus_tag="LMHCC_0178"
FT   CDS_pept        177413..177697
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0178"
FT                   /product="thioredoxin, putative"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38540"
FT                   /protein_id="ACK38540.1"
FT                   /translation="MKMAQKNGADFVVFFFTPMCGSCQIASRLVDVVLEADSLHAEVRK
FT                   VDLNYVPEIAQSLEITSVPALVKFKSGQPVDLSYQLHDATAIFEFLYSE"
FT   gene            177889..178764
FT                   /locus_tag="LMHCC_0179"
FT   CDS_pept        177889..178764
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0179"
FT                   /product="cation efflux family protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38541"
FT                   /protein_id="ACK38541.1"
FT                   /translation="MNHSNLTILSVCSNFVIVVLKLIVGFFTGSVAVISEGIHSSMDLF
FT                   ASIITFFSIRISNQPADEDHPYGHGKAENIAGTIETLLIFVAGIWIIVESVNKLINPHE
FT                   IRFPALGIMVMLFGAIVNIIVSRIIKKAADEANSVAMKSNALHLYTDVFTALGIALSLF
FT                   LVYITGWLWLDPVIAILTAFYIMYEAYKLLKESFPPLMDKRLSADEEEAIKQIILTHKT
FT                   KFIEFHDFRSRRAGAEEYIDFHLVVSSSMTIESAHSLCDEIEAEIMNFYSKAEVLIHLE
FT                   PEEERVFTRI"
FT   gene            178839..179534
FT                   /locus_tag="LMHCC_0180"
FT   CDS_pept        178839..179534
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0180"
FT                   /product="regulatory protein VanR"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38542"
FT                   /protein_id="ACK38542.1"
FT                   /translation="MTTSILIADDDKEIVDLVKLYLQNEGYTIYQAYDGAEVWRLVQEK
FT                   QPTLVILDIMMPEMNGLEVCRLMRDNGILTPILMLSAKAEDNDKIMGLLTGADDYMVKP
FT                   FNPLELSVRVKAILRRMQQMSQAEPVSQDKVIIGPIVVDRGLHVVTVGGKELHLTTSEF
FT                   DILFLLASEPGRVFSSEYIFEKIWQEKALGASKTVMVHISNLRDKLREAMGGENVIKTI
FT                   WGVGYKIEI"
FT   gene            179524..180666
FT                   /locus_tag="LMHCC_0181"
FT   CDS_pept        179524..180666
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0181"
FT                   /product="sensor histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38543"
FT                   /protein_id="ACK38543.1"
FT                   /translation="MKSKLELLFTKISHVMNIWQATFFAAVSWVLALITVQTIYLWSIS
FT                   IRDDSLFLREVSQAIVQLFGTNKYTRIMQSFWMLSLKFLIIFLIACLFFAFFYRLMRQR
FT                   ILKKQLRTINFALNDGKPVDTESFVPEIQELERNIENMRERQKKLMQQEEQAQQARNDL
FT                   ITNVSHDLRTPLTSILGYLSYIHEDRYRDEIELRYYTELVYGKARHLHKLIDDLFSYTR
FT                   LDSVDYQLKKDELDIVELLRQLVAEYDGRAAERNMQIVEHFDTNKLIIGGDGNQIMRLF
FT                   ENLFSNALRYGEGNKQIDVSAKKEDNMAVVRVTNYGEEIPNVDLPYLFERFYKVDKNRT
FT                   TTGTGLGLAIAKSIVEKHGGIVTAESKKRQTSFIVKLPLI"
FT   gene            180745..180933
FT                   /locus_tag="LMHCC_0182"
FT   CDS_pept        180745..180933
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0182"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38544"
FT                   /protein_id="ACK38544.1"
FT                   /translation="MKKHIVLIVVACITVIAVFMYIVQINNSELKYQKKAQIKIASQMA
FT                   NQVEQTNSSILSEITYK"
FT   gene            181250..182272
FT                   /locus_tag="LMHCC_0183"
FT   CDS_pept        181250..182272
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0183"
FT                   /product="methionine import ATP-binding protein MetN 2"
FT                   /EC_number="3.6.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38545"
FT                   /protein_id="ACK38545.1"
FT                   /translation="MITLQNVVKEYTSRNNKVLAVDHVDLEIEQGEIFGVVGYSGAGKS
FT                   TLIRMFNGLELPSAGTVEVDNLLISQIRGSKLRKARQQIGMIFQHFNLLWSRTVAENIA
FT                   FPLEIAGVRGEKRRFRVNELIRLVGLEGKENAYPAELSGGQKQRVGIARALANNPKVLL
FT                   CDEATSALDPQTTDEVLELLLDINKRLHLTIIVITHEMHVIRKICNRVAVMENGKVVEL
FT                   GDVLDVFRHPQEKVTQRFVRQVTDSDETEELIHLLLDNYAEGKIVKLLFMSENATQPVI
FT                   SQVAKENDVMLNVLHGNLTQTQNGAYGTLYVQVLGTEDAINASLTQLRQLKVETEVLER
FT                   "
FT   gene            182269..182943
FT                   /locus_tag="LMHCC_0184"
FT   CDS_pept        182269..182943
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0184"
FT                   /product="ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38546"
FT                   /protein_id="ACK38546.1"
FT                   /translation="MTKLQELFPNVDFQMMWVATQETLYMTLVSLFAVFLLGIVLGLLL
FT                   FLTNNKKHAGARILYWITAILVNVFRSIPFIILIVLLLPMTKSLVGTVIGPKAALPALI
FT                   ISAAPFYGRMVEIAFREVDKGVIEAAKSMGANMFTIIGKVLIPEALPAIISGITVTAIS
FT                   LVGFTAMAGVIGAGGLGNTAYLEGFQRGQPDVTVLATIIILIIVFIFQFIGDFLTKRTD
FT                   KR"
FT   gene            183008..183838
FT                   /locus_tag="LMHCC_0185"
FT   CDS_pept        183008..183838
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0185"
FT                   /product="ABC transporter, substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38547"
FT                   /protein_id="ACK38547.1"
FT                   /translation="MKKVLGFIFTLSLVLVLTACGSSSDKASSSKDDNQLVVGASNTPH
FT                   AQILEQAKPILKDKGIDLKIVKYTDYVMPNKALEEGDLDANYFQHKPYLELEEKEKGYK
FT                   FADVGAIHIEPMGIYSKKVKDIKDLKDGAQVLLSNSKSDWPRVIGIFVDNGLLTLKDGV
FT                   KPQDATFDDIKDNPKNLKFKYDFDPAYLMTAYNNEEGDVVAINSNFVVDQGLNPSKDAI
FT                   AIESKDSPYANIVVTTEKKKDDKNIKELVKVLHSKEIQDYITKEWDGAVVPVDK"
FT   gene            complement(183878..184954)
FT                   /locus_tag="LMHCC_0186"
FT   CDS_pept        complement(183878..184954)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0186"
FT                   /product="lipoprotein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38548"
FT                   /protein_id="ACK38548.1"
FT                   /translation="MKKAIMAATIFVLLLATLSGCSSPKSDFTAALQKTAKNRQYTTNV
FT                   TFQVNDLSEGYMKKLGPEIDLNQLKKSNIQYKISVDSDSASSYSASSIHWKGEKPFDLT
FT                   IHALQNSDDGKAYIPVSDFYDATDSISSLLPASTAKIFNQVLEQNKDLESKYLNLFETI
FT                   QNFSNQTIDTETVDRQAKELKKIEETAGIAIYSYLNDLDDKHFTSKDNDDIVLKLSKNE
FT                   VSDLVNDVLTKLDDQGNVVALIAEIDGSTQKAAKKKWNTAQKDMQASLKKLTNNDAQTL
FT                   DFNLTLTPDSKKGFSKAIITTNFEDTNTKDLMNFTTTIDMLDYEKVPPMPEGNEIVSKK
FT                   ELDKAISDGLKLYLSSAQ"
FT   gene            185295..186080
FT                   /gene="sufC"
FT                   /locus_tag="LMHCC_0187"
FT   CDS_pept        185295..186080
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sufC"
FT                   /locus_tag="LMHCC_0187"
FT                   /product="FeS assembly ATPase SufC"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38549"
FT                   /protein_id="ACK38549.1"
FT                   /translation="MATLKIQDLHVEIEGKEILKGVNLEISTGEIHAIMGPNGTGKSTL
FT                   SSAIMGHPKYEVTQGTITLDGEDVLEMEVDERARAGLFLAMQYPSEISGVTNAEFIRAA
FT                   INSRREEGDEIPVMQFIRKLDAKMDILDMDEEMAERYLNEGFSGGEKKRNEILQLLMIE
FT                   PKLAILDEIDSGLDIDALKVVSKGVNEMRGEGFGCLIITHYQRLLNYITPDFVHVMMQG
FT                   KVVKEGGPELAKRLEAEGYDWIKQELGIELEEEEAVDQQ"
FT   gene            186099..187400
FT                   /gene="sufD"
FT                   /locus_tag="LMHCC_0188"
FT   CDS_pept        186099..187400
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sufD"
FT                   /locus_tag="LMHCC_0188"
FT                   /product="FeS assembly protein SufD"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38550"
FT                   /protein_id="ACK38550.1"
FT                   /translation="MAENMTIKDDFIHAFSSNANEPDWFLDIRRNAFKAYGELDLPFVD
FT                   KTKITRWNFTKFETFIPFKEGVTNETLPEKVANLVDLDNKEANFYVQMDERPARLQLQQ
FT                   ELVDQGVIFTDIISAVKNHPELVKKYFMKDAVQVNEHKLTAFHAALVNGGIFLYVPKNV
FT                   EVKAPIQAVFVQDKAESPLVNHVLLVADDNSAVTYVENYVTVDNAPKGIVSIVEEVIAE
FT                   KNARITFGGVDNLASDVTTYVNRRGHIGTDSQIEWALGLMNDGDTINENVTNLIGDGSS
FT                   ADVKTVTVGRGKQTQNVTTRVTHYGKASNGTILSHGVMKERATTIFNGIGHIKHGASKS
FT                   DAQQESRVLMLSPEARGDANPILLIDENDVVAGHAASVGRVDPLQLFYLMSRGISQKEA
FT                   ERLVIHGFLDPVVRQLPIESVKTMLREVIEGKVR"
FT   gene            187401..188627
FT                   /locus_tag="LMHCC_0189"
FT   CDS_pept        187401..188627
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0189"
FT                   /product="cysteine desulfurase"
FT                   /EC_number="2.8.1.7"
FT                   /EC_number="4.4.1.16"
FT                   /note="Selenocysteine lyase; Selenocysteine reductase;
FT                   Selenocysteine beta-lyase; SCL"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38551"
FT                   /protein_id="ACK38551.1"
FT                   /translation="MIDIQKIRADFPILAQEINEKPLAYLDNAATSQKPKQVIEALTHY
FT                   YEFDNANVHRGVHTLAARATDAYESARGKVAQFIHAREVAEIIFTRGTTSAINLVVDSY
FT                   AEANIEAGDEIVISYLEHHSNLIPWQQLAKRKGAVLKYIELEENGTISVEQAKKTIGEK
FT                   TKIVALAHVSNVLGTITPIKEIAAIAHQFGAVILVDGAQAVPHMEVDVVDLDADFYAFS
FT                   GHKMMAPTGIGALYGKRELLDAMEPTEFGGEMIDFVELYDSTWKELPWKFEAGTPIIGG
FT                   AIALGAAIDYLAEVGLANIHAHEQALASYAIEEMSKIEGITIYGPKDASKRCGLVTFNL
FT                   EGAHPHDIATILDEDGIAIRAGHHCAQPLMKWLDVSSTARASFYIYNTKEEIDALIDGL
FT                   KLTKEYFGL"
FT   gene            188624..189067
FT                   /locus_tag="LMHCC_0190"
FT   CDS_pept        188624..189067
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0190"
FT                   /product="NifU family protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38552"
FT                   /protein_id="ACK38552.1"
FT                   /translation="MTSRKLDQLYRQVIMDHYKNPRNNGELPDSDVTIDLNNPTCGDQI
FT                   HLHLKMDGDKIVAAKFTGSGCSISMASASMMTQSIIGKTEKEALKMSREFSEMVQGHDH
FT                   ETIDEYGDVEALAGVAKFPARIKCATLSWKAMERAIFEKEGTK"
FT   gene            189090..190484
FT                   /gene="sufB"
FT                   /locus_tag="LMHCC_0191"
FT   CDS_pept        189090..190484
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sufB"
FT                   /locus_tag="LMHCC_0191"
FT                   /product="FeS assembly protein SufB"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38553"
FT                   /protein_id="ACK38553.1"
FT                   /translation="MTEIPEIGEYQYGFHDKDTSVFRTERGLTEKVVREISNIKEEPEW
FT                   MLEFRLKSLEQFYKMPMPTWGGDLSELKFEDITYYVKPSEQTVRSWDEVPEEIKRTFDK
FT                   LGIPEAEQKYLAGASAQYESEVVYHNMKQDLEDLGIVFKDTDSALKENEDIFKEYFAKV
FT                   IPPSDNKFAALNSAVWSGGSFIYVPPGIKVDTPLQAYFRINSENMGQFERTLIIVDENA
FT                   SVNYVEGCTAPVYTTNSLHSAVVEIIVKPGAYCRYTTIQNWANNVYNLVTKRTFCEENA
FT                   TMEWIDGNIGSKLTMKYPAVHLRGEGARGTTLSIAIAGKGQRQDAGAKMMHYAPNTSST
FT                   IVSKSISKQGGNVTYRGIVHFGRNADGARSNIECDTLIMDNLSTSDTIPYNEILNSNIS
FT                   LEHEAKVSKVSEEQLFYLMSRGLSEEEATEMIVMGFIEPFTKELPMEYAVEMNRLIKFE
FT                   MEGSIG"
FT   gene            190860..191702
FT                   /locus_tag="LMHCC_0192"
FT   CDS_pept        190860..191702
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0192"
FT                   /product="conserved protein YunF"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38554"
FT                   /protein_id="ACK38554.1"
FT                   /translation="MITIGLTGWSDHDSLLQSKKLTLADYAAHFPVVEVDTSFYAIPSP
FT                   RTTANWAAQTPDDFRFVIKAFSAMTKHKEWSQYFDSENAMYTAYMDMIAPISETGKLQA
FT                   ILYQFPPYFNCTKENVTYLKYVASKMGDLPVAIEFRNNSWYSEQNTEKTLDLLHELGFI
FT                   HTVVDEPQVGSGSVPIVLRETNSDMTLVRLHGRNQYGWMKASSPEWREVRTLYRYNEEE
FT                   INEWAKYVEHLQKLSKEVVVIFNNNSGGDAADNAKHLQKALQVEFQGLAPMQMDLFSE"
FT   gene            complement(191735..192100)
FT                   /locus_tag="LMHCC_0193"
FT   CDS_pept        complement(191735..192100)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0193"
FT                   /product="integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38555"
FT                   /protein_id="ACK38555.1"
FT                   /translation="MAEKKEEMYRVELIVSALLRIGVVLSAIIIVFGLVMLFITGESGY
FT                   PGETYPTSLTAIFSGLGTLKPYAIMMFGLFCLILTPVLRVVVSLFTFLKEKDYLYVGIT
FT                   GIVLIILVISFLIGIKA"
FT   gene            complement(192101..192940)
FT                   /locus_tag="LMHCC_0194"
FT   CDS_pept        complement(192101..192940)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0194"
FT                   /product="transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38556"
FT                   /protein_id="ACK38556.1"
FT                   /translation="MDITQTVEILLISVFAGVVGSLLGLGGGIIVTPALTLIFGIDIQY
FT                   AIGASIISVIATSSGSAIAYIKDGITNLRVGMFLEIATTIGAITGAFVSGLLSATALYI
FT                   IFGLLLLYSAFNMIKKVGTEFPTNVKPDPLATKLNLHDSYYDKSLRQTVDYQVANVPAG
FT                   FGVMYGAGIASGLLGIGSGAFKVMALDVFMKMPLKVSSATSNLMMGVTAAASATVYLFQ
FT                   GDIQPAIAAPVAIGVLVGATLGTRIMQRLKSKVIRIIFIPVILYVAFQMILEGLGWI"
FT   gene            193077..194465
FT                   /locus_tag="LMHCC_0195"
FT   CDS_pept        193077..194465
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0195"
FT                   /product="Ser/Thr protein phosphatase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38557"
FT                   /protein_id="ACK38557.1"
FT                   /translation="MKHLTLWHTNDVHSHLEHWPRIFNFLKEKRTAADKENKSALFFDI
FT                   GDFLDRVHPLTEGTNGLANTDLLNQLPYDAVTFGNNEGTTLAHEDLDKLYEHAAFPVVC
FT                   CNFYADKERTKQPDWVKSIVYKEIEQVKIAIIGATAPFREYYEAMGWGVEEPISSIQKQ
FT                   IAGLDEDTDVVILLSHLGLPSDERIALEIPEIDVILGGHTHHLLETGKLEGNALLAAAG
FT                   RWGEYIGKVDIELDENNQILTKTATTFKTEDLPAAPNEANEIQGFFDKGRAELSEKVVA
FT                   IPGKLAHNWFDDSEIAHILNEAVCEWTGAETFVMNAGIFMTDFEAGIVTDFDIHQMLPH
FT                   PLNAIALTMSGEELEILIDGIYRKKAELQDIPLRGFGFRGEYFGTVLMDRAGFDAENQV
FT                   ALFDNKPIDKTREYRIATHDTFVFAPFFPIVKQIKRKEVYTPELLRDILKWKLKKMYGQ
FT                   EEDK"
FT   gene            194462..194737
FT                   /locus_tag="LMHCC_0196"
FT   CDS_pept        194462..194737
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0196"
FT                   /product="YutD"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38558"
FT                   /protein_id="ACK38558.1"
FT                   /translation="MTITIQDLNYEIITNYRDAFDEEKLNERFSDILGRYDYIVGDWGY
FT                   DQLRLKGFFEDDNRKAAYDNKISTLKEYIYEYCNFGCAYFVIKKVK"
FT   gene            194751..195524
FT                   /locus_tag="LMHCC_0197"
FT   CDS_pept        194751..195524
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0197"
FT                   /product="HAD-superfamily subfamily IIA hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38559"
FT                   /protein_id="ACK38559.1"
FT                   /translation="MELKNYKAYLIDLDGTMYRGAEVIPEAIIFIENLKRAGIPYLFVT
FT                   NNSTKTPGQVAEHLTDMGIQAVSDDVFTTSQATVQFMMEQKREKTVYVIGERGIKQELT
FT                   DNGFEITSSNPAFVVVGLDREVDYEKFSKAALAVRGGAMFISTNGDAAIPTERGLLPGN
FT                   GSITSVVSVATETAPVFIGKPESIIMEQALAKLGVHKDEAIMVGDNYETDIMAGINYGM
FT                   DTLIVHTGFTSKEALLTKEIQPTYAVTKLTDWKFN"
FT   gene            195573..196016
FT                   /locus_tag="LMHCC_0198"
FT   CDS_pept        195573..196016
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0198"
FT                   /product="acetyltransferase, gnat family"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38560"
FT                   /protein_id="ACK38560.1"
FT                   /translation="MVSIQKLTKDNFHETAKLEVHPHQKTFVAENWYSIIEASFEETYH
FT                   SLVIYADNMPVGYAMYGMDTDDGEFWLVRFMTGKEHQGKGYGGDALEQIIEIVKNLPEK
FT                   PARLRLSYEPDNTVAEKFYAKYGFKKTGEIIDGEAVADLWFKR"
FT   gene            196052..197362
FT                   /locus_tag="LMHCC_0199"
FT   CDS_pept        196052..197362
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0199"
FT                   /product="CBS domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38561"
FT                   /protein_id="ACK38561.1"
FT                   /translation="MDVFNDFFVIFLIGATAFFVASEFAIVAIRKPTVLQLVASEDPRA
FT                   KYVKKVTSNMNDYLAACQLGNTLAALAMGWVGEATMRGWLEPLFLMLPVPESVEKPISI
FT                   FVSFILITFLNVVLGELAPKTFTIQSTEKVALFIARPLVYWYRLTFPLNWLLNNSANLI
FT                   TRMFGVKQTVDADQMTPTELKIIFEDSYRQGLLNPQEFRYMKNIFKLGDVPAKEVMIPR
FT                   MSMIAIDQTATVRDLLKLTSEHTYHIFPVTEDEDKDHIIGMLRVSAVMAGLGKDETIVT
FT                   QSIQPFITPVLEVFEGMILEELLVKMQQESEPFVVLTDEYGGTSGIVTLEDVMEVIVGD
FT                   MEEAKGPKGIRKVALNHYIIEGSEPLLEVEEALGVPIEGPGVHTLSGWMLLERFDLEAG
FT                   DEIEHEGYRFIVRSMNKNSIRQVEVKLGKEKPVKLEE"
FT   gene            complement(197387..197887)
FT                   /gene="pgpA"
FT                   /locus_tag="LMHCC_0200"
FT   CDS_pept        complement(197387..197887)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pgpA"
FT                   /locus_tag="LMHCC_0200"
FT                   /product="phosphatidylglycerophosphatase A"
FT                   /EC_number="3.1.3.27"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38562"
FT                   /protein_id="ACK38562.1"
FT                   /translation="MVEKQSALESKARSWLIERGVEIDDIAELVLFLQQKYHPGLELDI
FT                   CRQNVEHVLRKREVQNAVLTGIQLDVMAEKGELVQPLQNIISADEGLYGVDEILALSIV
FT                   NVYGSIGFTNYGYIDKVKPGILAKLNEHDGIAVHTFLDDIVGAIAAAAASRLAHSYHDD
FT                   IVN"
FT   gene            complement(197999..198235)
FT                   /locus_tag="LMHCC_0201"
FT   CDS_pept        complement(197999..198235)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0201"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38563"
FT                   /protein_id="ACK38563.1"
FT                   /translation="MEEISYAEVDKALKKFRPFLVRDGGDYELIEVTQDGVVKIKLLGA
FT                   CETCPSSDMTLKMGIELTLAEKIIGFKEVVQVF"
FT   gene            complement(198409..201000)
FT                   /locus_tag="LMHCC_0202"
FT   CDS_pept        complement(198409..201000)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0202"
FT                   /product="cell wall surface anchor family protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38564"
FT                   /protein_id="ACK38564.1"
FT                   /translation="MQKAIKIMLVLFLITTVFLPFSNVRAASTDVVNIPDPYLKEGLKN
FT                   IVGKPLLEELTEAHLETISTADISYMYGFSGYPVTGLVRDLTGLEKAVNMTNLYFSNQT
FT                   EITNLNQIKNLPKLKKIVGISTGLNDIKALGEMPALEEVELGGDNITDFTPLLEQENLK
FT                   SFSYNSYAWLDPSYHQINNEEFTKFANLKSIENLDLTWNNITDLAALTANDHITNLNLS
FT                   YNKFTNVAPIATMKKLKVLYLNNNNLTSIDSLHTLRGLSIAYADNNNITDLSKLKDFFE
FT                   SMDVVGDYKGLQVNSQTITLPTINIKEGATAISNNPTLDIDGKEMPISSISDGGTVSAD
FT                   NKTVSFSNLPIGTKTVTYNATFTATSAKGVPLSYSLKVSQPITVSEKTDSSVNVFYKDE
FT                   NGNELATSETISGKSGENYQTTEKTITNYKLKEIEGQASGQFGDSDTTVTYVYEKADGA
FT                   PVTVKYVDGDGNELATSDTLNGKIDAPYQSTAKSITGWTVKTTPTNANGVFTNANQTVT
FT                   YVYEKANGAPVTVKYVDGDGNELATSDTLNGKIDAPYQSTAKSLSGWTVKTTPANANGV
FT                   FTDTNQTVTYVYEKADGAPVTVKYIDEDGNELATPDTLNGKIDAPYQSTAKSLSGWTVK
FT                   TTPANANGVFTDTNQTVTYVYEKADGAPVTIKYLDSDGNELATPDTLNGKIDAPYQSTA
FT                   KSLSGWVVKTTPANANGVFTDTNQTVTYVYEKADGAPVTVKYVDADGNELATPDTLNGK
FT                   LDTPYAATAKNLSGWKLTATPANANGIFTTDAQTVTFVYAKQEDDPKKEDKNKTPIKIS
FT                   ENKPKANKLTTIKKQTKLPKTGDNQQDSILFGLVGTCFVLLGIYSISKKNS"
FT   gene            202037..202363
FT                   /locus_tag="LMHCC_0203"
FT   CDS_pept        202037..202363
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0203"
FT                   /product="conserved protein YuzD"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38565"
FT                   /protein_id="ACK38565.1"
FT                   /translation="MVNEAKLYVYGSTTICASCVGAPSSKETEEWLRAAIGRKFSGQPF
FT                   MVEYVDIFNPPNETALADMANKIVEEDYMYPVIVVDGEIIAEGNPRLKDIYQVMTDRGY
FT                   LATM"
FT   gene            202385..202618
FT                   /locus_tag="LMHCC_0204"
FT   CDS_pept        202385..202618
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0204"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38566"
FT                   /db_xref="InterPro:IPR009910"
FT                   /db_xref="InterPro:IPR022916"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8DDG0"
FT                   /protein_id="ACK38566.1"
FT                   /translation="MNPIVEFCVNNLASGADAAFAKLDADDSLDVIEYDCLTYCDLCAT
FT                   SLFALVDGEVVRGETAEELVANIYTFLEENPF"
FT   gene            complement(202664..203293)
FT                   /locus_tag="LMHCC_0205"
FT   CDS_pept        complement(202664..203293)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0205"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38567"
FT                   /protein_id="ACK38567.1"
FT                   /translation="MNVLVIGANGKIGRLLVEKLAMEKGFFVRAMVRKAEQVSELEKLG
FT                   AKPIIADLKKDFHYAYDEIEAVIFTAGSGGHTPASETINIDQNGAIKAIETAKEKGVRR
FT                   FIIVSSYGADNPENGPESLVHYLKAKQAADEELKRSGLDYTIVRPVGLSDDPATGKIAE
FT                   VSEKPTTIIPRADVADFISEALSEKSSFYKTYTIESGDTPIKEFFS"
FT   gene            complement(203381..204376)
FT                   /locus_tag="LMHCC_0206"
FT   CDS_pept        complement(203381..204376)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0206"
FT                   /product="pyridine nucleotide-disulfide oxidoreductase
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38568"
FT                   /protein_id="ACK38568.1"
FT                   /translation="MDEKTKIYDITIIGGGPVGLFAAFYAGMRNASVKIIESLPQLGGQ
FT                   LSTLYPEKYIYDIPGYPAVRAQELVNNLIQQMKPFDPTIALEEAVQSVEKQVDGTFEII
FT                   TKKDTHYSKAVIITAGNGAFEPRRLDLPEAEQYEGKNIHYFINDLSRFSGRRVAVCGGG
FT                   DSAVDWALMLEKVASSVAIVHRRNAFRAHEHSVNNLEKSSIAIKTPFIPTEVLGNGDKL
FT                   THITLQEVKGDTRETLEIDDFIINYGFVSSLGPIKNWGLELERNSIVVNSKMETSIPGI
FT                   YCAGDICTYDGKVKLIATGFGEAPTAVNNAMNFIDPKTRVQPMHSTSLFE"
FT   gene            204827..206038
FT                   /locus_tag="LMHCC_0207"
FT   CDS_pept        204827..206038
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0207"
FT                   /product="NADH dehydrogenase ndh"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38569"
FT                   /protein_id="ACK38569.1"
FT                   /translation="MSKPKIVILGAGYGGLKTLRKLQQRNLEAEIVLVNKNDYHHETTW
FT                   LHEAAAGTIEPEKLMYPLDKVVNNTKTTFIQDTVVKINKDEKTVTLDANGDISYDYLLI
FT                   ALGSEAETFGISGLKEYAFTITSVESVKKIRAHIEAQFAKWKTDPRDELLTIIVGGAGF
FT                   TGIEFLGELTNRIPELVKEYDVPREKVRIYCMEAAPKVLPQFDAKLVDYGVGVLEDRGV
FT                   EFHVGKPVKEATADGVKYAESENEVREIKAATIIWAAGVRGNSVIEASGFEAGRGRVKV
FT                   NNNLTVPGNEEILIVGDCSLIINPANDRPFPPTAQIAMQQADVAAVNLAKLVKGETDLQ
FT                   DFVYHEKGTVCSLGDNDAIGVVFGKNLKGYPASVMKKVIDDRALLLIGGSGVLASKGKF
FT                   KFYK"
FT   gene            206122..206943
FT                   /locus_tag="LMHCC_0208"
FT   CDS_pept        206122..206943
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0208"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38570"
FT                   /protein_id="ACK38570.1"
FT                   /translation="MKQLFEILPSEWAEKFSKTMKERIELSLTNEDVISLIESKVGGRG
FT                   YLPKEQGYPVNEGGEPLFFLAQINFAEMPQIENYPKSGILAFYVDYHDDLYGLNFDDQT
FT                   EQNGFRVFFFENIDRESMTAEEQAVYFEGIDKSALYTVVKGEYKLAGRVTKELLMNDIL
FT                   EFEKEFGSGFYDIMEQIFGDDEDKANELFDLATYSSQIGGFPFFTQEDPRMRTENSYHD
FT                   TLLFQLDSEYSEEPGAQINIMWGMSGVGNFFINKQDLINRDFSNVIFNWDC"
FT   gene            206978..207796
FT                   /locus_tag="LMHCC_0209"
FT   CDS_pept        206978..207796
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0209"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38571"
FT                   /protein_id="ACK38571.1"
FT                   /translation="MEQLFDILPSEWAERFLETEKERIELHFKDAGTLSLLQSKAGGRG
FT                   YLPKEQGYPVTEEGKPLSLLAQINFSEMPQMENYPEFGLLAFYVDYQDDLYGLNFENPT
FT                   SQDGFRVFFFDDLGSESLTAEEQDAFFEDVAKTDFYPVVNGEFKIAGQVSDQILLQDSF
FT                   DFENEFGNNFYELADQIFADEEDKADELYNLASEGSQLGGYPFFTQEDPRMYSENPHHD
FT                   TLLFQLASEDFDENRMAIMWGDCGVANFFINKQDLINRDFSNIMYNWDCS"
FT   gene            complement(207833..209095)
FT                   /locus_tag="LMHCC_0210"
FT   CDS_pept        complement(207833..209095)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0210"
FT                   /product="membrane protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38572"
FT                   /protein_id="ACK38572.1"
FT                   /translation="MLSTDFTKGLASVKKVTLVFSVYTFILGILVGVIAALFLAMVHFA
FT                   TTFLWDYLPNQFDFSWYYPLLVGLIGSFFVGMVQLKFGDYPRSMHDNVAEAKKTGRMEY
FT                   RKVLLPTILSAWIILTFGASVGPEAALIGIVGGATTWIIDHLKLSMAHKEELVSLSVGA
FT                   IISSIFHAPFSGLAEEIDESSQAKKIPKNSKLVLSLLISFSALGSFLWLKSFLKMPASI
FT                   FAIRLPDMGWSWWFILLFIPMIILGWLFSVYFQQLQVYIAKAASVIKNKMVAAVIGGLS
FT                   IGLFGIISSFMLFSGEHQLIELTTTVQNYSIPFLLIIALLKPVLVAICLATGWNGGAIF
FT                   PAIFTSTIMGYIATFWMDGSTGFLITVFVTACCTKIVGKPVLTASILLFIFPLQFFPFI
FT                   LLTAFIVNKNWWVSIKKIIRA"
FT   gene            complement(209170..209643)
FT                   /locus_tag="LMHCC_0212"
FT   CDS_pept        complement(209170..209643)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0212"
FT                   /product="YuiD"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38573"
FT                   /protein_id="ACK38573.1"
FT                   /translation="MSIFTNTPLIASIIAIVFAQVVKVPIHILVYRKFNVGLMFSTGGM
FT                   PSSHSAAVTALMTTLAIEYGLDSPYFAIAVVFGIIVMFDATGVRRQAGEQAVVLNKLVT
FT                   DFQDFVEHAKGLAAPEQEEKTKHLKELLGHKPMEVFFGALTGIAIGFILEMFM"
FT   gene            209771..210142
FT                   /locus_tag="LMHCC_0213"
FT   CDS_pept        209771..210142
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0213"
FT                   /product="thioesterase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38574"
FT                   /protein_id="ACK38574.1"
FT                   /translation="MGLQETIGIEIVSVEKGKAIVQLEVTEKVHQPFGYLHGGVSVVLA
FT                   EHAASIGAAKSIEPDEIVFGLEINANHLASKQEGLVTATAEAIHLGKSTQVWEIKITDE
FT                   TEKLICISRCTIAVKKKRK"
FT   gene            complement(210187..210774)
FT                   /locus_tag="LMHCC_0214"
FT   CDS_pept        complement(210187..210774)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0214"
FT                   /product="monovalent cation/proton antiporter, MnhG/PhaG
FT                   subunit subfamily, putative"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38575"
FT                   /protein_id="ACK38575.1"
FT                   /translation="MIIEIIISIMILIGGLLSILAAIGVIRLPDVYTRTHAAGISNTFG
FT                   VSLLLFATVGYFFHSGEGFNARVLLAVLFIFLTTPVASHLINRAAYDTGVPLAIRIRDQ
FT                   LRSVKKDDIKKKKSLIIRQEQIEKARQEREELEERMEWERREEKIDEREDQEEQERERE
FT                   EQTIEEQSDDSEHEIIEQDESETESDDDKTEK"
FT   gene            complement(210764..211051)
FT                   /locus_tag="LMHCC_0215"
FT   CDS_pept        complement(210764..211051)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0215"
FT                   /product="Na(+)/H(+) antiporter subunit F (Multiple
FT                   resistance and pHhomeostasis protein F) (Mrp complex
FT                   subunit F)"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38576"
FT                   /protein_id="ACK38576.1"
FT                   /translation="MIIQIALSIGLLLYSISTFLYLYRILKGPTTSDKVVALDSIGMNL
FT                   VAIVALLSMFYDTHAFLDVILLIALLAFIGTVSFAKFIEKGKVIDRERDN"
FT   gene            complement(211048..211527)
FT                   /locus_tag="LMHCC_0216"
FT   CDS_pept        complement(211048..211527)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0216"
FT                   /product="Na(+)/H(+) antiporter subunit E (Multiple
FT                   resistance and pHhomeostasis protein E) (Mrp complex
FT                   subunit E)"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38577"
FT                   /protein_id="ACK38577.1"
FT                   /translation="MAFQLILNIILACLWMFLESSFSFATFIIGFIIGIFLLFFMRRFL
FT                   GSRFYLFRLFALIKLVFRFLHDLIVSTVHVSRIVLKKDMNIRPGIFRYDTTLETDWEVT
FT                   MLALLITLTPGTLSIDISDDYKAIYVHSLHVPNIEEEIATIRKSYEGAIMEVFHG"
FT   gene            complement(211534..213030)
FT                   /locus_tag="LMHCC_0217"
FT   CDS_pept        complement(211534..213030)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0217"
FT                   /product="Na(+)/H(+) antiporter subunit D (Multiple
FT                   resistance and pHhomeostasis protein D) (Mrp complex
FT                   subunit D)"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38578"
FT                   /protein_id="ACK38578.1"
FT                   /translation="MKPMMNNIILMPILIPFLGAITLMLLPKKVIIQRVFALIFSGILV
FT                   VATLGLVFYIRENGITTVNIGNWAAPFGITMVGDMLAVLLTATTSIVLFCVILYSFYTI
FT                   GKPREKFLYYPAILFMIVGVNGSFLTGDIFNMFVFFEVMLMASYVLLVIGGTQVQLKAT
FT                   IKYLLINVVGSGFFVVAIALLYSMIGTLNMADISQKITDLNGANTGMISVVAVLFLFVF
FT                   GLKAGLFPLYFWLPGSYFAPPIPVLALFGGLLTKVGVYAIIRTYTLFFSSLTDFVVPLL
FT                   GILAIVTIVLGVIGAISYYDMKTIVIYNIMIAIGVILFSVSIMTRESMTGAVFYLIHDM
FT                   IIKAALFLIVGIVMAITGYSSVKKFSGLMSVKPSLGWIFFIATLGLAGIPPLSGFIGKL
FT                   LIVEGAFSAGQIVGGIIILLSSLFVLMSLIKVFTKGFWGEKKGVFNLQIPYKKMLVPVI
FT                   ILLAISIGYGVFSNAIYPFIEQAVDPLVDPSVYIHAVIKE"
FT   gene            complement(213011..213358)
FT                   /locus_tag="LMHCC_0218"
FT   CDS_pept        complement(213011..213358)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0218"
FT                   /product="Na(+)/H(+) antiporter subunit C (Multiple
FT                   resistance and pHhomeostasis protein C) (Mrp complex
FT                   subunit C)"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38579"
FT                   /protein_id="ACK38579.1"
FT                   /translation="MELLMSILIGLIFAAAVYLILSKSLLRIIIGTAVLSHGVNLLVLT
FT                   MGGLKKGRVPILGTPGAGTYNDPLPQALILTAIVISFGVTAFFLVLAYRAYQELDSESV
FT                   SKTRGHEADDE"
FT   gene            complement(213358..213780)
FT                   /locus_tag="LMHCC_0219"
FT   CDS_pept        complement(213358..213780)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0219"
FT                   /product="Na(+)/H(+) antiporter subunit B (Multiple
FT                   resistance and pHhomeostasis protein B) (Mrp complex
FT                   subunit B)"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38580"
FT                   /protein_id="ACK38580.1"
FT                   /translation="MKTNDVLLRNVTKVVAFIIFLFSLHLFFAGHYNPGGGFVAGLTTA
FT                   GAITLTLLAYDTKTVASMLNINTIMLTGVGLVFALGTGMIGIFTGDPFLTHKFGHVDLP
FT                   ILGDTALHTATLFDLGVYLVVVGVTLTIIQTIGESD"
FT   gene            complement(213767..216175)
FT                   /locus_tag="LMHCC_0220"
FT   CDS_pept        complement(213767..216175)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0220"
FT                   /product="Na(+)/H(+) antiporter subunit A (Multiple
FT                   resistance and pHhomeostasis protein A) (Mrp complex
FT                   subunit A)"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38581"
FT                   /protein_id="ACK38581.1"
FT                   /translation="MSFLHLAIVLPFIVALLIPLFYRWTKQVHTGWLVLPIPVILFIYF
FT                   LTFIPKTMDGATIVSMPWIPRLGINFTVVVDGLSLLFALLITGIGSLVTFYSIYYLGKK
FT                   KERLSNFYTFLFIFMTAMLGVVLSDNLIVLYLFWELTSISSFLLIGYWYHRERSRYGAR
FT                   KSMMITVFGGLMMLGGFILLHIMSDSFSIREIISNADVISNNSLFIPAMILVLLGAFTK
FT                   SAQVPFHIWLPDAMEAPTPVSAYLHSATMVKAGIYIVARFTPLFASSGVWFWTVSLVGI
FT                   TTLFWGSLNATKKNDLKAILAYSTISQLGLIMALLGVGAASLHFDTLSDDIYVMAIVAA
FT                   VFHLFNHATFKGSLFMMVGIVDHETGTRDIRRLGGLMRIMPITATIAFIGTFAMAGIPP
FT                   FNGFLSKEMFFESMVNITQLQLFDASTWGVLLPVVAWVASVFTFVYSMIIFFKTFTGKV
FT                   KPYLLPKKPHEAPFGLLLPPIILSIFVVGIGLFPNLIAEPILEPAVRAIVPGLSTDFSI
FT                   HISLWHGFTPALLMTFGVVAVGIVLFLTHKYWKPWITTKVPKALRIGKTYDNGMYYLEQ
FT                   GSYRMTMFIMTGWLRTYLNYMLSAFILMMASVMIFTQALDFNFSSMTKVTVVDFVLAAV
FT                   ILVTLVGIVFSKSRITSIILLGAMGYTISIFFVISRAPDLALTQLIIETISVVLYLLVF
FT                   YHLPQFSNIEEKPKWLSMKTFLSIGVGVIITLVSLSAYNTTFYDSISKYYVDNAYVEAA
FT                   GRNIVNVILVDFRGFDTMFETAVLSIAAIGIYAMIKLRLTKRGENDENE"
FT   gene            complement(216520..217680)
FT                   /locus_tag="LMHCC_0221"
FT   CDS_pept        complement(216520..217680)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0221"
FT                   /product="major facilitator family transporter"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38582"
FT                   /protein_id="ACK38582.1"
FT                   /translation="MSASMTMIMPFLSLYIETFGDYSNAYVQRWAGYIFGVTFLIAFIF
FT                   SPIWGRIGDKHGYKGILILTSVGLSVCIFLMGFAHSVTYLLILRIFMGVVTGFIGVSNA
FT                   FIARQTPRNEAGKILGTLQLGGVTGMLFGPLIGGAMADLFGFKDTFTITGIAMMVAALI
FT                   VAFGVKEIRTEEQKEAAKVVYSRRAVLKQIFTLRVLFTVMVITALIQIANFSVQPLLAL
FT                   YVGDMTQSDNIAFLSGLAFSATGFGNLVMTRKWGQLGDKYGYEKILNILLIMAAVFVIP
FT                   QAFATNLWVFIFFRFLFGIAIGGMVPCTTAYIRLAAPGVMQGEMLGYNQSARFLGNVIG
FT                   PILGGTLAGFTGIPSVFLFMSFMFLVAFFILLYALHSDRKRHVNVD"
FT   gene            217963..218547
FT                   /locus_tag="LMHCC_0222"
FT   CDS_pept        217963..218547
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0222"
FT                   /product="peptidyl-prolyl cis-trans isomerase Ppi1
FT                   (Cyclophilinppi1)"
FT                   /EC_number="5.2.1.8"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38583"
FT                   /protein_id="ACK38583.1"
FT                   /translation="MTYPQLSKEVAPNEIEAEMITNRGTIRIKLFPEIAPKTVENFVTH
FT                   SKNGYYDGLIFHRVIPEFMIQGGDPDGRGTGGESIWGESFEDEFSTEAFNLRGALSMAN
FT                   AGPNTNGSQFFIVQKPDMPADMLGQMEQAGFPVEIIEAYKQGGTPWLDGRHTVFGHVIE
FT                   GMDVVDEIANLPTGMQDKPVNDVVIEKINIK"
FT   gene            219030..220370
FT                   /locus_tag="LMHCC_0223"
FT   CDS_pept        219030..220370
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0223"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38584"
FT                   /protein_id="ACK38584.1"
FT                   /translation="MLDSTKYKTKNYLHFDHRVKIENVESYVTNRSKIGKHSFLPLIRY
FT                   VLSFEKRIEEKNPEFNNRPIKPKNRVIMYAGHMDNFIYKYYAEMLNKDFYNEFCIEKDI
FT                   DDCVSAYRNNKVGKSNIDFAAEIINQAVKYKKAYVLVGDFTNYFDKINHELLKKHLAEV
FT                   LNQPRLSKDWFNVFRSITKYGYYEKSFLNEKYGSDESIKSSNKKSYFENISKFREFQKD
FT                   NKTLYNKNKFGIPQGSAISAVFANIYASEFDLKLKEIADEFSGIYRRYSDDFILVIPKS
FT                   DIVNEQKIRRIETDTRRVASEYKIELHKDKTGLYLYENDKIFDIISNEVSHLDYLGFVF
FT                   DGTTVKMRGKSPYKFYRNAKKLIKFAQKVKVKKELTDLPYKKKIYGLCTDLGKNYNNHG
FT                   NFISYAKRAQKKFDEISPNTNNLIMNQLKNRKKKIEKMLGYKIHTKI"
FT   gene            220484..220876
FT                   /locus_tag="LMHCC_0224"
FT   CDS_pept        220484..220876
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0224"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38585"
FT                   /protein_id="ACK38585.1"
FT                   /translation="METSHPIKINNQLIYGRDQIWLISLNQTLDQLTLSIEVDLEESMF
FT                   LKMIFNGFIFHSSTELDTYEKSKWSTSWLTSQSNFEQIQHSDLINERVKIRDDYNVQDF
FT                   KHYRVSTYDYIIDIIAKDYQLEEVTK"
FT   gene            complement(220921..222282)
FT                   /locus_tag="LMHCC_0225"
FT   CDS_pept        complement(220921..222282)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0225"
FT                   /product="aspartate kinase family protein"
FT                   /EC_number="2.7.2.4"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38586"
FT                   /protein_id="ACK38586.1"
FT                   /translation="MKVIKFGGSSLASGIQLNKVFQLVAEDPDRKIVVVSAPGKRFKED
FT                   TKVTDLLIDCAAKALLGEDTSELFESVIARYAGIALDTGMSDEIINQIRADLQATISSD
FT                   KSDPDKFLDRMKASGEDNNAKLIAAYFKFKGLNANYINPKDAGLLVTNEHASAQVLPES
FT                   YDRLFALREREGIIVFPGFFGYTKDGEISTFSRSGSDITGAIVANGAQAELYENFTDVD
FT                   AVYAVNPAIVKNPKKVLELTYREMRELSYAGFSVFHDEALIPAFHAGIPVHIKNTNNPD
FT                   SCGTRVVHERENNNGPVVGIASDDGFCSIYISKYLMNREIGFGRKVLQILEDAGLNYEH
FT                   MPSGIDDLTIIIRENQFGEDTEQTIMSRLKEELNADQVIMQHGISLIMVVGETMRHNVG
FT                   ITSRASKALSDAKVNIEMINQGSSEVSIMFGVKEEQENTAVRALYNEFFSEVLV"
FT   gene            222527..222841
FT                   /locus_tag="LMHCC_0226"
FT   CDS_pept        222527..222841
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0226"
FT                   /product="lichenan-specific phosphotransferase enzyme iib
FT                   component (pts system lichenan-specific eiib component)
FT                   (eiib-lic)"
FT                   /EC_number="2.7.1.69"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38587"
FT                   /protein_id="ACK38587.1"
FT                   /translation="MKNIVLVCAAGMSTSLLVTKMRKAAEDRGETCEIEAYSIAEVSNL
FT                   IDDADVVLLGPQVRYQKKTVDELAAGKIPVDVIDMAAYGTMNGEKVLGQALDLINGFQK
FT                   "
FT   gene            complement(222885..223565)
FT                   /locus_tag="LMHCC_0227"
FT   CDS_pept        complement(222885..223565)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0227"
FT                   /product="putative hemin import ATP-binding protein HrtA"
FT                   /EC_number="3.6.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38588"
FT                   /protein_id="ACK38588.1"
FT                   /translation="METLLSFDKVYKDYPSGPSIIHALKETNFEAKKGELIAIVGPSGS
FT                   GKSTLLSLAGALLTPTGGTISINGKSVGNLSSKEQTALRLEEIGFIFQAAHLVPYLHVK
FT                   DQISFIGKMAGKSAAELEKDTASLLSQLGISDRANFYPKDLSGGQKQRVAIARALINQP
FT                   SVILADEPTASLDTERSREVVELIRNEVVQTSRTAIMVTHDERMLDLVNHVYRMEDGIL
FT                   TQES"
FT   gene            complement(223565..224668)
FT                   /locus_tag="LMHCC_0228"
FT   CDS_pept        complement(223565..224668)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0228"
FT                   /product="ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38589"
FT                   /protein_id="ACK38589.1"
FT                   /translation="MFLGLRELVYSKLRYILVTGIMVLIMLLSLILSGLANGLAYDNAS
FT                   SVADNGVPYYVLSKDAQDKLSRSQFPESKLADVKKDANVKDAAVLGQSMQTLKRESDDK
FT                   KFSVALFGIQPDSFLAPKISDGANIQVTKPDEIVVDSSLKSDGIKIGDVLMDDILNREL
FT                   TVVGFTENQKYSHAPVVYINIATWQEINPVLYHQKIPQTSTIAIKTENPDKGVTLSDKD
FT                   LTTIDHKGFLNQIPGYSAEQMTLNMMIFFLIIIGGFILTAFFYVMTLQKTTQFGILKAL
FT                   GTKTSYLVKSIITQVVIISIISILISVGVTLILPSIMPAAMPFRLSPMTIALYSGLFFL
FT                   VALFGALLSLRRIAKVDALDAIRGGDE"
FT   gene            complement(224807..225973)
FT                   /locus_tag="LMHCC_0229"
FT   CDS_pept        complement(224807..225973)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0229"
FT                   /product="putative aminotransferase B"
FT                   /EC_number="2.6.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38590"
FT                   /protein_id="ACK38590.1"
FT                   /translation="MSQFDEVIPRIGTNSEKWDGAEKLFGRKDIIPMWVADMDFRAPQP
FT                   VLDAFQRQIDHGIFGYSTKSAALVEAIIDWNKEQHQFEIDPSTLFFNGAVVPTISLAIR
FT                   SLTNEGDAVLMVSPIYPPFFNVTKATERKVVMSPLIYENRQYRMDFNDLEKRMKEEKVK
FT                   LFLLCNPQNPGGRCFTKEELVELAKLCEKYQIPIVSDEIHADLVMKNHKHVPMMVAAPF
FT                   YQDQIITLMAATKTFNLAAIKASYYIITNKDYQTKFAAEQKYATTNGLNVFGIVGTEAA
FT                   YRHGAPWLKELKEYIYSNYEYVKAALEKEVPEVGVTDLEATYLMWLDCRSLPKDEKTIY
FT                   ADLIEAGVGVQMGSGFGHSGKGFVRFNIACPKETLEKAVKLLIQGLKK"
FT   gene            226127..226480
FT                   /locus_tag="LMHCC_0230"
FT   CDS_pept        226127..226480
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0230"
FT                   /product="General stress protein 13 (GSP13)"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38591"
FT                   /protein_id="ACK38591.1"
FT                   /translation="MSTFKVGDVVSGKIAGIQSYGAFVALDNSTQGLVHISEITHGFVK
FT                   DIHDFLEVGQEVKVKILDIDEEKNKISLSIRATEEAPKEQPTKKKPVSSSENDEGFNTL
FT                   RDKLEGWIKKADK"
FT   gene            226630..227037
FT                   /locus_tag="LMHCC_0231"
FT   CDS_pept        226630..227037
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0231"
FT                   /product="MutT/nudix family protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38592"
FT                   /protein_id="ACK38592.1"
FT                   /translation="MKRSIHVQAFVYNEKKDEILVVRDRNLAWAFPGGQVETNQTMEEA
FT                   LASKVKEQTNIDIEIESILHCKERRATWEHVCTFVFRAKPVGSVLLASNDDNVFRVKWI
FT                   PIPLADDLLAVDQLSLNELVRSEGVLYENYT"
FT   gene            227139..228491
FT                   /gene="pgi"
FT                   /locus_tag="LMHCC_0232"
FT   CDS_pept        227139..228491
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pgi"
FT                   /locus_tag="LMHCC_0232"
FT                   /product="glucose-6-phosphate isomerase"
FT                   /EC_number="5.3.1.9"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38593"
FT                   /protein_id="ACK38593.1"
FT                   /translation="MTHIKFDYSKALRFFEERELDYLEPAVKAAHDSLHNGTGAGNDAL
FT                   GWINLPTDYDKEEFARIKKATEKIHSDSDVLIVIGIGGSYLGARAAIETLNHSFYNVLE
FT                   KGARKTPQVFFAGNSISSSYLHDLIEVVGDRDFSVNVISKSGTTTEPAIAFRVFKELLI
FT                   KKYGEEGAKKRIYATTDKAKGALKTLADNEGYETFVVPDDVGGRFSVLTAVGLLPIAVS
FT                   GVDIDALMNGAAAASKDFDKPELKNNIAYQYAAARNVLYRKGKVTELLISYEPGLQYFN
FT                   EWWKQLFGESEGKDKKGIYPSSANFSTDLHSIGQYIQDGRRNLFETVIKVDKPRHNLTI
FT                   NKEDVDLDGLNYLAGETVDFVNTKAFEGTLLAHTDGEVPNFVVEVPELDAYTFGYLVYF
FT                   FEKAVAISGYLNGVNPFDQPGVEAYKANMFALLGKPGFEDKKAELEKRLND"
FT   gene            228596..229354
FT                   /locus_tag="LMHCC_0233"
FT   CDS_pept        228596..229354
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0233"
FT                   /product="transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38594"
FT                   /protein_id="ACK38594.1"
FT                   /translation="MLSIERKRAIVQYVKSRKIATVSELAKHFEVHEATIRRDLTSLEK
FT                   DKKLKRTHGGVMIEEKVVSEPNWKKRSEVRYEEKQRIATLAATMVKDGDTIILDAGTTT
FT                   GHIATALKDRSKLTVITNDINVASIMRFSPSKVIVTGGVIYPETFILNGMITSGTLQSI
FT                   HVHKAFVTTPALDIDKGLMHYDEYLIPAKQQMLHSADEVILVTDHTKFGRISLYKYAAL
FT                   DEISSIITGKEIDPVLKEQFEEKGMQIYTT"
FT   gene            229712..231250
FT                   /gene="rrsA"
FT                   /locus_tag="LMHCC_R001"
FT   rRNA            229712..231250
FT                   /gene="rrsA"
FT                   /locus_tag="LMHCC_R001"
FT                   /product="16S ribosomal RNA"
FT   gene            231386..231459
FT                   /locus_tag="LMHCC_T030"
FT   tRNA            231386..231459
FT                   /locus_tag="LMHCC_T030"
FT                   /product="tRNA-Ile"
FT                   /note="tRNA-Ile-1"
FT   gene            231506..231581
FT                   /locus_tag="LMHCC_T001"
FT   tRNA            231506..231581
FT                   /locus_tag="LMHCC_T001"
FT                   /product="tRNA-Ala"
FT                   /note="tRNA-Ala-1"
FT   gene            231756..234686
FT                   /gene="rrlA"
FT                   /locus_tag="LMHCC_R002"
FT   rRNA            231756..234686
FT                   /gene="rrlA"
FT                   /locus_tag="LMHCC_R002"
FT                   /product="23S ribosomal RNA"
FT   gene            234766..234880
FT                   /gene="rrfA"
FT                   /locus_tag="LMHCC_R003"
FT   rRNA            234766..234880
FT                   /gene="rrfA"
FT                   /locus_tag="LMHCC_R003"
FT                   /product="5S ribosomal RNA"
FT   gene            234890..234965
FT                   /locus_tag="LMHCC_T010"
FT   tRNA            234890..234965
FT                   /locus_tag="LMHCC_T010"
FT                   /product="tRNA-Asn"
FT                   /note="tRNA-Asn-1"
FT   gene            234972..235060
FT                   /locus_tag="LMHCC_T051"
FT   tRNA            234972..235060
FT                   /locus_tag="LMHCC_T051"
FT                   /product="tRNA-Ser"
FT                   /note="tRNA-Ser-1"
FT   gene            235094..235166
FT                   /locus_tag="LMHCC_T063"
FT   tRNA            235094..235166
FT                   /locus_tag="LMHCC_T063"
FT                   /product="tRNA-Glu"
FT   gene            235224..235299
FT                   /locus_tag="LMHCC_T064"
FT   tRNA            235224..235299
FT                   /locus_tag="LMHCC_T064"
FT                   /product="tRNA-Val"
FT                   /note="tRNA-Val-1"
FT   gene            235321..235394
FT                   /locus_tag="LMHCC_T043"
FT   tRNA            235321..235394
FT                   /locus_tag="LMHCC_T043"
FT                   /product="tRNA-Met"
FT                   /note="tRNA-Met-1"
FT   gene            235401..235476
FT                   /locus_tag="LMHCC_T014"
FT   tRNA            235401..235476
FT                   /locus_tag="LMHCC_T014"
FT                   /product="tRNA-Asp"
FT                   /note="tRNA-Asp-1"
FT   gene            235481..235553
FT                   /locus_tag="LMHCC_T047"
FT   tRNA            235481..235553
FT                   /locus_tag="LMHCC_T047"
FT                   /product="tRNA-Phe"
FT                   /note="tRNA-Phe-1"
FT   gene            235574..235657
FT                   /locus_tag="LMHCC_T061"
FT   tRNA            235574..235657
FT                   /locus_tag="LMHCC_T061"
FT                   /product="tRNA-Tyr"
FT                   /note="tRNA-Tyr-1"
FT   gene            235665..235738
FT                   /locus_tag="LMHCC_T060"
FT   tRNA            235665..235738
FT                   /locus_tag="LMHCC_T060"
FT                   /product="tRNA-Trp"
FT                   /note="tRNA-Trp-1"
FT   gene            235754..235826
FT                   /locus_tag="LMHCC_T028"
FT   tRNA            235754..235826
FT                   /locus_tag="LMHCC_T028"
FT                   /product="tRNA-His"
FT                   /note="tRNA-His-1"
FT   gene            235856..235927
FT                   /locus_tag="LMHCC_T018"
FT   tRNA            235856..235927
FT                   /locus_tag="LMHCC_T018"
FT                   /product="tRNA-Gln"
FT                   /note="tRNA-Gln-1"
FT   gene            235933..236004
FT                   /locus_tag="LMHCC_T023"
FT   tRNA            235933..236004
FT                   /locus_tag="LMHCC_T023"
FT                   /product="tRNA-Gly"
FT                   /note="tRNA-Gly-1"
FT   gene            236024..236097
FT                   /locus_tag="LMHCC_T017"
FT   tRNA            236024..236097
FT                   /locus_tag="LMHCC_T017"
FT                   /product="tRNA-Cys"
FT                   /note="tRNA-Cys-1"
FT   gene            236143..236226
FT                   /locus_tag="LMHCC_T033"
FT   tRNA            236143..236226
FT                   /locus_tag="LMHCC_T033"
FT                   /product="tRNA-Leu"
FT                   /note="tRNA-Leu-1"
FT   gene            236946..237467
FT                   /locus_tag="LMHCC_0235"
FT   CDS_pept        236946..237467
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0235"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38595"
FT                   /protein_id="ACK38595.1"
FT                   /translation="MAKKRFMIIFLIVLSIFVLLNPVKGSAYVLNKQKMTNPKSINYFN
FT                   DSSIIKEKLDSYMAYATKWNYSGSQVKVSRSIGAVGVEIKNSYSNKNSGTYATTYYTTK
FT                   QSARIIYYKSFKNTSAANKRETVVHEVGHTIGLSHTQSKNNSVSVMRALNFNQKAYPLA
FT                   DDKKGINAKY"
FT   gene            237489..238103
FT                   /locus_tag="LMHCC_0236"
FT   CDS_pept        237489..238103
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0236"
FT                   /product="putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38596"
FT                   /protein_id="ACK38596.1"
FT                   /translation="MDRKKMTIIAIIAVLLLSIGGYMTYQKMKPKPFTEVAAEAKTDSF
FT                   DSEEELSKASNVIVIGSLSKRGESQVDRDAEGGILAVYRMSDFKIAQVIKNNTKESLAE
FT                   DTIIPIYENEGHDEKTNTTYHVAGYEKMENKETYMLFLTYDPEDKYYVPVGVNFGKMNV
FT                   DSEKETELYGDDSDNQEEEINKVQEEALDTYKEEIKEVENQ"
FT   gene            238308..238508
FT                   /locus_tag="LMHCC_0237"
FT   CDS_pept        238308..238508
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0237"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38597"
FT                   /protein_id="ACK38597.1"
FT                   /translation="MKEDILQVQYLDDLLLDVGFYGKQYKIFVKKNLNLGEPIVVSTAA
FT                   DFNAMLRQLQKVIPYIKNLQR"
FT   gene            238513..238983
FT                   /locus_tag="LMHCC_0238"
FT   CDS_pept        238513..238983
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0238"
FT                   /product="appr-1-p processing domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38598"
FT                   /protein_id="ACK38598.1"
FT                   /translation="MTQITYLKGDATNPMAKGNKIIAHICNDVGGWGKGFVLAISRKWK
FT                   EPEKAYRKWYKDKNDFKLGEVQLIPVTDYISICNMIGQKGTKTGSKGAPIRYEAVESCL
FT                   EKLSEIAKEQQASIHMPRIGCGLAGGKWEIIEPIIRKTLIANDIEVYIYDFD"
FT   gene            239074..240588
FT                   /locus_tag="LMHCC_0239"
FT   CDS_pept        239074..240588
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0239"
FT                   /product="transcriptional regulator, RofA family"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38599"
FT                   /protein_id="ACK38599.1"
FT                   /translation="MLTNYIEKDIKRKCLICDFLLKNKHTNLDEIAEYMETSRVTVRSD
FT                   IHALNEELDGLIVIQMKECADNWVYQCRLQNGATERKVLYKLYDNSMFLKCVAFFVTNV
FT                   EERKFTDFMDTYFISHSHAYRLKHKVEAFLREIDLTLDNNRITGKEYRVRYLIALLQAE
FT                   YGVLIYPLLDEEKQMIDDFMATLNLRINIDTLAHNAEGHAYFRSLISMVFKRDIPTSAI
FT                   ILDEQCQKYIESSSFLDMVRKSSKETLEKELGQAFSYNDYLYLMLIYYSTNFSIIDASM
FT                   KKVELEQFNNLIMKNADLQVLIDLFEEYFGPEVVNHSLFRAALCYFLKKTLFNLQGLIP
FT                   SNERLLDKKYEPLYMVVKNVLERWNEASEYRVLLIDSHINYLTIHLYPLIYKWNNPVQI
FT                   CIFSFNLINFESCKFQVEQELGRKVRVHETMFNSMEELNQVLAESCEPTIVLCHPNCEM
FT                   ELKEAVDGMIIPISLAFFDRDLVDVERAIQSLRIKEHEKRLAYLRG"
FT   gene            complement(240597..241991)
FT                   /locus_tag="LMHCC_0240"
FT   CDS_pept        complement(240597..241991)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0240"
FT                   /product="glutamate decarboxylase"
FT                   /EC_number="4.1.1.15"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38600"
FT                   /protein_id="ACK38600.1"
FT                   /translation="MLYSKENKESYLEPVFGSSAEDRDIPKYTLGKEPLEPRIAYRLVK
FT                   DELLDEGSARQNLATFCQTYMEDEATKLMSETLEKNAIDKSEYPRTAELENRCVNIIAD
FT                   LWHAPKDQKFMGTSTIGSSEACMLGGMAMKFAWRKRAEKLGLDIYAQKPNLVISSGYQV
FT                   CWEKFCVYWDIDMRVVPMDKDHMQLNTDQVLDYVDEYTIGVVGILGITYTGRYDDIYAL
FT                   NEKLEEYNSKTDYKVYIHVDAASGGFFTPFVEPDIIWDFRLKNVISINTSGHKYGLVYP
FT                   GIGWVLWKDESYLPEELIFKVSYLGGEMPTMQINFSRSASHIIGQYYNFLRYGFEGYRT
FT                   IHQKTSDVAQYLAHAVEQTGYFDIYNDGSHLPIVCYKLKDDANVKWTLYDLADHLQMRG
FT                   WQVPAYPLPKNLENIIIQRYVCRADLGFNMAEEFIQDFQASIQELNNAHILFHDTQQSG
FT                   VHGFTH"
FT   gene            complement(242004..243527)
FT                   /locus_tag="LMHCC_0241"
FT   CDS_pept        complement(242004..243527)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0241"
FT                   /product="amino acid antiporter"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38601"
FT                   /protein_id="ACK38601.1"
FT                   /translation="MSKQAKSLTLFGFFAITASMVMTVYEYPTFATSGFHLVFFLLLGG
FT                   FLWFLPVALCAAEMATVDGWQEGGIFSWVGNTLGERFGFAAIFFQWFQITVGFVTMIYF
FT                   ILGALSYVFDFPALESNPFIKFIGVLIIFWGLTFSQLGGTKNTAKIAKFGFIIGILIPA
FT                   IILFILGIAYVAGGNPLHVTFSKEAFIPDFSKASTLVIFVSFILAYMGVEASASHVNEM
FT                   TNPKRDYPLAMIMLVILAIALNTIGGLTISAVLPLKDLSLSSGVVQTFQALILHFGSGL
FT                   GWAVKLIAIMIALGVMGEVSAWVVGPSRGMYTAAEQGLLPEKMKKVNKHGVPVPLIMVQ
FT                   GIVVTIWAAILTFGGGGNNLSFLTAISLTVVIYLVGYLLFFIGYLVLIFKKSSLKRTYQ
FT                   IPGGKIVKVIVALIGLVTSIFALCISFVPPASIAAKSDTTYMVILSISFIVTVLIPFII
FT                   YAVHDKKDISPKDITHLDSSDINKFTHPRARGEHIINPDDKHIMNQDKL"
FT   gene            244152..244622
FT                   /locus_tag="LMHCC_0242"
FT   CDS_pept        244152..244622
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0242"
FT                   /product="appr-1-p processing domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38602"
FT                   /protein_id="ACK38602.1"
FT                   /translation="MTQITYLKGDATNPMTKGNKIIAHICNDVGAWGKGFVLAISKKWK
FT                   EPEKAYKKWYKDNNNFERGEVQLIPVTEYISVCNMIGQEGIRTGAKGVPIRYEAVESCL
FT                   EKLCEMAKEQQASIHMPRIGCGLAGGKWEIIEPIIKKTLVDNGIEVYVYDFD"
FT   gene            244667..245104
FT                   /locus_tag="LMHCC_0243"
FT   CDS_pept        244667..245104
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0243"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38603"
FT                   /protein_id="ACK38603.1"
FT                   /translation="MSTGFRDSLFGSFSYAQGIYKGMISVSSIEIEVLILIDSENIQTL
FT                   HEIYSQINLLSMESKKIASKLLINSINTELLNEEINKSLEVNELYQKMDLKRIIIPMKG
FT                   FYRFIYEINSIVNAGIITVSGNTDIGLTNVELENIESIEIR"
FT   gene            245400..245870
FT                   /locus_tag="LMHCC_0244"
FT   CDS_pept        245400..245870
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0244"
FT                   /product="Rrf2 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38604"
FT                   /protein_id="ACK38604.1"
FT                   /translation="MKLSKSMDQVFCIMTMLYTQKVDVPISSVTIHHRLRDSSPSYISK
FT                   ILRKLVVSGLINSVSGNNGGFTLAKDPEEINLLDIVEAVEGKIDTYPDSDLIHTVFSDY
FT                   HEFAESGIHTITSAFRNADKEYANYLYSQKLSVLVEQVIGKERTTIIDWNEA"
FT   gene            245904..248687
FT                   /locus_tag="LMHCC_0245"
FT   CDS_pept        245904..248687
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0245"
FT                   /product="transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38605"
FT                   /protein_id="ACK38605.1"
FT                   /translation="MDMVKNEWKKLFKNKILLLSFVVILFIPLLYASFFLKSVWDPYGK
FT                   TGDLPVAVVNNDKPVDYNGQTMDVGDQLVTKLKSNKELDWNFLSKEDAEQGLKDGKYYM
FT                   IVTIPKDFSKNAASVLDKDPKKMELSYKTNGSLNYLGQVVSEQGAKQLKSEVSAEVTKS
FT                   YAEAIFDKIKESGEGFAQAADGSGKIKDGLVKSQEGNKTISTNLKTLADSSLTFKDGAN
FT                   TLEVGLKTYTDGVNTAAAGGDKLNDGVSTLAAGVGPLKDGVAALDGGATKLASGVSTYT
FT                   SGVDTLAGGINQAYTGSTALSDGLNKMNGSVPTLASGITQLNNGQKSLATGLDSLVDGS
FT                   NKLSAGLKELDGNLTDKQGKIAQLKQGMNDLQQGIDQLNKSVNGEDAALAKQLAALQKS
FT                   LGDLQNGLTFIKSNANFDAEAIKSKINATAGVSAEDKQKIIDAIQADLDKETQKSATQV
FT                   ATVEQLQSGLSGLDLAAIQTQVTELQTGVAKISAGYQAVHGGTNEAFNSIHQAINGSGS
FT                   QTLLGGANQLTAGLKSAQAGNAKLVAGTNQLNSQVPTLTSGVGQLAAGSANMENGLSQL
FT                   NDGGNKLASNSGALRSGATELQGGTNQLAAKVPTLAGGVNQLQAGSSQLAGGLNQLSAN
FT                   SPKLVSGVGQLADGSSKIADGSSKLANGSFQLGDGLTKLTDGSTELTDKLADGAQQVKD
FT                   TKATDKTFNMIAAPTKLAHNEYTHVSNYGHALAPYVLSLALYVGALVFNFIMPIRRVSM
FT                   EGQPAYKWWLSKLSLGFVAAVAMALLEGGIMIALGLRPDSIVEFFGTAIITALAYMFLI
FT                   MLLAMTFDNPGRFIAMVLLIVQLAGSGGTFPMPLTGWFFNLIHPFLPMTYSIYAFRESL
FT                   AAGMGPNVYSMSMLVLTIIMIACVGLLYLSMSHLKKRHDAHESALDDNQKLMALEN"
FT   gene            248807..249652
FT                   /locus_tag="LMHCC_0246"
FT   CDS_pept        248807..249652
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0246"
FT                   /product="conserved hypothetical protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38606"
FT                   /protein_id="ACK38606.1"
FT                   /translation="MTKKIVFVDVDGTLVTDDGLVPASAKTAIIKARNNGHQVYLCTGR
FT                   SKPELYDSILSIGFDGIIGAGGGYIEVDDEIIYHKKVANEDVVHMVDFFHEKNLDFYLE
FT                   SNGGLFASENLEAHLDSLVYGDVENDPIAREKKANNPHPFMTSLTYGETNLYRTDVNKA
FT                   CFLENKNVPFEEIKNEFSGKFEVLHCTVPIFGDDSGELMVPDIHKATAIEFLLAHIGAE
FT                   KNATIGIGDGMNDAEMLTYCETGIAMGNAKEELKLLADEVTKSVEEDGLYASFEKHGLL
FT                   "
FT   gene            249696..250427
FT                   /locus_tag="LMHCC_0247"
FT   CDS_pept        249696..250427
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0247"
FT                   /product="glucosamine-6-phosphate deaminase
FT                   (glucosamine-6-phosphate isomerase) (gnpda) (glcn6p
FT                   deaminase)"
FT                   /EC_number="3.5.99.6"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38607"
FT                   /protein_id="ACK38607.1"
FT                   /translation="MKLIRTKTYEEMSQEALEVVKQVINENENPVINTTTGASFDGMFE
FT                   GLVKGINAGEIPIEKVFLMNLDEYVAKRDASFTVYTYMHQKFYDLINKMPKRVELLDGS
FT                   LADFTDEIARYKKILAENERDLQILGLGVNGHLGANEPGTPFDARLFLADSDESTIKST
FT                   IMYNNLKEDEAPSQMLTLGLADMMDAKQILVTASGERKAEAVKGLLEGPIDESCPASIL
FT                   RNHPNVVFIIDEAAGSLLTNH"
FT   gene            250443..250973
FT                   /locus_tag="LMHCC_0248"
FT   CDS_pept        250443..250973
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0248"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38608"
FT                   /protein_id="ACK38608.1"
FT                   /translation="MRKLYTYFVLILGVAMIGLGIYLMFNPSTSLQALTIFIGIILVLN
FT                   GINEVISYFGERKYWGISKWIMLDGILSILVGGFAIFESNMAERVFIIIFAIWILASAI
FT                   LRILTAFAVKGFPGWTLLLIMGIIGLIIAVISLFTNTLVAIAIGIILGLFFIFQGITCL
FT                   SLWWVIQKGDSKK"
FT   gene            251163..251774
FT                   /locus_tag="LMHCC_0249"
FT   CDS_pept        251163..251774
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0249"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38609"
FT                   /protein_id="ACK38609.1"
FT                   /translation="MQERFATELMFTLTNNPRFQEVAELVYWNEEEIVLCPENNEYVYA
FT                   IDEGNVTQCAARNSSWGKGSILGFTREETKIQPLSKTVAWKIPLNYVKDILKSMGNVKL
FT                   ADLTRIEKGFLDRNESDCIQWLIQEMPSRLHTTSWKVALDFFRQEIIQVVPKELCAFQV
FT                   KELKQQHILYELGYYLEIDVLQFHNYLRDLAYNKVLQKNN"
FT   gene            251834..251971
FT                   /locus_tag="LMHCC_0250"
FT   CDS_pept        251834..251971
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0250"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38610"
FT                   /protein_id="ACK38610.1"
FT                   /translation="MIGIYRQSLISHQQILLGGFLMKFFFSNVDGCDTLKKVSFNEGKV
FT                   "
FT   gene            251975..253216
FT                   /locus_tag="LMHCC_0251"
FT   CDS_pept        251975..253216
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0251"
FT                   /product="multidrug resistance protein B"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38611"
FT                   /protein_id="ACK38611.1"
FT                   /translation="MTKWLPKDLWIVIIGMVLLYTGLSFIWPFNMIYMTQELGMSTTDA
FT                   SLVLLINSGVGIVSSIIGGLIFDRFSGFISLTIGTIILVLSTASLCFFHGFPFFIWNLW
FT                   AVGIAMGMVFSGLYAAAGLTHPTGGRTGFNAIYVAQNIGVAIGPLLAGLLAKQGMSHVY
FT                   IGSFVFAIAFAGYFFFFFHKIDWKSERVSAETKHRKKGAKREFPTKLALCSFILLLLTY
FT                   LLCQLPHVQWQSNLSTYMTEIKGVTSSEYGNLWSLNGALIVLGQLILIPVVNRFKKYLL
FT                   AQIYIGIFLFILSFVVAMNASVYSGFVLGMIFLTLGEMFAWPAIPTIAYQLAPKGAAGL
FT                   YQGLVNGMATAARMLAPFLGAIVVQNLGGIKALFIGAFILLGCALISITLQQILQKKDQ
FT                   QDKAALKISVNQGE"
FT   gene            253219..254817
FT                   /locus_tag="LMHCC_0252"
FT   CDS_pept        253219..254817
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0252"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38612"
FT                   /protein_id="ACK38612.1"
FT                   /translation="MKLWKNATFYQMTAEGDQVSAVLTENGHIYAVGEARELEKQYAAN
FT                   ITETIDLEGKVVFPGFVDAHIHLLWYGQALERLNLNQTTTKKEALALIAERTKQLASDE
FT                   WLFVEGYDENKWSDEQTLISLADLDEVSQTNPILVRRIDYHSVSINSALQAHIADFSEN
FT                   GFDGGGEIVRDKAGDFTGILRDNATTMAIDSFPAATPYELSAWLKIAITDLWSKGITGA
FT                   HSEDLHYFTGFASTLAAFRNTIGANKMPFRAHLLVHHAELAAFSASNESFVSGDSFLEL
FT                   GAMKIFYDGTVGSRTALMSAGYADNPNEKGLQIHSDQAFEDLVKAARKAGLPVAIHILG
FT                   DQAFANVIRTLRANPPKEGQYDRLIHTPWLTEALIEEAAGLPVLFDIQPQFMASDLPWA
FT                   LEVLGENHPPLAFAWKTLLQAGFPLAGGSDAPIEVPNPFWGIHAAVTRTANADLDGVEY
FT                   WPEQALTVFEAIQLYTKGAAFAGYKTTTRGQIAPGFVADFTILAEDPFQMKQADLRQMS
FT                   VVMTVVNEQIVYQKK"
FT   gene            254941..256893
FT                   /locus_tag="LMHCC_0253"
FT   CDS_pept        254941..256893
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0253"
FT                   /product="sodium/hydrogen exchanger family protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38613"
FT                   /protein_id="ACK38613.1"
FT                   /translation="MEIFELILLMLSAVFLSNVLSRFLPGIAVPLIQVILGIILAIPLG
FT                   DHTMDLNPELFLLLFMAPILFNDGASTDKKSLWKNRKAILSLSIGLVFVTVGVLGAFIH
FT                   YLIPAIPFAAAFALAAALAPTDAVAVGALAEKVRVPHKIMHILEGESLINDASGLVSFQ
FT                   FAVLALVTGTFSFMSAGTSFLLLSLGGIALGAVLSLLKIMLMRGLRQLGIENMTSFMLM
FT                   EILLPFLIFMVAEKVGVNGILAVVSGGMVHSFSYKGLNPEIAQLNLLSKNTWSVIIFSL
FT                   NGLVFILLGTQLPQILMTIWQDANIQKGMLFVYILGITFLLLGLRFLWILFFRNYEENP
FT                   KVDLVSRLKNTFLYTVAGVRGTITLVSALSLPFVLGNGNAFPERDLLIFIAAGVIITTL
FT                   LLANFTLPLFADKKDKVAADHTTDIVLLRDIVQQLQAYKTDENAVEMNKVLNMYNNRIF
FT                   SLMEHKEVNATEKELRRLTQEWQLENTRRLVFERKIDTGVGLSHMMRLGKRLYVQTRAE
FT                   KYRARMRYRQLLSHRFRDFRFVPLTFEERRKEIAKLQNENNLFVIQKLQELDSNEYNPE
FT                   IISLYLMNFERALGRGKNKKESNDEALQTTIDLASQIERETIQHYFEKGTITRKEMKVY
FT                   RDNLLAIEANMQLEF"
FT   gene            complement(256920..257819)
FT                   /locus_tag="LMHCC_0254"
FT   CDS_pept        complement(256920..257819)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0254"
FT                   /product="transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38614"
FT                   /protein_id="ACK38614.1"
FT                   /translation="MEFRTIKTFYTVVNTGSFQRAAEVLNYSQPTISMRIKQLEQDLDV
FT                   QLFERGKTLKLTHAGRLFYERAGQLIAQYEVLDHTIFDLKNGNAGLIKVGISEPSASLV
FT                   FPKILKTFLADFPKLMVNVSVDDANTCSQKLIDGEIDFAICGEPELILENFYFPFFHDT
FT                   LDLIISESHPLSSRTSVELRDLRDECFIFTPANCPIRIQIEQHLKRAIGSDYKKMELTS
FT                   SMSHKYFVRENVGVSIFTSTAHSELLDGTIRIPIENLPISPPIGLLTNQKEKDFDSTTK
FT                   ELIDRIIYYFDDKKRQLG"
FT   gene            258062..258607
FT                   /gene="ssuE"
FT                   /locus_tag="LMHCC_0255"
FT   CDS_pept        258062..258607
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ssuE"
FT                   /locus_tag="LMHCC_0255"
FT                   /product="FMN reductase"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38615"
FT                   /protein_id="ACK38615.1"
FT                   /translation="MEKVTIIAGGIKTESRLTGLTQLAANELVTNGLEVNIIEVHKINA
FT                   EALVTADFAHSDIQLANSEIESSSGVIIATPIFKAAYSGVLKAYLDLLPLKALKRKVVL
FT                   PLGLGGSNGHLLALQYALDPVLKELGAETILKGQFTVDKQIERLGDGLYEIESSAKERL
FT                   DIALNQFISLLNQQSVEV"
FT   gene            258623..259159
FT                   /locus_tag="LMHCC_0256"
FT   CDS_pept        258623..259159
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0256"
FT                   /product="acetyltransferase, gnat family"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38616"
FT                   /protein_id="ACK38616.1"
FT                   /translation="MTEDIFRVATVDDAPEFLELLSSAFQSVKELGIDWPSTNADLAMV
FT                   TENIVNSSAFVLERNGKLISTITVRFPWESSAPPSKYPFVWWFATAPELAGQGIGDKLL
FT                   TYVEERVLRDTLKAPALTLGTSARKHPWLLDMYLRRGYEVYFEHEEDGDVGVMMRKILI
FT                   PEKFDATLLGIPSWT"
FT   gene            259176..259985
FT                   /locus_tag="LMHCC_0257"
FT   CDS_pept        259176..259985
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0257"
FT                   /product="L-cystine-binding protein TcyK"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38617"
FT                   /protein_id="ACK38617.1"
FT                   /translation="MKKKYGILALALTAALTLSACGGKEEPEAANQKVQTITVGTGTQF
FT                   PNVCFLDENGKLTGYDVELVKEIDKRLPGYKFKFKTMDFSNLLVSLGAGKVDIVAHQME
FT                   KSKEREKKFLFNDVAYNNFPLQLTVLDSNNSINSTKDLAGKRVITSATSNGALVLKKIN
FT                   EEQGNNFEIAYEGQGSNDTANQLKTGRADATISTPFAVDFQNKTSAIKEKVVGDVLSNA
FT                   KVYFMLGKDETKLSKDVDEALQSIIDDGTLKKLSEKWLGADYSKEQY"
FT   gene            260007..260723
FT                   /locus_tag="LMHCC_0258"
FT   CDS_pept        260007..260723
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0258"
FT                   /product="L-cystine transport system permease protein TcyL"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38618"
FT                   /protein_id="ACK38618.1"
FT                   /translation="MDKAFDVKMIADFIPTLAGYLPITLYILALSLIFGFILGVLLSLP
FT                   RIYKIPVLDQLARVYISFFRGTPIMVQLFIVFYGIPALSSIVGIDLSQMDPLYAAIATY
FT                   ALSSAATIAEVIRAGVNSVDAGQTEAAYSVGLNGRQTFLRIILPQALYQALPNFGNLVI
FT                   GYLKDTSLAFSIGVMDMSGRGQTLITLSNHALEVYISLSIIYYLTAVLLEYSFKWIEKR
FT                   VKKENTRFTSIFDIEL"
FT   gene            260734..261444
FT                   /locus_tag="LMHCC_0259"
FT   CDS_pept        260734..261444
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0259"
FT                   /product="L-cystine transport system permease protein TcyM"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38619"
FT                   /protein_id="ACK38619.1"
FT                   /translation="MMPLDVPFIGTAVMAMLKTIPLTLAMTFFPILFGFIIAIGLTLIR
FT                   MYHVRFLEPIAKFYVSFFRSTPAILHIMLIYLGIPLLVDFLSKSFGLGISANKIPVVVF
FT                   VIIALSFTAGAYLTEILRSGIMAVDIGQMEAAYSVGYTHGQAIRKVLLPQAFMIALPNF
FT                   TNLCIGFLHTTSIAAIVAVPEITGMATIVASDNYAFLEAFIGAALIYWFLTILIEAINY
FT                   ILEKNIAKYQGGTV"
FT   gene            261441..262220
FT                   /locus_tag="LMHCC_0260"
FT   CDS_pept        261441..262220
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0260"
FT                   /product="L-cystine import ATP-binding protein TcyN"
FT                   /EC_number="3.6.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38620"
FT                   /protein_id="ACK38620.1"
FT                   /translation="MITIKNIQKSFGENKVLKGIDLTVKKGEVVTILGPSGSGKTTFLR
FT                   CLNLLERPENGEISMHDQIINCKKPSKKEVLQLRKNTAMVFQQYNLFSHKTVLQNVMEG
FT                   LTVARKMPKKIAREIAERELTKVGLADKFSAYPSQLSGGQKQRVGIARALAINPDVILF
FT                   DEPTAALDPELVGEVLEVMLEIARAGATMIVVTHEMEFAKRVADQVVFMDGGLIVEQGT
FT                   PDEVFNHTKEERTKRFLHRVSADYLYEIKEVKKERVI"
FT   gene            262217..263212
FT                   /locus_tag="LMHCC_0261"
FT   CDS_pept        262217..263212
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0261"
FT                   /product="bacterial luciferase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38621"
FT                   /protein_id="ACK38621.1"
FT                   /translation="MTIRFSILDQSIINPGEKPSEALQNTVELAQLAEQLGYHRFWVAE
FT                   HHNSDEIAGAAPEVLLGYIAAKTTTIKLASGGIMLQHYSPYKVAEQFHVLENLAPGRIS
FT                   LGVGKAPGGFQPATDALQKDFVKPTRTFDAKLEELVDFVTQYSDATIAAKPLPENKPEI
FT                   FLLGGSAASAKQAAELGISFVFAYFINGEESVLKEARELFEKYRINTKVSFQLAPIIVV
FT                   AETKVAADRHVPERESIKVELADGRRVNVGSREQAEAYVKDIDQTYQFITQRIGAITGT
FT                   KQEVGTEIKRLSKEYNIQDFVVLTPVKSAEIKRYSYQLLSESIKEEVVHG"
FT   gene            263205..263471
FT                   /locus_tag="LMHCC_0262"
FT   CDS_pept        263205..263471
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0262"
FT                   /product="glutaredoxin family protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38622"
FT                   /protein_id="ACK38622.1"
FT                   /translation="MANVVVWSKVGCHYCKDVKDYLTEQKIVFQDIDVTDHDYLREVLQ
FT                   AKYGIRHVPVVEIGDIEKGIYQAVTEIGIEHLEKALFEKEEVK"
FT   gene            263468..264790
FT                   /locus_tag="LMHCC_0263"
FT   CDS_pept        263468..264790
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0263"
FT                   /product="nitrilotriacetate monooxygenase component A
FT                   (NTAmonooxygenase component A) (NTA-MO A)"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38623"
FT                   /protein_id="ACK38623.1"
FT                   /translation="MTRKETIQFGAIIHGVGGTTDGWRHPDINPAASTDLDFYKSRAQI
FT                   AEQGLFSFIFIADGLFISEKSIPHFLNRFEPITILSALAESTKNIGLVGTFSTSFTEPF
FT                   TLARQLSSLDHISGGRAGWNLVTSPQEGAARNHSKKNLPTHSDRYTIAAEHLQVVRGLW
FT                   NSWEEDAFTYNKETGEFFNPKKLHRLNHQGDYFQVEGPLNIARSKQGEPVVFQAGASST
FT                   GRDFAAQNAEAIFTHSDSLEEAIEFYQDVKARAEKAGRNAAEIRVFPGISPIVADTLEE
FT                   AEAKYTEFANLIPIENAVTYLARYFDDYDLSQFDLDAPFPDLGDIGKNAFQSTTDRIKK
FT                   EAKERQLTLRQVATEAATPKTPFLGTKEQVADLIEVWFQNEAADGFIIASDIPGAFETF
FT                   VEQVIPLLQSRGLYRTEYPASTLRGNLGIAIPKNKQAVETK"
FT   gene            264863..265564
FT                   /locus_tag="LMHCC_0264"
FT   CDS_pept        264863..265564
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0264"
FT                   /product="RNA pseudouridine synthase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38624"
FT                   /protein_id="ACK38624.1"
FT                   /translation="MRLDKLLSHTGFGSRKEVKPLLKSGAVVVNGTIQKDSKTQVNPDK
FT                   DQVTVHGTPVVYQEFVYFMLHKPQNVVSATEDNVSETVIDLLAQEDTLTNPFPVGRLDK
FT                   DTEGLLIITNDGTLAHNLLSPKKHIDKTYYAKIDGDVVAEDVTAFADGITLDDGYTCKP
FT                   ARLEIINPNEIKVTIQEGKFHQVKRMFAARGKTVSYLKRISMGNLQLDESLELGEYRPL
FT                   TETELAILQNK"
FT   gene            265697..266815
FT                   /locus_tag="LMHCC_0265"
FT   CDS_pept        265697..266815
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0265"
FT                   /product="carbohydrate kinase, PfkB family"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38625"
FT                   /protein_id="ACK38625.1"
FT                   /translation="MENNKAKMNEKEEIIFNSIRKNPYISQQELADILDLSRPTVANLI
FT                   SGLIKKGRILGKAYILNEAKQIVCIGGANVDRKFYIKDKAQLATSNPVRSTQSAGGVAR
FT                   NVGENLGRLGKEVILLTACGTDSDWEAVKNASNTYMNLDYVTAFPSIATGSYTAVLENN
FT                   GDLLVALADMDAYDHLTPDVLAKNEGLLSQASAIIADLNCPKETLEYLGSFAEINSIPL
FT                   VLVPVSSPKMSHLPERLDHVTWLICNRDESETHLDMTIENDEDWRLAAQKWLDLGVKNV
FT                   IVTNGSKGAVAANKAEGTIFEPAIVIENIVDVTGAGDAFCSAVIYAWLEGKALQEILKA
FT                   GSVNAARTLESEYTVRQNLSTSQLQKDLEEFK"
FT   gene            266812..267723
FT                   /locus_tag="LMHCC_0266"
FT   CDS_pept        266812..267723
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0266"
FT                   /product="indigoidine synthase A family protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38626"
FT                   /protein_id="ACK38626.1"
FT                   /translation="MKNYLSLSEEVKQAKAEGKAIVALESTIISHGMPYPQNVEMARDV
FT                   EQIIRDNGAVPATIALIDGKIKIGLSDEELELFAKSSNVAKVSRRDIGYLIATKQLGAT
FT                   TVAATMICAELAEIGIFVTGGIGGVHRGAETTMDVSADLEELAKTNVAVVCAGAKSILD
FT                   LNLTMEYLETKGVPVIGYQTDVLPAFYTRSSDVELTLRADAPEVIAESLKAKWDLQIEG
FT                   GAVITNPIPEEFAMDEKVINDVIQTALKEAEENHIHGKDVTPFLLGKVKELTDGKSLEA
FT                   NIELVKHNALIGTQIAVAYQNI"
FT   gene            267804..268247
FT                   /locus_tag="LMHCC_0268"
FT   CDS_pept        267804..268247
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0268"
FT                   /product="YbbK"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38628"
FT                   /protein_id="ACK38628.1"
FT                   /translation="MIAVSACLAGIACRYDGKDKEITKIKQMVERGEAIPFCPEVTGGL
FT                   PTPRNPAEIIGGDGKDVWLGHAKVIDNKGTDVTEEYKNGARLTLVKMQELGITQIIMKE
FT                   KSPSCGSCAIYDGTFSGKIKDGTGVAAALFQMNGIKIISEFAF"
FT   gene            complement(268244..269569)
FT                   /locus_tag="LMHCC_0267"
FT   CDS_pept        complement(268244..269569)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0267"
FT                   /product="aminopeptidase C (Bleomycin hydrolase)"
FT                   /EC_number="3.4.22.40"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38627"
FT                   /protein_id="ACK38627.1"
FT                   /translation="MHTELTFEQLESFSKKWRENPDKLVFQASIMKNGIKAATENPASK
FT                   VSIRPVFSHEVATDKVSNQQQSGRCWMFAALNTFRHKLNGTLGLKDFELSQNYTNFWDK
FT                   LEKANYFLENIIETANEEEDSRLVSWLLDTPQQDGGQWDMLVSIIEKYGVVPKSAMPET
FT                   FQSSKSADLNHILNERLRTDAVILRNAIAEKKDTADLKEEMLAEVYQLLVMTLGEPPKV
FT                   FDFEYRNKDNEFKQDLQITPKDFYKRYVDMDLKDYIPLINAPTKDKPFNQAFTVEYLGN
FT                   IVNGTPIKYLNVEMDVLKKAAADQIKDGETVWFGCDVGQLSERNTGIMDTNIFLLNQTF
FT                   GFKTAMTKAERLDYKHSMLTHAMVLTGVNIANGEVNRWKVENSWGEKIGNNGYFVASDA
FT                   WMDEFTFQVVVHKKYLSKELIESFNQKPIVLKPWDPMGSLAL"
FT   gene            269787..270539
FT                   /locus_tag="LMHCC_0269"
FT   CDS_pept        269787..270539
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0269"
FT                   /product="transcriptional regulator, DeoR family"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38629"
FT                   /protein_id="ACK38629.1"
FT                   /translation="MLNAERKQLIMESIEKLGVIKLQELVEGLATSESTIRRDLIELEE
FT                   QGLIQRVHGGAKLVKLHNQEPSMNEKSFKNIQSKKVIAAYCASLVEENDCIYLDAGSTT
FT                   LELITHLANRNITVVTNGLTHIEELVRQNIDAYLLGGKMKVHTKAIIGAVALDNIQNYH
FT                   FDKAFIGTNAMHPEHGYTTPDMEEAFVKRAAKERADRVFVVADHTKFNEVNFSKMFSIE
FT                   EATIVTDYIPSAVKESFIQKTKIIEVEK"
FT   gene            270536..271459
FT                   /gene="pfkB"
FT                   /locus_tag="LMHCC_0270"
FT   CDS_pept        270536..271459
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pfkB"
FT                   /locus_tag="LMHCC_0270"
FT                   /product="1-phosphofructokinase"
FT                   /EC_number="2.7.1.56"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38630"
FT                   /protein_id="ACK38630.1"
FT                   /translation="MIYTITLNPSIDYIVQIDQLNLGGLNRMKQDYKLPGGKGINVSRV
FT                   LNQLNVPSLATGFLGGFTGNFIKDWLQNEGVKTGFVTVKDDTRINIKLKHGEETEINGL
FT                   GPAISEKEINEFLKVMDKVTANDIVILSGSVPPSLGNDFYNKIIRICKEKNAEFMIDTT
FT                   GKELLDALPNRPILIKPNHHELAELFGVELNSVEELIPYGKKCLELGAQHVIVSMAGDG
FT                   ALLFTGEDVYFADALKGELKNSVGAGDSMIAGFVGTFDKTRDPVKAFAAGVATGGATAF
FT                   STDLAQKELIDKLLPQVKITKKTGRN"
FT   gene            271461..273359
FT                   /locus_tag="LMHCC_0271"
FT   CDS_pept        271461..273359
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0271"
FT                   /product="iiabc fructose/xylitol-pts"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38631"
FT                   /protein_id="ACK38631.1"
FT                   /translation="MRITDLLSKDVMIMSLQATTKETAIDEMIASLKSNGKINDEVLFK
FT                   EAIMNREAQSSTGVGEGIAMPHAKTKAVNEPTVVFAKSEKGLDYEALDGQPAHLFFMIA
FT                   APEGANATHLETLAALSRLLVHPTFVQSLRDAKTPDEVIELFNNEQEDSEETVVTPTST
FT                   NDTGKSVVAVTACPTGIAHTYMAAEKLQETANKLGVRIKVETNGSRGVENRLTDKEIAE
FT                   ADGVIIAADVQVDMPRFDGKHLIAKPVAAGIHKPDELINEAISGNAPVYKAEEGSQATE
FT                   SADGLSIGQQIYKHLMSGVSHMLPFVIGGGIAIAIAFMLDQMLGVPQDQLAKLGSYNEI
FT                   PALLKQIGDVAFGFMLPVFAGYIAYSISDRPGLVAGFVAGGVASVGGAGFLGALVGGFL
FT                   AGYAVELIKLALKKLPKTLDGIKVVLFYPVLSVLIVGLLMLLLNVPMSALNTWLNDFLN
FT                   SLSGTNAVILGLLLGAMMAADLGGPINKAAYIFATGTLAASVATGGSAIMAATMAAGMV
FT                   PPLATFVATLVFRNKFTAQERDAGLTNSILGASFITEGAIPFAAADPLRMIPSFIAGSA
FT                   ITGAIVMFLNIKVLAPHGGVFVIFLVSQPWFYIFAIIIGTIISAALIGVLRKKPTV"
FT   gene            273465..273812
FT                   /locus_tag="LMHCC_0272"
FT   CDS_pept        273465..273812
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0272"
FT                   /product="DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38632"
FT                   /protein_id="ACK38632.1"
FT                   /translation="MEFGEKLIHLRKKNRLTQKQLAAKIGTTASTISKYENDNHRPPIF
FT                   ILAKLAEILGTTTDFLLDDVAGLREKNSVNAFPLIGNPELEKWYLELPYTYSEDELLML
FT                   KRIADAIENKK"
FT   gene            complement(273866..274474)
FT                   /gene="comK"
FT                   /locus_tag="LMHCC_0273"
FT   CDS_pept        complement(273866..274474)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="comK"
FT                   /locus_tag="LMHCC_0273"
FT                   /product="competence transcription factor ComK"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38633"
FT                   /protein_id="ACK38633.1"
FT                   /translation="MKKEQISTQFYEVNPHTMIIFPKKSGSIVYSEIYEVDSHYTSKFT
FT                   PFELIKTSCNFFGSSYEGRKEGTKHLIGVTHKPPIIIDPVTSTYVFPTVAPSSTDCIWI
FT                   FPQHIKDYHAIGFNHTLITFSNMETFEIDMSLASFNNQIARTSMLHMKFSQKMRMMESN
FT                   FPSMNMFFPPTTLAAESRRYYNTMLPNNEDPKDPQDSDQ"
FT   gene            274725..274961
FT                   /locus_tag="LMHCC_0274"
FT   CDS_pept        274725..274961
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0274"
FT                   /product="YhzC protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38634"
FT                   /protein_id="ACK38634.1"
FT                   /translation="MEMRDFSNSLMNQVGVLKGEKELTNVFIECFLTMLLEERKLEQLR
FT                   AEIDKALDNRNKAEFMKLTEKMNKIQQEMLAFE"
FT   gene            275111..278584
FT                   /gene="addB"
FT                   /locus_tag="LMHCC_0275"
FT   CDS_pept        275111..278584
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="addB"
FT                   /locus_tag="LMHCC_0275"
FT                   /product="ATP-dependent nuclease subunit B"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38635"
FT                   /db_xref="GOA:B8DF43"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR014140"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038726"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8DF43"
FT                   /protein_id="ACK38635.1"
FT                   /translation="MTLQIIAGRSGTGKTTHLMDEVGEKIKQNSKTYIFIVPDQMTFQM
FT                   ETSFLNKENLAGMLGTQIFSFSRLAWKILQETGGLSKTFLSQTGIEMVIRKAALDQKDK
FT                   LKIFSRATSRKGFYSELANLFKEMKQEEVSIEDMVQSATNLSTSVNNKVHDISLIYQKY
FT                   EELLADKFLENEDYLRLLAEKIADSDYLNRTEIVIDGFTSFSKQELTVIGELMRKCDKV
FT                   TVSLTLNVPEIQHGLDEYSMFKASTEAYYALLELAKLNGTQVEENKFFLENKRAKTESL
FT                   AFLANTWGHNKFMSFKNEPQNLKIHQANNRRAEIEGIAREIRQLVLNGYRYRDIAILTR
FT                   NLGDYDVLCETVMEAYNIPTFIDKKRAMAKHPFIEFIRSSLDAILFNWKYEPIFQAVKT
FT                   EFFFDITEKSSLNRRKADILENYVLENGIQNKWKWEKEGDWVYRKIRGLSTNVLPQTDE
FT                   EIHMQSIINEMRSLIVNPLATLELNLRKAKTGMEFALALYHYLEQVNAVERLESWRQRA
FT                   EEQGYLELAREHEQAWSSISALLDEFVEVLGEETLDLDSFTEIIGTGLDALEFSLLPPS
FT                   LDQVVLSDMENAKLLDMKVIFAIGMNDGVMPLRQKDKGIFSDQDRDALRAEDSKLKPSA
FT                   KNNIGEEDLLAYKIISLPSDKLFLSYPAADEEGKVLSESNYLRKIKGQFNELNESVYLT
FT                   DPSLLSDAEQSSYIRSKQATLGLLTSQLQMYKRGYTLSSVWWDAYNSYFENEKESIMAK
FT                   QVLSSLYYENKTKPLQETTAKNLFGETIHASVSRMEKFFSCEFQHYAQYGLKLEERGHF
FT                   QLQAVDMGEIFHGAMEWISAELKRNNLDWGNLTEEECKQMAKLAMTFLAPKIQHEILLS
FT                   SKRMEYIQYKLLQIITRATTVLNEQAKSSAFRPVGLEVDFGLKGDIPPLKIPLQSDSEL
FT                   LLQGRIDRIDMAEQDDRTFLRIIDYKSSSHDLALTEVYYGLALQMLTYLDIVVTNAQKM
FT                   IGKTAEPAGVLYFHMHNQYVQAEKELSDEAIAKELQKSSKMKGLILSDPVAVSLMDTTL
FT                   EKGKASTIIPAEIKQNGELSARSRTATRAEFDKMRQFVRHKYQEAGNKILDGAVSINPY
FT                   KLKERTPCQFCSFRSFCGFDPSLTSNQYRHLANEKAETILTKMDMEGGTQ"
FT   gene            278586..282293
FT                   /gene="addA"
FT                   /locus_tag="LMHCC_0276"
FT   CDS_pept        278586..282293
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="addA"
FT                   /locus_tag="LMHCC_0276"
FT                   /product="recombination helicase AddA"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38636"
FT                   /db_xref="GOA:B8DF44"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011604"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR014152"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="InterPro:IPR038726"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8DF44"
FT                   /protein_id="ACK38636.1"
FT                   /translation="MSLNIPPKPEESLWTDDQWKAIQAKGNNVLVAAAAGSGKTAVLVT
FT                   RIIKKLIDESANLNVDELLIVTFTNASAAEMKFRIGKGLEEALGQNPDSAHLKRQVALL
FT                   NYASISTLHSFCLEIIRKYYFEADIDPSFRLIEPIESSMIRDEVLEGLLEQEYGIENNE
FT                   AFFHLVESFTGDRSDAELHSLISKLYDFSRANPDPNAWLEAMVNFYNTEEITSITELPY
FT                   FPIIKEDIELRVNQAKNYLLNAIDYANENNGPAPYLATLENDLVQIQALSELNWSSWTH
FT                   LKTSIENIDFKRIPTLKNKSDYDEVYVEEAKKFRDAAKKEMKNIATDWFSREEVNYLSD
FT                   LEKMKPDIQTLSELVKKFAANFFEEKQQRGVLDFNDLEHLALKILLNGDKASEVAQNYQ
FT                   KQFKEVLIDEYQDTNMVQETILRLVTNPSEAQGNLFMVGDVKQSIYRFRLAEPTLFMTK
FT                   YQTFQQDGSGNGIRIDLSQNFRSRKEVLDATNFIFRQLMDKHIAEIDYDTAAELTLGAK
FT                   SPETNAMATELLLIDMKTEDTETEDELSPQELQKNQVESRTIAMKIREMIDNKFPIYDK
FT                   KLKQNRPIQYRDIVILSRAMTSAPDMEEAMKVQDIPFYANNNSGYFETTEVATMIALMK
FT                   VVDNPYQDIPLAAVLRSPIIGLNEEELGQIRMAKKKGYFYDALLAYKDITVSETADKIS
FT                   DFVQQLNNWRELSIRENLTSLIWQIYQETNFYEFVGGLPGGKQRQANLRALYDRANQYE
FT                   KTSFRGLFRFVRFVERLEIRGDDLGTAKTLGEKEDVVRMMTIHASKGLEFPVVIVSGLS
FT                   RKFNMRDIYSKTLLDKDYGFASSYRDVEKMIVYPTIMQQAIKQKKSREMIAEEMRVLYV
FT                   ALTRAEEKLILVATVPDFEKTSKNWLQVAKEKETILPAATRAKAKCYLDWIGNATIRHS
FT                   AFKELLCEEMIQTLATEMKLQIEIKTKEMFLTNELERAESDNWLENIKEHQPVPIQSPY
FT                   KDEIQRYMEYEYQNEAATEIRAKQSVTELKRQFSLQDNWSDTTLLKEFQKVSLDRPKFL
FT                   QKNKLSATEIGTAMHTLMQAVSLDYKPTKEDLEQLLRTMREKDILTDAQIKAINIKQIL
FT                   DFFESPLGETMLQKKDLVKREVPFSYLLPVSELYENVDIDERVLIQGVVDSMIEEEETI
FT                   TLIDYKTDKIEGRYADWNAAEKVMKERYHIQIKLYAEAIQAISGKKVAAAYLYFFDGQH
FT                   ICQINTKEGL"
FT   gene            282294..283142
FT                   /locus_tag="LMHCC_0277"
FT   CDS_pept        282294..283142
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0277"
FT                   /product="fumarylacetoacetate hydrolase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38637"
FT                   /protein_id="ACK38637.1"
FT                   /translation="MKWLSYLYEGDLAYGILTPENKIIPAGTIFSNPPATLLDFIKEKP
FT                   LVPELTGIDGHIDLAEVEIQVPFVPPNNIIAIGKNYYNHVLEMGSKEDVPEHILVFTKS
FT                   ANSLLPHNGNIELHQNITSQLDYEGELAVIIGEKVRDISEQEALSAIFGFTILNDITAR
FT                   DLQKKHKQFYLGKSLDASCPIGPFVLENNANKEPVFHIETKVNGEVRQSDSTDKFIFGL
FT                   ARIISDLSKGHTLLPGDIIATGTPSGVGNGMTPPTFLQDGDIIEITIDKIGTLTNKVRK
FT                   S"
FT   gene            283162..283524
FT                   /locus_tag="LMHCC_0278"
FT   CDS_pept        283162..283524
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0278"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38638"
FT                   /db_xref="GOA:B8DF46"
FT                   /db_xref="InterPro:IPR010899"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8DF46"
FT                   /protein_id="ACK38638.1"
FT                   /translation="MWGYIHLISWVAIVVLTVTALLIYSKSVKSFTMLQMINRVFYILV
FT                   ILSGIMMVKYSIEQSWILAIFKILMGIIVIGVVEMLLSYRKQQKPTGMFLMIFVIVVVI
FT                   TISLGFYLSGGYPLFN"
FT   gene            283608..284510
FT                   /locus_tag="LMHCC_0279"
FT   CDS_pept        283608..284510
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0279"
FT                   /product="YitT"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38639"
FT                   /protein_id="ACK38639.1"
FT                   /translation="MSSKIVYKEYAKKTAIAIIAALLNAIGMNFFLIPAQVYAAGLNGV
FT                   AQLGSDMLRDSMNISISTGLLVLLLNIPVAILGWLKVGKSFTVFSFLTVAFMSFFLIVI
FT                   PEVQVSNDILLNAIFGALIASVGIGLALKFGISTGGLDIVAMYITIKTGRSFGKYFLLL
FT                   NGVIIIVAGFAYDWTFALYTLISLYVQSRVIDIIHTRHQKLTVMIMTQHSETVIKAIHE
FT                   NMVRGITVVDAMGGYSKEDVAMLIMVITRYELYDITHIVGEFDSKAFINVMETSSVFGD
FT                   FRSEADQKLAMAMYKNKMM"
FT   gene            complement(284588..285400)
FT                   /locus_tag="LMHCC_0280"
FT   CDS_pept        complement(284588..285400)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0280"
FT                   /product="HAD-superfamily hydrolase, subfamily IIB"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38640"
FT                   /protein_id="ACK38640.1"
FT                   /translation="MSKKLIVLDLDGTTLRDDLTISSHTKNTLEKARMAGHEVMIATGR
FT                   PYRISGSYYHELGLTTPIVNFNGAVYHHPRLTTFAEGYHHAIDLQVVHELLDFSNGFSL
FT                   DNIAAEVQDNVFLKERNNSVPETFHLGTENIVFGNIRDAIKSDATSLLFFGKMDQLDLI
FT                   SKHLDESLSGVISHHTWGASAWPAVEIIKFGIHKAIGVQAAAKTLGFDRKDIIAFGDET
FT                   NDLQMLDYAGVGVAMGNAAESVKNVANVVTASNQDDGIAVYLEENLNL"
FT   gene            285552..286304
FT                   /locus_tag="LMHCC_0281"
FT   CDS_pept        285552..286304
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0281"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38641"
FT                   /protein_id="ACK38641.1"
FT                   /translation="MIQVENEQIAGIPVLHISNSENADKMLPTIIFYHGFTSQKELYLH
FT                   YGYLLAQRGFRVILPDAKLHGERLQGTNPEDQATFFWDVIETNITEFPLITDELIKAGK
FT                   TDANRIGVGGVSMGAITSLGLLGLYENIKVAVSLMGSAYYVDFAKELSKYALAQGLTFP
FT                   YDVDERILALQKYDLTQNITKINNRPLLLWHGKKDDVVPFAYSEKLYQTLVEESLADNV
FT                   QFIIDDNAKHKVSVEGMLQGVSFFEKFL"
FT   gene            286369..286677
FT                   /locus_tag="LMHCC_0282"
FT   CDS_pept        286369..286677
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0282"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38642"
FT                   /protein_id="ACK38642.1"
FT                   /translation="MDEQLKENLMGALEQVIDPELGIDIVNIGLVYDVELDDDGLCTVS
FT                   MTLTTMGCPLAGILTEQVQMALSDIPEVKDTNVNLVWNPPWTKDRMSRYAKIALGIR"
FT   gene            286757..287632
FT                   /locus_tag="LMHCC_0284"
FT   CDS_pept        286757..287632
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0284"
FT                   /product="acetyltransferase, gnat family"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38644"
FT                   /protein_id="ACK38644.1"
FT                   /translation="MNYEMISDYKNNKMYRDSFNRLAESTFDINFEEWYRDGFWNDKYI
FT                   CYSYIDDNKVIANVSINKMNLIYQGEDYRALQIGTVMTHPDYRGQGLAKKLLEHVIAKY
FT                   EDQYDFLYLFANDTVLDFYPKFGFERVEESSFTVDACSLKRESSNLKKLNPDNKTDFQL
FT                   IRRIVSEKTPLSNILDVRESEDLLMFYVLIALKNELYYIEELDVIVLMEQEDADLYVLD
FT                   ILSTKKLDVVEVLRYLPIKKIETIHLLFTPEKSKYIDAAHIIETEDMLFVRPNILTSEN
FT                   YFLFPATSHA"
FT   gene            complement(287623..287973)
FT                   /locus_tag="LMHCC_0283"
FT   CDS_pept        complement(287623..287973)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0283"
FT                   /product="PTS system, beta-glucoside-specific, IIA
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38643"
FT                   /protein_id="ACK38643.1"
FT                   /translation="MEIQVEEAVVKLILHGGNTRKEAYKAIDYAEKYQFDEADKHLQIA
FT                   QDQFREGHIWQTKLVSIRDSETVAHPSFLLIHGQDHLMTAQAELQLAKRIIEQYKHQQR
FT                   LEERLTKLENQA"
FT   gene            288124..288315
FT                   /locus_tag="LMHCC_0285"
FT   CDS_pept        288124..288315
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0285"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38645"
FT                   /protein_id="ACK38645.1"
FT                   /translation="MEERLYELEDKVQDLELEVHDLRDRIQLLEDKPAARSSLLGHNVW
FT                   ILIPLVAIISWMIVEIFS"
FT   gene            288818..289339
FT                   /locus_tag="LMHCC_0286"
FT   CDS_pept        288818..289339
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0286"
FT                   /product="intracellular protease 1 (Intracellular protease
FT                   I)"
FT                   /EC_number="3.2.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38646"
FT                   /protein_id="ACK38646.1"
FT                   /translation="MTLKGKKVIALVSEDFEDLELWYPVLRLREAGASVHLVAEEAKKV
FT                   YHGKYGVPVTSDYDFDSVRAEDYDGILVPGGWSPDKLRRFDSVLNLVRAFDKAKKPIGQ
FT                   ICHAGWVLVSAGILEGVNVTSTPGIKDDMTNAGAIWHNEPVVTDGHIISSRRPPDLPEY
FT                   LPAFISALED"
FT   gene            complement(289381..289647)
FT                   /locus_tag="LMHCC_0287"
FT   CDS_pept        complement(289381..289647)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0287"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38647"
FT                   /protein_id="ACK38647.1"
FT                   /translation="MFLKSLLAGVALAVVVFLASFLIPDYTVSTLYSIVTTIIVFASII
FT                   LSAFVSFGGRSGNPSRKSQLRWSILLLVAAIPSFIGFIVTFYF"
FT   gene            complement(289757..291049)
FT                   /locus_tag="LMHCC_0288"
FT   CDS_pept        complement(289757..291049)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0288"
FT                   /product="inner membrane protein YicO"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38648"
FT                   /protein_id="ACK38648.1"
FT                   /translation="MFQLKANGTDVKTEVISGFTTFLTMVYIVVVNPAILSAAGVPFNT
FT                   VFMATIISAVIGTLWMAIFANYPIAIAPGLGMNAYFVTVVTTQKLDYSVAFAAVFVAGI
FT                   IFLLLSLTPLREKIIEAIPHNLKAGITAGIGLFIAFLGFRMTGIIVSNDSNLVGLGDLH
FT                   SKEAILAIVGLLITLILLALNVKGALFIGMIATGIIAFITGELKFTDGIVKLPPMPEFV
FT                   FTNPLNAFGDVISYGLYAVVLSFLLITIFDTTGTMIGVAKKAGLMKGESLPNAKQALMA
FT                   DAVATSVGSMFGTTPTSAYIESSAGVATGGRTGLTTLTVAILFMVSAFFAPLVGAVSGI
FT                   SAITAPALIIVGSMMIGAVKEIDWDTLDEAFPAFLVILAMPLTSSIAIGLAFGFISYPV
FT                   LKVFTGKWRELNWFLIVIAALFFILVAFLPH"
FT   gene            291222..291851
FT                   /locus_tag="LMHCC_0289"
FT   CDS_pept        291222..291851
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0289"
FT                   /product="phosphoglycolate phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38649"
FT                   /protein_id="ACK38649.1"
FT                   /translation="MKAVVFDFDGTMLDTENLWYTETMNYLKETYDIDLPDEIYQQIIG
FT                   TSEEPIIRYMMEATNGAFDKEAFLTTVAEACHLGQQSLGFRDGFKEFFEQVKANDYKIG
FT                   LATSSGFDWIEPTLDRLGILADFETIQTADHVDEIKPHPALYLQAVEALGVKPEEAIAI
FT                   EDSKNGALSAMQAGLKVYIVPNEATKNITFPKEATVVSSFAEIKLK"
FT   gene            complement(291893..293044)
FT                   /locus_tag="LMHCC_0290"
FT   CDS_pept        complement(291893..293044)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0290"
FT                   /product="aspartate aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38650"
FT                   /protein_id="ACK38650.1"
FT                   /translation="MMNNSKIAKKHQQMPVNILADIGTLAKTMPDILDLSIGDPDLITD
FT                   ESIINAAFEDVRAGHTKYTESGGDVELIDAIRGYFIRNYDLSFERNQIRATVGALHGMY
FT                   LTLQTILDDGDEVIIHEPYFSPYKDQVLNSGGTPIIIPTYEKDDFAINVDILEAAITDK
FT                   TKALILNSPNNPTGAVFSPETFEKIANLAKKYDFFILSDEVYDGFSFYEDFVPMAKFAP
FT                   DHTITFGSMSKNFAMTGWRLGYMIAPTYLNEAAKIINEGITYSAPTPSQRAAIYALNHS
FT                   ETLIPLVTETFQKRLEYIAKRVEEIPYLSLHPLKGSIYAFINISKTNMDSVSFTEYVLK
FT                   ETQVLVIPGLAFGESGDNYVRLAATQDISVLEEAFNRLAKLTF"
FT   gene            complement(293117..293842)
FT                   /locus_tag="LMHCC_0291"
FT   CDS_pept        complement(293117..293842)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0291"
FT                   /product="glutamine transport ATP-binding protein GlnQ"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38651"
FT                   /protein_id="ACK38651.1"
FT                   /translation="MIDIKNLHKHFGKLEVLKGIDLEIASGEVVVVIGPSGSGKSTFLR
FT                   CLNLLEQPTTGTILFENKDLMAKQTNVNELRQKMGMVFQNFNLFPHKNVLENLMLAPMK
FT                   VKNEDSAAAKKHALSLLEKVGLADKATSYPSQLSGGQQQRVAIARALAMNPDVMLFDEP
FT                   TSALDPEMVGEVLSVMKSLAKEGMTMVVVTHEMGFAREVADRVVFMDAGVIQEQGTPEE
FT                   VFGNPQNDRTKDFLGKVLA"
FT   gene            complement(293835..295295)
FT                   /locus_tag="LMHCC_0292"
FT   CDS_pept        complement(293835..295295)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0292"
FT                   /product="amino acid ABC transporter, permease protein,
FT                   His/Glu/Gln/Arg/opine family"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38652"
FT                   /protein_id="ACK38652.1"
FT                   /translation="MQKHLLQKFAAILLVFIVVFSGFTTVFAADTEDQTLAKIQEKGVL
FT                   TVGLSADYPPYEFHQTIDGKDKVVGFDVSIAKKIAKNLNVKLEIKEMNFDSLLGSLKTG
FT                   KIDMIISGMSPTPERQKEVDFSDPYMFVQQRVVIRKTDKDKFTSVNDFSGVKVGAQKQT
FT                   TQEELAQNELVGSEVVSLQKVPDLILNLKSNKVDAVVLEGPVAEAYISQDKTLAMADIK
FT                   FANGSKETAIAMPKGSTALQEKVNASIKDIQDTGLLKKYQKEANKLMFQDGSFYEKYGN
FT                   YFITGTLITIALAAIGVLCGAILGSLLALMKLAKTRWLRWPAACYIEFVRGTPLLIQIF
FT                   IVFFGTQIIGMDVSAFVSGCIALSLNSAAYVAEIIRAGISAVNKGQMEAARSLGMTQGA
FT                   SMRYIILPQAVKNILPALGNEFVTVIKESSIVSVIGVTELMFMTGVVQGASFKPFIPLI
FT                   ITSLIYFVLTFSLSRLLGVAERRMRTSD"
FT   gene            complement(295487..296485)
FT                   /locus_tag="LMHCC_0293"
FT   CDS_pept        complement(295487..296485)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0293"
FT                   /product="phosphate transporter family protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38653"
FT                   /protein_id="ACK38653.1"
FT                   /translation="MEGMFLITLVIVLAALAFDLINGFHDTANAIATSVSTKALKPRHA
FT                   IILAAVMNFVGAISFTGVAKTITKDIVNPFDLDHGELVILAALLSAIAWNLITWYFGIP
FT                   SSSSHALIGSIAGAAIASAGFAAIEYSGFTKIIVGLLVSPVLAFVVGYTIYSLFKIFLK
FT                   NLNLATTNRRFRMIQVGTAALQSYTHGTNDAQKSMGIITMALIASGFQTTDDVQLWVQV
FT                   SCAIAMAIGTSIGGWKIIKTVGGKIMKIKPVNGVAADLSSVIIIFGATFIHLPVSTTHV
FT                   ISSSILGVGTAHRVKGVKWDTAQRMIITWVITLPISATIAALIFYVLRFIL"
FT   gene            complement(296499..297119)
FT                   /locus_tag="LMHCC_0294"
FT   CDS_pept        complement(296499..297119)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0294"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38654"
FT                   /protein_id="ACK38654.1"
FT                   /translation="MAFKNKKDRFASLLHDIAVNLHEGANFFATYNINSVEDLHTFSNK
FT                   IKEYETAGDSMVHKMIMELNDAFITPIEREDMLELTNRLDDVMDALDETAFSLEICQIT
FT                   HYDEYMTKFIQAIQASTVEIEKAVDLVFDKKLKDVRKLAIQIKDYESQCDDVYRESLIQ
FT                   LFQNEKDPIKLIRLREVYEKLEDIADSCQSVANTLESIVMKNA"
FT   gene            297506..298390
FT                   /locus_tag="LMHCC_0295"
FT   CDS_pept        297506..298390
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0295"
FT                   /product="2,5-diketo-d-gluconic acid reductase a
FT                   (2,5-dkgreductase a) (2,5-dkgr a) (25dkgr-a) (akr5c)"
FT                   /EC_number="1.1.1.274"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38655"
FT                   /protein_id="ACK38655.1"
FT                   /translation="MTKTLQDRMILPGNETIPYIGLGVFQVTEQEFIAGAVEKAIEVGY
FT                   RLFDTAAVYNNEAIVGQAIADSAVSREELFISSKVWNGDLGYDETLFAFERTLQNLKLD
FT                   YLDLYLIHWPVAGKYRDSWRAMERLHDEKLIKSIGVANFKQHHLSDLLVAANEKPVLNQ
FT                   VETHPLLPQNDLRKYLAEQNIAHAAWSPLAKGILMQNPVITEIAKKHQASVDQVILQWH
FT                   LNRNTIIFPKSITSSRIEENSRLSYFQLDASDMEKIDRLETGKRVGPDPDDLEYFLSSI
FT                   ERERAYLTGGTAE"
FT   gene            298387..299043
FT                   /locus_tag="LMHCC_0296"
FT   CDS_pept        298387..299043
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0296"
FT                   /product="methylpurine-DNA glycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38656"
FT                   /protein_id="ACK38656.1"
FT                   /translation="MTDIQTLFRAHRSLTDAPPMEAYMKNQFTFLGIRAGERKKLVAEY
FT                   LKENGAPQDLLGFTIALFAEEEREFQYVAIDLLSRYGKKQPSEAIKVYEQLIVTKSWWD
FT                   TVDGLAGTVVSNHFKLYPELIPTYNEAWINGDNIWLARTAILFQLKYKEKTDVDLLFSN
FT                   CEKWLDSKEFFIQKAIGWALRQYAKVDSGAVRQFVNSHSLAPLSRREALKHIGEA"
FT   gene            299045..299437
FT                   /locus_tag="LMHCC_0297"
FT   CDS_pept        299045..299437
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0297"
FT                   /product="glyoxalase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38657"
FT                   /protein_id="ACK38657.1"
FT                   /translation="MLHHVEIYVADLEESRMFWSELLEELSYELYQTWNEGFSYKFADT
FT                   YLVFVQTEEPFIAEGYHRKRIGLNHLAFHGGTKERVDDFRAKLKAKGTKLLYEERYPFA
FT                   GGENHYAVFFEDPNGIKVEICTEVTT"
FT   gene            complement(299450..300319)
FT                   /locus_tag="LMHCC_0298"
FT   CDS_pept        complement(299450..300319)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0298"
FT                   /product="ribosomal large subunit pseudouridine synthase,
FT                   RluD subfamily"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38658"
FT                   /protein_id="ACK38658.1"
FT                   /translation="MTHVTLPILEDWEGLSLTTILQEKFHLGKKARHEIRMSQNVLLNN
FT                   KPLDDWNTPLFVGASLSLPVFLHDKIPTYEYDLEIIYEDDFLLVVNKPVDMKTHANDSY
FT                   ETDTCANAVQYYLEKTGQDANALAVHRLDQTTSGLVLFAKNKLAIAGLSWQMENRAIHR
FT                   TYLAAVDGTWGLVMQTINKPIGEDRHHGSRRQISPYGQPAVTHVKVLENDNEKNTSLVE
FT                   CQIETGRTHQIRVHLSGIGHPIIGDTLYGGSPRANRIMLHAEKLHLNHPFKGKEMNFSA
FT                   PAGDDWVF"
FT   gene            complement(300341..300901)
FT                   /locus_tag="LMHCC_0299"
FT   CDS_pept        complement(300341..300901)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0299"
FT                   /product="methylphosphotriester-DNA alkyltransferase"
FT                   /EC_number="2.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38659"
FT                   /protein_id="ACK38659.1"
FT                   /translation="MSDYYLTKKRWQAISTNDKTADGTFFYGVTSTKIFCYPSCKSRLP
FT                   KKENILIFHSAEEAFSHGYRACKRCKSGGTALPDTEWVTNIEMYIKENFAKPLTLQIIA
FT                   DDCHGSPYHLHRTFKRITMITPITYLENIRINYAKKQLTSSNQSIEIIGKMSGFPNPSH
FT                   FSTTFKRHTGLSPNQFRKTIKKN"
FT   gene            301047..301529
FT                   /locus_tag="LMHCC_0300"
FT   CDS_pept        301047..301529
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0300"
FT                   /product="methylated-DNA--protein-cysteine
FT                   methyltransferase (O-6-methylguanine-DNA alkyltransferase)"
FT                   /EC_number="2.1.1.63"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38660"
FT                   /protein_id="ACK38660.1"
FT                   /translation="MVDLYYDTLHFSDTVLYFAATENGLVYIGTQAEKIQSAKQNVEKM
FT                   HIYKEELLAYLNGELTDFTVPLHLTATPLQMEVFQALTTIPYGETRTYTEIAAQINRPK
FT                   AVRAVGTAIGRNPLLFVIPCHRVIGKNGKLTGYSGGIRMKESLLKLEKLNLNQLSF"
FT   gene            301621..302016
FT                   /locus_tag="LMHCC_0301"
FT   CDS_pept        301621..302016
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0301"
FT                   /product="transcriptional regulator, GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38661"
FT                   /protein_id="ACK38661.1"
FT                   /translation="MFTINTKSQLPIYEQIVQKIKEQVVKGILQEGEKILSIREFASRI
FT                   GVNPNTVSKAYQELERQEVIVTVKGKGTFIANQEDKVSSPKKLAETKIKLKETILDLVY
FT                   LGINVEEIHKLSDEYSQDIIGGDMVEG"
FT   gene            302006..302878
FT                   /locus_tag="LMHCC_0302"
FT   CDS_pept        302006..302878
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0302"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38662"
FT                   /protein_id="ACK38662.1"
FT                   /translation="MKVDSLSKKIDGKLLLDKITFEVKPGEIIGIVGRNGVGKTTLFRT
FT                   IMGFYIPDEGDVYLDEPLSKKPQLKQKLFMLQDNLHCWDGYKIPTIKKFYQKTYPLFDG
FT                   AKFDSLMNQVNLAADVKFQNYSKGMKGLFGLVLALSVGADYILLDEPMEGLDVIAQKKI
FT                   MGILLEEVEKRKLGMIISSHRLDDLDPIADYIHILQDNHIEESYHLESLREQAIKIQIA
FT                   FENKKVPPLLLENGKVINKYGRVYTILFRDMNPELYAAIKKEKPIFMDELAVTLEDLFI
FT                   YHLEERGGE"
FT   gene            302881..303945
FT                   /locus_tag="LMHCC_0303"
FT   CDS_pept        302881..303945
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0303"
FT                   /product="membrane protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38663"
FT                   /protein_id="ACK38663.1"
FT                   /translation="MSTGLLWKEWRQNAWVFLFILFAFIGSEATTATNTVSMFNENYKY
FT                   YQSEEFQKTNNTDQKMTGNEIKNDLSLTPYDFEGNLALFFYVFLFLGLKLTVFEKNKQM
FT                   DYFTFGLPYSKKQIFWHKMLIPLLLIFIIVPLIIFCRFWYIYQQIPELYLPSVDDSFIY
FT                   ISSFSLLFLFSFTLAIAVGNLVGEIITAGIIAIGSVVSFLYMFPGAITNLIVGFKAFFA
FT                   GKTLSDMDGGAVMLFNALPTPILSGTTMLWEFVVLIMLSIVMLIIGWYAMKTASLENNG
FT                   RFLMNNKFRLPILIIGSLYVTICLSGHYASFNYEKIITTGQVVFLTIKMILILAVSATI
FT                   FWILMYKWKTLRKH"
FT   gene            complement(303985..305175)
FT                   /locus_tag="LMHCC_0304"
FT   CDS_pept        complement(303985..305175)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0304"
FT                   /product="major facilitator family transporter"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38664"
FT                   /protein_id="ACK38664.1"
FT                   /translation="MKNKYLSTSLGLYMNYFVHGMALIIIAQNIDFLSQKWHTDLAGAA
FT                   GVVSSFGIGKLLAVFISGRLSDKFGRKLSVILGVFFYIIFLGGILLSPNTIIAYMFGIS
FT                   AGIANSFLDTGTYPALMEAYPKKAASANIIVKAFVQSGQFLLPFMIAFILANNLWYGWS
FT                   FIVLIVILLINLLYTLTRTFPPMTVGKPLDVAELAEEKKQKFHFSIDEICLILFGFVAQ
FT                   TLLYIMSQWIAKYGSEVIHMTDDASRLLVSYASVGAIICVCVTFVLGNRGVRTLHILIT
FT                   YVTMTMLISFTLFAFPSEIVCIVGAFLLGYFSAGGIIQLGLTLLAEVSARGKGFVTSLY
FT                   TIAEGIAVFVIPLIAAAISRIDIAAIFLLNAGIALFGLALLMIVFTRKKKFARDHI"
FT   gene            complement(305335..306543)
FT                   /locus_tag="LMHCC_0305"
FT   CDS_pept        complement(305335..306543)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0305"
FT                   /product="transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38665"
FT                   /protein_id="ACK38665.1"
FT                   /translation="MNAKRFYPTAIALYFTYFIHGIGVSILGQYKQDFAGVWGADKLSD
FT                   GTFDVSMVIAVIAALGLGRLLTLPISGPFSDKFGRKPSALIGVGLYAVYFIGLAFAPNM
FT                   YIAYAFAFVGGAANSFLDTAVTPSVLEIFTKNGAIANMFTKFSISIGQFVLPFAIGMVA
FT                   AANMSFRTLFVITMVLIVIDGLIIAFMPFPPMNNNVGGEKAKPEKMKFNATSWAIIGIG
FT                   FTCTSTFQLWLNCNQELGKLYGMADPSKIQSFYSLGTMCAILITAVLVKKFILPVRILI
FT                   LYPAIATLMLLIIYIVQTPTICLIGGFVIGYAAAGGVLQLAVSTANEFFPTNKGKITSI
FT                   VMISSSLANYIVLNVASYITKAGGIEGPKYVLLFNVAITVIGILLAIFVNMRYKNESKI
FT                   ATK"
FT   gene            complement(306576..307445)
FT                   /locus_tag="LMHCC_0306"
FT   CDS_pept        complement(306576..307445)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0306"
FT                   /product="shikimate dehydrogenase"
FT                   /EC_number="1.1.1.25"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38666"
FT                   /protein_id="ACK38666.1"
FT                   /translation="MENRISGTTRLLGLIGTPIDHSKSPIMYNYSFQKAGLDYAYLAFD
FT                   TPIQKVADTIKAIRTFNLRGANVTMPCKSEVLKHMDDLSPAARMIGAVNTIVNEDGKLT
FT                   GHITDGLGFIANLRDASVDVTGKKMTIIGAGGAATAIQVQCALDGAKEITIFNIKDAFY
FT                   DKAKQTVASIKQEVPHCIVHIYDLNDTEKLNAEIATSDILVNATLVGMHPNEHETPISN
FT                   TSVFRKELIVTDIIYNPKKTQLLLDAEAAGCKTVGGLGMLLWQGAEAYKLFTGKDMPVS
FT                   EVRDLYFN"
FT   gene            complement(307504..309429)
FT                   /locus_tag="LMHCC_0307"
FT   CDS_pept        complement(307504..309429)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0307"
FT                   /product="NADH:flavin oxidoreductase, old yellow enzyme
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38667"
FT                   /protein_id="ACK38667.1"
FT                   /translation="MKFNSMFSPIDIGPMKVPNRFVVSPMCNNYANTDGTLSDTSLAYY
FT                   KERALGGFGLITFEATVVDVRAKGGANKACLYSDHQIASFKRVIDVCHDAGAKISVQLQ
FT                   HAGPEGNSKVSGFPLKAASAIASAAGRNTPEAISREELYELIELYGEAALRAKKAGADA
FT                   VEVHCAHGYLVSSFLSARTNKRVDEFGGCFENRMRLPRLIIESIRKRVGHSIAILCRIN
FT                   STDGVEGGLSVQDSATVAAYLEDCGLDGLHVSRSVHIRDEYMWAPTVLHAGFSSDLVTQ
FT                   IKRAVSIPVITVGRFTEPHYAELMVREGRADLVAFGRQSLADPETPNKAAAGKLDELLP
FT                   CIACLQGCVANMYAGKPITCLVNPLLGRESEAYLPKTPSKKVVVVGGGVGGLYAGWMAG
FT                   SRGHDVTVYEASDMIGGQMRLAAYPPGKGDLTNMVRSYIKKCEQFDVEIKTNTPVTLEL
FT                   IQEVAPDAVIIATGATPLVLPIPGIEDAGLIHAVDLLDGKEKCGQKVLVVGGGMVGSET
FT                   AAFLGEAGHDVTVVELRDEVGADVISEHRKFLMRDFDEYKIKSVTNAKVTSFFEDGVTY
FT                   SLADNKEQRVDGFDSVVLAMGSRAYNPLEEAIKTIVPETYVIGDAVRARRALDATKEAL
FT                   DAVLQL"
FT   gene            complement(309498..310352)
FT                   /locus_tag="LMHCC_0308"
FT   CDS_pept        complement(309498..310352)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0308"
FT                   /product="sugar phosphate isomerase/epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38668"
FT                   /protein_id="ACK38668.1"
FT                   /translation="MTNANGNLKKCPITISSYTLGTEVSFPKRVKVAAENGFDGIGLRA
FT                   ENYVDALAAGLTDEDMLRILDEHNMKVTEVEYITQWGTAEDRTAEQQKKEQTTFHMARL
FT                   FGVKHINCGLLEKIPEEQIIVALGELCDRAEELIIGLEFMPYSGVADLQAAWRVAEACG
FT                   RDNAQLICDTWHWARANQTAESIKNVPADRIVSIQLCDVHETPYKELREESLHDRLAPG
FT                   EGYGDTVGFAKILKEHGVNPRVMGVEVISDSMVETGLEYAAIKVYNATKKVLDEAWPEI
FT                   SPR"
FT   gene            310652..311530
FT                   /locus_tag="LMHCC_0309"
FT   CDS_pept        310652..311530
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0309"
FT                   /product="transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38669"
FT                   /protein_id="ACK38669.1"
FT                   /translation="MNLHHLRYFVTLAHMEHYTKTAEKLLITQPSLSHAISSLEQELGI
FT                   PLFEKEGRNIGLSKAGKVFLDYVEESLDMIDAGVATTKKAANGEGQIDLAFLQTLGTSL
FT                   IPKLVQEFLQTEPEKQIDFIFHTGVSIDIIQGLKEKKFDIGICSKLENERNIHFTPIAK
FT                   QELVLIVPKSHPLAEKDWIDLIETVDYPHIAFSKKSGLRPIIDELFRKIGADYQIAYEI
FT                   EVDQVIAGMVAQNFGIAVVPNMPILNYVDVKVLPIRSPNWERFFYLAVAKNQTLTPAAE
FT                   KFKQFMLAHRI"
FT   gene            complement(311571..312875)
FT                   /locus_tag="LMHCC_0310"
FT   CDS_pept        complement(311571..312875)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0310"
FT                   /product="CBS domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38670"
FT                   /protein_id="ACK38670.1"
FT                   /translation="MILTIKFLIIALLIAISAFFVATEFAIVKMRPSRLDQLIAEKDKR
FT                   AVLARHIYNHLNAYLSACQLGITISSLGLGWLGESTVEAALHPLFSLMELPQSAITILS
FT                   FTIAFLFITFLHVVVGELVPKTLAIDKTEAVALAVARPLHIFYKVMFPFIWILNGSAVF
FT                   IARLFGLEPASEHEIAHTEDELKIIVGESYKSGEINQSEFRYVNKIFDFDERMAKEVMI
FT                   PRTEIVTVDTGSTIGELSDIMQNERYTRYPVIDGDKDHVIGVLNLKEILSAYVEHGSNP
FT                   SFSIDPYVKPIIRVIETIPIKELLFRMQRERSHIAILLDEYGGTSGLVTVEDIVEEIVG
FT                   DIRDEFDADEIPEIRKIKDGHFIVDAKLLIDEVNNILGTEIEEEEVDTIGGWFLTQNYE
FT                   VEVGDEIDYDGFIFRVKQGEPHHIEYIEIIKKTND"
FT   gene            complement(313131..314000)
FT                   /locus_tag="LMHCC_0311"
FT   CDS_pept        complement(313131..314000)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0311"
FT                   /product="cation efflux family protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38671"
FT                   /protein_id="ACK38671.1"
FT                   /translation="MDGYNDLKKAEKAAFLSIFAYLFLAVLKIVAGQLGNSDALLADGL
FT                   NNTTDIVASVALLIGLRISRIPPDADHSYGHRRTETISSLIASIIMFLVGVQVIWSSIV
FT                   HIIEKEFATPSMLTAVVALFSGVFMYAIYLYNHRLAKKLDSQAVRAAAYDNRSDAFVSF
FT                   GAFIGIIGVVLGVPWLDSVTAFLVGILIVYTAIKIFYDAAHTLTDGFDVSKLETIHDLI
FT                   ASVPDVKKVIDIKARMNGNRIWIDATIAVDPELNVVKSHEITEIVEQKIRNEYEGAFTL
FT                   VHIEPFFE"
FT   gene            complement(314065..314490)
FT                   /locus_tag="LMHCC_0312"
FT   CDS_pept        complement(314065..314490)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0312"
FT                   /product="arsenate reductase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38672"
FT                   /protein_id="ACK38672.1"
FT                   /translation="MTQKLIYFLSQTHIRSAIAEAWAKRLSLSNVKFISGSWHKSKSTP
FT                   FIAEALNEFAIEPPESLSYSPSSELLADADLIVTIYDSAHETAPKFPANIQEKIIYWDI
FT                   DDPEQEIALPKKWASYQEVCDNIALSVKNLEHVLIEA"
FT   gene            314812..316956
FT                   /locus_tag="LMHCC_0313"
FT   CDS_pept        314812..316956
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0313"
FT                   /product="penicillin-binding protein 1F (PBP-1F)"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38673"
FT                   /protein_id="ACK38673.1"
FT                   /translation="MDKFKQQLIKYLKLFFGFIGKWISKGWQKFRRFWKNKHIGKIFLL
FT                   AGLVFLLSFIIYLVIVAKSADIDALKKGLESATIIYDKDGDKAGELSSTDATFVSIDKI
FT                   SKNLQNAVVSIEDRKFYEHKGFDLKGIARAGVNLVTSGGISGGGSTITQQLAKNALLTQ
FT                   EQTFTRKAKEIFMAREIEKTYSKDEILEMYLNRSYFGNGEWGVENASLKYFGKSAADLN
FT                   IPEAATIAGLLQAPSAYDPYNHIDKATNRRNMVLNAMVETGTITKAEGDKYKATKIVLN
FT                   DQSKDPLANKYPWYVDAVINEAVNEADITQDEIMQKGYKIYTELDQNYQTSLEKVYNND
FT                   ALFPSNANDGTLVQSGAVLMDPATGGIRALVGGRGEHVFRGFNRATQMKAQPGSTMKPL
FT                   AVYTPALQSGYDVDSMLKDEKTTYKGNYTPTNVGGVYSGEVPMYKAVANSINAPAVWLL
FT                   DQIGIDKGVKSVEKFGITVPEKDRTLGLALGGMSKGASPVEMATAYATFANNGAKPESH
FT                   IITKIVDPSGNTVYENVPKTKQIISETVSNEMTSMLLDVINTGTGQSAAVSGHEMAGKT
FT                   GSTQVPFDDTSGTKDQWFVGYTPNLVGAVWMGFDKTDREHYLTTTSSAGVSSLAHYVMN
FT                   SGLQYQKSADFSTKSAAQETAAKKEEEEKEKNSGSDFWSGVKEKADEAGESIKKGADKV
FT                   KEFGGKVSDGIGNLIDSIGN"
FT   gene            317065..317262
FT                   /locus_tag="LMHCC_0314"
FT   CDS_pept        317065..317262
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0314"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38674"
FT                   /protein_id="ACK38674.1"
FT                   /translation="MDKTQIALIIPVILLYLALLLTAIIDLTKNWNERKNPVIWLVVII
FT                   VINIFGPIAYFIFGRKEEGS"
FT   gene            317262..318167
FT                   /locus_tag="LMHCC_0315"
FT   CDS_pept        317262..318167
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0315"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38675"
FT                   /protein_id="ACK38675.1"
FT                   /translation="MKNLEIQGLKKKYNGKWVIKGIDLTINEKECVALIGPNGAGKSTM
FT                   INMIVQILTQDEGQITLDGQNAKSVREKIGFLPQYPEFYGWMSATECLHFMGKLSNMEK
FT                   TDLKTRIKEVLLLVGLEESANKKISTYSGGMRQRLGIAQAILHRPELLVLDEPVSALDP
FT                   IGRREMMLLLDKLKKEITILFSTHILKDAEEICDRIAIIKNGELVTDKTVAQLMEEESS
FT                   PVFDVEFSGDSEAWQTLLLQNEHVEKIEKVGMVYQVYTTNQKAGSEAILKSLLQIDGEF
FT                   IRVENRHQSLEEIFMEKVGK"
FT   gene            318164..318958
FT                   /locus_tag="LMHCC_0316"
FT   CDS_pept        318164..318958
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0316"
FT                   /product="membrane protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38676"
FT                   /protein_id="ACK38676.1"
FT                   /translation="MTHFNALLAREWLEQRRSLKIIWLPIVFALLGLTQPLMMYFLPEI
FT                   LKAVGTGSETEQVVALMGNQSAQEVMAQTLGSQFDQIGIIIIIVVAMACIQNDRTRGML
FT                   AFIMTRPVSAAEYVLSKWVMQCVVGLSSLLIGYVLAVYYTYFLFGELAINSLTQGFFVY
FT                   AVWFIFVISLVVFASAVFDSNAVVAMISVFIAIVLGIISGFGGWIQMFNPAYLSKNATM
FT                   LIMSDKTMDYFIPTLCITILWIALLVSLTILMIKIKPLPKTE"
FT   gene            319028..320395
FT                   /gene="fumC"
FT                   /locus_tag="LMHCC_0317"
FT   CDS_pept        319028..320395
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fumC"
FT                   /locus_tag="LMHCC_0317"
FT                   /product="fumarate hydratase, class II"
FT                   /EC_number="4.2.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38677"
FT                   /protein_id="ACK38677.1"
FT                   /translation="MERIERDTLGEISVDATKYWGAQTERSKRNFAIGDNPMPIEIIYA
FT                   FAQLKKATAKVNAAEGKLSEEKAIAIGQVCDQIIQGELDEHFPLVVWQTGSGTQSNMNV
FT                   NEVIAHVANLTLSEGQIHPNDDVNMSQSSNDTFPTAMHIAAYGALVTKLLPEITKMEAV
FT                   LTEKKNKYMHLVKIGRTHLQDATPLTLGQEISGWEACLTNNKNYLETSMKAILPLAIGG
FT                   TAVGTGLNASRDFGDKVAEELMKQTGYPFTSDSNKYFALTSHSPINFVHGAIRSLASDL
FT                   MKIANDIRLLASGPRSGIGELTIPANEPGSSIMPGKINPTQCEAMTMVAAQVMGNDTTI
FT                   NVAASQGNFELNVYKPVIIFNFLESVKLLSDSMRSFRVHCLEGLTANEKVIETKVNDSL
FT                   MLVTALNPHIGYEKAAKIAKLAFEENTTLKEAAIKTGFVTEKQFDLWIDPLKMTNL"
FT   gene            320499..321632
FT                   /locus_tag="LMHCC_0318"
FT   CDS_pept        320499..321632
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0318"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38678"
FT                   /db_xref="GOA:B8DF86"
FT                   /db_xref="InterPro:IPR007383"
FT                   /db_xref="InterPro:IPR016991"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8DF86"
FT                   /protein_id="ACK38678.1"
FT                   /translation="MSVLFTILLMAVIGGFIGAMTNYIAIRMLFRPYKAIYLFNKRLPF
FT                   TPGLIPKRRDELAEHIGKVVVSHLLTEDAIRARLLDENLQKEITDTITKMFHEKMQLET
FT                   TPNELLHHFGYENAEIRSMAWIEKTMEKEINHFLSTKKTTKMSDLIPTMLESELTTKLP
FT                   HVTERITSKMALFVASEEGKSQIKQMLQKFFEEHGKMGSMARMFINVDSFSEKIQQEGL
FT                   KLIDQEDTKNLINQLLTTEWKNFEAKELQELIPTEKQVHLAGQLTSELIQTFPHEKLFN
FT                   QPIQVILRNYETTIVEKVIPFAVERMLDFVATHSAEIVERMDLAKLVETQIATFSLPEI
FT                   EKLVVEISGRELKMITYLGGILGGFIGVIQGILAMWI"
FT   gene            321714..322067
FT                   /locus_tag="LMHCC_0319"
FT   CDS_pept        321714..322067
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0319"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38679"
FT                   /db_xref="InterPro:IPR010368"
FT                   /db_xref="InterPro:IPR023378"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8DF87"
FT                   /protein_id="ACK38679.1"
FT                   /translation="MAVNIYDLAHDLDKGIRETPEFISLQDAYREVNENADAKAKFERF
FT                   RDVQVTIQEKQMTGQEIDDETVDVAQKVAQEVQENELIVKLMEKEQAMSTIINDLNRII
FT                   MTPLQDLYNVAND"
FT   gene            322211..323446
FT                   /locus_tag="LMHCC_0320"
FT   CDS_pept        322211..323446
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0320"
FT                   /product="Ser/Thr protein phosphatase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38680"
FT                   /protein_id="ACK38680.1"
FT                   /translation="MKEIQFLHMADLHLDSPFIGLSTLPQPLFSAIQESTFQSLERITT
FT                   VAIKEAVDFVLIAGDIYDSEDQSVRAQARFAKEMKRLEAANIPVFMIHGNHDFIEKHKE
FT                   KLALPSNVHVFSEQVEIMSHKTVTGVSVNIYGFSYNERHIRSSRVGEYKIQGDADFHIA
FT                   LLHGSEVSSSEEHDVYAPFRVQEISRKGFDYWALGHIHKRQLLAESPSIYYPGNIQGRN
FT                   RKESGEKGASIITLSEASTTIDFIGTSPIIWEEAVITLPENSEINAFYRETTKLLESYQ
FT                   GRSHSYFLHIIVKMESKQKIDTNDWLQMLQEEVEITDNTFVWVHKLTTEITNQSNSQTW
FT                   YESHLAGDEIKHSFETLQDESAFYQAVEALYLESGVSRYLDDLSEIDRERLLHDALMEL
FT                   GRTLAEVEGDDK"
FT   gene            323443..326166
FT                   /locus_tag="LMHCC_0321"
FT   CDS_pept        323443..326166
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0321"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38681"
FT                   /protein_id="ACK38681.1"
FT                   /translation="MRITSIDIIGYGKWSDAHFNNIANFQVFYGENEAGKSTIMAFIHS
FT                   ILFGFPTKQQSIPRMEPKNGGPYGGRLTLEDTPLGKVIIERLKGKATGDVRIYYGDGQT
FT                   AGEEKLPEIIGEIDRNTYEAIFSFDIHGLQNIHQWKKKEFERYLLATGTTGSDALLKAA
FT                   EALQKKLDSLYKPSGRNPLINQQLKKVKEAQQAFQNAKKQNAQYEELINEKEQAIVRQT
FT                   ELQKEKTTMRVELDALATLADLWPLYQEWKALSNKASETTEATFPPDGVIRLEHLHLRE
FT                   KEWQNQLIQLEERQKNLINNNNYEHSAFFAENEAEVTYLIETYAAFGEREIQLKNLKQE
FT                   IKFQQVDTKQPLRIWSSELEQTMIHLKEKEQSHKEQQHDIQLKLKFTNDSEEKLQKKID
FT                   QIEAEMWDNKTFQQAKEKMQDSPKTSKTKTMVSLGIFAVAFVLMIVFQAIWSVALVFVS
FT                   ALIVGYAFITTGKSSPTNNEQILAFLEQKKIRQEWQQLLNEMDMVASQIAELRAAENKL
FT                   SENIYQHTMELRHFFSDLGINTEPSSNWHYELSIYKKNSEKRQLAMELISKLEPLAEKQ
FT                   EAYRARLENLKLPIDYTDTEEKITFLRQGLLYYRNHLTENAKLAEKLEQVTMQLDLVKQ
FT                   DLLLVKKEKADLLERANVSNEEDFRMAAMRVKEEQKWRERLVLIEAQLEPEKREALNRY
FT                   ENQATIKEKELQLEESLRQIELEQEQLHASLAAQNHAIDKLEEGGTFAVLMQEFYSEKS
FT                   KLQQISAEWTETKLALQMLQNTMQQLQEGKLPKTLKLASEYFNHLTSGNYRKVYLQDNR
FT                   LQVESKGSIPFFPEELSQATKEQLYLAIRFALIDVIHKDFPLPIIIDDGFVHFDSSRMG
FT                   QMMQLLQKRKSENQVIFFTCHQETRKYFSSEDIRVL"
FT   gene            326166..327152
FT                   /locus_tag="LMHCC_0322"
FT   CDS_pept        326166..327152
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0322"
FT                   /product="3-5 exoribonuclease YhaM"
FT                   /EC_number="3.1.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38682"
FT                   /protein_id="ACK38682.1"
FT                   /translation="MGEETSYYRKKEGDTMEKRLLDFEVGETVDLFLLIKSSVKGTASN
FT                   GKPFLSLVLQDKSGELEAKLWDVKESDEANYGVQQIVHLMGDIQNYRGRKQLKIRQIRQ
FT                   ATALDGVSASEFMETAPINKEEMADEITQYIFEMKNANLQRITRALLKKYQDDFYDYPA
FT                   AMRHHHEFVSGLSFHVVSMLRLAKSVADLYPSVNRDLLYAGVILHDLGKVIELSGPVST
FT                   TYTLEGNLIGHISIVVEEVSKIADELSIDGEEVVVLKHVLLSHHGKGEWGSPKPPLVRE
FT                   AEILHQIDLMDASLNMMDKVLKHTKPGEFSERVFGLDNRSFYNPTFE"
FT   gene            complement(327198..328079)
FT                   /locus_tag="LMHCC_0323"
FT   CDS_pept        complement(327198..328079)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0323"
FT                   /product="foldase protein PrsA"
FT                   /EC_number="5.2.1.8"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38683"
FT                   /protein_id="ACK38683.1"
FT                   /translation="MKKKLILGLVMVMALFSLAACGGGGDVVKTDSGDVTKDELYDAMK
FT                   DKYGSEFVQQLTFEKILGDKYKVSDEDVDKKFNEYKSQYGDQFSAVLAQSGLTEKSFKS
FT                   QLKYNLLVQKATEANTDTSDKVLKKYYETWQPDITVSHILVADENKAKEVEQKLKDGAK
FT                   FADLAKEYSTDTATKENGGQLAPFGPGKMDPAFEKAAYALKNKGDISAPVKTQYGYHII
FT                   QMDKPATKTTFEKDKKAVKASYLESQLTTENMQKTLKKEYKDANVKVEDKDLKDAFKDF
FT                   DGSSSSDKESSK"
FT   gene            complement(328196..328735)
FT                   /locus_tag="LMHCC_0324"
FT   CDS_pept        complement(328196..328735)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0324"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38684"
FT                   /protein_id="ACK38684.1"
FT                   /translation="MRCLKSINTERRDEFNRLFLKGILVWLAAVCICFLTQHLIYPGQL
FT                   TNDYQLASFLGIILIYPIHKLLHILGCFKYREGTVIQWRIHFFFLPCIKLNIKRIIPKW
FT                   HYIFSLVLPFVIITAILVALMLFTPIGHSGMFLILLSVHFGMSFSDFTHIKKLWKMPKN
FT                   CFIESAERGFSILISD"
FT   gene            complement(328918..329280)
FT                   /locus_tag="LMHCC_0325"
FT   CDS_pept        complement(328918..329280)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0325"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38685"
FT                   /protein_id="ACK38685.1"
FT                   /translation="MNKKSLIFGILAGGAIGAAASVLFAPKSGNELRKDIVAKSGEASV
FT                   ILKELAYNANELIQSVQVLGTEGSTLLKDVSSDIMESVSKWNEEMEPEKKRLKDEIKDM
FT                   QKTISDLEKTLKKDNK"
FT   gene            complement(329310..329732)
FT                   /locus_tag="LMHCC_0326"
FT   CDS_pept        complement(329310..329732)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0326"
FT                   /product="HIT family protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38686"
FT                   /protein_id="ACK38686.1"
FT                   /translation="MDDCIFCKIVRGEIPSAKVYEDDKVYAFLDLGQVTEGHTLVIPKK
FT                   HARNTFDLPDETAAELFRRVPKIARALKEALPIQGLNILNNNEEVAFQSVFHCHIHLIP
FT                   RYSKSDDFGLKWKDNADWYTQERYQEIAELIAAKVD"
FT   gene            329893..330645
FT                   /locus_tag="LMHCC_0327"
FT   CDS_pept        329893..330645
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0327"
FT                   /product="ABC-type transporter ATP-binding protein EcsA"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38687"
FT                   /protein_id="ACK38687.1"
FT                   /translation="MALVEVEHLTGGYTKRPVLKDISFAIEEKQIVGLIGLNGAGKSTT
FT                   IKHITGLMHPKQGTIKINNHQLVEDTETYRKQFSYIPETPVLYEELTLKEHLELTGMAY
FT                   GISEEELHARMTPLLKEFRLEKKLNWFPAHFSKGMKQKVMIMSAFLIEPKLYIIDEPFV
FT                   GLDPLGIQSLLNWMDEMRGKGASILMSTHILATAEKYCDTFIIIHQGEIRAEGTLKDLQ
FT                   TNFEMPGASLDEIYIQLTKEEEADEDDI"
FT   gene            330635..331852
FT                   /locus_tag="LMHCC_0328"
FT   CDS_pept        330635..331852
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0328"
FT                   /product="ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38688"
FT                   /protein_id="ACK38688.1"
FT                   /translation="MIFDSKALWKERFSAYTTEVMRYLRYMFNDHLLFVLVIGLGAGIF
FT                   YYAGWVKTLEPTFPVIPLMVILLTASIAISPVATLLKKPDIVYLIVQEKAMDTYFSQAK
FT                   IASFFMQLYVFVIVLGVCMPMYVEVTEVPYSQFFTLFIVLSMLKAWNIYFGWESMKLEE
FT                   ADTTWMFIRVILNAILIYIALVAAPYISIPLVLVVLLASYYWLRTKTAKVTLRWEYLVD
FT                   KEEARMNRFYRLVNLFTDVPHLRGTVRRRSYLDFLYQPIPYAKRKTFAYLFSRTFIRTN
FT                   EYAGLYIRLTVIAVILLVFVQGFYLNIIFSLLFLYLTGFQFIPMLKHYDAQIMLRLYPI
FT                   NDSYRHRSFIHFLRILLLAQALLFSVIGIAQNGTIGGMIILGINLAFVVIFTFLYAPVR
FT                   MKKMYE"
FT   gene            complement(331893..332396)
FT                   /locus_tag="LMHCC_0329"
FT   CDS_pept        complement(331893..332396)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0329"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38689"
FT                   /protein_id="ACK38689.1"
FT                   /translation="MKKVFITTGTEHYLRQLMSNYTGANVTLLQNFSQSLLYQESTGEK
FT                   IFQEGAEYRVLQSSGSLKGFGVVVFEYIHLRDEEIPIFLQMYQRASLHFSETPGLQSTK
FT                   LTKAMNMNKFLIISFWDSEVFFQEWKKTPLHKEITNIMKKNNSQASFSHEDIYHYPEFS
FT                   HDAK"
FT   gene            332593..333645
FT                   /gene="hemE"
FT                   /locus_tag="LMHCC_0330"
FT   CDS_pept        332593..333645
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemE"
FT                   /locus_tag="LMHCC_0330"
FT                   /product="uroporphyrinogen decarboxylase"
FT                   /EC_number="4.1.1.37"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38690"
FT                   /db_xref="GOA:B8DF98"
FT                   /db_xref="InterPro:IPR000257"
FT                   /db_xref="InterPro:IPR006361"
FT                   /db_xref="InterPro:IPR038071"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8DF98"
FT                   /protein_id="ACK38690.1"
FT                   /translation="MTKITNDLFLKAARKEQVDRIPVWYMRQAGRSQPEYRKLKEKYSL
FT                   FEITHQPEICAYVTKLPVDQYGVDAAILYKDIMTPLPGMGVDVEIKSGIGPVIHNPIRT
FT                   FQDVEKLAIFKPEIEVPYVLDTIKLLADDMLDVPLIGFAGAPFTLASYMIEGGPSKNYH
FT                   QTKSFMYREPEVWAILMEKLGRMTANYLIAQINAGASAVQLFDSWVGALSRADYAKYIR
FT                   PVIEMIVSEVKAAHPTTPIIMQAVGASHLLAEWETMPLDVVGVDWRETITSAREKVPTK
FT                   AIQGNLDPSTLLAPAKCLEEAERILQEGVLEPGYIFNLGHGVFPEVPPEMLKKLTNYIH
FT                   ERSEILLKKG"
FT   gene            333652..334581
FT                   /gene="hemH"
FT                   /locus_tag="LMHCC_0331"
FT   CDS_pept        333652..334581
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemH"
FT                   /locus_tag="LMHCC_0331"
FT                   /product="ferrochelatase"
FT                   /EC_number="4.99.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38691"
FT                   /protein_id="ACK38691.1"
FT                   /translation="MTKKVGLLVMAYGTPYKDEDIERYYTDIRHGHKPSEEMIADLRGR
FT                   YHAIGGLSPLAKITEAQAYGLEKALNDSQDEVEFKAYIGLKHIEPFIEDAVEAMHKDGI
FT                   EEAISIVLAPHYSSFSVEAYNKRAKDAADKLGGPSIKAINDWYKQPKFIQMWADRINET
FT                   AKQIPADELLDTVLIVSAHSLPEKIKQHNDPYPDQLQETADFIFEKVVVPHYALGWQSE
FT                   GKTGEPWLGPDVQDLTRELYGQEKYKHFIYTPVGFVAEHLEVLYDNDYECKVVTDEVGA
FT                   AYHRPPMPNADPEFLEVLRTVVWEKYSN"
FT   gene            334735..335079
FT                   /locus_tag="LMHCC_0332"
FT   CDS_pept        334735..335079
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0332"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38692"
FT                   /protein_id="ACK38692.1"
FT                   /translation="MKNKAEKQRIATNLSLYMKINGYTHRTFALAVGISQNTLKALMIG
FT                   KMRNESKFQKYISQITESLALEEKFFEQPKEAITAAPITFQDTNKMHLGDEKFNAISLM
FT                   LKIGEIHYES"
FT   gene            335200..335985
FT                   /locus_tag="LMHCC_0333"
FT   CDS_pept        335200..335985
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0333"
FT                   /product="acetyltransferase, gnat family"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38693"
FT                   /protein_id="ACK38693.1"
FT                   /translation="MIRKLTVSDNEEVMALLKPEATLNLFIIGDIENFGYESDVQDLWG
FT                   EFDSSGKLHALLLRFDTFFLPYSKDANFDAKAFSEIIAKHDTYEVSGISRVTKELEPFL
FT                   PELAEKRQDTYFCECEHVNRISVNQDVIVRTAVAEDVAPIIKMRKHIKEFGSRDENEEL
FT                   IIRQIEKGVKRIYYIEQDQEVVAVAETSAENSFSAMITGVATSDGYRQRGFASTLLKKL
FT                   CCDVLAEGKKPCLFYDNPVAGEIYHRLGFEHTGDFVMYK"
FT   gene            336049..336819
FT                   /locus_tag="LMHCC_0334"
FT   CDS_pept        336049..336819
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0334"
FT                   /product="conserved hypothetical protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38694"
FT                   /protein_id="ACK38694.1"
FT                   /translation="MKPRGICFFDMDGTLLNSDSKVLDSSLQALDKLRENNIIPVIATG
FT                   RTLIEISHQMKITGIESAVMMNGQMAIFEGEKVYEDVIDAGLLERLTEEAKSQNVEVCY
FT                   YNDKRIGATASTPVVKAHYDFLGEPMPKVRPNMYKEETINMALLLLETGDDYFPERFPE
FT                   LQFVRNTPFSNDVLRKGGSKAVGISKLLEVMGYQDVPTYAFGDGMNDLEMFGAVDYAIA
FT                   MENAVPILKEKAAFVTKDNNSDGIMLGLKQFDLI"
FT   gene            336930..337607
FT                   /locus_tag="LMHCC_0335"
FT   CDS_pept        336930..337607
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0335"
FT                   /product="membrane protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38695"
FT                   /protein_id="ACK38695.1"
FT                   /translation="MNEINHTSERANTEKRTEKQIIMQKILNWFVFSLLLASIGAAIGS
FT                   KLSPELYLPLVVLEVALLITAMVVRRSKTINKVVGYPVVLAFAFVTGLTLGPTLTYYFG
FT                   AGQGAAVLMAFVTATVTFTTLAFIGAKMKKDLSFLSSALFAAIIILIIFSFVGVFLPLG
FT                   SMLSTIISAGGTIIFSLYILYDFNQIMKRDVELADVPMLALNLYLDFLNLFMFLLRLFT
FT                   GRD"
FT   gene            337755..340355
FT                   /gene="clpB"
FT                   /locus_tag="LMHCC_0336"
FT   CDS_pept        337755..340355
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="clpB"
FT                   /locus_tag="LMHCC_0336"
FT                   /product="ATP-dependent chaperone ClpB"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38696"
FT                   /protein_id="ACK38696.1"
FT                   /translation="MDLQKFTQQVQQTIADAQNLAIASEHQEIDVAHVFKVLLTESDFA
FT                   KRVYDVAEVDIDALQKTVEDALTKIPVVSGSGVNYGQAMSQALFQLMRDAEKEQKQLDD
FT                   DFVSTEHLILAVMDQKSNPITMNLKNQHKSKKQIQEAILKIRGGKKVTSQNAEENYEAL
FT                   TKYGRDLVAEVRSGKLDPVIGRDAEIRNVIRILSRKTKNNPVLIGEPGVGKTAIVEGLA
FT                   QRIVRKDVPEGLKDKTIISLDIGSLIAGAKYRGEFEERLKAVLQEVKQSDGQILLFIDE
FT                   IHTIVGAGKTDGAMDAGNMLKPMLARGELHCIGATTLDEYRQYIEKDAALERRFQKVLV
FT                   PEPTVEDTVSILRGLKERFEIHHGVNIHDNALVAAASLSNRYITDRFLPDKAIDLVDEA
FT                   CATIRVEIDSMPSELDEVTRKVMQLEIEEAALKEEKDPASERRLEILQRELADYKEEAN
FT                   QMKSKWESEKNEISKIREVREQIDHLRHELEEAENNYDLNKAAELRHGKIPAVEKELLE
FT                   LEAENREKTAQEDRILQEEVTENEIAEIVGRWTGIPVTKLVEGEREKLLKLADELHQKV
FT                   IGQDDAVQLVSDAVLRARAGIKDPKRPIGSFIFLGPTGVGKTELAKALAFNMFDSEDHM
FT                   IRIDMSEYMEKHSVSRLVGAPPGYVGYEEGGQLTEAVRRNPYSIVLLDEIEKAHPDVFN
FT                   ILLQVLDDGRITDSQGRLIDFKNTVIIMTSNIGSNLLLERTEEGEISPELESDVMQILQ
FT                   SEFKPEFLNRVDDIILFKPLTLADIKGIVEKLVEELQIRLADQEITITISDDAKAFIAE
FT                   EAYDPVYGARPLKRYIVRHVETPLAREIVSGKIMPHSSVEIDLEDKEFTFKVTE"
FT   gene            340446..341135
FT                   /locus_tag="LMHCC_0337"
FT   CDS_pept        340446..341135
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0337"
FT                   /product="2,3-bisphosphoglycerate-dependent
FT                   phosphoglycerate mutase (phosphoglyceromutase) (pgam)
FT                   (bpg-dependent pgam) (dpgm)"
FT                   /EC_number="5.4.2.-"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38697"
FT                   /db_xref="GOA:B8DFA5"
FT                   /db_xref="InterPro:IPR001345"
FT                   /db_xref="InterPro:IPR005952"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8DFA5"
FT                   /protein_id="ACK38697.1"
FT                   /translation="MKLVLIRHGQSEWNKLNLFTGWHDVDLSQEGVVEAMTAGKRIKEA
FT                   GLEFDVAFTSVLTRAIKTLNYVLEESDQMWVPVHKSWRLNERHYGALQGLNKQETAEKY
FT                   GADQVQKWRRSYDTLPPLLEENDERQAKNDRRYQLLDTHAIPSGENLKVTLERVIPYWM
FT                   DTIAPEIKEGRRVVIAAHGNSLRALVKFLEGISDDEIMDLEIPTGVPLVYELNDDLKPV
FT                   NKYYLDK"
FT   gene            complement(341225..341404)
FT                   /locus_tag="LMHCC_0338"
FT   CDS_pept        complement(341225..341404)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0338"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38698"
FT                   /protein_id="ACK38698.1"
FT                   /translation="MVTVVWVFLLSLMAEFVLSSMLYVSFDMTRAIILTVGLSFFIILI
FT                   TFLMPKDSEVYDFK"
FT   gene            341760..342863
FT                   /locus_tag="LMHCC_0339"
FT   CDS_pept        341760..342863
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0339"
FT                   /product="N-acetylmuramoyl-L-alanine amidase, family 4"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38699"
FT                   /protein_id="ACK38699.1"
FT                   /translation="MKKKFTQILLASVIVSSTLVPFVQAEAAGTSQTAVSQAGMTLSQQ
FT                   QFIQSIANDAQDLQKEEKILTSVTLAQAILESNWGKSGLSTSANNLFGIKGSYEGSSVS
FT                   MGTQEFSNGKAYQTQADFRKYPDKKTSLVDHAQLFVNGVSGNANLYSAVIGETDYKKAA
FT                   YAIQNAGYATDPAYAEKLISTIENYHLDQYDQIYDTVKSTEYQLAYAEIKNTSNEIIWT
FT                   KPYNTEGAEKVASANDYKNKTLRISQKAVTEKGTWYQLQDQGKTIGWINSNAVEIFYTP
FT                   QNETNVTLDKYITDSDQKVYAYPVEDNSKVVANLNDYLGKELDIDRRADVKNEYWYRIK
FT                   SDDGKVIGWSKAGGFAENNPNKALEVK"
FT   gene            342983..343921
FT                   /locus_tag="LMHCC_0340"
FT   CDS_pept        342983..343921
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0340"
FT                   /product="3-oxoacyl-(acyl-carrier-protein) synthase 3
FT                   protein 1 (3-oxoacyl-(acyl-carrier-protein) synthase III
FT                   protein 1) (Beta-ketoacyl-ACP synthase III 1) (KAS III 1)
FT                   (bFabH1)"
FT                   /EC_number="2.3.1.41"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38700"
FT                   /protein_id="ACK38700.1"
FT                   /translation="MNAGILGVGKYVPEKIVTNFDLEKIMDTSDEWIRTRTGIEERRIA
FT                   RDDEYTHDLAYEAAKVAIENAGLTPDDIDLFIVATVTQEATFPSVANIIQDRLGATNAA
FT                   GMDVEAACAGFTFGVVTAAQFIKTGAYKNIVVVGADKLSKITNWDDRATAVLFGDGAGA
FT                   VVMGPVSDDHGLLSFDLGSDGSGGKYLNLDENKKIYMNGREVFRFAVRQMGEASLRVLE
FT                   RAGLEKEELDLLIPHQANIRIMEASRERLNLPEEKLMKTVHKYGNTSSSSIALALVDAV
FT                   EEGRIKDNDNVLLVGFGGGLTWGALIIRWGK"
FT   gene            344124..345365
FT                   /gene="fabF"
FT                   /locus_tag="LMHCC_0341"
FT   CDS_pept        344124..345365
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fabF"
FT                   /locus_tag="LMHCC_0341"
FT                   /product="3-oxoacyl-(acyl-carrier-protein) synthase 2"
FT                   /EC_number="2.3.1.41"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38701"
FT                   /protein_id="ACK38701.1"
FT                   /translation="MDKRRVVVTGIGAVTPIGNDAETSWENAKKGVNGVAKMTRLNPDD
FT                   FPVKIAAELKDFDVEKYLEKKEARKMDRFTHYAIASAEMAVQDSGLVIDDSNANRVGVW
FT                   IGSGIGGMETFETQYEIFLNRGHRRVSPFFVPMMIPDMGSGQVSIRFGAKGINSTTVTA
FT                   CATATNSIGDAFKVIERGDADAMITGGAEAPITKMSLAGFTANKALSLNPDPETACRPF
FT                   DKDRDGFIIGEGAGIVILEEYEHAKARGAKIYAEIVGYGATGDAYHITAPAPNGEGAAR
FT                   AMKMAIDDAGLTPDKVDYINAHGTSTPYNDEYETQAIKTVFGDHAKKLAISSTKSMTGH
FT                   TLGASGGIEAIFALLSIRDSIIAPTIHLKNQDEVCDLDYVPNEAREANVNVAISNSFGF
FT                   GGHNATLVFKKMED"
FT   gene            345485..345940
FT                   /locus_tag="LMHCC_0342"
FT   CDS_pept        345485..345940
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0342"
FT                   /product="transcriptional regulator OhrR"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38702"
FT                   /protein_id="ACK38702.1"
FT                   /translation="MLDTNTRILEEQLCFSVYNASKQFTKLYREALEPFQLTYPQYIAL
FT                   LVLWEGEEQTVSELGKRLALDSGTLTPMLKRMEHLGYVTRSRHPEDERRVYIRLTEKAI
FT                   KIQPDVLKSVDNCLQLLDFAELDYRQLLTKIQALTKQLGGIENEKIV"
FT   gene            345924..346340
FT                   /locus_tag="LMHCC_0343"
FT   CDS_pept        345924..346340
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0343"
FT                   /product="OsmC/Ohr family protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38703"
FT                   /protein_id="ACK38703.1"
FT                   /translation="MKKLYETTVINTGGRSGEVHSPDNVFYFDISAPTELGGDGGGGTN
FT                   PEQLFAAGYGACFNSALELVLGKAGIEAKSTVTATVSLYSDPEDNGFKIGVVLEGTIEG
FT                   QDKEKTEALLKKAHEVCPYSKATRGNIDVEIKVG"
FT   gene            complement(346396..347391)
FT                   /gene="trpS"
FT                   /locus_tag="LMHCC_0344"
FT   CDS_pept        complement(346396..347391)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trpS"
FT                   /locus_tag="LMHCC_0344"
FT                   /product="tryptophanyl-tRNA synthetase"
FT                   /EC_number="6.1.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38704"
FT                   /protein_id="ACK38704.1"
FT                   /translation="MKKVIFSGIQPSGQLTLGNYIGALKQFGQFQDEYECFYCIVDEHA
FT                   ITVPQDRLKLREQTRSLAALYLAVGLDPEKSTLFIQSEVAAHAQAAWILQCNVYIGELE
FT                   RMTQFKDKSAGKAGVSAGLLTYPPLMAADILLYQTDLVPVGEDQKQHIELTRDLAERFN
FT                   KKHADIFTMPEVFIPKQGARVMSLQDPTKKMSKSDANLKNAIFLLDPPATIRKKIKSAV
FT                   TDSSGIIEYNKEEKPGVSNLLTIYSVITGETIASIEEKYVGKGYGDFKTDLAELVVSEL
FT                   EPIQERYYAYLKSEELDTILDAGAEKAARVANKTLKKMENGVGLGRKRRK"
FT   gene            complement(347726..348070)
FT                   /locus_tag="LMHCC_0345"
FT   CDS_pept        complement(347726..348070)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0345"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38705"
FT                   /protein_id="ACK38705.1"
FT                   /translation="MFLRITIYTLIQEAIIFGILLFGKNNGVSLSNYVDVSFMVALITL
FT                   LSGLFVYIMRSGFLDRVHNGFRNISRKIKREEENEFSDMLLSELVGLQYAGILFSSLLI
FT                   MLSSIVCMFL"
FT   gene            348694..350370
FT                   /locus_tag="LMHCC_0346"
FT   CDS_pept        348694..350370
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0346"
FT                   /product="oligopeptide ABC transporter,
FT                   oligopeptide-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38706"
FT                   /protein_id="ACK38706.1"
FT                   /translation="MKKSKLFLTLGLTLLLSLVLVACGGGSDSKSDKKGSDSGKASGEQ
FT                   VLNLTESALIPSADSTKADDQVGLNVVNQTNEGLYALDKDGIPAIAGAAEEPKISDDKT
FT                   VYTIKLREDAKWSNGDPVTANDYVYSWRRAVDPNTAATYSYLFDAIKNGGDIVAGKKKP
FT                   EELGIKAVDDYTLEVTLSKPTAYINSLFAFPTFFPLNEKFVTEKGEKYAQNSDNMLFNG
FT                   PFELKDWTGTNKKWTYVKNDKYWDKDKVKLKQINVQVVQDSGTGLNLYNTDKVDRTVLS
FT                   ADYAAQNKNNKDYVTVNDSSTFYIKFNQKRAGKDTVFANKNIRKAIALAIDKQSYTDTV
FT                   LKNGSKPANNLVPEGFTFDPGNKEDYTKESGKHLEYDVKEAQKAWKAGLKELGVSEITV
FT                   EFTSDDTENARKSSEFIQDQLQKNLDGLTVKLKNVPFKVRLQNDQNQDYDFSMSGWGPD
FT                   YQDPSTFLDLFVTDGAQNRMSYSNKDYDKILNDASVTYAADDQKRWDEMVKAEKILLTD
FT                   DVAIQPLYQRSTAYLQKDYIKNLQKNPFGPDYTYKETYLTK"
FT   gene            350649..351578
FT                   /locus_tag="LMHCC_0347"
FT   CDS_pept        350649..351578
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0347"
FT                   /product="oligopeptide transport system permease protein
FT                   OppB"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38707"
FT                   /protein_id="ACK38707.1"
FT                   /translation="MVKYTLKRVLYMLITLFIIASVTFVLMKFLPGTPYRNQEKLSDEQ
FT                   IHMMNEKYGLNDSIPVQYFNYMTGLVKGDLGVSFQLDNRPVSEILGALIGPSIQLALEA
FT                   MVFGIIFGILLGVVAAMYQNKWPDYTSTFIAILGKSVPSFVFATVLQYWLGAKLQIFPV
FT                   AGWGTFADTILPAFALAMFPLATAARFMRTELIDVFASDYVLLAKAKGNSRTEVAVKHA
FT                   IRNALIPLITVLGPLSVALMTGSLVIENIYSIPGIGSQFVSSIQTNDYPVIMGTTLLFA
FT                   AMLVFVILVVDILYGLIDPRIRVSGGRK"
FT   gene            351578..352612
FT                   /locus_tag="LMHCC_0348"
FT   CDS_pept        351578..352612
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0348"
FT                   /product="oligopeptide transport system permease protein
FT                   OppC"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38708"
FT                   /protein_id="ACK38708.1"
FT                   /translation="MAEHKIAKERFQPAHILDAEAEKINRPSLTFMQDSWLRIRKNKAA
FT                   LVSLIVLALVIIMAIVGPYLSQNLGPKHDINRQITENASLPPKVQGFENMPFWNGHQSI
FT                   GGEDVDIYKQNNIKEGTYYWLGSDTLGRDQFARIWAGTRVSLIIAVVAALCDLVIGVAY
FT                   GLISGYAGGRVDNFMQRILEVIGAIPNLVVVILMMLVLDSGMVSIIIAIAMTSWITMAR
FT                   VVRGQVLKLKNQEFVMASMTLGESTPKILTKHLIPNISGVIIINIMFSIPSAIFFEAFL
FT                   SFIGLGLPAPAASLGVLVNDGYKTLQVLPYMILYPCIVLCIIMIAFNLIADGLRDAFDP
FT                   KMRD"
FT   gene            352630..353706
FT                   /locus_tag="LMHCC_0349"
FT   CDS_pept        352630..353706
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0349"
FT                   /product="oligopeptide transport ATP-binding protein OppD"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38709"
FT                   /protein_id="ACK38709.1"
FT                   /translation="MEKLLEVKDLNISFHTYAGEVKAIRGVNFDLYKGETLAIVGESGS
FT                   GKSVTTKSIMRLLPEGNSEIKSGQILFNGMDIAKAHEKQMQKIRGKDIAMIFQDPMTSL
FT                   NPTMTIGKQISEPLIKHQKISKHEAHKTALRLLQLVGIANAEERIKQYPHQFSGGMRQR
FT                   VVIAISLACNPQILIADEPTTALDVTIQAQILDLMKDLQKKIDTSIIFITHDLGVVANV
FT                   ADRVAVMYGGKIVEIGTVDEIFYNPQHPYTWGLISSMPTLDTDDEELFVIPGTPPDLLH
FT                   PPKGDAFAARNKYAMQIDLEEEPPLFKVSDTHYAATWLLHPDAPEVTPPDAVLRRQEQF
FT                   AELHPGMQAVHAKGVEVE"
FT   gene            353703..354671
FT                   /locus_tag="LMHCC_0350"
FT   CDS_pept        353703..354671
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0350"
FT                   /product="oligopeptide transport ATP-binding protein OppF"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38710"
FT                   /protein_id="ACK38710.1"
FT                   /translation="MTEQREKLLEIHNLKQYFNKGTASEVRAVDDISFDIYKGETLGLV
FT                   GESGCGKSTTGRTIIRLYDATGGEVIYNGKNVHARKSRKEMLEFRRKMQMIFQDPYASL
FT                   NPRMKVKDIIAEGIRIHGLAKTPEETNRQVYDLLETVGLSKEHAGRYPHEFSGGQRQRI
FT                   GIARALAVQPEFIIADEPISALDVSIQAQVVNLLRQLQKEKNLTYLFIAHDLSMVKYIS
FT                   DRIGVMYFGKLVELAPANDLYHAPLHPYTESLLSAIPLPDPNYERTRVRKTYDPTSHNY
FT                   KDGDEIKMREIAPGHFVYCSEEEEVMYKEKHAKLTAEAAAK"
FT   gene            354991..355386
FT                   /locus_tag="LMHCC_0351"
FT   CDS_pept        354991..355386
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0351"
FT                   /product="regulatory protein spx"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38711"
FT                   /protein_id="ACK38711.1"
FT                   /translation="MVTLYTSPSCTSCRKARAWLEEHDIPYKERNIFSEPLSLDEIKEI
FT                   LRMTEDGTDEIISTRSKTFQKLNVDLDSLPLQQLFELIQKNPGLLRRPIIIDEKRLQVG
FT                   YNEDEIRRFLPRRVRTYQLREAQKMVN"
FT   gene            355612..356271
FT                   /locus_tag="LMHCC_0352"
FT   CDS_pept        355612..356271
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0352"
FT                   /product="adapter protein MecA 1"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38712"
FT                   /protein_id="ACK38712.1"
FT                   /translation="MTMEIERINEDTIKFYISYLDLEERGFNQEDVWYDREKSEELFWD
FT                   MMDELKYEEEFSPEGPLWIQVQALKHGLEVFVTKATIGGKGEDGFDVTLSSPDELAEEK
FT                   IEKLLEENFNPVKKEALGEDDTLEFILEFRDFEDAISLSRATGLENLVTKLYSYQGKYY
FT                   LNVEFPENKYDESNIDNAVSILLEYGLESNLTGYMLAEYGKVIFDVPALKQIRKHF"
FT   gene            356455..357513
FT                   /locus_tag="LMHCC_0353"
FT   CDS_pept        356455..357513
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0353"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38713"
FT                   /protein_id="ACK38713.1"
FT                   /translation="MNVERIKQEEKLFCKSCASPVMIKAGQIKIPHFAHEKTTKCAFAS
FT                   EGESEEHLAAKKQIMAWYCYQSIPVEVESYFPDINRQADIFVNGKAVIEFQRSSISISE
FT                   MIQRTMDYLSIGLEVHWILGQVIRKEKGRICLSTFQQAFIQSDKKLGYHFWHYSAEREI
FT                   CTLYYHLTFEKGNRFFASEMKFSMKVPFSEWKKKLARIITRHAYVKRDRELERQKICFY
FT                   YAKFKKHGQFMQKLFNAGYYLHYLPKEIGVDLEEQFLVITPAVEWQFDLWEKFFKGLEK
FT                   GDTFSECCFFESFQSVVTQILTIWLSPNESLKLGKSYLSYLIGEGVLSTIPDNRYRVKR
FT                   KMTFTNTRAAHI"
FT   gene            357586..359391
FT                   /gene="pepF"
FT                   /locus_tag="LMHCC_0354"
FT   CDS_pept        357586..359391
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pepF"
FT                   /locus_tag="LMHCC_0354"
FT                   /product="oligoendopeptidase F"
FT                   /EC_number="3.4.24.-"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38714"
FT                   /protein_id="ACK38714.1"
FT                   /translation="MSKTNALPLREEVPENLTWDLTTIYPNDEAWEQAFTDLQKITEES
FT                   EQFKGRLSESSQTLYEALQFRDNAYDLISNLYVYAHLKMDQDTANAKYQGLHSRAGSLV
FT                   TKLMSALSYYDPEILAMDESVLKQFLNENKDLQLYAHLLEELNLSRPYILSEKEEALLA
FT                   NAGEVLGSSSNTFNTLNNADMKFPTIKDENGEDIEITHGRFGKLLESNDPRVRREAFLG
FT                   VYSVYEGLKNTLASTLNGQVKKSNFYASTRGYTSAREAALSGNHIPETVYDSLLKSVNA
FT                   NADLLHRYVKLRKELLGLEELHMYDLYTPLSDDVNLEFTYEEAKELVLEALKPLGDEYQ
FT                   AILKEAFDSRWIDVMENKGKRSGAYSSGSYSTNPYILLNWQDNINNVYTLAHELGHSVH
FT                   SYYTRKNQPFVYGDYSIFLAEVASTTNENLLTDYLLKKYEDPKVRAYLLNHYLDGFKGT
FT                   VFRQTQFAEFEHAIHQADQQGVALTADFLTETYFDINKKYYGEAMVYDAEIGYEWSRIP
FT                   HFYMNYYVFQYATGFSAASALSAKILTEGQEAVTAYIDFLKAGSSDYPIDVLKKAGVDM
FT                   ATPNPVDDALKVFEQRLDELEKLVK"
FT   gene            359690..359950
FT                   /locus_tag="LMHCC_0355"
FT   CDS_pept        359690..359950
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0355"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38715"
FT                   /protein_id="ACK38715.1"
FT                   /translation="MEFEDEKLLREVLLFARSVDTKINDMSLEVIDFGNLRDYTKNEVL
FT                   LTLYWLEENGFLTRNNNIAEKRYTLTLKGELLYDRFSQIEE"
FT   gene            360161..360787
FT                   /locus_tag="LMHCC_0356"
FT   CDS_pept        360161..360787
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0356"
FT                   /product="iron Transport-associated domain family"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38716"
FT                   /protein_id="ACK38716.1"
FT                   /translation="MKRILVLAAFIALFSFSFLSTGLTAQAALKDGTYSVDYTVLQGDS
FT                   DSVSMANDYFDKPATVTVNGGKSTVSLQVNHSKWITGLWVEGSAVSVTSKNTANDTRKV
FT                   SFPVSTLSSPVNAKIKVDIDDDGLNYHHEYQIKLRFDEGSAKALAGAVKSSDNNNTATP
FT                   ATKSDSSNKVANPKSSDSSQMFLYGIIFVAAGTGLVLLKRRAIFK"
FT   gene            360800..362509
FT                   /locus_tag="LMHCC_0357"
FT   CDS_pept        360800..362509
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0357"
FT                   /product="iron Transport-associated domain family"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38717"
FT                   /protein_id="ACK38717.1"
FT                   /translation="MKKLWKKGLVAFLALTLIFQLIPGFASAADSRLKDGGEYQVQVNF
FT                   YKDNTGKTTKESSEADKYIDHTATIKVENGQPYMYLTITNSTWWQTMAVSKNGARPEKP
FT                   AQADVYQDRYEDVQTVSTDAAKDTRVEKFKLSSLDDVIFSYMHIKVDAISYDHWYQVDL
FT                   TIDPSTFKVISEPAVTTPVTLSDGIYTIPFVAKKANDDSNSSMQNYFNNPAWLKVKNGK
FT                   KTVAMTVNDNKTVTALKTNLAGALQDVKVVSEDKDANTRIVEFEVEDLNQPLAAHVNYE
FT                   APFNGSVYKGQADFRYVFDTTKATAASSYPGSDETPPVVDPGETKPPVTKPDPGTTNPP
FT                   VTTPPTTPSKPAVVDPKNLLNNHTYSIDFDVFKDGTTETSMMESYVMKPALIKVENNQP
FT                   YVYLTLTNSSWIKTFQYKANGVWKDMEVVSGDINKNTRTVKYPVKDGTANTDVKTHVLI
FT                   EDMPGFSYDHEYTVQVKLNAATIKDITGKDVTLKEPVKKDILNTGNVANNNNAGPKLAK
FT                   PDFDDTNSVQKTASSTEKNAKTNDSSSMAWYVTLFGASFLYLAYRLKRKRLS"
FT   gene            362547..362678
FT                   /locus_tag="LMHCC_0358"
FT   CDS_pept        362547..362678
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0358"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38718"
FT                   /protein_id="ACK38718.1"
FT                   /translation="MLNSLYRFYFINGGISNEEIGCHIFSVIAFFSWLRQGRGGSKA"
FT   gene            362707..363468
FT                   /locus_tag="LMHCC_0359"
FT   CDS_pept        362707..363468
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0359"
FT                   /product="iron compound ABC transporter, iron
FT                   compound-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38719"
FT                   /protein_id="ACK38719.1"
FT                   /translation="MATTVAITEIMDKLDLSLVGIPTSSKKLPERYADVKETGSPMGPD
FT                   LEIIRMLKPDMVLSTKTLEADLKAGFEGADLKADFLDFTSIASMQTEIKKLGAEFDRKE
FT                   EAAKLNGDLTNEIDKVKSSVAKKKKPTVLILMGVPGSYLVVTEHAYIGDLVKLAGGENV
FT                   IKDQKVEYLASNTEYLQSANPDIILRAAHGMPAEVVKMFDEEFKTNDIWKHFDAVKNNR
FT                   VYDLDENLFGMTASLNAPEALQEMEKMLYDN"
FT   gene            363458..364447
FT                   /locus_tag="LMHCC_0360"
FT   CDS_pept        363458..364447
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0360"
FT                   /product="iron compound ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38720"
FT                   /protein_id="ACK38720.1"
FT                   /translation="MTIKQKSSFGAVLVLLIGTILWAVQAGSLSMSIPAFLSGVFSGGN
FT                   EMVDVVIDLRFPRIIIALLAGAALSVSGLLLQAVMRNPLADAGVIGISAGAKFFSFVII
FT                   LFLPELYFWLPLFSFIGGALACFLVFLFSYRSDFNPLRFIIIGIAINAVFTGLSDALSS
FT                   QVALVSSQSASSAASLAMKKWSDVETLLIYVMIGLICALLLAKWCNVLGLENKMARGFG
FT                   VPVNKTRIWLALIAVLLASITTAVVGVIAFVGLLVPHIARKLVGGNYQILVPFSILFGA
FT                   LLLLFADTLGRTLFQQMEIPASVIMLIIGGPFLIFLMRKGDFYGSKGR"
FT   gene            364428..365207
FT                   /locus_tag="LMHCC_0361"
FT   CDS_pept        364428..365207
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0361"
FT                   /product="ferric enterobactin transport ATP-binding protein
FT                   FepC"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38721"
FT                   /protein_id="ACK38721.1"
FT                   /translation="MEVRDVNFSYNGTDSTLKNVSFTIQKNKINTIVGPNGSGKSTLLE
FT                   ILARLLSPDSGDVLLEGKSIFEWKAKEFAQNVAIVHQNNVLPNELPVKELLYFGRLPYK
FT                   NWRMTRTKEDDLAVERALVQTELTEKAEKFVDSLSGGERQRVFIATALVQDTPVLLLDE
FT                   PTTFLDMYFQLEILELVKRLNQEENLTIVMILHDLNQALTYSDHLIVMKNGEVVAKGEP
FT                   GELLTTELIAETYGVVAEVLSDAETGKYIVPQRRKEF"
FT   gene            365211..365951
FT                   /gene="srtB"
FT                   /locus_tag="LMHCC_0362"
FT   CDS_pept        365211..365951
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="srtB"
FT                   /locus_tag="LMHCC_0362"
FT                   /product="sortase, SrtB family"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38722"
FT                   /protein_id="ACK38722.1"
FT                   /translation="MKIKSFLGKSLTLVVLGIFLFSGWEIGMELYENKHNQTLLDDAKA
FT                   VYTKDVATTNVNGEVHDELKALRKLNKDMAGWLTIADTEIDYPILQSTDNDYYLHHNYK
FT                   NEKARAGSIFKDYRNTNEFLDKNTIIYGHNMKDGSMFADLRKYLDKDFWEKHPTFSYES
FT                   GLANYKVEIFAVYETTTDFYYIETEFPGANDFDNYLQKVKGQSIYKSNVEVSGKDRIIT
FT                   LSTCDTEKDYEKGRMVIQGKLVAK"
FT   gene            366012..366488
FT                   /locus_tag="LMHCC_0363"
FT   CDS_pept        366012..366488
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0363"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38723"
FT                   /protein_id="ACK38723.1"
FT                   /translation="MKLYELTDNYLRLQELLEENKTEAVMDTLDAITDGFHDKAENIAK
FT                   IIKSLAADAEMAGTEAKRLLKRKQALENNVQKLKTYLQTEMERMEIRKINSTLFTIQIQ
FT                   KNPVSVEIVDDSLLQAFFLLQEPKIDKKRIAEILKSGEEVKGARLVESESIRIR"
FT   gene            366682..370137
FT                   /locus_tag="LMHCC_0364"
FT   CDS_pept        366682..370137
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0364"
FT                   /product="cell wall surface anchor family protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38724"
FT                   /protein_id="ACK38724.1"
FT                   /translation="MNRLKKLVIILICTLLIVSLLPFSVWAEDKEGVETNVGETATEEK
FT                   NTKETTSNETTTEPLEQTTVNEPISTKSFPTGNYSGDFSINSQKDVIESGQTVNYNIYL
FT                   KITGPNTSYKNAKLVINLPENGEFTQALNELKIAGVTPSYNQTTRQLVYKYQTLNSGVV
FT                   DKVILKLSTKNGYTPNGTKLEVTGEFSADNLSEKVTEQAETTVNATATTALSNEFTKVE
FT                   NSINNNPSQGDIGIWSFNLNIPKKSTGSLFIEEGKKIIIEYTLADKLDYLGVAGDTPEP
FT                   TKIEGQKLTWEIAAPTYLEQEKATSLLNKTFQIRTFFQTSIPNFATVENKAVATTNFIT
FT                   LTDSIMDTSKASVSVSASDPATIPPTIGSVYAPAHRGPVDENWGIATATGNPDIKAYDS
FT                   AKLGFSLMLNSAMNDSPSYDFIYYDVYYNIDDNLNLDYFRSGDFYFKPNVNYPGWPQLK
FT                   KSPKYNLLVKYDGDTDWTTLKEDVELSKMYSRKDLGIPDDKHVSKVWLHFTYAPAGMYS
FT                   ADLSFFTTVKEGYVGEVRNTTKINMYGADSQGYIHYFDDTNPWPENWQKYAGDRTAQII
FT                   PQPIGKNKFVQGSVAFDDTDGNLINIGDNSVSVNLESNKASISRLTGPFEAMVLLPSGV
FT                   KMKKTDQQGFNVSVLNSNYQNSGRQLLKVKWDKKTLLPAEKLTAKINVTVSKDTPSNMS
FT                   VEMFGFLQDTDFNVPEVTGTPTISDTKMEIDSNDINQNGNSEESRITSGNHYILNTSNH
FT                   LKISKKAKGNLDKGYSGLANATTNSIVSYQLLLENDSDEKIANMVLMDVLPSEKDLGIT
FT                   DNSERGSKFNLELTKAVAIPNEWKDKVEVKYSTAKNPKRAGVLDKHTIYPTGSEPLVDN
FT                   REATEADWLTASEVQDWSQIHSFKMELKEGIEWIPGKSMKIQFDLKTPKKNQIDKELLN
FT                   QQTKKEDRAAWNSFAVAVNNSQVIEPAQVGVALDDSVAPVTVQYVDQNHKQIANPETLT
FT                   GAYGEKFTAKQKKITNYTLVKTPANVSGTFNEKAQTVTFVYQKVTAGNIIVDYVDKNGE
FT                   KIADSIVLTGKLNSSYRTSAKKISGYKLYQTPKNASGKFSNTSQKVTYVYEKTSALSVS
FT                   SNERAENVKKSEKLPQTGDSKKTNLWFILGMLLLSSAFVLAKKR"
FT   gene            370318..375174
FT                   /locus_tag="LMHCC_0365"
FT   CDS_pept        370318..375174
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0365"
FT                   /product="cell wall surface anchor family protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38725"
FT                   /protein_id="ACK38725.1"
FT                   /translation="MKNIRQWKKLVIAMVISLLVFQNVSPVLATMTDSETANTTLKIIK
FT                   EDKDTQEKINGSTFEIKNKETGETNDLTISANGEATMDSLSPGDYLVKEKVAPKGYTLD
FT                   EKEYSVTLAEKEEVITSVSAKEQEETTKEAATPTPTPVKKATQNANLKAAITDNIFNKV
FT                   TLKDGNGDEINTSDRIQNGSGVVLNMNFAFSGKNYKAGDTFTTVLPDAFNFGNKNLSGN
FT                   FLPSTEAEWTLDVTTRELTITFLKDGIQEGDYDVNISTAFKVFTSTEETIQEVVFKTAG
FT                   KDTVYQIEVVPVVNYPTTVGITANPGVVNPTKGQVDAKFNLTKEKDAKGELKLTDYASG
FT                   GTTTIDKDSIKVYSSDVSAGGTFIGTKKLLVEGTDYTLTYSATSLTVTLNGGLAGKGYQ
FT                   VTYDRTINKPSDSLSYMSTQAYTVGDSGTLSSNSAYVYLTMTNYKHIEKKATYNGSTQS
FT                   IDWKINFNFDQDEISPSTVLTDVLADNDVEYVADSLKIKRVTFNATNGSPIVGGDASSD
FT                   WTTSAISANGNFNLTYKDTNTNAYEITYSTKITDFSDRKIKNEITDENGVSADATIAIQ
FT                   PDLLKKEAGTIDYFNNTMTWKITANSDRIKMGNLNITDEFSTGVKALKSYTVRAYTDNT
FT                   NSVLLTEGKDYTIDKDVTPAGFYIQLIGDYASTDKKIVVDFVTEIDLSDVTKTIDNKAS
FT                   ISYYDGGIIKYVDEVTASMTPDPAMMTNGGKYGSYNSTTGNIDWIVSVNAMAKNYDNLI
FT                   FDDAIPTGLTYVEGSLQYRNVASTSEMMNLYIPLNSVGTVAKTGDKNYPTKVDTTGNKL
FT                   HLEFANLENSRVFIKYSTKPNENWYFYSYVQNTAKVSDNGVGEKSYSYQAYASKLFNAM
FT                   TKTATIDPSFDNKVNWVVTLNNISADRPINNPTITDTMKTGTTGAQVVKSSFKVINETT
FT                   GEDIDSKYYDITYTDNNFTIQFKDYKATAPIKVTYSTISLMSGLVSNTATTASPDYGSL
FT                   PMTYKSRTTSISPAFTIGSGSGTATIGSLEITKVDKKDNSKKLTGAKFQLYTLEGDKAG
FT                   QEATTDSDGKIVMDGLQSGKYKLVETEAPTGYTISDEYKDGKEITVTADAVTNVTIENT
FT                   EQTGSAVLLKEDSVTKDAIAGAEFELQNADGTKVAENLVSNADGKIEVTDLAPGDYQFV
FT                   ETKAPTGYVLDGTPTKFTVEFNQEAAVVVTKENTAKTGSVVLTKEDSVSKATLSGAEFE
FT                   LQNAAGTKVQANLTTNADGKLEVSDLAPGDYKFVETKAPTGYELDATPVTFTIEFNQAT
FT                   AVNVTKDNVAKTGSVVLTKLDSKSRSNLAGAEFELQTKLGVSLKDKVVTEANGQLQIDD
FT                   LAPGDYQLVETKAPTGYELDATPVEFTIAFNQQAPIQVTKTNTMSTGSVVLTKTDAETK
FT                   TPLANATFKLVDEDNNVTDNLTTDASGKLEITDLVPGDYQLIETKAPAGYELDTVPVDV
FT                   KIAFDQKETLQVTKTNLKTVVSGKVIAEFVDTKGNVLAEKEIHAGIVGDKYALKAKAIK
FT                   GYTLTKEPTNKAGTFREEDQKVTFVYEKNKAPIVVNPDKPVTPVKPTKPTKTVDPAKKP
FT                   TVTSLPSTGDESPYGIIFTGLFASLVGLFLLRKSRKVND"
FT   gene            375409..380499
FT                   /locus_tag="LMHCC_0366"
FT   CDS_pept        375409..380499
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0366"
FT                   /product="cell wall surface anchor family protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38726"
FT                   /protein_id="ACK38726.1"
FT                   /translation="MKKLKMWKKLLIMMVIGLVVFQNISSVFAAAIDVKESKPSLKIVK
FT                   IDKDTNKNINGSIFEIKSIQTGEIKELSIEENGTAVETSLAAGEYLVKEKKAVEGYILD
FT                   ERAYNITLQDKAEQITSPSSKNKAAPKTNLKAAISDNNFTKVELLDGNGTKINLDERVK
FT                   NGSGVVLNMNFSFTGKNYKAGDTFKTTLPNDFNFGSTDLNGNFLPSTEAEWSFDAATRE
FT                   LTIKILKDGVQEGSYDVSITTAFRPLTETDQTSQKAIFTTAGGDTVYEYEVIPSVDYPT
FT                   TVDLTLSPSNLNPEKALATAKFNLTKETNAIGELRLTDFTYGGSTKIDKSTVKIYASDV
FT                   SAKGTFKGSKQLLEEGVDYTIEHTDAELKIKLTNGLAGKGYEVTYTRFINDTTESRVSL
FT                   VSRAQTIGGSEVLSVNQTTVEAKIVKYKHLEKKAVYNSKTQTIDWAINVNYDQAELTPT
FT                   TVLKDVLADNGVNYVANSFKIREVTFSPTTGQAIVGSSDASSNWTTSTITANGSFEATY
FT                   KNTDKKAYQITYATKVTDFSARDIINEVTDEKGVKATEKVTFEPNIVKKESGTVDYFNN
FT                   LMSWTITANTDRIRMSDMTIIDEFSTGIKSLDNLDVYAYSTEADKVKLVKDVDYTITNT
FT                   TTPAGFKIKLIGNYATTDKEIEVKLVTKIDLSNGIKTLDNKAYISYYDGYITHYSDTKK
FT                   ASLEIDSKILENGAKYGVWNYETGTIDWIVALNTMGLDFENLIFDDEMPEGTSYVEGSL
FT                   EFRRVSGPGELLNLNIPIASTGILAKEGDKNYPTKIEATDKKIHLEFSGFGQSKVFVKY
FT                   KTKPDNKWYSSEFLKNIAKISDNGKNPKEYTAEIYNNESHHPISKTGRIDMVYNNKINW
FT                   ELELTSITENRVVTNPTITDTMNMGLTGAQIVKNSFKVVDTKTGDSIDPKYYDITFNDN
FT                   SFIIQFKNYTATAPIKITYDTVSLISGPVVNTVRVDANDYGNLPVHSRTVINTVTPNFT
FT                   TGSGSGIDTIGSLEITKVDKENPTKKLAGAKFQLYTIDGEKSGQEAITNANGEIIFDSI
FT                   QAGKYKLVETEAPAGYTISEELRNGKEVTVTSDGIPSKYTIENTPKTGSVTLTKIDKLT
FT                   KAPLDGATFELQKADGTAVKEGLITDASGKLEIADLTPGNYQLIETEAPTGYKLDEAPV
FT                   TFAIEFNQTETAKVTKENTAKTGGVILTKKDDKTSATLSGAKFELQTSTGAKLQENIAT
FT                   NAAGQLEITNLAPGDYQLVETEAPTGYELDEAPVPFTITFNQSEKVNVVKLNKAKAGSV
FT                   VLTKQDDVTKAGLADAEFELQDSAGTKLRENLITDTAGKLELTNLAPGNYQLVETAAPI
FT                   GYVLDATPVTFTVEFNQTELLSLTKENTAKTGSVVLTKQDSLTGQTLADAEFELQDETG
FT                   AILQEKLITNANGEIDITNLAPGKYQLVETKAPTGYQLDNTSVPFTIEFNQVEPIHVTK
FT                   ENSAKTGDVILTKVDAKTNKGLAEAKFELQTKQGRVLKTGLTTGINGELKVTNLEPGEY
FT                   CFVETEAPINYELDRTKVEFTIVFNQVSPVTVTKTNKLKVGLVKVAHTDTEGNHLVNPE
FT                   NYTGDVGEKYETEPKEFAGYQLVEHPTNKAGTFTEATQKVTFVYEKINVPIVANQVVPN
FT                   QAKPSNSTSPTTAIEKPATVMKKAKRLPLTGDEAPFNNVISGLFISAIGIFVLRRVNK"
FT   gene            complement(380544..380894)
FT                   /locus_tag="LMHCC_0367"
FT   CDS_pept        complement(380544..380894)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0367"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38727"
FT                   /protein_id="ACK38727.1"
FT                   /translation="MNDHRILNALSYFSILFAPIIVPVLIWIFAKSEEVSHHAKVALLT
FT                   HIIPTIIGILCFSSVFVTAMTNSGILSSFTFFITASLFIFTLIAVVGLFIFNIVRGIQM
FT                   LCVTKEKDDVWI"
FT   gene            complement(381000..381563)
FT                   /locus_tag="LMHCC_0368"
FT   CDS_pept        complement(381000..381563)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0368"
FT                   /product="transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38728"
FT                   /protein_id="ACK38728.1"
FT                   /translation="MDRRVKKTKKAFNQALFTLLDQKPFQQITITDIVAEADVNRGTFY
FT                   KHYRDKEQLLDSIIEEILTDLKNAYQDPYLHTTHFSIQALTPSMIKIFDHVYSHQAFYR
FT                   QVIKSTIRPSFQNQVCNVIRELILDDVASFPDSSGANPQLLATYQAHAIFGMIVFWAEE
FT                   DFSHSPAYMSEQLLHIIHAKTQQV"
FT   gene            381745..382506
FT                   /locus_tag="LMHCC_0369"
FT   CDS_pept        381745..382506
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0369"
FT                   /product="3-ketoacyl-(acyl-carrier-protein) reductase"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38729"
FT                   /protein_id="ACK38729.1"
FT                   /translation="MGKLTGKVAVVTGAASGMGQQIAILFAKEGAKVVVADLNLEAAQK
FT                   TVELVEKEDGTGLAVIANVTKQEDIENMINQAVEAFGTLDILVNNAGIMDNFVPAGELT
FT                   DELWDKVFAINTTGVMRATRKALHIFEEKGQGVIVNIASAGGLFGSRAGAAYTASKHAV
FT                   VGFTKNVGFQYANKNIRCNAIAPGAVNTNIGTTIYAPDEFGQERAMIGMGTNPRAGDAS
FT                   EIAKVALFLASDDSSFVNGTVITADAGWTAY"
FT   gene            382657..383730
FT                   /locus_tag="LMHCC_0370"
FT   CDS_pept        382657..383730
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0370"
FT                   /product="ggdef domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38730"
FT                   /protein_id="ACK38730.1"
FT                   /translation="MVEQLVSNAAILLAGFYIISLVYKEPITKELATNRKMVIGIWAGL
FT                   LGFALMVFGIPISNNVIVDLRHIPIIMVGFYGGPIPAIVSAIIISASRFLLSVNSAAMM
FT                   AAIVMMLIGIITALFGKRLEKFKIWGVFILNIIACSFVVINLHLILARESLFWINMTIF
FT                   VLIALVIGAVSAGLMSNMIKSKQLFQKYEQDSTLDYLTKLSNVRQFDEKINHVMDSGSR
FT                   QVTLMLIDIDYFKNINDTYGHDAGDAILKQLAVILKASTTDGSEAFRNGGEEFSIVLLD
FT                   CSIEEGNKVAEQVRKETEEHDFVIPGGQIVKITISVGVSSSKDGANTSEGLFKSADEAL
FT                   YKAKLTGRNRVCIADGN"
FT   gene            383836..385203
FT                   /locus_tag="LMHCC_0371"
FT   CDS_pept        383836..385203
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0371"
FT                   /product="sigma-54 dependent transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38731"
FT                   /protein_id="ACK38731.1"
FT                   /translation="MFDLMDNLLGVQSFGELNKDMPTTLFVTDADGNILISNKFTALTV
FT                   GMSLEELLRCNVRDLVEDGVYNDSVTLEAIRTKQKKTKVINTKKGFSIRSTSTPILYPD
FT                   GTVHLVVTMSDETQPDSFKTWRGEAISGNKESLLLEDYKENDGTVIIAESVAMKQIVRV
FT                   CNQIAPFDSKVLLYGESGTGKEVLSRYIHEQSEQAAGPFISINCAAIPKALFESELFGH
FT                   EKGSFTGADIEKPGMLELADGGTLFLDEISEMPLELQAKMLRVLETGEVRRLGSTTETK
FT                   RRFRLISATNRNLGEMVEKGTFRRDLYYRINVVPVHIPALRERPQDIIGLARQFIQKFN
FT                   QKYQKDFQLSGDKTKELLSHNWPGNVRELRNQIERLVVMSGNKEVKVSETDDFALDLHF
FT                   KEQTKKESLHLKDYLQDVEKHFILRVLEESDGNVTKAASVLGIHRSVLYRKLKTLH"
FT   gene            385433..387016
FT                   /locus_tag="LMHCC_0372"
FT   CDS_pept        385433..387016
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0372"
FT                   /product="propionate CoA-transferase"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38732"
FT                   /protein_id="ACK38732.1"
FT                   /translation="MSKVIKASEAAKLIKDGDTVAFSGFGLACVNEEMAIAVEERFLEE
FT                   GAPRNLTVMHASALGDRREKGMSHWGHEGLIKRWIGGIAIASPKMAKLIEEDKCEAYNL
FT                   PQGVITQLYREIAAKRPGVITKIGMGTFVDPRIEGAKMSASSKDNLVELLTIHDEEWLF
FT                   YPSFPIQVALIRGTVADEFGNLTLEKEGLHMEVLPIAQAVRNSGGIVIAQVESVAKKGS
FT                   LNPKDVRVPGILVDHIIISEPENHFQTENTQYNPAFSGHIQVPLGDIEPLALDDRKVIA
FT                   RRSAAELEPQTILNLGVGIPVNVSTVAAEEGVSDQLILTTEAGSVGGVPAGLADFGHAY
FT                   NSEAIVDHHSQFDFYDGGGLDLSVLGLAQTDESGNVNVSKFGSRVAGCGGFINISQSAK
FT                   KLIFAGTFTAGGLKTRVADGKLEILQEGKAKKFIKQVQQITFSGEYASTTDQIILYVTE
FT                   RAVFRLENGKMVLTEIAPGVDLEKDILGQMEFEPIIANDLKVMDSGMFSEQWGGLKAII
FT                   EKQTREGVSI"
FT   gene            387013..388236
FT                   /locus_tag="LMHCC_0373"
FT   CDS_pept        387013..388236
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0373"
FT                   /product="major facilitator family transporter"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38733"
FT                   /protein_id="ACK38733.1"
FT                   /translation="MTKEINRWGVLIGSVGVLLCTGAVYAFSVFAGPLSAAHGWTIPQI
FT                   MMAFTINAAIGPIPTILGGILTDKGKAKWAILIGGILFGLGFALTGFATSTTMLYLSYG
FT                   VLAGLGQGFAYSGCLSNTIRLFPDKRGLASGLITAGMGGATIIAAPIANHLIETYNVMT
FT                   AFKIMGAVYIAVVIGCSFLIRVAPAGYAPKGWTPPAGNGAGMVNVPWTGMVRTVTFYLI
FT                   LLMLGIGAFSGLMIASNASLIGQNMFGLTAASAAAYVSIYSLSNCLGRVVWGAVSDRLG
FT                   RSNTLMIIYTVIALSLLALATLQSVVGFVIGIIGLGLCFGGTMGVFPSIVMENYGPKNQ
FT                   GVNYGIVFIGYSTAAFFAPKMAAQIAGQNGGDFTQAFYIAIALAAVGLCINIVYKLREK
FT                   KQPTKELA"
FT   gene            388258..389187
FT                   /locus_tag="LMHCC_0375"
FT   CDS_pept        388258..389187
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0375"
FT                   /product="enoyl-(acyl-carrier-protein) reductase"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38734"
FT                   /protein_id="ACK38734.1"
FT                   /translation="MSLTEMLQIKYPILQGAMAQIATYELASAVSNAGGLGIIASGGMS
FT                   ADTLREQIRLCKEKTTKPFAVNIMLMMPNCPELVDVIIEEDVRVVTTGAGTPKPFMEKF
FT                   KAAGIKVIAVIPSVKIAQKMEEIGVDAVVAEGTEAGGHVGETTTMALVRQVVSAVNIPV
FT                   IAAGGIADGHGMAAVYALGASGVQIGTLFLVAEECPVPASFKQAVLDATDTSTTVTGRR
FT                   NGAPVRSIKNPMIQKYVELENENASRDKLEELTLGSLRKAVHEGDVENGSVMAGQICGM
FT                   LTEIRSTSDIIENLMKESKQVASNLVIQ"
FT   gene            complement(389230..389388)
FT                   /locus_tag="LMHCC_0376"
FT   CDS_pept        complement(389230..389388)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0376"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38735"
FT                   /protein_id="ACK38735.1"
FT                   /translation="MGKYFIIILIALAINGVSILFHNDIASLIAVLITAVLLIYLMVDL
FT                   TKMYRRK"
FT   gene            complement(389414..389803)
FT                   /locus_tag="LMHCC_0377"
FT   CDS_pept        complement(389414..389803)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0377"
FT                   /product="glyoxalase I/lactoylglutathione lyase"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38736"
FT                   /protein_id="ACK38736.1"
FT                   /translation="MTAKMLHTCIRVKNLTDSINFYEKALGLKEVRRKDFPDFEFTLVY
FT                   MAFEEGGFELELTYNYDQKEAYDLGNGYGHLAVGVPDVRALLKEHQAAGYTVTDLKGLP
FT                   GEDPFYYFLTDPDGYKTEIIQDGAL"
FT   gene            389905..390552
FT                   /locus_tag="LMHCC_0378"
FT   CDS_pept        389905..390552
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0378"
FT                   /product="metallo-beta-lactamase superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38737"
FT                   /protein_id="ACK38737.1"
FT                   /translation="MMDVKKGGSEMTKIKRIMTGIIQENCYIIYQDNLALIVDPGDEAS
FT                   KIEAEIAKLEVKPVAVLLTHCHYDHIGALEEIRTTYNIPVYVSPLEQEWLSNPELNLSA
FT                   HIAGKAIIAQPAENEFTLGEYNIEGFQFKVVPTPGHSIGSVSFIFDDFVVVGDALFKGS
FT                   IGRTDLYTGDFDMLINSIKTQLFVLPDELPAYSGHGDATTIGHEKKTNPYFN"
FT   gene            390618..391289
FT                   /locus_tag="LMHCC_0379"
FT   CDS_pept        390618..391289
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0379"
FT                   /product="cyclic nucleotide-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38738"
FT                   /protein_id="ACK38738.1"
FT                   /translation="MHSDEEIFKETTPKALLQLLKKDYYFHDYCYQEIIPRGKEIKMNN
FT                   SKGFKIYLVESGYFSYCLQNEYGDSGIISFVGGEIAINLVPIIKEEPEESVLRSLTEVH
FT                   CWVLDPDFVERVLDESGEKAKYLLSNLLYTRKVYFKASKRNFMKKERRIRACLKEIGLY
FT                   MGRVTKDKEFILPDEINNSILAQYANTTREYTNIIVLKLRKEGILDDSHKPWVIKKIDT
FT                   L"
FT   gene            391542..392237
FT                   /locus_tag="LMHCC_0380"
FT   CDS_pept        391542..392237
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0380"
FT                   /product="LapA"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38739"
FT                   /protein_id="ACK38739.1"
FT                   /translation="MNTLEKRQHEILTNPLHFCKKSGDFAKHSMSIKLSKNELFDVDFV
FT                   TGIYFVEKGIVMKGTQIDDYIGYDQLLKHGDVCNFSSFMSSDLKRNIGAKLLSPSSSVI
FT                   TAVDRDFFIFMVEKHISIEEFMLYQSKKEIMVLQRRCLLNTLKVKDRVKHVIAAIGYEY
FT                   GISNGDNIQIPQELSTTFLSKFMGITREYLSLTLSELKKEGYLLNTKIPVVINVEKLFN
FT                   EIPYESLIL"
FT   gene            392307..393185
FT                   /locus_tag="LMHCC_0381"
FT   CDS_pept        392307..393185
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0381"
FT                   /product="transcriptional regulator, AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38740"
FT                   /protein_id="ACK38740.1"
FT                   /translation="MSEYLEIPELNKAFPFRSFVNEGEVLVYPHWHKEIEIIYALKGSL
FT                   NLGVNDMPIQLKEGEIQVINGGDVHYFLASPSSERVVIQFDLSLFQEEMQMDDQMQTLR
FT                   EMLTEMAHLSREWPEETVAKMQSLIMNIHEESSGEKPGKHYILKADLLAIIGLIYREIP
FT                   QIKTQPDSVISEEAVLKSQETLHKLDQIFSYVEKHYQEPVSLQEVANYTGFSTYYFTKF
FT                   FKRNTGMTFVTFLNDYRLNKAKWMLLNEAFPVTEVAELAGFSSVKTFHHAFKRAMGVAP
FT                   LKYRKTIYGNN"
FT   gene            393260..394336
FT                   /locus_tag="LMHCC_0382"
FT   CDS_pept        393260..394336
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0382"
FT                   /product="oxidoreductase, Gfo/Idh/MocA family"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38741"
FT                   /protein_id="ACK38741.1"
FT                   /translation="MTLKVGIIGCGGIANGKHMPSLLKAEKAEMVAFCDIVLEKAEAAA
FT                   KEFGGENASVYTNYVELLQDKSIDVIHVCTPNISHAEISIAAMEAGKHVMCEKPMAKTT
FT                   AEAKSMIEAAERTGKKLTIGYQNRFRKDSDYLHQVCENGELGDIYYAKAKAIRRRAVPT
FT                   WGVFLDEEAQGGGPLIDIGTHALDLTLWMMDNYKPKYVVGNSYHQLAKKENAANAWGSW
FT                   DPSKFTVEDSAFGFITMENGATIVLEASWALNTLDVGEARTSLSGTEGGADMEDGLRIN
FT                   GEAHSQMYEKKIQLEAGGVDFYDGTGDDPALIEAEQWLAAIENNTDPVVKPEQALVVTQ
FT                   ILEAIYESSKTGQPVYFN"
FT   gene            394352..395092
FT                   /locus_tag="LMHCC_0383"
FT   CDS_pept        394352..395092
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0383"
FT                   /product="sugar phosphate isomerase/epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38742"
FT                   /protein_id="ACK38742.1"
FT                   /translation="MKAKIALQLWSVKEACEDDFFGTLEKVAEMGYDGVEFAGYYGKSA
FT                   SEIKAKLAELGLEVAGSHISKEQLEEDLENVILFERELGNEYIICPYADFKTKQEWLTF
FT                   SEKLREITKTVQQAGMHFGYHNHAHELDKLENEIILDNLLKNVPEMVAELDTYWIEYAG
FT                   IGVIPFIEKYRNRVPLIHIKDKSNANKESTIIGEGVLDVPGFVKTALQSGTTWLIIEQE
FT                   AFMQDPLTSVAKGYTYLANVLEEN"
FT   gene            395094..395816
FT                   /locus_tag="LMHCC_0384"
FT   CDS_pept        395094..395816
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0384"
FT                   /product="trehalose utilization protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38743"
FT                   /protein_id="ACK38743.1"
FT                   /translation="MTRVTVWNEFLHEKEDDAVLAIYPDGIHGQIASFLKKAGIDAGTA
FT                   TLEEPEHGLTEEVLANTDVLIWWGHMGHDRVEDKIVDRVQKRVLEGMGLVVLHSGHMSK
FT                   IFMRLMGTSCDLKWREANERERLWVVDPTHPIAKGIGEFIELDEEEMYGEHFDIPTPDE
FT                   LIFLGWFEGGEVFRSGITYKRGNGRIFYFQPGHESYPTYHHPDIQQVIINGVHWCAEGR
FT                   KNYPAYGNHQPLEKIGRK"
FT   gene            395819..396787
FT                   /locus_tag="LMHCC_0385"
FT   CDS_pept        395819..396787
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0385"
FT                   /product="sugar phosphate isomerase/epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38744"
FT                   /protein_id="ACK38744.1"
FT                   /translation="MKLGVFTPLFANLSLEEMLDKVKAAGLDAVEIGTGGNPGNHHCPT
FT                   DELLASEAARKEYLEKFTSRGLTISAFSCHDNPISPNKEEAAASDEILRKSIKLASLMN
FT                   VPVVNTFSGTAGDSDDAKAPNWPVIPWPTVYSDIKTWQWETKLIPYWKEIGELAAASGV
FT                   KIGIELHGGFLCHTPYTILKLREETNDSIGVNLDPSHLWWQGIDPVGAIKILGKAGAIH
FT                   HFHAKDTYLDQDNINMYGLTDMQPYGDVQTRSWTFRSVGCGHSLTEWSDIMSALRTYGY
FT                   DYVVSIEHEDPLMSIDEGFDRAVTNLQSILIKDKPLDMWWA"
FT   gene            396810..397859
FT                   /locus_tag="LMHCC_0386"
FT   CDS_pept        396810..397859
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0386"
FT                   /product="oxidoreductase, Gfo/Idh/MocA family"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38745"
FT                   /protein_id="ACK38745.1"
FT                   /translation="MKKYQLVIVGYGGMGSYHVTLASAADNLEVHGVFDILEEKREAAA
FT                   EKGLKIYESFEAVLADEQVDAVLIATPNDSHKELAITALEAGKHVVCEKPVTMTSEDLL
FT                   AIMDVAKKVNKHFMVHQNRRWDEDFLIIKEMFEQKTIGEMFHLESRVHGANGIPGDWRH
FT                   LKAHGGGMVLDWGVHLLDQLLFLVDSNVKSVSANLSFALGDEVDDGFVTFITFENGITA
FT                   QIEVGTTNFIKLPRWYVKGTEGTGIIHDWDLSGEIVKPTALAKTSEPTPIKAGQGLTKT
FT                   MAPPSEEATNTLSLPAPAKLAPSFYNNFVDVLNNTSEPIVQNEEVYQVLKLIEAIFEAA
FT                   ETNRTIHSI"
FT   gene            397953..398138
FT                   /locus_tag="LMHCC_0387"
FT   CDS_pept        397953..398138
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0387"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38746"
FT                   /protein_id="ACK38746.1"
FT                   /translation="MSEDKGMKDKAKGLKDKVVGDAKDKFGKATDDKGKQVEGKAQKAK
FT                   GEVEDKTGDAKKKLSE"
FT   gene            complement(398313..398630)
FT                   /locus_tag="LMHCC_0388"
FT   CDS_pept        complement(398313..398630)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0388"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38747"
FT                   /protein_id="ACK38747.1"
FT                   /translation="MLLAAVLLTVCAIWEYAMPTDAAVKSYYVKVEDAGKPVQKNQFKG
FT                   FKYVSNVYDDKGKQKQLTFYSEKELTKDEQFKVLVGENKMVVNYKKIKNVPDKIKYLAE
FT                   K"
FT   gene            399192..401483
FT                   /locus_tag="LMHCC_0389"
FT   CDS_pept        399192..401483
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0389"
FT                   /product="ribonucleoside-diphosphate reductase, alpha
FT                   subunit"
FT                   /EC_number="1.17.4.1"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38748"
FT                   /protein_id="ACK38748.1"
FT                   /translation="MKWGLQMTTYIVKDGGNRKLPFDKSRLDGYLEKIHEEFPKLDLED
FT                   YKRKVFNFVEKKEDYAADELVDYLIREAEARTDIHIPEWEHFAARLYLNKLYKKASKNR
FT                   FYNDDDKYGSYVGLQESLGERGIYSGNILKNYSKEDLIAAGKLIDPEKDKLFTYNGLYL
FT                   LATRYLATDSERNVYELPQERWLTIALYLMQNEPKEKRMKLVEEAYWALSNLYMTVATP
FT                   TLANAGKVGGQLSSCFIDTVDDSLQGIYDSNTDVARVSKHGGGVGAYLGYVRSTGAAIR
FT                   GVKGASGGVIPWIKQLNNTAVSVDQLGQRKGAIAVYLDVFHKDIESFLDLRLNNGDQRL
FT                   RAHDVFTAVCIPDIFMEAVERRGEWYLFDPHEVKAKKGWYLQDFYDETKGEGTFREKYD
FT                   ELVADETISKKIVKAIDIMKRVMMSQLETGNPFMFYRDEVNRMNPNKHEGMVYSSNLCT
FT                   EIMQNMSPTKMIQEIISGDQIVITKQAGDFVVCNLSSVNLGRAVVAEEGTLERLIEVEV
FT                   RMLDNVIDLNELPVPQATITNQKYRSIGLGTFGWHHLLALKNIAWDSEEAEKYADELYE
FT                   QINYLAIRASNKLAQEKGAYKVFKGSDWNTGEYFARRNYNSPEWQELAKEVAEKGLRNA
FT                   YLVAVAPNMSTAQIAGSTASIDPIYSAFYYEEKKDYRRPVIAPDLNLSTYPYYEKGAYK
FT                   VDQFASVRQNGRRQRHVDQSLSFNFYVPSGIKASKLLELHMTAWNEGLKTTYYVRSNDI
FT                   DVEECEWCSS"
FT   gene            401539..402588
FT                   /locus_tag="LMHCC_0390"
FT   CDS_pept        401539..402588
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0390"
FT                   /product="ribonucleoside-diphosphate reductase, beta
FT                   subunit"
FT                   /EC_number="1.17.4.1"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38749"
FT                   /protein_id="ACK38749.1"
FT                   /translation="MANQKEQLTRIKILEPLFPNRSTSIINGETSGILNWNDIPYPSFY
FT                   RAYKELSTNYWIPDEVDMKSDAKQYPALSEQEKYAFDAIIGLLATLDSPQTRFIYNIAE
FT                   YITDPAVHANAAIIAQQEVIHNESYSYVLASITNLQEQNRVFELARTHPTIIKRNEPIM
FT                   DAYDDFMNNKTGETLVKALIQSSILEGINFYSGFAYFYNLVRQNKMTGTGKIISFINRD
FT                   ELAHSKFISEVIRAILGENPELQTEELVEYTHEAFRHAVELETEWSEEVLQGIEGIDVE
FT                   EMVDYVKYRANKMLGMLGIPELYPGHSDNTMTWIKAYADNFTETKTDFFEMRNSSYKKT
FT                   NMDNGFDDL"
FT   gene            402630..403022
FT                   /locus_tag="LMHCC_0391"
FT   CDS_pept        402630..403022
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0391"
FT                   /product="ribonucleotide reductase-associated flavodoxin,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38750"
FT                   /protein_id="ACK38750.1"
FT                   /translation="MVADEIEERLISEGHEVVSFRVSPLAEYPLDEDFDLYVLGAWTVD
FT                   YGRTPPDMKDFIAELAVKPKNVAIFGTGETQWGMDFYCGAVDRMAKYFGTSYPTLKIEQ
FT                   MPHTEQDVADIDNWVKKILALRSGIK"
FT   gene            403019..403345
FT                   /locus_tag="LMHCC_0392"
FT   CDS_pept        403019..403345
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0392"
FT                   /product="thioredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38751"
FT                   /protein_id="ACK38751.1"
FT                   /translation="MTSIEIKTPEEFQAHLNGEELVYVDYWKDNCPNCKMLDLSFAEFK
FT                   NSEIASKVKVLKVKLEEMGENFFFDRDVQQTPTLVLYKGGEEIHRLNGFIPPNKIEEAI
FT                   SLNA"
FT   gene            403424..403723
FT                   /locus_tag="LMHCC_0393"
FT   CDS_pept        403424..403723
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0393"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38752"
FT                   /protein_id="ACK38752.1"
FT                   /translation="MKHLQNEITTFLKERDWLEQYNHPKDLAISLSLEASELLECFQWK
FT                   TDEVALKENREEILKEVADVMIYALQIAESMGADGEELVRSKLAENRTRTWPKK"
FT   gene            complement(403770..403946)
FT                   /locus_tag="LMHCC_0394"
FT   CDS_pept        complement(403770..403946)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0394"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38753"
FT                   /protein_id="ACK38753.1"
FT                   /translation="MKLAGLVILLIGLIGFGFSFSITGLIGFGVCIISVILVVAGIFAI
FT                   IRSKKRRKRAYSY"
FT   gene            404145..404462
FT                   /locus_tag="LMHCC_0395"
FT   CDS_pept        404145..404462
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0395"
FT                   /product="MazG nucleotide pyrophosphohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38754"
FT                   /protein_id="ACK38754.1"
FT                   /translation="MDFKEYQILANRTAATHEQALTNYGLGIAGEAGEVADLIKKYAFH
FT                   GHDLDKDALTKELGDVLWYVSQIAKWADISMETVAELNIEKLKRRYPQGFSAERSKLHI
FT                   D"
FT   gene            complement(404506..405147)
FT                   /locus_tag="LMHCC_0396"
FT   CDS_pept        complement(404506..405147)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0396"
FT                   /product="membrane protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38755"
FT                   /protein_id="ACK38755.1"
FT                   /translation="MTKSIWICRAFLLGYFLVLHFTADTYTFLILNVGLAYIPFEIAVF
FT                   LTRKPRVWWIFWPLGIVWLVFFPNAPYLLTDLLHLKRLEIYGAEGILSTSPWLWRHFTY
FT                   IVVGVFFGLFIGFWSFAKMLAEIRRRFNWTSWLSYQLLLIGLILLSSYAIYIGRFSRLH
FT                   SIHLLTQPIDSIQIMFSVFHWPFWNFVFYFSIIQYVIYTLFSRFSSSLED"
FT   gene            complement(405203..406210)
FT                   /locus_tag="LMHCC_0397"
FT   CDS_pept        complement(405203..406210)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0397"
FT                   /product="membrane protein"
FT                   /note="similar to membrane protein Lmo2147"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38756"
FT                   /protein_id="ACK38756.1"
FT                   /translation="MSQVLFKTKTFWYGIALTFCIATLSYFLAKLPFLMILGQLVTAIL
FT                   IGIIIRALFPVPDKWFTGIQFSNKVILRAGIILLGFRLNLVDIYDAGWRVFLIAALCLS
FT                   FGITVVYFLAKLFGVDKKLAILVACGTGICGAAAVVAISPQVKADNNQTAVAATIIALL
FT                   GTIFTIVYTLIYPILPLGPDGYGIFAGATLHEIAHVIAAADPGGTGAVDMAVIVKLTRV
FT                   ALLVPVCFVVAKMVNAGTNNRFSWAELPVPWFIFGFLATSAINSFGIIPASITNFLVVC
FT                   AYFLIAMSMGGLGLNVHLPSFGKMGGKPFAAAFIGSILLSAFGLILVLLFHLAG"
FT   gene            406316..407170
FT                   /locus_tag="LMHCC_0398"
FT   CDS_pept        406316..407170
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0398"
FT                   /product="transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38757"
FT                   /protein_id="ACK38757.1"
FT                   /translation="MDEALRTYIRVVELQSFTKAAEELHISQPAVSLQLKKLEERYETE
FT                   LIYRQAKKFVLTATGEMLYHRAKQLEGLYKQVEDEISLYHHHLKGRLRIGASFTIGEYY
FT                   MPALIAEFHARYPDITIELIIENTAKIADKVELFQVDAGLIEGQVSKKDLEISAFADDE
FT                   MCIVGRADGSLAEIEQGATWIAREEGSGTREYLDHVLSTNGWNVTEKVVAWSNMAVKQM
FT                   VLEGMGYTVISRCVVKTEIAEGKLRVFNEAGSFMRKFSVLKNKQRLENRIAETFLTFLK
FT                   ENR"
FT   gene            407239..408255
FT                   /locus_tag="LMHCC_0399"
FT   CDS_pept        407239..408255
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0399"
FT                   /product="regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38758"
FT                   /protein_id="ACK38758.1"
FT                   /translation="MKEYFIDRSYKASMGIANAVLVTLGIGLLLQTIGQMTGISFLVTV
FT                   GAIGKTMLIPGIGVGIAMCLHANTLVTISAAASAVIGGGAVVTLAGGGVGITSGEPVGA
FT                   ILAVIVAVWTGKRVTGKTKFDMILIPGVSLLAGGLSGILFAKIMAPILASVSLGISSLI
FT                   GGSPLISSMVIAFVFGLLILSPASSAALAIALQLDPTASAAALIGCSVQFVSFAVLSYR
FT                   DNNWGAFFAQLICTPKLQTPNIIRKPSLMLVPLLTTLIAGPLGVMVFHIQAASEVAGLG
FT                   LCAFVAPLYLIANYGFSTLAAFILVAVVLPGVIALIVRPFLIKKERLKTGDLTIELQ"
FT   gene            408370..409104
FT                   /locus_tag="LMHCC_0400"
FT   CDS_pept        408370..409104
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0400"
FT                   /product="transcriptional regulator, GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38759"
FT                   /protein_id="ACK38759.1"
FT                   /translation="MVRKLNKMYDASPLYAQIADDLRDKIQSEVWQTGDKIPPELDLCE
FT                   LYNVSRITVRKAIDELVRENLLYRERAKGTFVRDWEEAEDEHFTLVRSFTNEMKELGKK
FT                   AATLHAEVEVINADKKIALQLGLSVGDKVLQIKRLRGTKDLAFALFISFIPYNQDYSLK
FT                   AEDYYGSFYEYLKGFGIVVNQEKEYIEAMLPNREVQEALAIDKQEPILKRVRMTKQKES
FT                   DFREYSECFYVGKHYRYYIDFE"
FT   gene            complement(409144..410886)
FT                   /locus_tag="LMHCC_0401"
FT   CDS_pept        complement(409144..410886)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0401"
FT                   /product="mannose-6-phosphate isomerase, class I, putative"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38760"
FT                   /protein_id="ACK38760.1"
FT                   /translation="MTTYDLAPEVKIHQFDGAWAGYKDIATELRTAIQKKKQDQTIVAI
FT                   ECYPGTRNEEIAAELLPLLPVEKAVFADDWALNNEEVTATIQSHLTDDRVFGIMSHYEV
FT                   SDFYPAEKLAEIQAEIAASKGLVVIYGTGATVIAPKPDILIYADLARWEIQCRYRGENK
FT                   PNWKADNAGEDALRKFKRGYFFEWRMADRQKKKIYQQVDYLLDTNKKNEPKMVRGEDYR
FT                   NGLNQVSKAPFRVVPYFDASVWGGQWMKNNFGLDPAADNYGWAFDGVPEENSLYMRFGD
FT                   IRVEVPSTNVVNHFPNELLGPKVHSRFGTEFPIRFDYLDTVGGGNLSLQVHPLVEYAQD
FT                   KFGIHYTQDESYYILEADSDSTVYLGTKEGTTKEAIMADLEKAAEGNYRFPDEEYINVF
FT                   PVKKHDHILIPAGTIHCGGPSTVVLEISATPYIFTFKLWDWERTGLDGMPRPVHLAHGR
FT                   ENLQLDRDTKWVKDNLINQFETLHEDNDSKVERTGLHELEFIETHRHWFKETVTIHTNE
FT                   SVNMLNLVEGTSAVVESIDDSFAPFEVHYGETFIVPAIVGTYQIRNTSDNEEVAVIQAF
FT                   VRNL"
FT   gene            411099..411764
FT                   /locus_tag="LMHCC_0402"
FT   CDS_pept        411099..411764
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0402"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38761"
FT                   /protein_id="ACK38761.1"
FT                   /translation="MEKSGFVADPIYGEIKNEIMANTLENGEKVDIEDIMKRFQVSKRV
FT                   AFSALHCLHKSGIVCKNIGESGFSVAVNSEAEHREKSRLKLAFFHLNYAVQKLQEQDAE
FT                   VCATCLRKELVYIKLAAKEQDTDVFINHVKNFYACMIHYTEMPAMEKNIDILSQTLRNM
FT                   KEKNEKLFFEAFTIDVSQALEDLVTHLEAKEFEKCHSVIQHFYDKNISILFSESKNPV"
FT   gene            complement(412350..412823)
FT                   /locus_tag="LMHCC_0403"
FT   CDS_pept        complement(412350..412823)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0403"
FT                   /product="acetyltransferase, gnat family"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38762"
FT                   /protein_id="ACK38762.1"
FT                   /translation="MQIRLSKREDAASMIELEHLVWTPGTTPGSIHFDSEAEFLLKSPP
FT                   GSKIVVVADDKVVGILGYKSPIPLASNKHVAEIDIAVHPDYQRAGIGQLLMDKMKEVAR
FT                   EKGFIKISLRVLSINQKAIRFYEKNGFKLEGRLEKEFIIQGEFVDDILMAYFL"
FT   gene            complement(412840..414060)
FT                   /locus_tag="LMHCC_0404"
FT   CDS_pept        complement(412840..414060)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0404"
FT                   /product="ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38763"
FT                   /protein_id="ACK38763.1"
FT                   /translation="MITKQVYKRRVKTKSFLISLLFPVLIAGLIAGIPKMVDYFDSSSD
FT                   ITKIAVLSEDPVFAKSLAADKNHFKVNSDIKDKKSAQSALKDGKIDGFVTITQKDETVS
FT                   AVYTTQETAGQDVITRLTEDLTATKIAEKAAAYKITNEQLQSITSPVSVTNDLESNNQL
FT                   TNHEKDVMSAAVLILTLVIFIFVMSYANIVASEIATEKGTRIMEVILSSVSATTHLFAK
FT                   LTAIIFMLLTQIGFYIVCGAIVLIAGRNTEMVQNVLDQIAVFPAYYLVLNLLFVILGLL
FT                   LYILLAAMIGSMVPNVETVAQFIYPMTILAIIGYWGSIAAANAPDNMLVIIGSYIPTFS
FT                   PMMMLARMDLLSVSTIGIFSSLAILLASVVGAFFLTVRLYQGNVLLYSNDGLWKTWKTS
FT                   LSYAKRK"
FT   gene            complement(414068..414970)
FT                   /locus_tag="LMHCC_0406"
FT   CDS_pept        complement(414068..414970)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0406"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38764"
FT                   /protein_id="ACK38764.1"
FT                   /translation="MTLELHNVTKNFGTKVAVNDLSFRVEPGKILGLIGQNGAGKTTTF
FT                   RLILHFLEATSGKITWDDKEVSKIDPNIIGYLPEERGLYPNVTIEEQLIFFAELKGYPK
FT                   QKIKAEIDGWLERAEIVGKKTDLIKTLSKGNQQKIQLLSTIIHQPKLVILDEPFSGLDP
FT                   VNAEILKKFVFDLRASGAAIIFSSHRMENVEELCDSLLMLKKGNVVLQGTTESVKSVFG
FT                   RKRILIESRHTADELAVLPGVLNVQTHRDGVLQLEIAHESDAEKIFDYVTKDGFIQTFS
FT                   LQAPTLEEIFKWKAGELNE"
FT   gene            415165..416622
FT                   /locus_tag="LMHCC_0407"
FT   CDS_pept        415165..416622
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0407"
FT                   /product="DNA-binding/PRD domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38765"
FT                   /protein_id="ACK38765.1"
FT                   /translation="MLLTKTERALINLFLTKNDFLTAKQLAEILDVSSKTIYRKIKNIN
FT                   ETTERKDIIISEKGRGFKLDYKAYIQAKLETTGDIFGYTPTERREKILLQVLFKSPKYL
FT                   NVTALYEDYYVGYNSIKNDFALLNQAIEKYELALEKRQKEIRVVGSEENIRTAINEVIN
FT                   NIDLSTYDDLKTEYSDLNKADVRFIVRQMEMIENKLMISIPYPYDINIFSHLYILINRF
FT                   RQGEVEDFKESDDAYIVTNEKLHTIAVEAIEAIEQYLKMQLPKRETFHFLQYLISSRFN
FT                   HEIELVPSKVLPIVEEMTDFYINQVAVKMNVPINKKQLKIELLSHMKPMVNRMNHQIHI
FT                   KNNLLSDIKLEYGELFEIIKETARDVAKTFKLNTISDDEVGYITIYFAKHIEASPLVKR
FT                   IIIMCSSGIGTSELLKVKVQKAFPDVEIVDVLSSTRFKNSLHDYQNIDFILTTINAEST
FT                   KEIPSLLVSAMFTEKDKIMVKKLMESL"
FT   gene            416634..417107
FT                   /locus_tag="LMHCC_0408"
FT   CDS_pept        416634..417107
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0408"
FT                   /product="PTS system, fructose-specific IIA component"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38766"
FT                   /protein_id="ACK38766.1"
FT                   /translation="MDIQELDISKVISPALVNLDLHATTKLGVIEELTDLLVETGAVAD
FT                   KDAFIADVLYREEEGKTGLGEGVAIPHGKSASVTSTSIAVGRTKNPVEWESLDDKPVNI
FT                   IILFAVKNSDATTTHIKLLQKVAILLADDEVISQFQTVQTKEDFIKLLAKNQD"
FT   gene            417120..417431
FT                   /locus_tag="LMHCC_0409"
FT   CDS_pept        417120..417431
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0409"
FT                   /product="PTS system, fructose-specific IIB component"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38767"
FT                   /protein_id="ACK38767.1"
FT                   /translation="MNIIGIAACTSGIAHTYIAKEKLTKAGTALGHNIHIETQGTIGIE
FT                   DELSAEQVKNADVVIIAADIKISGKDRFKGKRVVEIPTDLAIKAPKQIINKIDKEINN"
FT   gene            417445..418542
FT                   /locus_tag="LMHCC_0410"
FT   CDS_pept        417445..418542
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0410"
FT                   /product="pts system fructose-specific eiibbc component
FT                   (eiibbc-fru)"
FT                   /EC_number="2.7.1.69"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38768"
FT                   /protein_id="ACK38768.1"
FT                   /translation="MMKKLQIKKHALTAISYMLPLVVASGLLIAIGNLTNGQVIENYKA
FT                   PYSIPDALVSLGVLGMGLLAPVIAGAIAYSIADRPGIAPGLLMGLIANSIGAGFLGGML
FT                   GGYLVGYFVLILVKYLKVPKWAQGLMPMMIVPLISSLVVGLLMYFVVGVPIVWATEAMT
FT                   SFLQGMQGSMRFVFGAVLGAMAAFDFGGPVNKVASLFADGLLLEGVKEPEAVKILASMV
FT                   PPFGVTLSWVVSKLIKKKKYTKSEEDNIKIAFPMGICMITEGVIPIAAVDPIRVIISCT
FT                   LGAAVGGGLSMTWGIGSPVPSGGMFIVPAMNEPLLFCLALLIGTCVTAAMLLILKREPT
FT                   KEEELIADQGLEEEDEIDLSGIKIS"
FT   gene            418560..419414
FT                   /locus_tag="LMHCC_0411"
FT   CDS_pept        418560..419414
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0411"
FT                   /product="fructose-bisphosphate aldolase, class II family"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38769"
FT                   /protein_id="ACK38769.1"
FT                   /translation="MYVSMKGMLERANKKYYAVMAINCFNLETARAAIDAAQELRAPII
FT                   IDLLQDHLTSHLGSRFLTKPIIKMAEEASVEVAINLDHGHDVAIVKQCLADGFSSVMMD
FT                   ASSHPYEENVAITKKMVEFAEVYCASVEAEVGSIGAVTGDNYTNQEMYTNPKVAIDFAK
FT                   RTGIDALAISYGSSHGDYPEGFTPAFQFDIVREIKAATNMPLVLHGGSGCGAENIRESV
FT                   RLGINKINVGSDFMKAQANQLKANLEANPTKNYVDLIHETIKAGKETVKNYIQLSGSTG
FT                   KSL"
FT   gene            419431..420330
FT                   /locus_tag="LMHCC_0412"
FT   CDS_pept        419431..420330
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0412"
FT                   /product="fructose-bisphosphate aldolase, class II family"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38770"
FT                   /protein_id="ACK38770.1"
FT                   /translation="MLVNMKQLLEVAKENKFAVGAFNVADSNFLRVVVEEAEKNNAPAI
FT                   IAVHPTELDFTKDDFFQYVLARIKNSPVPFVLHLDHGDNMGDVMRAVRCGFSSVMIDGS
FT                   LLPFEENIRVTKEVVEVCHKLGVSVEGELGTIGKTGNSIEGGVSEIIYTKPEEAEEYIS
FT                   RTGVDTLAVAIGTAHGIYPKDKEPKLRLDILKEIKDLVHIPLVLHGGSANPDAEIAAAV
FT                   EIGIQKVNISSDYKYAFYKKCREILSTTELWDANAIYPDCIDAAKEVVKYKMELFRSIG
FT                   QVEKYQQAKTPAWRSELI"
FT   gene            complement(420505..421071)
FT                   /locus_tag="LMHCC_0413"
FT   CDS_pept        complement(420505..421071)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0413"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38771"
FT                   /protein_id="ACK38771.1"
FT                   /translation="MYLKETLDQFASIDNILKLLKKNPSFNKHCIQERLPQKTIITTNK
FT                   QRKYIYIIEEGFMKLIFDENKPRDFSYILSKGALPFLPVYTEDIPQHIKMVALTDIVWW
FT                   KIDIGFFKSTMEFEDPQNYLMLHQLAETRKRFYIIAYQEKLTSRESIYYSLNTLIELGL
FT                   RISEKVVELPGFFNLPNPCRPCEYF"
FT   gene            421551..422252
FT                   /locus_tag="LMHCC_0414"
FT   CDS_pept        421551..422252
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0414"
FT                   /product="cyclic nucleotide-binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38772"
FT                   /protein_id="ACK38772.1"
FT                   /translation="MQSVFEDLYSKKILEEEFGYASFLQTLIDNRIPYKKTRIPTNMIL
FT                   LTEDTINTKVYFIEKGIVSLEKNKNVISFLGSNQIAGLNDYFMAEANVYTARVIETITA
FT                   YEFDKEDIICSIIGMQEGWLYLYLNNRNHENVLIEKCNLMRGNGESRLKDSLKQIGKYF
FT                   GSEKEGALRIPKCFTKKIIANYSNLSVRSVTHLCRNLVESGFLAENSKSFVLLNNITNS
FT                   YARLEPEATTI"
FT   gene            complement(422362..422434)
FT                   /locus_tag="LMHCC_T039"
FT   tRNA            complement(422362..422434)
FT                   /locus_tag="LMHCC_T039"
FT                   /product="tRNA-Lys"
FT                   /note="tRNA-Lys-1"
FT   gene            complement(422441..422515)
FT                   /locus_tag="LMHCC_T019"
FT   tRNA            complement(422441..422515)
FT                   /locus_tag="LMHCC_T019"
FT                   /product="tRNA-Gln"
FT                   /note="tRNA-Gln-2"
FT   gene            complement(422527..422610)
FT                   /locus_tag="LMHCC_T062"
FT   tRNA            complement(422527..422610)
FT                   /locus_tag="LMHCC_T062"
FT                   /product="tRNA-Tyr"
FT                   /note="tRNA-Tyr-2"
FT   gene            complement(422620..422693)
FT                   /locus_tag="LMHCC_T057"
FT   tRNA            complement(422620..422693)
FT                   /locus_tag="LMHCC_T057"
FT                   /product="tRNA-Thr"
FT                   /note="tRNA-Thr-2"
FT   gene            complement(422851..422922)
FT                   /locus_tag="LMHCC_T020"
FT   tRNA            complement(422851..422922)
FT                   /locus_tag="LMHCC_T020"
FT                   /product="tRNA-Glu"
FT                   /note="tRNA-Glu-1"
FT   gene            423256..425079
FT                   /locus_tag="LMHCC_0416"
FT   CDS_pept        423256..425079
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0416"
FT                   /product="APC family amino acid-polyamine-organocation
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38773"
FT                   /protein_id="ACK38773.1"
FT                   /translation="MASPLKRLLIGRPLKTSEAGDQKLGKLKALAVLSSDALSSIAYGT
FT                   EQILLVLVTVSAAAMWYSLPIALCVLVLLFALNLSYKQIIYSYPHGGGAYIVSRENLGN
FT                   NAGLIAGGSLLVDYMLTVAVSVSSGTDAIVSAVPSLYPFAVPIAVLLVVGVTIINLRGI
FT                   TESASLLAIPVYLFVFSIIALIFTGLFKVLTGMDASHETAAVGTHVQGVTIFLLLRAFA
FT                   SGSASLTGIEAISNAVPLFKEPRPKNAAKTLTLMAGLLGFFFVGITVLAFVYGTVPELK
FT                   VTVLSQIAENVFGRNFMFYFIQATTALILVLAANTGFSAFPMLAFNLAKDKFMPRMYLA
FT                   RGDRLGYSNGIITLAVGSILLIILFKGKTELLIPLYSVGVFIPFTLSQTGMIVKWWKQR
FT                   PKGWKKSLSANLLGASISFTVLLVLFLTRIESVWPVFVFMPIMIYVFHRTRHHYRKVGP
FT                   QLRIDETMDLPDFKGNAVIICVSDTTKVVEGALQYAKSIGDTVIAVHISIDKKQEKEFV
FT                   ERWNRVHPEVRMANLFSPYRSISDPLMKFIDTAKQKADQDNYSLTVLIPQFIPRKGWQN
FT                   VLHNQTSLLIRTRLLMKRDVVVSTYPYHLKE"
FT   gene            425745..425912
FT                   /locus_tag="LMHCC_0417"
FT   CDS_pept        425745..425912
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0417"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38774"
FT                   /protein_id="ACK38774.1"
FT                   /translation="MNASSFPFISFLTTALVAIAIGIIIGGIHQLSRVIIKSYQQTKER
FT                   RVSQKKWQTL"
FT   gene            426051..427016
FT                   /locus_tag="LMHCC_0418"
FT   CDS_pept        426051..427016
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0418"
FT                   /product="transcriptional regulator, LacI family"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38775"
FT                   /protein_id="ACK38775.1"
FT                   /translation="MATLADVAKRANVSKMTVSRVINHPDQVSDELKMLVYSAMEALEY
FT                   VPNYAARALVQNRTQVIKFLILEEIDTVEPYYMNLLTGISRELDKYYYSLQLVTQRSRN
FT                   IGAYDGLIVTGIRDKDYDLGLLDIDKPVIFYGENKRGYDSIDVDNKKGTALATEHMVEI
FT                   GFSRIVFLGIDLLDEQFMKSRLEGYEEVVRKHGLEPESYFIANSSSVAEEKAFELLRYN
FT                   SEKIAIVCASDRIAIGVVRAAAAFGRRFGENIAVTGFDGVFLDRISSPKITTVRSPVVE
FT                   MGEELAKMLLAKINDHGKPQGNLLFTPELLIRASTTGKEE"
FT   gene            complement(427053..427688)
FT                   /locus_tag="LMHCC_0419"
FT   CDS_pept        complement(427053..427688)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0419"
FT                   /product="caax amino protease family protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38776"
FT                   /protein_id="ACK38776.1"
FT                   /translation="MENTLSFKKQGYWLFSSAIIIGVLFLLLPHIISNIGVLEFIGAFF
FT                   NALCMGVIAFIILKAEFLDWFKHFSFKWILIGAPALIIISSIFNIAWAYFAGSTTENGI
FT                   NSVLTWSYVFTSIPFMLLGEELLSISLLYAAWKKWNWKFWQASLLCSLLFATWHLTSYD
FT                   FNFLQCIITLAPARLILNYLFKKTNSIWVTFIVHFIFDFIAFLPVLLK"
FT   gene            427946..429721
FT                   /locus_tag="LMHCC_0420"
FT   CDS_pept        427946..429721
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0420"
FT                   /product="neopullulanase"
FT                   /EC_number="3.2.1.135"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38777"
FT                   /protein_id="ACK38777.1"
FT                   /translation="MEKAGIYHQPASSYAYSYDAKTLHIRIRTKRLDISEVTLIAADPY
FT                   LWKDGKWQSESYTMRKIAETEEHDYWFFAITPEHRRLQYGFLLTDTKGEKTFYGGRGFF
FT                   EPTEANLDTMDYYFKFPFIHAVDTFEAPEWVGKTIWYQIFPERFANGNPAISPENALPW
FT                   GSKDPNTTDFFGGDIEGIIEHLDYLAELGINGVYLTPVFEAPTNHKYDTVDYKKIDPHF
FT                   GDKETFRKLVQEAHKRGIRIMLDAVFNHIGDTSAEWQDVVLNEEKSAYRDWFHIHSFPV
FT                   RQNENGNIEGEPTLSYDTFAFTTHMPKLNTANPEVQKYLLDIATYWIREFDIDGWRLDV
FT                   ANEVDHAFWKEFKKAVQAEKEDIYILGEIWHDSWIWLLGDEFHAVMNYPFTQTIIENFI
FT                   EEKITPEQMVSGINEQYMRYPNQVNEVMFNMLDSHDTARILTRANNDEDKVKQALAFMF
FT                   AHTGSPCIYYGTEIGMDGGNDPGCRKCMEWDETKQNQDMLAFTKQLIALRKDNQAIITS
FT                   GELTWLGASSETGITAFSKELNGEKLHFLFNQAKEDKDFTISFENTATDIWNNRAVTEN
FT                   LVVPAKGFLVIKENS"
FT   gene            429934..431193
FT                   /locus_tag="LMHCC_0421"
FT   CDS_pept        429934..431193
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0421"
FT                   /product="maltose/maltodextrin ABC transporter,
FT                   maltose/maltodextrin-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38778"
FT                   /protein_id="ACK38778.1"
FT                   /translation="MKRFKKVGIVSAVLVMALSLAACGGGKDTSKSGSSDEKTLTVSVD
FT                   AGYKDYVNKIKGDFEKDNDVKVKVVEKDMFETLEALPLDGPAGTAPDVMMSAFDRIGSL
FT                   GQQGHLAEVKLGNKDDYDEKDQKQVTIDDKIYGAPAIIETLVLYYNKDLLDKAPATFKD
FT                   LETLSKDSRFAFTSEKGKNTGFLAKWTDFYFSYGLLAGYGGYVFGDEGTNPKDIGLNNK
FT                   GSVEGITYATKWFQDVWPKGMQDNKSADDFIQDQFVKGKAAAILGGPWSAANYKEAKIN
FT                   YGVAKIPTLNNGKEYSPFAGGKGWVVSNYSKNKDVAQKWLDYVTNQKNQETLYDMTNEV
FT                   PANLKARDTAKSKNDELTNAVIEQYKNAQPMPNIPEMSEVWTGAENLMFDAASGSKTPQ
FT                   QSADDAVKVIEDNVTQKYTK"
FT   gene            431281..432588
FT                   /locus_tag="LMHCC_0422"
FT   CDS_pept        431281..432588
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0422"
FT                   /product="maltose/maltodextrin ABC transporter, permease
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38779"
FT                   /protein_id="ACK38779.1"
FT                   /translation="MKLEQKQIKNVRQATLLSIIPGLGQFYNKQNFKGIVFFALFALFI
FT                   IEFFAVGLNALIGLVTLGSVPGVDHSLFLMIEGTLQLIVTLLFIGFWFINIFDARRVAM
FT                   QWNLGETVNRSALAIIKNMLDKGFPYLLTLPAYLVMTFVIIFPVLVTLFMAFTNYDFYH
FT                   IPPANLIDWVGFKNFFNIFFLSSYRDTFLSVFSWTLIWTICATSLQIVVGVFTAIVANQ
FT                   SFIKGKRLFGVVFLLPWAVPAFITIMSFSNMFNDSIGAINSQVIPLLNHLPFVDINAIA
FT                   WKTDPFWTKVALISIQGWLGFPYIYVMVTGVLQAIPGELYEAARIDGASAIQRFRKITL
FT                   PMILFVTAPVFITQYTFNFNNFSIIYLFNEGGPGSVGAGAGSTDILISWIYKLTTGTSP
FT                   QYAVAAAVTLLISIIVITVSMIAFKKTNAFGNEEMM"
FT   gene            432589..433440
FT                   /locus_tag="LMHCC_0423"
FT   CDS_pept        432589..433440
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0423"
FT                   /product="maltose/maltodextrin ABC transporter, permease
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38780"
FT                   /protein_id="ACK38780.1"
FT                   /translation="MRDFMKDQRTTKFLTQFFTYLFLTVLTIIILYPILITASSAFKPG
FT                   NIAAFTLEWSDSWTLNNFTRLFNETLYLDWYKNTLIIAVVTMIMQVTIVTLAGYTYSRY
FT                   RFKGRKNSLIFFLIIQMVPTMAALTAFYVLAMLLGALDQYWFLTLIYIGGGIPMNTWLM
FT                   KGYFDTVPRDLDESAKLDGAGHFRIFAQIILPLVRPMIAVQALWAFMGPFGDFLLAKFL
FT                   LRTPENLTIAVGLQTFIANPQQQKVALFAAGAILAALPICLLFFFLQKNFVSGLTAGGT
FT                   KG"
FT   gene            433468..434301
FT                   /locus_tag="LMHCC_0424"
FT   CDS_pept        433468..434301
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0424"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38781"
FT                   /protein_id="ACK38781.1"
FT                   /translation="MKKVPFIIQYVKSTLGPTAIFEGRKVLKFWQMVIVFIFLNALLLL
FT                   PVSAHFANQSSFDLPSLMPKMATLGTDQLATEISGLTLENGALTDKNAHIVEKTANGVA
FT                   GVNLTKAELSGAKNVINFKDQEMTLTDASGYTFEVSYPKDATLSEITSGESLVDWVSAQ
FT                   WYLENQAFVFLSMVLMIGSIIFVSSLMLTVFTTLFIWMTKRSSFSSIASFKESVNLTLN
FT                   ALGIPVIAACIIGFIYFDITIIMAVQSLGMVLMIAWTFLKTRFYKTSEKSMAASR"
FT   gene            434317..436572
FT                   /locus_tag="LMHCC_0425"
FT   CDS_pept        434317..436572
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0425"
FT                   /product="maltose phosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38782"
FT                   /protein_id="ACK38782.1"
FT                   /translation="MAQKQLFEIEPWTLRTTKLDKENKRLQESLTSLGNGYMGMRGNFE
FT                   EGYSGDGHIGTYYAGVWFPDKTRVGWWKNGYPDYFGKVINGLNFIGIEVRLDGEKLDLF
FT                   VDEVSDFELVLDMEKGVLKRQFTVVKNNKTFRISAERFLSVATKELAVIHYQVEALSPA
FT                   KVELTSFLDGNVQNEDANYEEMFWQEVEKASSASRGSLVTKTIPNNFGTPRFTVSAVME
FT                   NKTNAANETNQTKALYAENYFQFDLQEKEVAQIEKRVVITTSRDYVEGEILPAGEKILK
FT                   SLEAKTYDELLAAHVSGWRERWDKADVEIAGDDSAQQGIRFNIFQLFATYYGEDARLNI
FT                   GPKGFTGEKYGGATYWDTEAFALPMYLSLTDKSVSHNLLKYRHDQLDGAKINAQKIGLA
FT                   GALYPMVTFTGVECHNEWEITFEEIHRNGAIAYAIYNYTNYTGDDSYLKTDGIEVLTEI
FT                   TRFWADRVHLSDRLDKYMIHGVTGPNEYDNNVSNNWYTNYIAAWTIRYTLENLDAEAKK
FT                   RLDVTEYEIAKWEDIEHRMYYPFDEKWQIFVQHDTFLDKELRSTDTLKPEDMPINQNWS
FT                   WDKILRSCFIKQADVLQGLYLFYDDFDTKQRNFEFYEPLTVHESSLSPAVHAVLASELG
FT                   KYDKAVELYKRTARLDLDNINNDTEDGLHITSMAGSWLSIVQGFAGMRVTAGELSFAPF
FT                   LPDGWENYRFKINFRNRLLEVKVEVGKVTVKLCHGEPIHLEMYKKEYLLETAITVEF"
FT   gene            436747..437568
FT                   /locus_tag="LMHCC_0426"
FT   CDS_pept        436747..437568
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0426"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38783"
FT                   /protein_id="ACK38783.1"
FT                   /translation="MDFSNMSILHYLANIVDILVVWFVIYKVIMLIRGTKAVQLLKGIF
FT                   IIIAVKLLSGFFGLQTVEWITDQMLTWGFLAIIIIFQPELRRALETLGRGNIFTRYGSR
FT                   IEREQHHLIESIEKSTQYMAKRRIGALISVARDTGMDDYIETGIPLNAKISSQLLINIF
FT                   IPNTPLHDGAVIIKGNEIASAASYLPLSDSPFLSKELGTRHRAALGISEVTDSITIVVS
FT                   EETGGISLTKGGELFRDVSEEELHKILLKELVTVTAKKPSIFSKWKGGKSE"
FT   gene            437565..438920
FT                   /locus_tag="LMHCC_0427"
FT   CDS_pept        437565..438920
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0427"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38784"
FT                   /protein_id="ACK38784.1"
FT                   /translation="MMDRILNNKWSIRIVALLLAAILFTSVNANNNNATTFSTTSSSDS
FT                   EVIENVPVKVYYDKTNLYISGIPETVTVTLSGPRSIVQSAKAQQDFTVYADLKNASIGT
FT                   QEVKLQVKDVSDRLKVKVNPATVNVNVQEKVTKKFSVDVELSKSVVADGYQAGTPIIDP
FT                   KKVSITGAKDTIEQIAYVKATLESGGKHKSEFTDKATVSVFDSNLNKLDVEVNPQEVEV
FT                   TVPVEKVGKSVPVKIKQEGTPESDIEISSMTPDKSEVVVVGDDAVLEKIKEIEIPIDVS
FT                   KIKADTVKEVTVPVPNGAKSVQPTTIEVKIKTVKKSEANNNPTTSDNQGTDENNNNTDD
FT                   SGDNDTKISKSFSDMQVYMSGLKNTFDAQMITPANGKVSVTITGEKKTVDGITAKELSV
FT                   IANLSKSKAGNYSIPLELNGLPDNVAYVINPKKADFIITDKEASIAVPSKST"
FT   gene            439169..440521
FT                   /gene="glmM"
FT                   /locus_tag="LMHCC_0428"
FT   CDS_pept        439169..440521
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glmM"
FT                   /locus_tag="LMHCC_0428"
FT                   /product="phosphoglucosamine mutase"
FT                   /EC_number="5.4.2.10"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38785"
FT                   /protein_id="ACK38785.1"
FT                   /translation="MGKYFGTDGVRGVANSELTPELAFRLGRMGGYVLTRHVGEHPRVL
FT                   VARDTRISGEMLESALIAGLVSVGIEVMRLGVISTPGVAYLTKAQGASASVMISASHNP
FT                   VDDNGIKFFGSDGFKLSDDQEEEIEQLLDTAEDTLPRPSGEGLGTVSDYFEGKQKYIQY
FT                   LKQTIENDFNGYHIALDCANGATAGLATHLFADLDADISSMGASPNGLNINDGVGSTHP
FT                   EALAAFVLDKKADVGLAFDGDGDRVIAIDEIGQIVDGDKIMFICAKYLREQGLLNNNTI
FT                   VSTVMSNLGFYKGLKELEIEDVQTAVGDRYVVEAMREGNYNLGGEQSGHIIFLDHNTTG
FT                   DGLLSGIQLINVMKATGKKLSELAAEMKTFPQKLENIRVSDKNHVTDNPKVSKVIGEVE
FT                   AEMAGNGRVLVRPSGTEPLVRVMVEAATKEETDEYCERISAVVRSEMALND"
FT   gene            complement(440556..441017)
FT                   /locus_tag="LMHCC_0429"
FT   CDS_pept        complement(440556..441017)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0429"
FT                   /product="acetyltransferase, gnat family"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38786"
FT                   /protein_id="ACK38786.1"
FT                   /translation="MNWTTWNKSQPAPLELLLEADPSEKQIAKYLEASHVFQLVDANEI
FT                   IGVICLLPLNKQQLEIMNIAVQPSKRNQGIGKILLEKAFDYAVKNGFSALIVKTGNSSI
FT                   DQLAFYQKNHFRMQQIVPNYFTKHYPDQTITENGIACLDQIILLKEIKS"
FT   gene            441070..441903
FT                   /locus_tag="LMHCC_0430"
FT   CDS_pept        441070..441903
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0430"
FT                   /product="membrane protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38787"
FT                   /protein_id="ACK38787.1"
FT                   /translation="MGKLPEKIRGICGSLLIALGVTQLYSFVSAVIGYFSAEKNSFTFV
FT                   WNYWMLLLFGLALFIAGFLFIKREKFRLASIIVVSCFVLFQAFSVYYYQLRIFAKLEYA
FT                   QPFEWSGTLLVIAGLLLLIALIIGPKFAKKEQGSDENWKNKWRYAAGLFALLGAVTAIF
FT                   AAVTVFKQLHSDSVKQGYLFTTSLDGYFACFVAVIFLIVTVLAWRKVSLLFIGILMGAA
FT                   FILLTNYLSVTNWIDFAKENLSITFGSNERQVFGMQFLMGTSAFLSSVFAYIAKK"
FT   gene            complement(441942..443885)
FT                   /locus_tag="LMHCC_0431"
FT   CDS_pept        complement(441942..443885)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0431"
FT                   /product="ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38788"
FT                   /protein_id="ACK38788.1"
FT                   /translation="MTLFDIAKKNIRHNFVHYFLYFASMIFSIMIYFTFLVLSKDPSVT
FT                   SRIDQSAKLSTAFTSSSVILLIFVAIFILYSNNFFTRKRKKEIGLYSLLGLRKKEIGRM
FT                   LFYENFIMGLGALVIGILAGTLLSKLFVTILLNLINIENIGGFAFSWGAVLQTSIVFII
FT                   ITLFTSFSGYRIIYRSTLLELFHSESKREKSPKPSFILSLVSLVLIGIGYFIASQPLEA
FT                   KNSVWAKLGFSVGALVILTTVIVGTALFITFFLPYLLTKLRNNKRIFYKGSNIISTSQL
FT                   NFRISSNAKTLIVISILSATTLSAIGTISSIYYQANTSASTTAPSSFEYVIPENAETND
FT                   KIMNILENDSDHPVEYAQKSTYYIVKADGERPDFVEYDINDGFPVISESNYNELVKKQG
FT                   NTEKTAKLKDNEAQMVLSITYDEKARNKMIGEKYTLATPEKTSVEIKKVVQDSPLGTVQ
FT                   GLLVLPDKQVEQIAADKNIPATSVESVTVQDAKQAQALDKEVRTLLPKDTNYISYADSY
FT                   QQIITVTGVLLFIGMFIGFVFLAATGSIIYFKQLTEAYNDIGTFDILKKIGLTKKDIRK
FT                   ILAKQLLVVFLIPLIIGIAHSSVALIGLSNMLLLDLTLPVIISTGIYTLMYIIYYFVTL
FT                   NSYTNIVFGKKS"
FT   gene            complement(443872..444639)
FT                   /locus_tag="LMHCC_0432"
FT   CDS_pept        complement(443872..444639)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0432"
FT                   /product="bacitracin export ATP-binding protein BceA"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38789"
FT                   /protein_id="ACK38789.1"
FT                   /translation="METVLQAKNVRKIYGSKGNVYTALENISIDIKEGEFTGIMGPSGA
FT                   GKSTLLNVLSTIDKPTSGEIMISGHALENMDEQQMSTFRRDKLGFIFQDYNLLDTLTTR
FT                   ENIILPLALAKHPVNEIEEKLKVISTKFGISEILDKYPSEISGGQKQRTAASRAIITSP
FT                   SMIFADEPTGALDSKSATNLLESLCDLNEQDKATIMMVTHDAFAASFCKRILFIKDGEL
FT                   YTEIYRGTKTRKEFFQKILDVLAKLGGDTDDVI"
FT   gene            complement(444835..445590)
FT                   /locus_tag="LMHCC_0433"
FT   CDS_pept        complement(444835..445590)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0433"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38790"
FT                   /db_xref="GOA:B8DH02"
FT                   /db_xref="InterPro:IPR010644"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR031332"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8DH02"
FT                   /protein_id="ACK38790.1"
FT                   /translation="MNEAVKTLDGWFCLHDFRSIDWAAWRELNPGNQELMLNELSHFLS
FT                   DMEITKNIGEGEHTIYSILGQKADLVFFTLRDSLEALNEVENRFNKLAIADYLLPTYSY
FT                   ISVVELSNYLASHMAGGEDPYQNKGVRARLYPALPPKKHICFYPMSKKRDGADNWYMLP
FT                   MEERQQLIRDHGLIGRSYAGKVQQIIGGSIGFDDYEWGVTLFSDDALEFKRIVTEMRFD
FT                   EASARYAEFGSFFIGNLLLSEQLSKLFTI"
FT   gene            complement(445674..445904)
FT                   /locus_tag="LMHCC_0434"
FT   CDS_pept        complement(445674..445904)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0434"
FT                   /product="DNA-binding protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38791"
FT                   /protein_id="ACK38791.1"
FT                   /translation="MRQQQIDFKWLEENFLTANEAATYLGISKQALLSLAKRDVLPFTK
FT                   KGNMVLFHRMDIELRLENQQSLREKYRPFET"
FT   gene            446027..446758
FT                   /locus_tag="LMHCC_0435"
FT   CDS_pept        446027..446758
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0435"
FT                   /product="NADPH-flavin oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38792"
FT                   /protein_id="ACK38792.1"
FT                   /translation="MNDVLTLLRNHRSFRKYKKGVEIPEEKLDAIIRAAQAAPSWINGQ
FT                   HYSIIAIKDQERKNKMAELCGNQPYIAECSVFLCFVADFHRVKVASDMHGKSFQIAGEE
FT                   DLLMVAATDIGLCMQNALTAAESLDYGTICIGGLRRNITATAEFLNLPEFVMPVVGLCI
FT                   GVPDVEAPVKPRLPKEAVYFEETYQTDVMPLLEAYDQEIIPFSEREGFVSYTERLAKFY
FT                   DRPYYPNLTEQIKERGFLGGK"
FT   gene            446838..447794
FT                   /gene="manA"
FT                   /locus_tag="LMHCC_0436"
FT   CDS_pept        446838..447794
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="manA"
FT                   /locus_tag="LMHCC_0436"
FT                   /product="mannose-6-phosphate isomerase, class I"
FT                   /EC_number="5.3.1.8"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38793"
FT                   /protein_id="ACK38793.1"
FT                   /translation="MTEALFLNPVFQDRIWGGTKLHDYFGYDIPSDTTGEDWAISAHPN
FT                   GPSVIKNGEYKGKTLAELWQENPALFGNPKEAVFPLLTKILDANTDLSVQVHPNDEYAK
FT                   VHENGELGKTECWYIIDCAPGAELIYGHKAASKEEFATWAKNGEWDKLLRKVAIKPGEF
FT                   YYVPSGTIHALGTGTLVLETQQSSDTTYRVYDYDRKDAEGNLRELHLDKAIDVTTAPHV
FT                   DAKLDIKTETRGGLTETTFVSNDFFSVYKWEVDGVAEFAAKATYTLVSVLDGEAVLTID
FT                   GTKQSIKKGDHFVLPNDVKAWEIDGKMTAIVSNPPVK"
FT   gene            complement(447899..448708)
FT                   /locus_tag="LMHCC_0437"
FT   CDS_pept        complement(447899..448708)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0437"
FT                   /product="hydrolase, alpha/beta fold family"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38794"
FT                   /protein_id="ACK38794.1"
FT                   /translation="MPLFKHEGTYFNYEIQGKGIPFLFLHGLGDNLKFAYETFDKDEKI
FT                   QLISLDQRGHGKSGNDSRKLSYDRLAKDALALMDYLGIHHFFVGGLSMGAGVAVNLAVQ
FT                   AADKVLGLIILRSSATDEPMKKEVIAWFSTVSKYWPKKDGALLFEQDPIFPSIKETYPK
FT                   AIDTFKRYFEDDAAVTHYKKFSDIPKDRPIKSKSELANLTIPTLILANNYDVIHPIEYS
FT                   LFYKRNIENASYYELTPKTIDAEKHKLEITTYMNTFIINTSKKINYK"
FT   gene            complement(448750..449883)
FT                   /gene="nagA"
FT                   /locus_tag="LMHCC_0438"
FT   CDS_pept        complement(448750..449883)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nagA"
FT                   /locus_tag="LMHCC_0438"
FT                   /product="N-acetylglucosamine-6-phosphate deacetylase"
FT                   /EC_number="3.5.1.25"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38795"
FT                   /protein_id="ACK38795.1"
FT                   /translation="MAVINNVKIYKENELIDAAVITEGNLIKEVCSTTPEKYSDEPTFD
FT                   GNGQLLIPGMVDVHIHGANNYDMMDGSTESIQAVSMACAETGCTSFLVTSVSSSFEDLI
FT                   QMIKQTKKVIGKEKGAKIAGIHLEGPYLNIEKKGMQNPAYLRHPDLKEMKKIFDEADGL
FT                   IKMVTIAPELPGGIELIDFLKKRGVVVAIAHSNATYEEAQNAFEQGATHITHCFNAMPA
FT                   IHHRAPGLVTAALENDSVSVQAIVDGVHLHPGIVRLIHKIKGPDKMVLTTDALQAMGVG
FT                   DGEYIFGGHQVTVKEGIARLKDGTLASSTVTMNKSLKLSNEFGIHLQDAIQMAASTPAD
FT                   ILGMNNFGRIEKGYVADLVLLDKNFEVLTTWIDGEIY"
FT   gene            complement(449889..450650)
FT                   /locus_tag="LMHCC_0439"
FT   CDS_pept        complement(449889..450650)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0439"
FT                   /product="transcriptional regulator, DeoR family"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38796"
FT                   /protein_id="ACK38796.1"
FT                   /translation="MNQKERIVEELKLLEKQKTISQEELMRIFSISKDTARRDILKLVE
FT                   SGLAERYPGGVSQPILKPQIESYTSRLVKQSAQKQAIAHAAGKTIKDHMTIYLDVSTTV
FT                   HFLASELEQHDLVVVTNSMDNAIAASQNQDNKVYLLGGFFNFHSRVLSGEPVLDQLKQF
FT                   NFDLAFIGGAGLTEDGIFYSELTDVYMKQEIIRNSEKVFLLIDSTKVNKKTASKIDFSG
FT                   IDAVITDQPLPKDLMQHLISEEVEVISLKGL"
FT   gene            450888..451742
FT                   /locus_tag="LMHCC_0440"
FT   CDS_pept        450888..451742
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0440"
FT                   /product="Ser/Thr protein phosphatase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38797"
FT                   /protein_id="ACK38797.1"
FT                   /translation="MSLKMKWIIAVILIVLLLVVGWFLGTRLTVKKYEVSSAKIDQEIK
FT                   IVQLSDLHFSEFGNKNEKLVDKVVALQPDVITITGDLFDRQGDSVPKELIEKLTKIAPV
FT                   YYSPGNHEYDVKGAYESDYKPFLEKMGVVNLEDKTATIDVNGQKFQMSGLRSSAKLDYD
FT                   YPYYKEGLAEIKSQQDSAYYQVLLSHMPDYFELYVENDFDLTLSGHTHGGIIRIPYTNI
FT                   GAIAPGPQRVILPDYVYGKHTKDGKTMIISAGLGAGSFNQKAFPRLGNPYEIVAVTIKP
FT                   ETK"
FT   gene            complement(451771..451935)
FT                   /locus_tag="LMHCC_0441"
FT   CDS_pept        complement(451771..451935)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0441"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38798"
FT                   /protein_id="ACK38798.1"
FT                   /translation="MVNLLLGGAIFGYTIYAIIKFIKRSKQGKCGGCELEKTCNCESDE
FT                   HTNLDHIFK"
FT   gene            complement(451960..453954)
FT                   /gene="feoB"
FT                   /locus_tag="LMHCC_0442"
FT   CDS_pept        complement(451960..453954)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="feoB"
FT                   /locus_tag="LMHCC_0442"
FT                   /product="ferrous iron transport protein B"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38799"
FT                   /protein_id="ACK38799.1"
FT                   /translation="MSQNTYCLLGNPNTGKTSLFNALTGSYEYVGNWSGVTVEKKVGTL
FT                   RSKTGKLIDLPGIYDLNPISRDETVVTRFLLEEKFDCMLNIVDSSQIERNLNLTIQLLE
FT                   FGAPVVMGLNMIDVAAGRGIHLNIQNLAKQLRIPILPVVARSGKGTDDILSTLSEKHVA
FT                   PAIPLVLPYGEPAEKAITEIQVLIKDMIPAKQSRWLAVQFLSKNEVTEEFLATCPALEQ
FT                   LKHIRTELEIALDGKLENHFHQVRVNYIHDICLTSVEYTRHSDIPLSDKLDQIFTHKFF
FT                   GIPIFLGIMWLIFQITFTWVGAPLSDLLDGFIGGSLTDSVTSFLTAIGASGFITDLVTD
FT                   GIIAGVGGVLVFVPQILVIFFFISILEDSGYMARIAVVMDRVMEIFGLNGKAFIPMIIG
FT                   FGCNVPGIMAARSIEESKERTLTILVSPFMSCSARLPVYALFVGVFFEKHQALVVLSLY
FT                   VIGILMALIVTKILSKTILKKDNSVFVVELPPYRLPSLKTLWRSTWEKGKGFLRKAGTF
FT                   IFAGSVIIWLLNYAGPSGLDVPMGESFLAIIGGMLAPLLVPLGFGTWQAGATLIPGFLA
FT                   KEVVVSTMAIIYAVGESSLGSIVSTFYTPLSAYCFMLFILLYIPCLATVAAIRKETSSW
FT                   KWTAFAVAYPLVTAYVLVFLVYQIGSLFV"
FT   gene            complement(453951..454178)
FT                   /locus_tag="LMHCC_0443"
FT   CDS_pept        complement(453951..454178)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0443"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38800"
FT                   /protein_id="ACK38800.1"
FT                   /translation="MQLNETAVGEKVRISELKMENAMLKRRLLALGCDEGCDICIKQKG
FT                   LFGGPCTFETKGQYISIRQCDACAIMVERK"
FT   gene            454498..455475
FT                   /gene="pta"
FT                   /locus_tag="LMHCC_0444"
FT   CDS_pept        454498..455475
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pta"
FT                   /locus_tag="LMHCC_0444"
FT                   /product="phosphate acetyltransferase"
FT                   /EC_number="2.3.1.8"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38801"
FT                   /protein_id="ACK38801.1"
FT                   /translation="MSDLFTTIKGQVTGKNVRIVLPEGTDERIVGAAARLQKENIVKPI
FT                   LLGNKAEIEAKAKEIGVSVEGIAIHEPATDPLFDELVAAFVERRKGKATEEAARKMLVD
FT                   PNYFGTMLVYTGKAEGLVSGAAHSTGDTVRPALQIIKTKPGVSKVAGAMIMVRGEERYL
FT                   FSDVAINIAPVAADLAENAIVSAETAEIFGIDPRVAMLSFSTKGSAKSDETEKVVEATA
FT                   LAKEKAPELTLDGEFQFDAAFVPTVAEKKAPGSVIKGDANVFIFPSLEAGNIGYKIAQR
FT                   LGNFEAVGPILQGLNAPVNDLSRGCNTDDVYNLTLITAAQAVNK"
FT   gene            455824..456495
FT                   /locus_tag="LMHCC_0445"
FT   CDS_pept        455824..456495
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0445"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38802"
FT                   /protein_id="ACK38802.1"
FT                   /translation="MDENLVRWLSLSGVALFVILAVLLANRINRQRRQKLQQEFENKFS
FT                   MFKVYFNHSNATPQELNDPILTMKRSKGGRFILPVFICIIAFIIGYFYRGGSFNGKLIV
FT                   LAILALWFVWSVLNATKYVKVYKNAIVHGSLITKKIIWFHRIDSIEAKLYDYNGVMDAR
FT                   QAQVYRVYEVKRGNKVVFDIWETQFASARLIEKCFDTENPFVQEIQESFDSGNSHYRED
FT                   F"
FT   gene            456495..456935
FT                   /locus_tag="LMHCC_0446"
FT   CDS_pept        456495..456935
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0446"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38803"
FT                   /protein_id="ACK38803.1"
FT                   /translation="MIQNTGELMMYIGGALVLVYPLGVLIINILRSSTKGRFRPTSTMG
FT                   IVLGLCVVAGAVLIFVGDSYRKDISKDVMVSYYEKNIPYEDLTKAQRKNIDASVINISK
FT                   MNKAGEDVSKYVPALEKYMYESYIADGISEKDAKSYMESFLK"
FT   gene            complement(456981..457547)
FT                   /locus_tag="LMHCC_0447"
FT   CDS_pept        complement(456981..457547)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0447"
FT                   /product="glutamine amidotransferase subunit PdxT
FT                   (Glutamineamidotransferase glutaminase subunit pdxT)"
FT                   /EC_number="2.6.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38804"
FT                   /db_xref="GOA:B8DH16"
FT                   /db_xref="InterPro:IPR002161"
FT                   /db_xref="InterPro:IPR021196"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8DH16"
FT                   /protein_id="ACK38804.1"
FT                   /translation="MKKIGVLAIQGAVDEHIQMIESAGALAFKVKHSNDLAGLDGLVLP
FT                   GGESTTMRKIMKRYDLMEPVKAFAKEGKAIFGTCAGLVLLSKEIEGGEESLGLLDATAI
FT                   RNGFGRQKESFEAELSVDVFDAPTFEAIFIRAPYLIEPSDEVTVLATIDGKIVAAKQAN
FT                   ILVTAFHPELTNDNRWMRYFLEKIL"
FT   gene            complement(457549..458436)
FT                   /locus_tag="LMHCC_0448"
FT   CDS_pept        complement(457549..458436)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0448"
FT                   /product="pyridoxine biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38805"
FT                   /db_xref="GOA:B8DH17"
FT                   /db_xref="InterPro:IPR001852"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR033755"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8DH17"
FT                   /protein_id="ACK38805.1"
FT                   /translation="MEKKVGTDRVKRGMAQMQKGGVIMDVVNAEQAKIAEEAGAVAVMA
FT                   LERVPSDIRAAGGVARMADPRIVEEVMNAVSIPVMAKARIGHITEARVLEAMGVDYIDE
FT                   SEVLTPADDEFHLLKSDFTVPFVCGCRDIGEALRRIGEGAAMLRTKGEPGTGNIVEAVR
FT                   HMRQVNGQIRQIAGMTDDELMVAAKNFGAPYELIKEIKTLGKLPVVNFAAGGVATPADA
FT                   ALMMELGADGVFVGSGIFKSDNPAKFASAIVQATTYYTDYELIGKLSKELGSPMKGIEM
FT                   SRLNPEDRMQDRSI"
FT   gene            458563..460008
FT                   /locus_tag="LMHCC_0449"
FT   CDS_pept        458563..460008
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0449"
FT                   /product="transcriptional regulator, GntR
FT                   family/aminotransferase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38806"
FT                   /protein_id="ACK38806.1"
FT                   /translation="MWQLTRDSDLPIYLQIVDLIETKIINGELLPEEKLPPERQLAEMF
FT                   GVNRSTVVRALDELTARAVIIRKQGSGTTVNAEKWGLFAGQSTNWRHYLTQGGFTPAVP
FT                   YIRQTGVMERVDSDQVIDAASGELPLEMTPKMETPSLSWQSFIAEEQQEDEAGYKPLRE
FT                   TIQKQMKEAYGLQTRPEQIFITSGAQQALFLITQCLLKPGDAVAIESPSYFYSLSLFQS
FT                   AGLRIFALPMDEDGVIISELRDLYHKHRVKMVFVNPTFQNPTGLVMSLKRRKELVKICA
FT                   HLQIPIVEDDPFSELAALDSRIPVPLKQLDTDNVLYIGSLSKIMGSTTRIGWLIGPTAV
FT                   IERLALARQEMDFGLSIFPQVLANSVLNTTGYKTHLQQLHHVLERRRDDLIEAFEAILP
FT                   NDVVFIKPKGGFHLWVKLPVEFRSIRDFDIFLANDLLVMPGFLFGVKEAVIRVTYARLE
FT                   KTEARRVAEIIKQILIEKKCEEA"
FT   gene            460189..462195
FT                   /locus_tag="LMHCC_0450"
FT   CDS_pept        460189..462195
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0450"
FT                   /product="M protein trans-acting positive regulator (MGA)"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38807"
FT                   /protein_id="ACK38807.1"
FT                   /translation="MEQNCKELITYLLLNRQVNLRNVSKNFKVSKEAIGAQITQINHLL
FT                   KSEPILIDHDMIFVTDVCREACYRLLTAEEQQLFSFYEVNIRRKLIMIKLLLHNHYMSL
FT                   GALADYVYVSKNTMLTDVKSIKESLHEFEIQLDYSRKDGYAVSGSEFLIRNLLAELIRE
FT                   VVQTPYGKFVLDEKKLITVSEVFLLKKRLEKVESKLQITFTDEQMEELPYILHGIIKRS
FT                   KVTNKKWTFKIEMYDIKNTREFPIMKEMFWGYDFLSENDLLYLSLQVLASNLVESALHF
FT                   SDSEEIAYAVDEFIRLLEMYFATEIMKKNEFKEKVILHVRPAIYRTILGFQINNPLKKQ
FT                   FIKEYTPTFNIVEKASKPFEKLVGHKWSEEEIVYLSMIVLGWMYQIEETEQPIFRAVVL
FT                   CKSGTSISKLLLENLKMMFPNIDFQGAYAVRQLSTVARDIDFIFTTVPVQSDATIFVIP
FT                   SILSKDSRQILREQVDKAIEMDSHKKTKELLAMLKDEIPEENIRLVQAKMESFFNKKEQ
FT                   PMEKKEPEQMQITEEQIHFLETPLEWEQLVSAAFAPMLERGTVDTCYIHTCEEIFYQNY
FT                   EQMMIGPNIYLPHAKPANGVIEQDIQLMIMKADTRTKAGEAVKIMIALAPSEQNKHIPL
FT                   LLKLNEIFLQPERLAELLASTNKKKIVEILERG"
FT   gene            462203..462670
FT                   /locus_tag="LMHCC_0451"
FT   CDS_pept        462203..462670
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0451"
FT                   /product="PTS system galactitol-specific enzyme IIA
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38808"
FT                   /protein_id="ACK38808.1"
FT                   /translation="MDYHDLFQKELTLINSSYESQAELFECTSKVLEKEQYVEATFREA
FT                   VTSREVVFPTGLEMNGIKIAIPHTDTIFVKRPFVLVNKLSTPIPFIQMGSSEKWIDVEV
FT                   IFMLGIKNPKDQVPLLSSIMEKFMEADFVEQIKQINDSNALCDFLKKQFGE"
FT   gene            462676..462951
FT                   /locus_tag="LMHCC_0452"
FT   CDS_pept        462676..462951
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0452"
FT                   /product="PTS system galactitol-specific enzyme IIB
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38809"
FT                   /protein_id="ACK38809.1"
FT                   /translation="MKKVIVACGSGVATSQTVASKVERILKEKGVRATVEAVDIKSLEQ
FT                   HIKTSDVYVAITKANKEFDIPTLNGIAFLTGMGMDEETEKLLNALK"
FT   gene            462979..464328
FT                   /locus_tag="LMHCC_0453"
FT   CDS_pept        462979..464328
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0453"
FT                   /product="galactitol pts, eiic"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38810"
FT                   /protein_id="ACK38810.1"
FT                   /translation="MESLQSVIQFILNLGAAVFVPALMIIIGLIVRMKVRDAVSAGIIL
FT                   GVAFLGMNIVIGFMIEALTPAAQGLAERTGINLSILDGGWTSMATLAWAWPFAFLMFPL
FT                   QLGINAIMLVINKTKTLNVDLWNVWGKILTAVLIIGVTQNVYLAFIVAGIQIVTELILC
FT                   DANQRQIQELNGIPGVTVSHGMMIFCIFLMPLDWLLKKIPALRKDMDANALKDKIGIFA
FT                   ENHVMGFIIGGLLGIAAGYDVAKTLMLAMQAAAALTLFPMVAKLFMQALSPLSDGISEF
FT                   MKRKFKNRELFIGLDWPILAGCSEVWVAIVLMVPVTLIFALILPGNGVLPFAGILNISL
FT                   CAPALIVTGGNLIRMIILGTITTPIFLYVSTFFAGTITDLAHSTGAISLKAGQQITWST
FT                   LEYPVFRYIFAEASQFTILGFIFVAIWVLLLVFYVKMMKKRTIELEKASS"
FT   gene            464346..465278
FT                   /gene="pfkB"
FT                   /locus_tag="LMHCC_0454"
FT   CDS_pept        464346..465278
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pfkB"
FT                   /locus_tag="LMHCC_0454"
FT                   /product="1-phosphofructokinase"
FT                   /EC_number="2.7.1.56"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38811"
FT                   /protein_id="ACK38811.1"
FT                   /translation="MIYTITLNPAIDRLLFIQGELEKRKTNRVKKTAYDCGGKGLHVSG
FT                   VLSKFGIKNEALGIAGSDNLDKLYAILKEKHINHDFLVEAGTSTRECFVVLSDDTNGST
FT                   MIPEAGFTVSQTNKDNLLKQIAKKVKKEDMVVIAGSPPPHYTLSDFKELLRTVKATGAF
FT                   LGCDNSGEYLNLAVEMGVDFIKPNEDEVIAILAKKTNSLEENVRKLAEKIPYLVVSLGA
FT                   KGSLCAHNGKLYQVIPPQVQERNDTGAGDVFVGAFIAGLAMNMPITETLKVATGCSASK
FT                   VMQQDSSSFDLEAAGKLKNQVSIIQLEER"
FT   gene            465280..465930
FT                   /locus_tag="LMHCC_0455"
FT   CDS_pept        465280..465930
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0455"
FT                   /product="class II aldolase/adducin domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38812"
FT                   /protein_id="ACK38812.1"
FT                   /translation="MLYQKEREDLAKVVKTMFDRFETNAAGGNVSVRMNNEHIIMTPTL
FT                   MSQAKLCDLSPYEILVVDNNNEVVEGDGRVTREINLHRACYVENPKIGCVLHAHPKESM
FT                   LFATLGMELPNLTEATQKIGQIPTLEFAPATSPELAEIVRKHVIELGEKAVPSASLLNK
FT                   HGIVVLDTSLHKAYDMLERIEYNAYIAEKALVFDALGIKKLAHDRELNYNLEE"
FT   gene            465934..466131
FT                   /locus_tag="LMHCC_0456"
FT   CDS_pept        465934..466131
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0456"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38813"
FT                   /protein_id="ACK38813.1"
FT                   /translation="MEKFLFNATLFASALLLMVGIFKSSIPITAISLVLAVVSQHFFRK
FT                   KYPKQTRSYREIVAAKQKKG"
FT   gene            complement(466175..467698)
FT                   /locus_tag="LMHCC_0457"
FT   CDS_pept        complement(466175..467698)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0457"
FT                   /product="glycine betaine transporter OpuD"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38814"
FT                   /protein_id="ACK38814.1"
FT                   /translation="MKKLTSVFWGSGCLVLLAVLFGAFLPKQFETFTTNIQKFLTSNFG
FT                   WYYLIVVAIIIIFCLFLVLSPIGSIRLGKPGEEPGYSNKSWFAMLFSAGMGIGLVFWGA
FT                   AEPLSHYAVQAPGGEVGTQAAMKDALRYSFFHWGISAWSIYAIVALALAYFKFRKNAPG
FT                   LISATLYPILGKHAKGPIGQLIDIIAVFATVIGVATTLGLGAQQINGGLTYLFGVPNNF
FT                   TVQFTIIIIVTILFMLSAMSGLDKGIQLLSNVNIYVAGVLLILTLILGPTLFIMNNFTN
FT                   SFGDYLQNIIQMSFQTAPDAPDARKWIDSWTIFYWAWWLSWSPFVGIFIARISRGRTIR
FT                   QFLLGVIVLPALVSVFWFAVFGGSAIFVEQHGNSGLSGLATEQVLFGVFNEFPAGMVLS
FT                   IVAMILIAVFFITSADSATFVLGMQTTGGSLNPPNSVKVTWGLLQAGIASVLLYAGGLT
FT                   ALQNASIIAAFPFSIVIILMIVSLFVSLTREQEKLGLYVRPKKSQRSQL"
FT   gene            complement(467866..469236)
FT                   /gene="argH"
FT                   /locus_tag="LMHCC_0458"
FT   CDS_pept        complement(467866..469236)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argH"
FT                   /locus_tag="LMHCC_0458"
FT                   /product="argininosuccinate lyase"
FT                   /EC_number="4.3.2.1"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38815"
FT                   /db_xref="GOA:B8DH27"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR009049"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="InterPro:IPR029419"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8DH27"
FT                   /protein_id="ACK38815.1"
FT                   /translation="MEKLWGGRFQGKSEAWIDDFGASISFDQKMAKEDLAGSLAHVAML
FT                   SKCGIIPASEAAEITAGLKILQEKLALGELEFSTVNEDIHLNIEKLLHEEIGPVAGKLH
FT                   TARSRNDQVATDMHLYLKQAVAEIIQSLKHLRVVLVQKAELHVETIMPGYTHLQHAQPL
FT                   SFAHHLLAYFGMFTRDLERLEESVKRIDISPLGSAALAGTTFPIDRAYSAELLGFSAVY
FT                   ENSLDGVSDRDFIIEFLSNSSILMMHLSRFCEELILWTSHEFQFVELTDAFSTGSSIMP
FT                   QKKNPDMAELIRGKTGRVYGNLFGMLTVLKGLPLAYNKDLQEDKEGMFDTLETVQTSLD
FT                   IFAGMIETMKVNTEIMEESTQKDFSNATELADYLAKKGVPFREAHEIVGKLVLECTQNG
FT                   IYLQDVALSHYQEINPLIEDDIYVVLSSKTAVQKRNSYGGTGFDQIKVALENTKKTL"
FT   gene            complement(469240..470454)
FT                   /gene="argG"
FT                   /locus_tag="LMHCC_0459"
FT   CDS_pept        complement(469240..470454)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argG"
FT                   /locus_tag="LMHCC_0459"
FT                   /product="argininosuccinate synthase"
FT                   /EC_number="6.3.4.5"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38816"
FT                   /db_xref="GOA:B8DH28"
FT                   /db_xref="InterPro:IPR001518"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR018223"
FT                   /db_xref="InterPro:IPR023434"
FT                   /db_xref="InterPro:IPR024074"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8DH28"
FT                   /protein_id="ACK38816.1"
FT                   /translation="MAKEKIVLAYSGGLDTSVAIQWLVESGYEVIACCLDVGEGKNLDF
FT                   IKEKAITVGASESYTIDAKEEFAEDFALIALQAHAYYEGKYPLISALSRPLIAKKLVEV
FT                   ARQEGASAIAHGCTGKGNDQVRFEVAIHALAPDLKVVSPVRDWKWSREEEINYAKEHNI
FT                   PVPIDLDNPFSIDQNLWGRSNECGVLENPWTTPPEAAYDLTVSLEDAPDTPDIVEITFD
FT                   AGIPISLNGENMSLANLILTLNEIAGKHGVGRIDHIENRLVGIKSREVYECPAAVTLIT
FT                   AHKELEDLTFVREVAHFKPIIEQKISETIYNGLWFSPLTEALVAFLKSTQKFVNGTIRV
FT                   KLFKGHAIVEGRKSPNSLYDENLATYTSSDTFDQDAAVGFIKLWGLPTKVSAEVNSKVT
FT                   ITTEV"
FT   gene            470669..471712
FT                   /locus_tag="LMHCC_0460"
FT   CDS_pept        470669..471712
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0460"
FT                   /product="lipase"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38817"
FT                   /protein_id="ACK38817.1"
FT                   /translation="MKNTIKWIAIGFAGIILLPLLIVFFIYKKAVGKKEYNPEVLENLD
FT                   EASQEFVKNTSPLSDVDSRYKYMRLATKALPSAKDIEIGDVENKKIDGPAGKIPIRIYT
FT                   PQEDGPFEIIVYYHGGGFVLGGLQTHDAIARKLVQTTGARVVTVDYRLAPENPFPAAVE
FT                   DAYAALLWVQNHRTSLRAKSSDIIVAGDSVGGNLATVVTQIAKSKGKPNITAQILLYPA
FT                   TDIFSRDASVLYPSMDEFAEGYVLTKESLDKFFKLYIANASDRKYDPLVAPIRSKDLVG
FT                   LPKTFIATAEFDPLRDQGEAYAKKLKDAGVEVFAKRFEKVPHGFMTTNSEATDETYELI
FT                   SEFLEEK"
FT   gene            471823..472413
FT                   /locus_tag="LMHCC_0461"
FT   CDS_pept        471823..472413
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0461"
FT                   /product="transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38818"
FT                   /protein_id="ACK38818.1"
FT                   /translation="MRKEEIKQAALTLFANNGFEGTSLADIAGVVGLKKQSIYSHFKDK
FT                   DDLFLSIMKDAKSTEIDYYRAKLRDSDLSRPDLVLSSLLFGVKELYDTDEAYQFWLRYG
FT                   FYPPKHLYEVVQADITENVLQMEHEFTNLFSNWMEQKLIPMQDVETMKEAYMGILDAVI
FT                   VDIVYVNDPERTEKKITALWQIFWRGITLKALN"
FT   gene            472423..473754
FT                   /locus_tag="LMHCC_0462"
FT   CDS_pept        472423..473754
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0462"
FT                   /product="mate efflux family protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38819"
FT                   /protein_id="ACK38819.1"
FT                   /translation="MAKNMEILETDSVKKIYFRYLIPSLVGMLLMSLNIVIDGIFVGHK
FT                   LGGVALAGINIAVPVFTIFTAISIWIGIGAATQFSFAIGEKNVAKAQTIFTNAILAVVS
FT                   ITVIIGIIAFIFKVPLAYFLGANDDTIGYVLEYMNILLVFGFALTLENILSIFVRNDGD
FT                   PNLSMIALIVTAISNVILNYLFLFVFEWGVTGSALATMIAIIIGVLILITHFFKKSSRL
FT                   KFVKVDWNKAFFKKTLAIGLPSFLAEVGVSVFTLGYNISIAAIAGTAGVAAFSVLNYTH
FT                   SVILMLFLGMGSAIQPLISYYRGAKARQKEIETLKIAIMVAFSTGVGFLLVGLFGSNLL
FT                   VSMFGNFSPEIRDLASNGIKLFYTAYLFMGFNFVMMTYFQTSDKVKMATWITISREIIF
FT                   MVIFLLVLPPIIGIPGVWLAIPISEMIVAASIVFYMKKKHILFK"
FT   gene            474165..474299
FT                   /locus_tag="LMHCC_0463"
FT   CDS_pept        474165..474299
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0463"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38820"
FT                   /protein_id="ACK38820.1"
FT                   /translation="MRFRTKGKQGFFGLKRFVCKARVRNSLFRNKKKYIDEKAEGLNP"
FT   gene            474380..475651
FT                   /locus_tag="LMHCC_0464"
FT   CDS_pept        474380..475651
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0464"
FT                   /product="DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38821"
FT                   /protein_id="ACK38821.1"
FT                   /translation="MNLIGLRIKNIRKEKQLTLKDVAQGIISVPYLANIENGIKIASLE
FT                   TLIHIAKRLEVPEQILLISEEESNKELLKEMDAIFELLVFSNTAEMESRLNSIAENVDL
FT                   LHESPAVELSFYCLQTAYYYKTWEFSKAEEIEAKYLNNTKKRAEESFPRQLLSYYYYGQ
FT                   AVKHSHATCDYQLAVEYWEKCVDLTENKGFQVVFHVCICINYICQSIYEPALAHIKQAL
FT                   ELIKYEEQERIVAILYFYGYIYFQIGFMAEAKNRFEQAVGYFEKYPESKKIYYFVVQLK
FT                   MAEIENIEGNEALFNEKIASLYEELMAYETTNTSFNNNDYLVITELMVIFAEKGFVDEA
FT                   ASLMGLMNKVDERVKELNFFIEYTETLLLYHQNEQVSYEEKMIKLLKKIDDSNDPILID
FT                   RVKKHASKHFAKSTKYKMAYDILS"
FT   gene            475748..477436
FT                   /locus_tag="LMHCC_0465"
FT   CDS_pept        475748..477436
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0465"
FT                   /product="cell wall surface anchor family protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38822"
FT                   /protein_id="ACK38822.1"
FT                   /translation="MQKKLIGSLFILIVLFIFGSTSEKVQASPTSPNGWQLKWAIKNND
FT                   FEDVDIADYGVDAGTTNVWQVNQKGVEAWGTTNPTGNIEVWQNGNGYNVPAFSGNNFIE
FT                   LNSDGIGPVYQDIRTIPGSNLTWKFSHRGRMGVDTADLLIGSPESQTEVSRVSDGETWG
FT                   SFEGNYIVPDGQTITRLTFNPISTASGSLTSGNFLDDIQLYINVNGAKIGDVVWYDFNG
FT                   DGIQQDSEEPAPGVKVDLLTKDGAFKESTTTNNIGSYLFTDVLPGDYQVKFTLPDNDFI
FT                   FSKANQGNDTTLNSKPDKTGIASVNVPNLKSENFDMDAGITTNGKVEIQKLSGDKALSG
FT                   AVYTIKDNSQSEVAKITTDQNGTGTAEGLPPGKYTATEVTAPLGYQKNPTPKTFTITYG
FT                   DTNPVKLTFQNVEKTGSITIFKQDEANKKGLANAVFDVKSTDGTTLKKVTTNSKGYALA
FT                   ENLQPGTYVITEATAPPGYEKSAKEIRVTIPFNPQKTINITFSDNKIMVPKKPTSTNGS
FT                   TVVKVSGETTKITTLPQTGDSSNSSTIFTGLFIVAASGLLVYRRY"
FT   gene            complement(477689..478303)
FT                   /locus_tag="LMHCC_0466"
FT   CDS_pept        complement(477689..478303)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0466"
FT                   /product="transcriptional regulator, xre family, putative"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38823"
FT                   /protein_id="ACK38823.1"
FT                   /translation="MSDLGKELLNLRVKLGLSLREAKEKTGLSHNYIRKLELGFDPSTK
FT                   TPIEPSVETLKKISLGYGISFDKLMQLANYSSSIEKNEVIATKVPIYKTLHDMKSKKET
FT                   NDFRLYKQELVSKNAILVEVSNPSLSKFNSNSLLLLEPYEDSFKGELVLLTTDSKIIIG
FT                   HINLFNDKELQLKPIDSESTVTIKKDLIMIWKIVEVIQLIS"
FT   gene            478682..479305
FT                   /locus_tag="LMHCC_0467"
FT   CDS_pept        478682..479305
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0467"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38824"
FT                   /protein_id="ACK38824.1"
FT                   /translation="MVFILTCIGIIIVSYSLYLLYKIFKNRTIKFSIKQLVLSLCILII
FT                   GIWIFPSMSNSEAGSWYSEKFFPAYSSSVYELENSRDSVAAYVTYLGMVENENYDDNFF
FT                   ASVNKTDIATHEDNLKSELISLKKSKQSLEEIKAPWYLSDPYFKGGNKIINNQIEILKI
FT                   QIKDIKSYLKQGPDNIEKSYKRSGEIEEIQKKIDSLILEYKFHS"
FT   gene            479858..480565
FT                   /locus_tag="LMHCC_0468"
FT   CDS_pept        479858..480565
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0468"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38825"
FT                   /protein_id="ACK38825.1"
FT                   /translation="MNFILFRIATIENKDISNIARSFPSKTQGMEYEHENQEWHFYRQL
FT                   FFSMHKEYSKALKCGKDIHFFREVILDEKKTTKVYFYDSGDQIRHRIVSNAKRDTTILL
FT                   LEEMNYRRKNESEIKREKENGNDKPNRFKRSTFPMEDTNLNSLAIFDTSSSVSIANMET
FT                   YDMVKRIIDSMVESGELKTKEIRLLREICDDVPNSELSKQYGVPVKIIQQKKRRLQKKM
FT                   ANFKENYMNTHKE"
FT   gene            481052..481948
FT                   /locus_tag="LMHCC_0469"
FT   CDS_pept        481052..481948
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0469"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38826"
FT                   /protein_id="ACK38826.1"
FT                   /translation="MAYETAYSKELKRNDITALEANQYFHEGILTDSKAFQCSEVCSVP
FT                   LTCANFTKKSSEWNKSPYFRSPDASITHSDNCSIKTKKNALYNETEEGSSRVLSDLDFL
FT                   NLNIDLNQGFTEQKPTNTSTSSPNINLDGKKTMSNGGEKYIRTEIPQIKSLSKIVTYYF
FT                   SDDWDNNKLIIKVKGGEVISFNDLFQNLDSENDILKPPKIYYAEAKVIDKGDYYILLFN
FT                   SACSLKGLLRKPTFLINKNRLKTKKILLNKLIRLSQPNKLCQLFFFGTFIVKDNQYINF
FT                   NLDSTKSDFSANIFILE"
FT   gene            482116..482715
FT                   /locus_tag="LMHCC_0470"
FT   CDS_pept        482116..482715
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0470"
FT                   /product="putative resolvase, N terminal domain protein"
FT                   /note="putative resolvase, N terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38827"
FT                   /protein_id="ACK38827.1"
FT                   /translation="MKLGYARVSTVGQDLKTQQEKLLKQGIEEDYLYIEKKTATTTRNR
FT                   EALKDLIKNSRKGDIVYITKIDRLARSIIDLNNVMNEFLKKGVTVVFIDNNMTFSANAK
FT                   SDPMQKLLFNVLGAFAEFERDMIVNRTTEGKIRAQQAGKKLGRKGQPDQQIQKALRLMN
FT                   KREDNNLSVSDIVKATGVPKATLYKKLKELKKGTSS"
FT   gene            482716..484275
FT                   /locus_tag="LMHCC_0471"
FT   CDS_pept        482716..484275
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0471"
FT                   /product="serine/threonine protein kinase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38828"
FT                   /protein_id="ACK38828.1"
FT                   /translation="MIDNNMKSVQEKSILNLEKMKEGLIEYSTDGEFDETEYVKIRYFI
FT                   LNNDNTKKIAPDFLRTRRTLKEFWQFIKNQYSSYAERREFLTTTFNIMIDTLEQTSEFV
FT                   GSESFDLSNRIGGGGFGEVFKIEHQYVEMSFALKVLSPIFPDKNKDYVTRFFREAKILF
FT                   SLNHPNIIKIYDTGIDNGKPFIKMEYIDGYDLDGYVKKYSTLDFTKSKVPIQMILKGLA
FT                   YAHNRGVIHRDLKPSNILVSSNGTCKIIDFGISAYLEPYLHTKLTLTNERIVGGSFIDP
FT                   LLMDNPSLRDKRSDIYSIGAIWYYLIVGSAPIGSDIERRLVSSNNISKLQANVILKCLS
FT                   HSLEERFQSCEEILNTISPKKEDMLNISNNWITDVTHLDLIDFLRAYHQTAFYIREDNF
FT                   PFNYYGRYGELEFLNDLYELDSIDGKDGMSFIQEIEQHRINNYDWEDTWFLTDDRLKLK
FT                   DNDENLLKFLSHMFHPKVRNESSAWEYILENINDMLIKDGYKLVPNGEISGKIVYSYER
FT                   IL"
FT   gene            complement(484409..485353)
FT                   /locus_tag="LMHCC_0472"
FT   CDS_pept        complement(484409..485353)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0472"
FT                   /product="integrase/recombinase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38829"
FT                   /protein_id="ACK38829.1"
FT                   /translation="MRRSNHLSLEEKAIVYQTIVPDDDFVFQEFIRSRRIRNVRETTIQ
FT                   YYTDAINVLKRDREYIHVQKPIMHLSQRDLEDMIMYWKGFMRANTINSKIKAFKAYYNF
FT                   LYQQGFIKINPCENLSLLRVREEIRETLNPDEIKKIANHFKKKETFSSYRDLVIFQLLL
FT                   DTGIRISEAVGINIQDIHSDYIIVVESKNLKQRIVYISKRMREKLTSYLKIRGNLSHTK
FT                   VFINRDQLPYNKNTFQQNLREARVLCGIQKQVSPHVCRRTYAKNAILSGMDAFSLATLL
FT                   GHSSLEVTKRYVQIWGKDLKIQSKLKKDYSHLF"
FT   gene            complement(485495..485578)
FT                   /locus_tag="LMHCC_T034"
FT   tRNA            complement(485495..485578)
FT                   /locus_tag="LMHCC_T034"
FT                   /product="tRNA-Leu"
FT                   /note="tRNA-Leu-2"
FT   gene            485711..486604
FT                   /locus_tag="LMHCC_0473"
FT   CDS_pept        485711..486604
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0473"
FT                   /product="aminoglycoside phosphotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38830"
FT                   /protein_id="ACK38830.1"
FT                   /translation="MDVTQLKMLRNAKVVSEIKKGFSIDKKYQVDETYLVRVFPKELLQ
FT                   TRKQEFEIIQALGSQTPFVPRAYDFGCTDGEGYMIIGYVRGEDAENGMFSLSHSEQFKA
FT                   GFSAGEILREVHKIPLDIPKMNWLDFQTAKFKRKVEELKELEITASFLTETEQFVYENI
FT                   ARLKNRPICLQHGDFHPANIILKNKKFVGLIDFNRLEFGDPLFDLAKIGFFTTEVSIPF
FT                   ARGNILGYIDKEEVTDFWNLYALYTAMHITSAVNWAAKNESRNFKKLMNYAAKTAASHD
FT                   NFQKLMPDWMNEEEFK"
FT   gene            486601..487227
FT                   /locus_tag="LMHCC_0474"
FT   CDS_pept        486601..487227
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0474"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38831"
FT                   /protein_id="ACK38831.1"
FT                   /translation="MTEKKIDFKKEEKKFYAPKRKPERIFVPEMNFLMVDGKGDPDGEE
FT                   YQKAVQSLYAIAYTIKMSKMGETRLDGYTDFVVPPLEGFWWSEGKFDLQDRDAWLWTSI
FT                   LRQPDFVTEEVLEWAKEVAKKKKPDVDTSRVKLVRFEEGECVQMMHIGPFSEEVKTVAE
FT                   MHQFMETEGLHNDTGAVRKHHEIYLSDPRKADPEKMKTILRLPVS"
FT   gene            487349..487723
FT                   /gene="crcB"
FT                   /locus_tag="LMHCC_0475"
FT   CDS_pept        487349..487723
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="crcB"
FT                   /locus_tag="LMHCC_0475"
FT                   /product="CrcB protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38832"
FT                   /protein_id="ACK38832.1"
FT                   /translation="MGIFGALGGMCRYAMNLWLGGGDFPSATLAVNLIGCFLLAFLMQF
FT                   LAEKSRISLVILNGIGTGFIGAFTTFSAFSVDTIQLIQNGAWVLALSYVLASFIGGLIM
FT                   VKLGRMLSNKLLNRGAERVH"
FT   gene            487713..488069
FT                   /gene="crcB"
FT                   /locus_tag="LMHCC_0476"
FT   CDS_pept        487713..488069
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="crcB"
FT                   /locus_tag="LMHCC_0476"
FT                   /product="CrcB protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38833"
FT                   /protein_id="ACK38833.1"
FT                   /translation="MFINFLLVGFGAGLGAMLRYGISIFVKSKWKTNFPFATFFINITG
FT                   SFLLGFLVSSALGPDWQLFLGTGFMGGYTTFSTFKVESMELKWKTNYRVLFSYLGCTYV
FT                   FGLVAAFIGIMLGI"
FT   gene            488165..488545
FT                   /locus_tag="LMHCC_0477"
FT   CDS_pept        488165..488545
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0477"
FT                   /product="lipoprotein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38834"
FT                   /protein_id="ACK38834.1"
FT                   /translation="MTGFKKIMLPVLLVVLFLAGCNQEEVPALVLDGSVTDTSLLENNK
FT                   QLTVNGTLTWDGEKNNYASEVIITVSSNTAVTNATTGKTMKLADIKDEDTIRAVFPQGS
FT                   TVTSPAPGKVSENATSIKVTPK"
FT   gene            488679..489821
FT                   /locus_tag="LMHCC_0478"
FT   CDS_pept        488679..489821
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0478"
FT                   /product="lipoprotein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38835"
FT                   /protein_id="ACK38835.1"
FT                   /translation="MKKGILLSILLALVLVISACGESAEEKAAKTPQGKFVQTMKNGMN
FT                   VPDQSTYTTSFAVTDINVSSTDPSAQTMGILKDIKLSVTTSTDKKANKSEAKFNVTSTN
FT                   NLLPISMDLDFLVDSKTGNAYIPLKTIVEPDASLLSYLDQATGGMWSKINTDYPDLKNK
FT                   YLSTEELTSSLTDQPEAKTAVDTKEIEAATKDLNKKAIKLIDTYFTGLEKDRFKEADDG
FT                   TVSVTIKNADIANLMNQVVKLMDDEKVKADFKVIAESQGSDAVTDFDSTYAEMKSSLTD
FT                   AAKELKENKTYLISNKLTAKSGKDNSLDTLTLQTKIDDKSDASAPESISFTVKTKAEKF
FT                   VPIEDFPTKDEVISSEELNKIITDVTTKMYGGMDISGTNY"
FT   gene            489926..490387
FT                   /locus_tag="LMHCC_0479"
FT   CDS_pept        489926..490387
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0479"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38836"
FT                   /protein_id="ACK38836.1"
FT                   /translation="MEYELIMTSERETRLRAKQLGEQLAAGDVILLEGDLGAGKTTFTK
FT                   GLGEGLLIPQMIKSPTFTIIREYKKGRLPLYHMDVYRLEDASADELGLEEYFYGAGVSV
FT                   VEWAQFVREDLPEEYLEVQLFHIDENTRKMVVKPVGQRYEQLAMEVFGK"
FT   gene            490384..491076
FT                   /locus_tag="LMHCC_0480"
FT   CDS_pept        490384..491076
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0480"
FT                   /product="M22 family peptidase"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38837"
FT                   /protein_id="ACK38837.1"
FT                   /translation="MILGMDTSSDTMTIALFNEGVVLGEYTTNLKKNHSVRLLPAIAAL
FT                   MDECGVKPTDLKKIAVAKGPGSYTGLRIGVTVAKTMAWDAGIPIVGISSLALLAENGLY
FT                   FPGKVVALMDARRNNVYAGIYHASEGKMENIFADGHIALAELLEPLASSDEPILFVGTL
FT                   TEQICATVTEILGEQAIFGQADYTYSRASSLVKLAADLDGEPADNFVPAYLKLAEAESK
FT                   WLESRGSE"
FT   gene            491049..491528
FT                   /gene="rimI"
FT                   /locus_tag="LMHCC_0481"
FT   CDS_pept        491049..491528
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rimI"
FT                   /locus_tag="LMHCC_0481"
FT                   /product="ribosomal-protein-alanine acetyltransferase"
FT                   /EC_number="2.3.1.128"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38838"
FT                   /protein_id="ACK38838.1"
FT                   /translation="MVGIEGFRVSLDDALLFREATVADLKSIMNVENAAFTVPWTEAAF
FT                   RNEFIINQYAYYLLAIHEEQTVGYAGVWLVLDEGHITNIAIHPDYQGNHYGEALLREMI
FT                   RVAKERGIVRMTLEVRVSNDVAQGLYKKLGFQDGAIRKNYYPDTKEDALVMWVDL"
FT   gene            491525..492547
FT                   /locus_tag="LMHCC_0482"
FT   CDS_pept        491525..492547
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0482"
FT                   /product="probable O-sialoglycoprotein endopeptidase
FT                   (Glycoprotease)"
FT                   /EC_number="3.4.24.57"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38839"
FT                   /protein_id="ACK38839.1"
FT                   /translation="MKKNTLILGIESSCDETAASVVKNGNEIISSVVASQIESHKRFGG
FT                   VVPEIASRHHVEQITLVIEEALKQANVTMDDLDGVAVTEGPGLVGALLIGVNAAKTLAF
FT                   MHNLPLVGVHHIAGHIYANRFETELKFPLLSLVVSGGHTELVLMKADNEFEIIGETRDD
FT                   AAGEAYDKVARTLGLAYPGGVQIDKLAKDGEDTFHFPRAMMDEGSFDFSFSGLKSSFIN
FT                   TLHNLRQRGEEPNPNDMAASFQASVVDVLVSKTIRAAKQYDVKQLLLAGGVAANQGLRE
FT                   RLIQEVKLELPETELIIPPLALCGDNAAMIAAAGTVSFLQGKRSGFDMNANPGLLLEDI
FT                   "
FT   gene            complement(492779..492904)
FT                   /locus_tag="LMHCC_0483"
FT   CDS_pept        complement(492779..492904)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0483"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38840"
FT                   /protein_id="ACK38840.1"
FT                   /translation="MSGFYFLSFLLFMIVTIKTAKAIISVRLSKTVTRLSFLGNA"
FT   gene            complement(493092..494051)
FT                   /locus_tag="LMHCC_0484"
FT   CDS_pept        complement(493092..494051)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0484"
FT                   /product="cell surface hydrolase, membrane-bound"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38841"
FT                   /protein_id="ACK38841.1"
FT                   /translation="MKKILIISSSIVVSLLVIITICASFYLYSYALARDNSSMNDTATT
FT                   DETTATAKLAKKNREENVAWMEKQNLTQWTEKTADDLKLVATYLAADKPSNTTIILAHG
FT                   YRGKSGKVEMAGLARMYHEKFSYNVLMPDARAHGKSEGENIGFGWPERKDYVEWIDQVI
FT                   DKNGTDTQIALHGVSMGSSTVLMTSGEKLPKQVKSVIADCGYTSMDAELSYQLKAMFHL
FT                   PKFPIIPTASLINKAKEGFFFSEASAIDAVAKTDLPIFYIHGDSDAFVPTYMVDELYDA
FT                   TNSYKEKWIVKGAEHGQAFTVDPKTYEEKVRQFLNKTM"
FT   gene            complement(494076..496028)
FT                   /locus_tag="LMHCC_0485"
FT   CDS_pept        complement(494076..496028)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0485"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38842"
FT                   /protein_id="ACK38842.1"
FT                   /translation="MILLQVQQISKFFGAEVILDNIKLEVKTGDRIALVGRNGAGKSTL
FT                   LKIIAGKMSYDGGTISKPKSVEIGYLAQNTGLESSKTIWDEMLSVFDSLRKMEADLRKM
FT                   ELRLGEPELYNDPEKYQALMTDYDTLQHTFKEIGGYTYEAEIRSVLNGLRFYPEDYEVE
FT                   IASLSGGQKTRLALAKLLLAKQDILVLDEPTNHLDIETLAWLETYLQNYHGSLLIVSHD
FT                   RYFLDKVVNQVYEISRTKIDHYKGNYSSFVSQKQAKLEQMWKEFDKQQKQIAKLEDFVA
FT                   RNIVRASTTKRAQSRRKQLEKMDVLGRPQGDEKAARFGFQFEKQTGKDVLMVDQLSIGY
FT                   AKDKRIASNLTFEMKRQDSLALVGPNGIGKSTLLKTLIRDIPALSGEFHFGAGVKIGYY
FT                   DQEQAKLTSNKTVLMELWDDYPELNEVNVRTTLGNFLFSDDDVLKNVQSLSGGEKARLA
FT                   LAKLTLLEANVLILDEPTNHLDIESKEVLEAALIDFEGTILFVSHDRYFINRIASKIVE
FT                   LAPEKATVFLGDYDYYQEKLAEAKELARLDAEDRRKKGEQVEATASVRKLNYQEEKEQQ
FT                   KLLRQRKRKLEEVEKSMEATDEKIAELEHQLTNPEVFQDHEKALEITQELDAVKATGEK
FT                   LMEEWETLSEELESM"
FT   gene            496270..496986
FT                   /locus_tag="LMHCC_0486"
FT   CDS_pept        496270..496986
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0486"
FT                   /product="redox-sensing transcriptional repressor rex"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38843"
FT                   /protein_id="ACK38843.1"
FT                   /translation="MKGSTVHKSFNFRKNLKEEGTEGMMEETTKIPQATAKRLPLYHRY
FT                   LKYLDESGKERVSSAELSEAVKVDSATIRRDFSYFGALGKKGYGYNVSYILDFFSKTLS
FT                   QDKQTNVALIGVGNLGTALLHYNFMKNNNIKIVAAFDVDPAKVGSVQQDIPIYHLNDME
FT                   EIVRENGVEVVILTVPADEAQVTVDRLIEADVKGILNFTPARISVPKQVRVHHIDLTTE
FT                   LQTLIYFLENYPAKTE"
FT   gene            complement(497020..497217)
FT                   /locus_tag="LMHCC_0487"
FT   CDS_pept        complement(497020..497217)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0487"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38844"
FT                   /protein_id="ACK38844.1"
FT                   /translation="MKNSLIKQSFLYFALGLVFVYFVVVRVADYGYDVLAYILIIMTLM
FT                   DFGIGIGLIITGLKRRKKNL"
FT   gene            complement(497219..497905)
FT                   /locus_tag="LMHCC_0488"
FT   CDS_pept        complement(497219..497905)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0488"
FT                   /product="caax amino protease family protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38845"
FT                   /protein_id="ACK38845.1"
FT                   /translation="MAKRYITIVLIYLLLLFSASVGIPIVQHILLSTTSLSAESAASYG
FT                   MVIWSIFSNLLSLAIIIPMLYRKPKENKIEIGEKTKPLLSIVWIVGGVIGLYVAQIICS
FT                   VIITMISGELSNSANTELLVDLTKAAPIFLIFISILGPILEELVFRKVIFGGLSNVTNI
FT                   HVAAVISSLFFGLLHGDISFLLTYFVIGLILCFLYTKTKRIAVSMGAHILMNTIVLLLS
FT                   LGIIGG"
FT   gene            498140..498424
FT                   /gene="groS"
FT                   /locus_tag="LMHCC_0489"
FT   CDS_pept        498140..498424
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="groS"
FT                   /locus_tag="LMHCC_0489"
FT                   /product="chaperonin GroS"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38846"
FT                   /db_xref="GOA:B8DH58"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR018369"
FT                   /db_xref="InterPro:IPR020818"
FT                   /db_xref="InterPro:IPR037124"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8DH58"
FT                   /protein_id="ACK38846.1"
FT                   /translation="MLKPLGDRVVIEVLEAEEKTASGIVLPDSAKEKPQSGKIVAVGSG
FT                   RVLDNGTKEPLEVAEGDTVIFAKYSGTEVTYEGTDYLILRESDILAITK"
FT   gene            498459..500087
FT                   /gene="groL"
FT                   /locus_tag="LMHCC_0490"
FT   CDS_pept        498459..500087
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="groL"
FT                   /locus_tag="LMHCC_0490"
FT                   /product="chaperonin GroL"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38847"
FT                   /db_xref="GOA:B8DH59"
FT                   /db_xref="InterPro:IPR001844"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR018370"
FT                   /db_xref="InterPro:IPR027409"
FT                   /db_xref="InterPro:IPR027410"
FT                   /db_xref="InterPro:IPR027413"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8DH59"
FT                   /protein_id="ACK38847.1"
FT                   /translation="MAKDIKFSEDARRAMLRGVDQLANAVKVTLGPKGRNVVLEKKFGS
FT                   PLITNDGVTIAKEIELEDPFENMGAKLVSEVASKTNDVAGDGTTTATVLAQAMIQEGLK
FT                   NVTAGANPVGVRRGIEKAVATAIEELKAISKPIESKESIAQVAAISSGDEEVGKLIAEA
FT                   MERVGNDGVITIEESKGFATELDVVEGMQFDRGYTSPYMVTDSDKMEAVLEKPYILITD
FT                   KKINNIQEILPVLEQVVQQGRPMLIIAEDVEGEAQATLVLNKLRGTFNVVAVKAPGFGD
FT                   RRKAMLEDIAVLTGGQVITEDLGLELKTATVDQLGTANKVVVTKDDTTIVEGAGDSTQI
FT                   SARVNQIRAQMEETTSEFDREKLQERLAKLAGGVAVVKVGAATETELKERKLRIEDALN
FT                   STRAAVEEGIVAGGGTALVSIYNKVAALEAEGDVETGINIVLRSLEEPVRQIAHNAGLE
FT                   GSVIVERLKHEAVGVGFNAANGEWINMIDAGIVDPTKVTRSALQNASSVAALLLTTEAV
FT                   VADKPDENGPAAVPDMGMGGMGGMM"
FT   gene            500343..501320
FT                   /locus_tag="LMHCC_0491"
FT   CDS_pept        500343..501320
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0491"
FT                   /product="choloylglycine hydrolase (conjugated bile
FT                   acidhydrolase) (cbah) (bile salt hydrolase)"
FT                   /EC_number="3.5.1.24"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38848"
FT                   /protein_id="ACK38848.1"
FT                   /translation="MCTSITYTTKDHYFGRNFDYELSYKEVVVVTPKNYPFHFRKVEDI
FT                   EKHYALIGIAAVMENYPLYYDATNEKGLSMAGLNFSGNADYKDFAEGKDNVTPFEFIPW
FT                   ILGQCATVKEARRLLQRINLVNISFSENLPLSQLHWLMADQNESIVVECVKDGLHIYDN
FT                   PVGVLTNNPTFDYQLFNLNNYRVLSSETPENNFSNEIDLDAYSRGMGGIGLPGDLSSMS
FT                   RFVKATFTKLNSVSGDSESESISQFFHILGSVEQQKGLCDVGGEKYEHTIYSSCCNIDK
FT                   GIYYYRTYGNSQITGVDMHQEDLESEELAIYPLVNEQQLNIVNK"
FT   gene            501472..501681
FT                   /locus_tag="LMHCC_0492"
FT   CDS_pept        501472..501681
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0492"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38849"
FT                   /protein_id="ACK38849.1"
FT                   /translation="MRENSIIGRIIAFCAICFAFFNPKTVTYWLGVRAESGPAWYLTTV
FT                   VACGIAVFVLIDLIKKIKRRKAAE"
FT   gene            501726..502121
FT                   /locus_tag="LMHCC_0493"
FT   CDS_pept        501726..502121
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0493"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38850"
FT                   /protein_id="ACK38850.1"
FT                   /translation="MNWTRISSIIIVGFTAIGAIYGGLSMVFMPSGGLLSLSTGLLDGS
FT                   PFVDYLVPGIFLFVFVGLFHLAALIYLLKKLPRTKEVMFAAAAVLAVWMIVQLLIIGYV
FT                   FILQIIFLVVAAVEMFLAIQLKKQQKN"
FT   gene            502493..503362
FT                   /locus_tag="LMHCC_0494"
FT   CDS_pept        502493..503362
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0494"
FT                   /product="lipoprotein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38851"
FT                   /protein_id="ACK38851.1"
FT                   /translation="MKKKIIGLLASILLLGGCFNMNEKTDQEKAQEGTTLVQDYVGQGL
FT                   SFVDGNKSAERVKEHEEEIKQEAINYMKNTYKTDVKVNNVVPARNAAVVMVESEEPIQF
FT                   HTYVIVGLILNKDEVGNARSDEGEVEKAIVGGLYAKAYEEEFKNLDVFAEKIAKENNLL
FT                   GMRAEAIDKTASDGYTSNYYFLSIFALDYPSVYNAYLENPKISAEELKKLFEKDDPTSK
FT                   NISIPMKFFVRGNKLPEQGVADNLANEIKQEEGIPKGRYAVLIYKNFIVDRVGLPDGES
FT                   VDVEGIIK"
FT   gene            503378..505366
FT                   /locus_tag="LMHCC_0495"
FT   CDS_pept        503378..505366
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0495"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38852"
FT                   /protein_id="ACK38852.1"
FT                   /translation="MPEKLKTSDVDLIELSGKWVYKHPGELSNINVNGTKYEVRAGEYN
FT                   KASGLDYMIVENTSTGEISMIFEGTQGTQDFLTDGTLPGSIPNTQLREADAAYKKESQK
FT                   YNIKNVAGNSLGGGLSNYVASKNDGIRSVTYNPAILPNGIYDKDNPRITNYLSEYDPLT
FT                   LGERGMGYGDRLPGESHILQNNVPWLQTILSNHTGYDDAGVTVNGKNIPIDADAYLPVG
FT                   IWSGQVLTGGGNGQKIDMNPDNIRILANSLRTRMMEQIKRGQFYLDTAVDLVNNEGNHL
FT                   DNRTTSLQETFDNLLAEGEFGGIITSLANYAEFRDEMEKAKPVSYAAIDFMQRVRTLPI
FT                   LGEVLDVVSGSFFHALDLLVDIPALVNDLALRTEDMMDQVSKIKMQAIPELFKGINDQY
FT                   LSDAMVTELKEHYKILDENKDLVVKQILTFSSQVTYVSNELEKADKLLSATQKVQSVGA
FT                   PPATQAYVLKESKALKDGMGKKQRLLDRNFRDFSAKTTNLLMPILSSIRSITNQLKQVI
FT                   KSAIRYLEDLQTGLSMVKIPFTDRDYQLKEELREYIRKLQEILLTVRGVGSAVKDMESN
FT                   LEHVLAIYRPYIDTALFEGTKFQDVILLNKAATNIFHSAELIFGDIKHQLSGNTSAAIS
FT                   ALDKVAVQTSNNMKSLLEQAKRGSIHI"
FT   gene            complement(505431..505817)
FT                   /gene="mscL"
FT                   /locus_tag="LMHCC_0496"
FT   CDS_pept        complement(505431..505817)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mscL"
FT                   /locus_tag="LMHCC_0496"
FT                   /product="large conductance mechanosensitive channel
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38853"
FT                   /db_xref="GOA:B8DH65"
FT                   /db_xref="InterPro:IPR001185"
FT                   /db_xref="InterPro:IPR019823"
FT                   /db_xref="InterPro:IPR036019"
FT                   /db_xref="InterPro:IPR037673"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8DH65"
FT                   /protein_id="ACK38853.1"
FT                   /translation="MKKMLVEFRDFALKGNVLDLAVAVVIGAAFGKIVSSLVDNIIMPL
FT                   VGVLLGGLDFTDLSFKVGKSVIQYGAFIQSIVDFIIIAFAIFIFVKVLTSFIKKKEQTV
FT                   EETPVPPTEEYLKEIRDLLKEQQK"
FT   gene            complement(505879..506070)
FT                   /locus_tag="LMHCC_0497"
FT   CDS_pept        complement(505879..506070)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0497"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38854"
FT                   /protein_id="ACK38854.1"
FT                   /translation="MLRYIELFFMFAFVTLITMWIQALLAKWKPTILRSFWLRTLTFII
FT                   IGYALMAPTLYIGSLLLK"
FT   gene            506210..507835
FT                   /locus_tag="LMHCC_0498"
FT   CDS_pept        506210..507835
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0498"
FT                   /product="copper resistance domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38855"
FT                   /protein_id="ACK38855.1"
FT                   /translation="MKLLKRVSFFLIILYLLIVPVQHVSAHAYLENSNPADQSHIQTAP
FT                   EKVTLVFNEEIEADFPLIEVKDSSGKQVETGKTSVSKKNNHMVEASLPADLKADVYSVS
FT                   WRVVSADGHAVTGIISFKLGDTKATFQASEVPSSGADLQISSIQKAILYIGFSLFIGVL
FT                   VFGLGLYPRKEQISEKISGRLKKVTWIALALLGVALFMQLFVQTSITTGVSISESFGPS
FT                   KLAAFLTTKTGYIWISEFIVWLLLAIFTIMMFFKKKQWSWFALLTESALIGYLIFAKAQ
FT                   NGHAAASADKIVSITADMLHMIAASVWVGGILVLLFVLPRTGKAREVWSRFAIVAIIAV
FT                   ASILVSGLLMAVMNIGQMANLFTTNYGKILLFKIGLFLLMALLGLGHYIYIKLKNQRLP
FT                   YKTILMELIIGTIILVVASVLTNVQTPPPPAPKAFDETIAAEGEKAKINLRVEPATVGQ
FT                   NQFIITFTSADGSAKTDFEQVTITTKSTKTDEKSTFQAKLANDTQYFAEGLYINQTGKW
FT                   EIMVHGLTKDFTDINQTFTTNITQ"
FT   gene            507848..508465
FT                   /locus_tag="LMHCC_0499"
FT   CDS_pept        507848..508465
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0499"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38856"
FT                   /protein_id="ACK38856.1"
FT                   /translation="MKKIISSIVVLLAVFIIPFQASAHVSVLPSESTVDSWETYTMKVP
FT                   SEKDVASKKIVLKVEKGVSFESYEPVPGWTTTVDKKNGTVTWQTEGNGIEKGQFQRFSF
FT                   IAKNPSEEGEIAWNAYQYYEDGSIVEWVGAEDSETPHATTKIVKESSKSATGSHGEVVA
FT                   GAENTAGDTSSSGDNTILLWTAVAISVIALITGILAILSRKK"
FT   gene            508484..509125
FT                   /locus_tag="LMHCC_0500"
FT   CDS_pept        508484..509125
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0500"
FT                   /product="mosc domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38857"
FT                   /protein_id="ACK38857.1"
FT                   /translation="MERKIMHLAVGKPKELNLSKNKRMMTGIEKKLVQSASLTTTGFEN
FT                   DAPHNLKYHGGPDRTVCIYPYEHYAKWAAMFGEELQVTAFGENLITTNMLESSVQIGDK
FT                   FQIGETVIQITEARNPCSTIEKFNGIPNLYKAIHKTGLTGYLCRTITPGIIHATDEIKQ
FT                   IHQESHGVTVAFCHDKVLHKNGTKEDLERILAVEALSERYRDQVEKQIKK"
FT   gene            complement(509131..509874)
FT                   /locus_tag="LMHCC_0501"
FT   CDS_pept        complement(509131..509874)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0501"
FT                   /product="Ion channel family"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38858"
FT                   /protein_id="ACK38858.1"
FT                   /translation="MDKTKRKMIYETFMLILILLSLALLPYRNSFTFILNWIIWVIFTL
FT                   DYLVRLYRADNKWHYVKTHPFQLIAIIPFYGGFRAARIVSFVHLLSITAMGRRYIVPIY
FT                   NFFRSNGLNRFLMIFVLLVIIIPVPMVFIEPEINNYPDALWWAIVTATTVGYGDIVPVT
FT                   PIGRILASIMMLFGIAFIGMITSTITNFFRAKKTTTSSTQRASKITQLIADTPDLTNEE
FT                   IAVVEQFLALRKKELADENIKSDSE"
FT   gene            complement(509983..510900)
FT                   /locus_tag="LMHCC_0502"
FT   CDS_pept        complement(509983..510900)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0502"
FT                   /product="cytochrome aa3-controlling protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38859"
FT                   /db_xref="GOA:B8DH71"
FT                   /db_xref="InterPro:IPR003780"
FT                   /db_xref="InterPro:IPR023755"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8DH71"
FT                   /protein_id="ACK38859.1"
FT                   /translation="MKKFLKVWSVLTIICMTVVVFGGALVTKTGSADGCGNSWPLCNGQ
FT                   LVRLTDVTPEKLIEFMHRMTTGISSIFVIVLAICAWIYMKNRRETKPLAIIAVLFLIIQ
FT                   ALMGMAAVVWGQNPYIMALHFGISIICYASIVLLALMIFEVDRKFDARNLVMGTKLRIN
FT                   IYALTIYTYLAVYTGALVRHEKASMAVPVWPFENGHFIMPTSVQDYVQYFHRLAAFILI
FT                   VWLLYVTWLVFRDYRRYRVLTFSMVLSLVFIALQAVTGALSVYTGVNLYIALAHSLIIT
FT                   MLFALLCYLCLLASRSKSNRLRIK"
FT   gene            511137..512042
FT                   /gene="cyoE"
FT                   /locus_tag="LMHCC_0503"
FT   CDS_pept        511137..512042
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cyoE"
FT                   /locus_tag="LMHCC_0503"
FT                   /product="protoheme IX farnesyltransferase"
FT                   /EC_number="2.5.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38860"
FT                   /db_xref="GOA:B8DH72"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR006369"
FT                   /db_xref="InterPro:IPR030470"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8DH72"
FT                   /protein_id="ACK38860.1"
FT                   /translation="MNQIEKTGELSASRFTVRDFTELVKIGIVNSNTITAFTGMWLAFQ
FT                   LNGISFIQNVDVIFFTIVGSALIVAASGAFNNVIDRDIDGIMERTKNRPTMTGKISGKR
FT                   ALMVALVLGVVGTIMLFMTTWQAGVLGVIGVFLYVVVYSLYAKRKLVSNTVIGSFSGAV
FT                   PPLIGWFAVEPSFSIVPIMLFLVMFCWQPPHFYAIAIKRKEEYAAAGIPMLPVVKGIER
FT                   TKKSMFFWVILLTILPFFMFELGIVYVVLATLLNIGWLALSIYGFKMEDSIKWAKWMFV
FT                   YSLNYMTILFVAMVVISIFL"
FT   gene            512189..513244
FT                   /locus_tag="LMHCC_0504"
FT   CDS_pept        512189..513244
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0504"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38861"
FT                   /protein_id="ACK38861.1"
FT                   /translation="MKFIMRVAVLLIICLFIGYNTDLFFSKSVEKNTAEDTATKSNFPD
FT                   NKKTTNENPKQVQDSSSLARFINKNVSDLKKEFGDPVRVDKTAYGYDNYIYSQPGTSYM
FT                   QVGVTNNIVQTIYALGQDLNVMPYTIGMSTEKVFTDANLQSEISFNYKDSYYKFELSEE
FT                   DLNARPIVNIGSGVYAQLNFDKFKSKLISVRYLNKLSFVKMRPYELSYQGEIYEEKLSP
FT                   ADWNAIDDASSKQVLEITNVIRDRYGIEEVAWDESVAKVAYGHSVDMKKNDYFDHTSPT
FT                   QGDLSKRLSKGDVKYTKAGENIAYNYVDSAAAVEGWLNSKGHRENLLDGSYTYMGAGTY
FT                   QKYYTQNFIIK"
FT   gene            513293..513742
FT                   /locus_tag="LMHCC_0505"
FT   CDS_pept        513293..513742
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0505"
FT                   /product="regulatory protein YlbF"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38862"
FT                   /protein_id="ACK38862.1"
FT                   /translation="MLATMENMALLDLSDELASMILNSEEAQNYKSAKEALLNDANSQK
FT                   NIRQFIRIKEQYEEVQRFGRYHPDYKEVTRKTRAYKREVDMDQNVAAFRRAEMDLQSLL
FT                   DEISLLLASAVSENIKVPTGNPFFETKSACSTGGCGSGGGCGCSA"
FT   gene            513773..514054
FT                   /locus_tag="LMHCC_0506"
FT   CDS_pept        513773..514054
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0506"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38863"
FT                   /db_xref="GOA:B8DH75"
FT                   /db_xref="InterPro:IPR016979"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8DH75"
FT                   /protein_id="ACK38863.1"
FT                   /translation="MENDRQAIVVWMNHLKQVRSLKRFGNVHYVSRKLKYAVLYCDMAE
FT                   VEDISNKVSRFHYVKRVEMSFRPFLKTEYESKKEMMYEHKNEDVQISI"
FT   gene            514151..514708
FT                   /gene="rsmD"
FT                   /locus_tag="LMHCC_0507"
FT   CDS_pept        514151..514708
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rsmD"
FT                   /locus_tag="LMHCC_0507"
FT                   /product="RNA methyltransferase, RsmD family"
FT                   /EC_number="2.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38864"
FT                   /protein_id="ACK38864.1"
FT                   /translation="MRVIAGERKGHALKAVPGNNTRPTTDKVKESLFSIIGPFFDGDMV
FT                   LDLFAGSGGLGIEALSRGAERAVFIDQATLAIKTIHQNLEGCHFTERAEVYRNDAERAL
FT                   KLLHKNEWKFDLVFLDPPYKKQQLEKLLGILEKLELVNENGRIICEHDKEAIMPDTIGK
FT                   FEKIKSVSYGITVLSIFEFQEA"
FT   gene            514711..515193
FT                   /gene="coaD"
FT                   /locus_tag="LMHCC_0508"
FT   CDS_pept        514711..515193
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="coaD"
FT                   /locus_tag="LMHCC_0508"
FT                   /product="pantetheine-phosphate adenylyltransferase"
FT                   /EC_number="2.7.7.3"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38865"
FT                   /db_xref="GOA:B8DH77"
FT                   /db_xref="InterPro:IPR001980"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8DH77"
FT                   /protein_id="ACK38865.1"
FT                   /translation="MGDKIAVIPGTFDPITNGHLDIIERAAKIFDVLYVSVLNNSSKKP
FT                   LFTIEERMEMIRQVTAHLPNVQVESASGLTVDYAATRGATAIVRGLRAVSDFEYEMQIA
FT                   SMNRTLNADIETFFVMTNTKYSFLSSSMVKEVAQYQGDISELVPEIVNKAVQAKFK"
FT   gene            515212..516252
FT                   /locus_tag="LMHCC_0509"
FT   CDS_pept        515212..516252
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0509"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38866"
FT                   /protein_id="ACK38866.1"
FT                   /translation="MRKEWKKITAIVLLIIIIAGFFIPVPYYISKPGGTEELAPLVTVD
FT                   NHPNKKDGSLSLVTIAMGKANIYTYMTAKFLPYHELEKDSEIKYENESDEEYNVRQMQM
FT                   MNESKNNAIQVAYKAAGQEVKVTYDGVYVLSVKDDVPAADVLHAGDLITKIDGNAFESS
FT                   QEFIDYIHSKKVGDTVKINYKHGDKNEQADIKLTAIDKKGTPGIGITLVDDEKITADPT
FT                   VKIDSEKIGGPSAGLMFSLEIYSRFQKDDLTDGKKIAGTGTIDPDGTVGRIGGIDQKVV
FT                   AADKSGAKIFFAPNDPITDEMKKSDPSIESNYDTAVKTAKDIDSKMKIVPVKTFQDAVD
FT                   YLEKLQ"
FT   gene            complement(516295..518535)
FT                   /locus_tag="LMHCC_0510"
FT   CDS_pept        complement(516295..518535)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0510"
FT                   /product="daunorubicin resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38867"
FT                   /protein_id="ACK38867.1"
FT                   /translation="MVQEYIRLRGARENNLQNISLDIPKRKITIFTGVSGSGKSSIVFE
FT                   TIATESQRQLNETYSAYLRNFLPKYTQPDADSIENLSTSVIIDQKRLGGNSRSTLGTIT
FT                   DINSILRLLFSRVGKPSIGTANLFSFNDPAGMCPDCHGVGQKVSVDLVKLLDPNKSLKE
FT                   GAILFPTFSVDSWYWNSYAYSGFFDVNKKIKDYTDEEYDMLLHGKDIKVFLETPMGSMN
FT                   ATYEGLIPKFNRLYIQKEGEMSASTKKRVDKFTHIAPCTTCEGTRLSAQALSCKINGAN
FT                   IADFTAMQLDELKETIARIDDPIAAPMVKSVTERLQHLIDIGLGYMTLDRQTASLSGGE
FT                   SQRVKMIRHLNSSLTDLLYIFDEPSIGLHPRDVHRLNELLVKLRDKGNTILVVEHDPDV
FT                   IKIADHIVDVGPHAGKHGGEIQFVGSYTDLLKSDTLTGQFLNRHLPINSKPRQPKGFLT
FT                   TEKSSRFNLKDIQANIPKEVLTVVTGVAGSGKSTLIHSVFLKEYPDAIVIDQSAAHANI
FT                   RSNPATYTGIMDPIRKAFGKENDVSPSLFSYNSKGACENCKGLGFTTMDLAFMDSIRTP
FT                   CEVCHGKRFQDSVLQYKLNGKSISDVLELTVSEALDFFTDKKILKKIEAMEEVGIGYVT
FT                   LGQALSTLSGGECQRLKLANELHKKGSIYIMDEPTTGLHMSDIEHILTIIHSLVNKGNT
FT                   VIVIEHNVDIIRNADWIIDLGPEGGSAGGQIIFEGAPLDLLENKQSLTAKYL"
FT   gene            complement(518617..519789)
FT                   /locus_tag="LMHCC_0511"
FT   CDS_pept        complement(518617..519789)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0511"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38868"
FT                   /db_xref="GOA:B8DH80"
FT                   /db_xref="InterPro:IPR008513"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8DH80"
FT                   /protein_id="ACK38868.1"
FT                   /translation="MKATGIVVEYNPFHNGHKLHLNKARELTQADVVIAVMSGSFVQRG
FT                   EPAIIPKWERAKMALAAGVDMVIELPVSFATQHATIFAEEAVRILDAIHVDTLFFGSEH
FT                   GVAEDFTFAAKKVVENEARFDEAIQLALVDKKTSYARAYTEAFKKLFGQNLLDITKPNN
FT                   ILGFHYALAAQNQNPSISLQTIPREHAGYHDEEANHDQIASATAIRKLILAGKLEEASH
FT                   YLPASSIAILRNYEGPFLSWKDYWSFLQYRLIQAGSEELEGIRGVSEGIQNRMQQAATK
FT                   AQNFSDFIELTKTKRYSNTRLQRTALQILLNARSQTSSPYIRILGMNKTGQQYLSLHKK
FT                   NISLPIVTTVSKAPVGLLEEELRATNIYTLAKGLENYQAGDFHIPPILTL"
FT   gene            519919..520455
FT                   /locus_tag="LMHCC_0512"
FT   CDS_pept        519919..520455
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0512"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38869"
FT                   /protein_id="ACK38869.1"
FT                   /translation="MKWSISQLKKYRDSNFTINEKADLKKFFQENNIDVRDASPVQVTG
FT                   ELIVHPEEVTANLTMKGEWTLPCARTLEDVIYPYEVHATETFVKSKEQVLDESWHVMEQ
FT                   DMVDLTPVVEELLLVEIPMQVFSEDALEMSNLPRGNEWEMKTEEGNLLEQIAKEPKVDP
FT                   RLAGLANFFDEKKED"
FT   gene            520722..520868
FT                   /locus_tag="LMHCC_0513"
FT   CDS_pept        520722..520868
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0513"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38870"
FT                   /protein_id="ACK38870.1"
FT                   /translation="MLKAGDVSLVENEPRKTPWVFRGFCLRTEVQKNATSDKIKALTNM
FT                   ELN"
FT   gene            520869..521762
FT                   /gene="panE"
FT                   /locus_tag="LMHCC_0514"
FT   CDS_pept        520869..521762
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="panE"
FT                   /locus_tag="LMHCC_0514"
FT                   /product="2-dehydropantoate 2-reductase"
FT                   /EC_number="1.1.1.169"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38871"
FT                   /protein_id="ACK38871.1"
FT                   /translation="MANQLKVGIIGAGAMGLLYAANFATISELTLFTRRKEQSDLLNQK
FT                   GLSLKDRSELKNIHIQAAEITDTEKLSEQQLLIIAVKQYSLNAILPVLQKISEQVPLLF
FT                   IQNGAAHLDSLSLLGDKRTILLGISEHGAGREDDTTVIWRGHGRTKYSIYQGELSEALT
FT                   EMLHSNPDFPVEKHASYLEIIQEKLFINAVINPLTAVLQVQNGKLLENEEWHALLKVIV
FT                   KEIQTVLPVENALEKVEAVCQVTALNFSSMALDRMNNRMTEIDGIVLPLLEKGEALPTL
FT                   RALYHLIKGLEGESDV"
FT   gene            521755..522141
FT                   /locus_tag="LMHCC_0516"
FT   CDS_pept        521755..522141
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0516"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38873"
FT                   /protein_id="ACK38873.1"
FT                   /translation="MFDWLTNSTAMIIILPVVVFILTMFFSSFKIKKSQRRIMLAADLT
FT                   TIFLIIAVHFFMIVLFNRSFLLYILLFLFILGIVIVVMAAKKEGEIQFRKILRGYWRLC
FT                   FFIFALLYVVLYLYGIIYSLILRF"
FT   gene            complement(522113..523885)
FT                   /locus_tag="LMHCC_0515"
FT   CDS_pept        complement(522113..523885)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0515"
FT                   /product="bacterial extracellular solute-binding protein,
FT                   family 5"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38872"
FT                   /protein_id="ACK38872.1"
FT                   /translation="MDKDYFTMRAYLYNKSTDLEIPFKLNDLATIWFCTTKNAKRKLQQ
FT                   YQANNMLTYLPGLGRGNVSRIVFPKQLEMEVLEVLEHSLAMDAFSDILFLLQLPIPKSW
FT                   FSTISTEIQQMFGLQVTENQQEVLRSIVRRKLTTLDPLQTSVSMEAFLITQISDSLVKY
FT                   DEKKKKIIPHIAHHWKVSNDFTEWTFYLRKNVLFHHGRMLDSEDVKYTLKRSMQAKSVS
FT                   FWQLEAIKSIDCINKFTLHVRLKKPDSFFIRYLCTANMAILPRDVIFDEYKWISTGPFR
FT                   IRERNDERLVLEAFDGYFLARPILDRVEFWTAETGTTLKNIPMQFTSVDYEENPAYVER
FT                   RKLGVGVNFLCFNTHRKGIPQHPAFREAIYHLIDCQKASVQHFENYGTVASNYYPEKST
FT                   PPKKHPEKINALLKEANYQGEKVIFGTTQHPTAIKESQWIQELAADFGINLERKIITHQ
FT                   EASYSKVPAEETDFMMMGEIPAADDEMAYLDFLNNPYLLPQQLFNQTIIKELTEKLDAF
FT                   KTEKDASKRDVLQTSIDRWLTENYYLIYLHHPEKSQSLHSMIKGIAENPYGYFDLSKVW
FT                   IETNPLKNVKSDYK"
FT   gene            524001..525248
FT                   /locus_tag="LMHCC_0517"
FT   CDS_pept        524001..525248
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0517"
FT                   /product="permease of the major facilitator superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38874"
FT                   /protein_id="ACK38874.1"
FT                   /translation="MFRELHPNIRARILIQFLSKVIGSMIFPFMAIYFSMEINSSIAGV
FT                   LLMINVFAQFLAGMYGGHLADLIGRKKLMVTGELLKVFAFLGMVICNSPMFHSPWITFV
FT                   MLLVIGVAQGLINPAGEAMLIDVSTPENRSFMYSVSYWANNLSILIGIMVGGWFFVDYL
FT                   FPLLVVLFFMSFVTAWLTISLISETLQQKTVPQKGTYGLMKLFKNYGQVLHDYRFLLYT
FT                   IGGIAIMSIEFQRSNYISVRLAEDVKALLVHLGPLGDISLNGVQIVSVLTAVNTLCIVL
FT                   FTVPIARFVTKRAQQPIMYVGFTLFALGFAVCAFANSLAVLLLATVVLSVGELLYVPTR
FT                   QTILAAIVDDDRRGAYMAFNGIVFQIGKMIGSVSLVFAPFIGKYGMGAFTIILGILSIV
FT                   FSALALKSGWEKVLAK"
FT   gene            525451..525882
FT                   /gene="mraZ"
FT                   /locus_tag="LMHCC_0518"
FT   CDS_pept        525451..525882
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mraZ"
FT                   /locus_tag="LMHCC_0518"
FT                   /product="MraZ protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38875"
FT                   /db_xref="GOA:B8DH87"
FT                   /db_xref="InterPro:IPR003444"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR020603"
FT                   /db_xref="InterPro:IPR035642"
FT                   /db_xref="InterPro:IPR035644"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="InterPro:IPR038619"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8DH87"
FT                   /protein_id="ACK38875.1"
FT                   /translation="MFMGEYQHNIDIKGRLIVPAKFRELLGDNFVITRGLDKCLFAYPQ
FT                   EEWKKLEEKLQTLPLTKKDARSFTRFFFSGASECELDKQGRINIPSNLLQYADLEKETV
FT                   IIGVSSRIEIWSKSEWDDVFNEAEESFADLAENMIGFDI"
FT   gene            525895..526833
FT                   /gene="mraW"
FT                   /locus_tag="LMHCC_0519"
FT   CDS_pept        525895..526833
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mraW"
FT                   /locus_tag="LMHCC_0519"
FT                   /product="S-adenosyl-methyltransferase MraW"
FT                   /EC_number="2.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38876"
FT                   /db_xref="GOA:B8DH88"
FT                   /db_xref="InterPro:IPR002903"
FT                   /db_xref="InterPro:IPR023397"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8DH88"
FT                   /protein_id="ACK38876.1"
FT                   /translation="MFKHETVLLHETVDMLEVKPDGIYVDATLGGAGHSEYLLNKLNEK
FT                   GHLFAFDQDQTAIDNAKIKLADYSDKVTFIKANFRDMKEALNERGIEAVDGILYDLGVS
FT                   SPQLDERERGFSYHQDAALDMRMDQEQELTAKTVVNEWSYQDLIRIFFQYGEEKFSKQI
FT                   AREIERRREVKPIETTGELVDIIKTAIPAPARRKGGHPGKRTFQAIRIAVNDELGAVED
FT                   SLEKALTLLKPGGRISVITFHSLEDRITKQLFQEATKGPDLPPGLPVIPDEYKPDFKLA
FT                   TRKPIVPSEEELEQNNRARSAKLRVIEKIIK"
FT   gene            526850..527212
FT                   /locus_tag="LMHCC_0520"
FT   CDS_pept        526850..527212
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0520"
FT                   /product="cell division protein, FtsL family"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38877"
FT                   /protein_id="ACK38877.1"
FT                   /translation="MSNVAYKSNLEPNRVHREAEQPKKQILKRGQMTLGEKVIITIALA
FT                   IVLVVAFRIISVQAQIYTVNQEIQTKETKILEQQKSNEDLKVEVKDLGRYERILKIAKE
FT                   KGLKLDGDNVKVVDGQ"
FT   gene            527281..529464
FT                   /locus_tag="LMHCC_0521"
FT   CDS_pept        527281..529464
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0521"
FT                   /product="penicillin-binding protein 2B (PBP-2B)"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38878"
FT                   /protein_id="ACK38878.1"
FT                   /translation="MVSGRFLYLQITGEANGVPLAAKASKQHLKSSVLEAKRGSILDRK
FT                   GEVLAEDTASYTIAAVVSDKLSKTTKNPMRVVDEEKTAQVLAKYIPMDESDILDKLNEK
FT                   GKYQVEFGSAGKNISTETKAKIDKEKLPGIEFTRQSERFYPNGTFATQLIGFAQQEEEK
FT                   NTTVLEGKMGIESRYNDILTGKNGKIDYSTDRMGYILPNSKNKVTEAKDGKDITLTLDK
FT                   KIQTFLEDTMTTVDAKYKPKNMMAVVADPKTGEILAISQRPSFNPADRSTITGNSSSIW
FT                   QDLPVEYAYEPGSVMKIISLASAIDTNVYNPNDYYQSGSYKVGDIAIHDHNNGNGWGSI
FT                   TYREGVERSSNVAFAKLLNKMGTDTFKTYLDKFGFGKKTGIALPNETSGKILYNYPIEK
FT                   VTTVFGQGTTVSMMQMIQAASAIASDGTMKEPYVVSSVKDPNTGEKTDTKTKIAGKPIS
FT                   AETAKKTRDELKNVISGQNGTGKLYAIPGYDVAGKTGTSQIPDPKTGKYMTGADNYIFS
FT                   FLGMAPADNPELVIYVTMQQPQLSGSQTGGEAVSEVFNPVMKNSLQYMNIKPGDVEKLA
FT                   SEKVPVLAGKTVDEAKKAVQDKGLEPIVVGNGKKIVQQLPQANSEIMQGQKVILMTDGD
FT                   MTAPDMITWSKDDALKVSEITGIPFEFSGSGYVKSQSVSAGSVINSETKMKLTLAPPEE
FT                   IGDFNQNHDQDTAEKNKKATDIQENAGIGDLLN"
FT   gene            529639..530520
FT                   /locus_tag="LMHCC_0522"
FT   CDS_pept        529639..530520
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0522"
FT                   /product="UDP-N-acetylmuramoylalanyl-D-glutamate--2,
FT                   6-diaminopimelate ligase"
FT                   /EC_number="6.3.2.13"
FT                   /note="UDP-N-acetylmuramoylalanyl-D-glutamate--2,
FT                   6-diaminopimelate ligase (UDP-N-acetylmuramyl-tripeptide
FT                   synthetase) (Meso-diaminopimelate-adding enzyme)
FT                   (UDP-MurNAc-tripeptide synthetase)"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38879"
FT                   /protein_id="ACK38879.1"
FT                   /translation="MKLNELMQAIPVYTGEASETIEISHIAQDSRKVKPGTLFICIDGE
FT                   LVDGHQFASRAVELGAVAIIAEKQLDVSIPVIYVRDSKRAMAMLADYFYGSPTQALKLV
FT                   GITGTNGKTTVSHLVEQIVRENGEQTGLIGTMYRKIGDQILETKNTTPDSLTLQETFRD
FT                   MLLSGVSTAVMEVSSHALVQGRVYGSDYDVAVFMNLSQDHLDYHHTMDEYANAKSLLFA
FT                   QLGNSYHTSNPKMAVLNADDAESVRMQTATAAHVITFGIKQQADFKASNIQITSHGSTF
FT                   DLTTPVGEFTVK"
FT   gene            530523..531113
FT                   /locus_tag="LMHCC_0523"
FT   CDS_pept        530523..531113
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0523"
FT                   /product="UDP-N-acetylmuramoylalanyl-D-glutamate--2,
FT                   6-diaminopimelate ligase"
FT                   /EC_number="6.3.2.13"
FT                   /note="UDP-N-acetylmuramoylalanyl-D-glutamate--2,
FT                   6-diaminopimelate ligase (UDP-N-acetylmuramyl-tripeptide
FT                   synthetase) (Meso-diaminopimelate-adding enzyme)
FT                   (UDP-MurNAc-tripeptide synthetase)"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38880"
FT                   /protein_id="ACK38880.1"
FT                   /translation="MIGNFSVYNVLAAIATSFALHIPIEKAIATLETIPGVKGRFELVN
FT                   AGQAFPVIVDYAHTPDGLLNVLETIAEFAEKRVFVVVGCGGDRDKGKRPQMAKIAVDYS
FT                   SNPIFTSDNPRSENPHAIIEDMIQGVPDSDSYVVHENRRDAIRFAVNEAEAGDVILIAG
FT                   KGHEDYQLIGDEVIDFDDRVEARIAIEKKLGLA"
FT   gene            531289..532134
FT                   /gene="mraY"
FT                   /locus_tag="LMHCC_0524"
FT   CDS_pept        531289..532134
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mraY"
FT                   /locus_tag="LMHCC_0524"
FT                   /product="phospho-N-acetylmuramoyl-pentapeptide-transferase"
FT                   /EC_number="2.7.8.13"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38881"
FT                   /protein_id="ACK38881.1"
FT                   /translation="MHEKKSGTPTMGAVVFITAMLISFLVFSFISGEVSAATWLLFIAL
FT                   ALFGALGFLDDYIKVVQKRNLGLTSKQKFLGQVAISILFYLVYHFNSFAETLNIPFTNI
FT                   EVDLGWFFVIFILFWLVGFSNAVNLTDGLDGLVSGLSVIAFSAFGVIAFYQEQMDVAIF
FT                   CFAIVGGMLGFLLFNKNPAKIFMGDTGSLALGGSIAAISILVHQEWLLLLIGIIFVIET
FT                   ASVILQVFYFKATGGKRIFRMTPIHHHFELGGWSEWRVVLTFWGIGLIGAIISVCVVIF
FT                   "
FT   gene            532138..532251
FT                   /locus_tag="LMHCC_0525"
FT   CDS_pept        532138..532251
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0525"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38882"
FT                   /protein_id="ACK38882.1"
FT                   /translation="MRRNLFAAKASLVSCFLQNLVGAFRRFCENHKFDRQF"
FT   gene            532275..533642
FT                   /gene="murD"
FT                   /locus_tag="LMHCC_0526"
FT   CDS_pept        532275..533642
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murD"
FT                   /locus_tag="LMHCC_0526"
FT                   /product="UDP-N-acetylmuramoylalanine--D-glutamate ligase"
FT                   /EC_number="6.3.2.9"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38883"
FT                   /protein_id="ACK38883.1"
FT                   /translation="MKKIEMYHHKKVLVLGLARSGVSAATIMHKLGAFVTVNDQKPFSE
FT                   NPEAQGLLEQGIKVICGSHPIELLDEGFELVIKNPGIPYNNPMIEKALKLKIPVITEVE
FT                   LAYQISEAPIVGITGTNGKTTTTTIIHHMLNAHKENSSLLAGNIGFPASAVAENATSDQ
FT                   YISMELSSFQLMGVETFKPHISVITNIYEAHLDYHTDRSEYVQAKWHIQKNQTADDFLV
FT                   INWDQEELKNLTKQTKAQVIPFSTTQRLGQGSYVQNGNIMFNDEVIGARDNILLPGEHN
FT                   LENVLASVAVAKTLGVTNEEIMHVLETFKGVEHRTQFVVEWQGRKFYNDSKATNILATQ
FT                   SALKGFKNPVVLLAGGLDRGNSFDELLPFFKNVKTLIVFGETADKIGRVGKIAGIDVHY
FT                   VDNVEAAVPVAYRESSPGDIILLSPACASWDQYRTFEVRGNAYMDAIGELIEEVEK"
FT   gene            533639..534730
FT                   /gene="murG"
FT                   /locus_tag="LMHCC_0527"
FT   CDS_pept        533639..534730
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murG"
FT                   /locus_tag="LMHCC_0527"
FT                   /product="undecaprenyldiphospho-muramoylpentapeptide
FT                   beta-N-acetylglucosaminyltransferase"
FT                   /EC_number="2.4.1.227"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38884"
FT                   /db_xref="GOA:B8DBP8"
FT                   /db_xref="InterPro:IPR004276"
FT                   /db_xref="InterPro:IPR006009"
FT                   /db_xref="InterPro:IPR007235"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8DBP8"
FT                   /protein_id="ACK38884.1"
FT                   /translation="MKVAISGGGTGGHVYPALALIRELKKVHPEAEFLYIGTEKGLEAG
FT                   IVKREGIPFEAIEITGFKRSLSLENIKTVMRFLSGAKKSKQILRDFKPDVVIGTGGYVC
FT                   GPVVYAAAKLKIPTLIHEQNSVAGLTNKFLSRYTDKVAICFEEVSDSFASEKIVFTGNP
FT                   RASEVVGVDSEGALEAYGLVSGKPTVLVFGGSRGARGVNEAVEAILPEWNNRDFQLLYV
FT                   TGDVHYEKIKDSLAELNLGYHISVQPFIYDMPKILNAVTLVVSRAGATTLAELTALGVP
FT                   SILIPSPYVTANHQENNARALEKNNAAIVITEAELKNTNLMATVDSILNDETKLNGMKL
FT                   SAKQMGRPDAAAKLVEAVLSIMK"
FT   gene            534753..535565
FT                   /locus_tag="LMHCC_0528"
FT   CDS_pept        534753..535565
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0528"
FT                   /product="division initiation protein (Cell division and
FT                   sporulation protein)"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38885"
FT                   /protein_id="ACK38885.1"
FT                   /translation="MAENKRVISIENRIPELKKYRKKKLVRHLAILIGIFVILIAITLY
FT                   FLSPLSKLDKIAVSGNKQLTENEVRKESGLEVGEFVLGIRNGKTEDRLKKNTLIKDATV
FT                   SKEGLNDVQINITEFKTIGYQQQDGKYYDVLESGIMLTDQPRQFPIGNDLLFQNFKNGK
FT                   TLEKMVAQINKLPKDVVSSISEVIYSPTKSDQNHIELYMNDGNQVSADISTFAEKMQHY
FT                   PAIVAQLAKGQKGVIDIEVGSYFQSYYQQNAEKKAAEEAAKEKKETNE"
FT   gene            535929..537230
FT                   /gene="ftsA"
FT                   /locus_tag="LMHCC_0529"
FT   CDS_pept        535929..537230
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsA"
FT                   /locus_tag="LMHCC_0529"
FT                   /product="cell division protein FtsA"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38886"
FT                   /protein_id="ACK38886.1"
FT                   /translation="MGDSEIYVSLDIGTASVKVIIAEMADDRLNIIGVGNVESSGIKKG
FT                   IIIDIDKTVESIKKAIEQAERMVGVEISQVIVGVVSSQVHLEACRGIVAVGSENREITD
FT                   EDVWNVMDAAQVVPLSPEREIINTIPDQFVVDGLTGITDPRGMIGVRLEMEGTLITGSK
FT                   TILHNTLRCVERAGLEISDIALQPLAEASISLSEDDKEFGTALVNVGAGTTTVSVFEQG
FT                   RLTYTGVIPVGGDNITKDLSLGLNTSTANADRVKLDHGYAFYDDASPDEVFAIDVIGSD
FT                   QKQHFTQVEVADIIEARMEEIFQLVVEELTRVGKTHLPGGYVLTGGSMAIPGAIDLAGK
FT                   TLAAHVRLAIPDYIGVREPSFTTAVGLIKYAYQMAELEGRDVSSSASEPRYDDEAPKQK
FT                   QPKPKQKQPKPKQKKSDDEKVSTKMKNFFGAFFE"
FT   gene            537297..538472
FT                   /gene="ftsZ"
FT                   /locus_tag="LMHCC_0530"
FT   CDS_pept        537297..538472
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsZ"
FT                   /locus_tag="LMHCC_0530"
FT                   /product="cell division protein FtsZ"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38887"
FT                   /protein_id="ACK38887.1"
FT                   /translation="MLEFDTSSESLATIKVIGVGGGGNNAVNRMIEHGVQGVEFISVNT
FT                   DAQALNLAKAETKLQIGTKLTRGLGAGAVPEIGKKAAEESREQIEEALKGSDMVFVTAG
FT                   MGGGTGTGAAPVIAQIAKEMGALTVGVVTRPFGFEGPKRTKQALTGTEAMKEAVDTLIV
FT                   IPNDRLLQIVDKNTPMLEAFREADNVLRQGVQGISDLIAVPGLINLDFADVKTIMTNRG
FT                   SALMGIGIATGENRAAEAAKKAISSPLLETSVDGAKGVLMNITGGSNLSLYEVQEAAEI
FT                   VSSASDEDVNMIFGSVINDELKDELIVTVIATGFDEEKQAQQQAQANRRPNQSIQVNRP
FT                   NYAVQDEQQNDYAQNAPQQANAPVHEQQAEPQQNSSDVDVPAFIRNRNRRG"
FT   gene            538592..539281
FT                   /locus_tag="LMHCC_0531"
FT   CDS_pept        538592..539281
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0531"
FT                   /product="pyridoxal phosphate enzyme, YggS family"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38888"
FT                   /protein_id="ACK38888.1"
FT                   /translation="MTKQANLQKVTAQIERACEESNRQAKDVTLVAVTKTIDAAGITEL
FT                   YDLGIRHFGENRADVFQEKTVALADKEDICWHYIGSLQTRKVKDVLPKIDYLHSLDRSS
FT                   LAKEIEKRATKPVKCFLQVNISGEESKHGFSKEEALSFLQEANFTFIEIVGLMTMAPIT
FT                   NSDIELHHVFHELKQLQQEIHALQLNNIPCTELSMGMTNDYGVAITEGATFIRVGRALV
FT                   SDDNMEV"
FT   gene            539285..539743
FT                   /locus_tag="LMHCC_0532"
FT   CDS_pept        539285..539743
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0532"
FT                   /product="YlmF"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38889"
FT                   /db_xref="GOA:B8DBQ3"
FT                   /db_xref="InterPro:IPR007561"
FT                   /db_xref="InterPro:IPR023052"
FT                   /db_xref="InterPro:IPR038594"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8DBQ3"
FT                   /protein_id="ACK38889.1"
FT                   /translation="MGLSNKFKSFFFLDEEEEYYEEEVAREPEPMQKKTKKEKPNKNRF
FT                   YAVEEDDAKVVSMQGAQFSSRMVLAEPRVYAEAQELADYLKEYKSVVVNLQRISHDQAT
FT                   RIVDFLSGTVYALGGDIQRVGNNIFLCTPDNVEVDGSISEMLDEQNFM"
FT   gene            539766..540056
FT                   /locus_tag="LMHCC_0533"
FT   CDS_pept        539766..540056
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0533"
FT                   /product="yggt family protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38890"
FT                   /protein_id="ACK38890.1"
FT                   /translation="MQSILYQVVEIILFIIRWLPTLMFIYFLMSWFPGARESKIGQFLA
FT                   RIFEPILEPFRRIIPPIGMFDISSLVAYFIFQYAMRVLTGLIQVYVIPMLF"
FT   gene            540178..540957
FT                   /locus_tag="LMHCC_0534"
FT   CDS_pept        540178..540957
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0534"
FT                   /product="S4 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38891"
FT                   /protein_id="ACK38891.1"
FT                   /translation="MMDGIYQHFRAEEYAFIDKILGITMQVENEYTPQLTDFLDPRQRF
FT                   ITETVIGGYDEINVQFFGGVAHAERRRALIYPDYYTPTEADFEIALFHIRYPVKFTTLT
FT                   HQKILGTLMSLGMKRDIFGDILNNGTEWQLLVESTMKDYLTLQLEKIGKVNVMLEETDL
FT                   ANAVYAPVVWEEMGLTVSSMRLDVIISNAHHISRQKAKQLVTAGLVKVNWKTVENPDFE
FT                   CEEEDVLSARGYGRVKVLSTGGRTKKDKIRIEIGYLK"
FT   gene            complement(540990..542090)
FT                   /gene="nadA"
FT                   /locus_tag="LMHCC_0535"
FT   CDS_pept        complement(540990..542090)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nadA"
FT                   /locus_tag="LMHCC_0535"
FT                   /product="quinolinate synthetase complex, A subunit"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38892"
FT                   /db_xref="GOA:B8DBQ6"
FT                   /db_xref="InterPro:IPR003473"
FT                   /db_xref="InterPro:IPR023515"
FT                   /db_xref="InterPro:IPR036094"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8DBQ6"
FT                   /protein_id="ACK38892.1"
FT                   /translation="MNLLETVEQDTMPTHYKQMTQAEMIARVTEIKDQLGENLFIPCHH
FT                   YQKDEVVPFADAIGDSLQLAQIAAQNKKAKHIVFCGVHFMAETADMLTTSEQVVTLPDM
FT                   RAGCSMADMADIHQLTNAWPKLQTLFGDTILPVTYINSTAAIKSFVGEHGGTTVTSSNA
FT                   TKIVSWALEQKERIFFLPDQHLGRNTAFELGIPLEHMAIWNPIKNELEYEGNLDDCKVI
FT                   LWKGYCSVHQHFTVKNIENIRKNHPKMRIIVHPECTHEVVSLADDSGSTKKIVTEINNA
FT                   APGTEWAVGTEANLVGRIIQENPDKKIVSLNPFMCPCMTMNRIDLPHLLWTLEAIQNGE
FT                   QRNQIKVDEQTTKFALKALERMLQLS"
FT   gene            complement(542087..542932)
FT                   /gene="nadC"
FT                   /locus_tag="LMHCC_0536"
FT   CDS_pept        complement(542087..542932)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nadC"
FT                   /locus_tag="LMHCC_0536"
FT                   /product="nicotinate-nucleotide pyrophosphorylase"
FT                   /EC_number="2.4.2.19"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38893"
FT                   /protein_id="ACK38893.1"
FT                   /translation="MNSILMNQAIQAFLLEDIGQYDLSAETVFPRDTMGEGVFLAKETG
FT                   ILCGISIPPKVYELLGGNIQFEAYKKDGDWVQKGDIIAAVTAPVRTLLSGERVILNLMQ
FT                   RMSGIASQTNFAIKQLDDSAIRICDTRKTAPGLRPFDKYAVQTGGGFNHRNGLYDGVML
FT                   KDNHIAFSGGITSAVSTVREKLGHMIKIEVETETAEQVKEAVQAGADIIMFDNRTPEEI
FT                   KQLVKLVPPHITTEISGNVTLENIHRYKGSGANYISLGSLTHSVRAFDISFNSKGGIKA
FT                   "
FT   gene            complement(542929..544383)
FT                   /gene="nadB"
FT                   /locus_tag="LMHCC_0537"
FT   CDS_pept        complement(542929..544383)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nadB"
FT                   /locus_tag="LMHCC_0537"
FT                   /product="L-aspartate oxidase"
FT                   /EC_number="1.4.3.16"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38894"
FT                   /protein_id="ACK38894.1"
FT                   /translation="MIKERVIIVGSGISGCTAALRLMQDYDVTIITKGYKEESNSMLAQ
FT                   GGVAAAVSKNDTPKKHFSDTFQAGCFHNKVLAVNQLVTHGPMVIQKLIAEGMAFDEQDG
FT                   ELALGLEGAHQLPRILHTGGDQTGKFLTTFLQEKLTNIHWQEQKMAIEIIKQNDTAIGV
FT                   HCLDKENQLHTYYGEYIILASGGLGQLFPVTTNAATISGDGLALAYRAGAKLTDMEFIQ
FT                   FHPTLLFLNGRCHGLISEAVRGEGAKLIRTDGSAVMTDVHPRADLAPRDIVAATLFAEI
FT                   QDGNDVFLDVTTIPNFEERFPGITASLDAHHVPFRETKRIPVHPGAHFLMGGIRTDLSG
FT                   KTNIPGLYAIGEVANAGVHGANRLASNSLLETLVFGEKVAEYIRTQKINPIDHPEIPLS
FT                   NQTQTPHLPDKQLLQEKIWETLGITRKPEKITEFLHWLTDFDYANHTRKTAEISHMLIT
FT                   AKLIAESALKRTESLGAHRILKGVIK"
FT   gene            544514..545620
FT                   /locus_tag="LMHCC_0538"
FT   CDS_pept        544514..545620
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0538"
FT                   /product="aminotransferase, class V"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38895"
FT                   /protein_id="ACK38895.1"
FT                   /translation="MIYFDHAATTKMSEAALEVFMSASREFFANSESLHDAGTKSAALL
FT                   EKCRGSFEEILHVPSRGIMFTSGGTESNQIAIQTLLHSTKKKEVLVSPLEHASVWQQLE
FT                   ALEEAGACWLRLLPVDAFGRVDPAVLGDMISPDTGLVIIQQVNSEIGTIQPIGELAHIA
FT                   KQAGVYFHTDIVQSFGKLDLALDDVTSFSISSHKIYGPKGAGLLFIKPDVPMQAPLPNV
FT                   HHEFGYRPGTVNVPAIAAFTTAAYDIMENREKEARRIAELKKAICEALTAKVKVEGGLN
FT                   TSPFILGITLPNMQGQEALLALNEADIQISTTSACSLRDPAPSRTLLATGKTIEEASRF
FT                   VRLSFGRENELSDSLIFKKELDKLLRKR"
FT   gene            545625..546146
FT                   /locus_tag="LMHCC_0539"
FT   CDS_pept        545625..546146
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0539"
FT                   /product="3H domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38896"
FT                   /protein_id="ACK38896.1"
FT                   /translation="MKKILGNTRRQLILKWLKEAETPISGNQLASKTNVSRQVIVQDIS
FT                   LLKAGNEPIMATPQGYIYAKETSFAGERRVIAVKHTKEQAAEELNILVDHGVSVVDVIV
FT                   DHPIYGEITASLHLKSRFDVEKFIKKVQTTGATMLSGLTDGTHLHTIEADTKEQLEQAI
FT                   EALEKAGFLI"
FT   gene            546240..546767
FT                   /locus_tag="LMHCC_0540"
FT   CDS_pept        546240..546767
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0540"
FT                   /product="cell division protein DivIVA"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38897"
FT                   /protein_id="ACK38897.1"
FT                   /translation="MPLSPLDIHNKEFTRGFRGYDEDEVNDFLDQIIKDYEQVIKEKKR
FT                   IEDTLNNSEERLGHFTNIEETLNKSLIVAQTAAEEVKASAEKEAKLIIREAEKNADRIL
FT                   SDSLSKARKIAIEIEDLKRQSKVFRERLRMLVEAQMDLIKSEDWQQMMAYDVDATELAS
FT                   IKEVESAQSEER"
FT   gene            547050..549815
FT                   /gene="ileS"
FT                   /locus_tag="LMHCC_0541"
FT   CDS_pept        547050..549815
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ileS"
FT                   /locus_tag="LMHCC_0541"
FT                   /product="isoleucyl-tRNA synthetase"
FT                   /EC_number="6.1.1.5"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38898"
FT                   /db_xref="GOA:B8DBR2"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002301"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR010663"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR023585"
FT                   /db_xref="InterPro:IPR033708"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8DBR2"
FT                   /protein_id="ACK38898.1"
FT                   /translation="MEYKDTLLMPKTDFPMRGNLPNKEPEWQAKWEEEKLYEKIQEKNA
FT                   GRPTYILHDGPPYANGELHMGHALNKTIKDIIVRYKSMAGFSSPYVPGWDTHGLPIETA
FT                   IAKKGVKRKEMSIAEFRKLCAEYAMTQVDGQRTGFKRLGINGDWENPYITLLPEYEAEQ
FT                   IKVFGEMAKKGYIYKGKKPVYWSPSSESALAEAEIEYQDKTSASIFVAFKVTDGKGVLD
FT                   EGTNIVIWTTTPWTIPANMGITVNPDLDYVVIESAGEKYVVAEALLPSLREKLGFEDAT
FT                   VVKTVRGSELDRVVTKHPFYDRDSLVMNGEHATAEAGTGAVHTAPGHGEDDFLIGKKYD
FT                   LEVLAPLDDRGVFTEEAPGFEGVFYDTANKMVTEKLEEVGALLKMEFITHSYPHDWRTK
FT                   KPVIFRATAQWFASIDAFRDDLLAAVKGVNWTPAWGETRLFNMVRDRGDWVISRQRAWG
FT                   VPLPIFYAENGEAIITDETINHISELFREHGSNVWFERDVKDLLPAGFTHPGSPNGEFT
FT                   KETDIMDVWFDSGSSHQAVLNARPELSRPADLYMEGSDQYRGWFNSSLTTAVAITGEAP
FT                   YRNVLSHGFALDGEGRKMSKSLGNTLLPGKVIKQLGADIVRLWVASVDYQADVRVSDEI
FT                   LKQVSEVYRKIRNTMRFLLGNINDFHPTTNAVSYENLREVDKYMMIKLNDLVKNVKDSY
FT                   EAFEFSAIYHQINNFCTVELSQFYMDFAKDVVYIEAADSHDRRAMQTVFYEAVVTLTKL
FT                   LAPILPHTTEEVWNSLIGEGVESIHLQDLPEVKVLADSEEITAKWDAFMQIRDNVQKAL
FT                   EFARNEKLIGKSMLAKVTLYVDGEAKTLFDSLEGDFAQLFIVSDFELVEGLENAPESAF
FT                   KSNQVAVQITVAEGETCERCRVVKKDVGVNPKHPTLCGRCADIVVKHYEA"
FT   gene            549927..550916
FT                   /gene="dapF"
FT                   /locus_tag="LMHCC_0542"
FT   CDS_pept        549927..550916
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dapF"
FT                   /locus_tag="LMHCC_0542"
FT                   /product="diaminopimelate epimerase"
FT                   /EC_number="5.1.1.7"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38899"
FT                   /db_xref="GOA:B8DBR3"
FT                   /db_xref="InterPro:IPR001653"
FT                   /db_xref="InterPro:IPR018510"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8DBR3"
FT                   /protein_id="ACK38899.1"
FT                   /translation="MATIHFTKVHGSQNDFFLVDEEENLITEWSDEQRADFAIKLCDRK
FT                   HSLGGADGILYVTKSSEVGPIGQMRVVNSDGSIASMCGNGLRTVARYLLEKHALTEAKV
FT                   ETMKAILDVKKATSLGFDIPTYQVEISPVKFAAETLPMHVGVEKLFNQVIPELDTELAF
FT                   SAVSVPNPHLITFVDQSVLDSDKQEKLASYLNSENPYFPDGVNVSFVKRLSDDAIYVRT
FT                   FERGVGFTNACGTAMSACSLIKKMLDNDTFETPLNVYNDGGRVQVTAKEDAAGEISLQL
FT                   IGNATFVSKGSVRYENDIVTELTNEATAEQALYQALVKEVKEFLKTTE"
FT   gene            550930..551625
FT                   /locus_tag="LMHCC_0543"
FT   CDS_pept        550930..551625
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0543"
FT                   /product="PAP2 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38900"
FT                   /protein_id="ACK38900.1"
FT                   /translation="MNTNRKKATPLFVIGGFCLILFITIASAIATESNWVARFDLSWIE
FT                   KIRGGIQPDKTSIVKFMTTLGSAETTIILTIVVVLILFFLRKFVVGLWFGGTMLVCGVV
FT                   LNLVLKSLVGRTRPASVNWLVSESGFSFPSGHATATAVFYGLAAMFLIFTVPKMWQKIV
FT                   IGIIGYGFILFVMYTRVYLGVHFPTDVLGGFFLGTASVFISLGVYFLVRKPLHNLLVKW
FT                   RIKDKSITE"
FT   gene            551914..552114
FT                   /locus_tag="LMHCC_0544"
FT   CDS_pept        551914..552114
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0544"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38901"
FT                   /protein_id="ACK38901.1"
FT                   /translation="MQTGTVKWFNSEKGFGFIEVEGGDDVFVHFSAIEGEGFKTLDEGQ
FT                   SVEFEIVEGQRGPQAEKVTKL"
FT   gene            complement(552183..555281)
FT                   /locus_tag="LMHCC_0545"
FT   CDS_pept        complement(552183..555281)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0545"
FT                   /product="alpha-D-mannosidase"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38902"
FT                   /protein_id="ACK38902.1"
FT                   /translation="MFFTKDKLRGRLDEVALYRYEKTYPIQKFQAAEDMDGEIAARPDT
FT                   VLYDNELTIGENWSGRDRYVWLKTTITFPDTKTGTRLIGYFDFGNTGDGHNSGFESLLF
FT                   VNGEPYQGVDQNHREVLFPDSFAGKKVELVFRLWSGLEGGGTPTIQTHQLKEAFIGYLN
FT                   LVIDDLYFTSKATLKTLDQLEEKNPTYAPLLQAINRAYLAIDWSTPGSEQNLASMATAN
FT                   QLLQAALEKMPKNFPIKVAAVGHTHIDVAWLWRLKHTREKAARSFSTVLHLMEDYPEYL
FT                   FLQSQPQLYAYIKEDYPEIYAKIKAKISEGAWEADGGMWLEADCNIPSGESLVRQMLYG
FT                   QKFLREEFGKPSSFLWLPDVFGYSWALPQILRKSGIKTFMTTKISWNQYNRMPHDTFQW
FT                   RGMDGTEILTHFITAPEKNSRISTYNGKMTARELVGLWDKYQDKEVNQELLLAYGYGDG
FT                   GGGVNREMLEMRRRYDAMPGIPEVKPKSATTYFNDLHETINATDQYVHTWNGELYFEYH
FT                   RGTYTSQAFTKKMNRKIELGLRNSEWLSVLANLKQGITYPTEKLAGIWQILLRNQFHDI
FT                   IPGSSIKEVYDDALIEYTEAAEGNNALISNQLTNLTTDANQKITLWNSSTWSRPRYIEI
FT                   SPDNQADHLAFYDKNNTPLPAQKLANNAWLIQHPNLPALGAATISVKETANILEQPSFH
FT                   YKNNQLETPFYQITWNEAGQFTSIFDKKNNRQVLAENARGNVFQLFEDKPMWHDAWDID
FT                   LFYQEKQKEISALDSVEITENGPLQFTMKQVLHSEKSQITQWIHFYHESPEIRFETEVD
FT                   WRDRNQLLKVAFPVAVHASEASYDIQFGNVKRPTHWNTSWDYARFETVGHQWADLSEKN
FT                   YGVSLLNDSKYGYDIKDSTLRLTLLKAAGYPDPDADLGIHQFTYSLYPHQGDFLDGETV
FT                   QAAWELNNPIFSSNGEIQTFSLFQVTNPYVMIDSIKQAEDGDGIILRLHEFAGTHGEVT
FT                   IASDYTITSITECNLLEENETSPSNPTFAVAPFEIKTYRIHLA"
FT   gene            555536..558193
FT                   /locus_tag="LMHCC_0546"
FT   CDS_pept        555536..558193
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0546"
FT                   /product="glycosyl hydrolase, family 38"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38903"
FT                   /protein_id="ACK38903.1"
FT                   /translation="MTRKKAHIISHSHWDREWFLPLESLRFRLVTLMDEVEALLDKEVG
FT                   FHHFHMDGQMIMLEDYLAVKPAKREKMKQLVADGKLRIGPWYMLQDAFLTSGEANIRNL
FT                   QYGLEMAEEFGQVEKIGYFPDTFGLYGQVPQLMRQAGFDTVVFGRGVNPTGFNNQVFDS
FT                   AFASKYSEMFWESPDGSKVLGILLANWYSNGNEIPVEKEAAKVFWDKKLADVERFASTD
FT                   EWLFMNGCDHQPVQTDLAEALEVARELYPEVEFIHSHFEKYQEAVKAGLAPEKLQTVHG
FT                   ELTSQQSDGWSTLANTASSRIYLKQANAKIERLLERLAEPISVMATEAGVQYPHEYLAY
FT                   AWKLLMENQIHDSITGCSLDEVHREMEARFEKVEQATMAIIQNAARQITEQITTNEAGI
FT                   PITVFHSGGLEATRTIELELETDAIHFSEMHFELIPDELAKLPEQSFRLETSTGEEIPV
FT                   VVESLGIRFNYDLPERKFRDSYFARKYKLTFTVENLPAVGYETIYAHPVDLVNESANQT
FT                   QDFSLENRFLKVEIAANGTYTILDKEKAIEIAGVGAYEDAGDIGNEYMFKETGDNLRIN
FT                   TLHSKPAIRVLREDKLGKTIEINHEIEIPESASSAFAEEKRRLIWHPDRQSERSENFTT
FT                   FKITTELTLNKHDKQLTIRVKLNNNVDDHRLRVLFPTGKQTETHQAGSVFEVVTRANKQ
FT                   VKEWTNPAKDNRKQGFVASGNIVVASLGLPEYEVSEHGDKLELTLLRAVSEIGDWGDFP
FT                   AYEAECHREITAEFHVFLTNDSDVANSSIPAQVNARLTPIFAFQHKSTTKEKILAEKRD
FT                   FAEWKTEAGFVFSAFKLAKDNQPIIRFFQTASEPKQLQTMQPWQKSTILEETTGDAKKQ
FT                   FTASPNEIITLKGV"
FT   gene            558197..559501
FT                   /locus_tag="LMHCC_0547"
FT   CDS_pept        558197..559501
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0547"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38904"
FT                   /protein_id="ACK38904.1"
FT                   /translation="MTNKVPASFSKWIEKVKTTFPENKKLHRMFEKCFTNTYTTTLQET
FT                   EEGLPFVITGDIPAMWLRDSTSQIRPYLIVAEEDEEMATVIENLVKLQTKCILHDPYAN
FT                   AFNKSANGAGFQNDKTAMTDLVWERKYEIDSLCYPIQLAYLLWKSTSRTGHFTEEFRKA
FT                   LHQIIEVFKIEQKHTEQSPYRFERENVRQSDTLNNNGKGTDVSYTGMSWSGFRPSDDAC
FT                   MYGYLVPSNMFLVVVMDYVQEIIAAFYPDDKELLKDSADLRKEVAAGIETYAKQAHPYY
FT                   GDVYAYEVDGTGRKLFMDDANVPSLLAAPYLGFCKKNDPAYQATRKLILSRENPYFVEG
FT                   SVLTGIGSPHTPDHYVWPIALSIEGLTAETEAEKQAILEMLIAGDGGTDYMHEGVNASN
FT                   PAEFTRDWFAWSNAMFSEFVLSMCGVYVKGSPLSK"
FT   gene            559562..560173
FT                   /locus_tag="LMHCC_0548"
FT   CDS_pept        559562..560173
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0548"
FT                   /product="protein of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0548"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38905"
FT                   /protein_id="ACK38905.1"
FT                   /translation="MKLIDKFSVISDWIIRLVWTNLVWLFLVLIGGIVLGFMPATVALF
FT                   TITRKWARGDLDVPVWKSAWQTYKQVFVSANLAGAIFALIGIFLYADLRIVFELMQGFW
FT                   STILYFFLMFLLFLVGIAFLQYFTVFVHFQMKNARAYVGQAFLLAITSFKNTFMIVVGL
FT                   VFCAWLISKMPAFLLFISGVLPSYWIMKINLHRFKQMEPK"
FT   gene            560236..561969
FT                   /locus_tag="LMHCC_0549"
FT   CDS_pept        560236..561969
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0549"
FT                   /product="sensor histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38906"
FT                   /protein_id="ACK38906.1"
FT                   /translation="MTQELPRKRVFKRMLLIFSLTSLFTVSLLLFFIYKYYTNIQLDAN
FT                   LQKAETIASKQLDALSEKQKALISLTQDIYRNSDLMQDVQIAMTNDYGSYTEQNIDNYF
FT                   KSKNFYSVDMQTYLQSYFSYDEDIIALQLISDDGSYSYTFPSRYREWKETVDTYGEANI
FT                   ATEASKQGTFYTIENKIVVKQPINDPGTLKQMGYLLLYIDPTFLSKWITKDYQNSTFQI
FT                   QNTKGVEVYSNHPKKQIQTPEKQGWLQADNKKVYFQKTEDETNGLKNNTFLYRVTDDSA
FT                   PLIELTLFGIGLLLVIFSISINFVISRRYSKRILTIIGGMNRVENGTLDAKLPVDNNGD
FT                   ELTMISERFNHMTENLDAYVKKVYSLEMEEQKARLKALQGQMQPHFLYNSLEAIRMNAR
FT                   VEGAKATSDMIYQLATLLRYTANHREITTLGEEINYVKQYVRFMEMRHEQPIKLEINIE
FT                   KRFNHTQIPRFALQPLIENFFKYAYKENQNPIVVITVTAENENLQFRIEDNGSGIDAEK
FT                   LKEVQATIESKDETSHIGLANLNKRLQLLYGETYQLTIKSKANEGTVIMFQVPQNTGGE
FT                   K"
FT   gene            561969..563453
FT                   /locus_tag="LMHCC_0550"
FT   CDS_pept        561969..563453
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0550"
FT                   /product="DNA-binding response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38907"
FT                   /protein_id="ACK38907.1"
FT                   /translation="MLKIVLVDDEPLILKGLESIIPEFEQSIEIIGTAKNGAVALDLFA
FT                   NQQVDVLLTDIEMPVMNGLELIDEWKKRQPATKTIVLSGFEDFHYVKRGLSAGIENYLL
FT                   KPLNEQELKETFIQIEKKQMTDSVIPKEEAYYILRDNTIWRWLNLRINKEEWEERLALY
FT                   DMILNSKENAVLIQIQPTKEINLTEWKNLSEQYRKDFPFMLLTPENEIIIGITEPTSIS
FT                   EQILAIHQDVKKRLSNEAFYLFISEKVQGEMMYPQAFRQLTRLLPERLVQEPGSLIAYQ
FT                   KRTKHTWRPKRKQHQLAKLLVMNNEKEIKAWIQHFFKEWNDHKLESDPHQMLHILNELL
FT                   VMMAESDPKELSESMGRIAEETSIEGLEEATLAYAIRYYNRKKQTDESKSPIIQNVLSY
FT                   ITEHFAEGMSLKTLGNDFHINAVYLGQLFQKEMGEHFTDYLNRYRVNYAKEELLQTKDN
FT                   LTIIAGKSGYTDMAYFYRQFKKHTGETPNRYRKIHQ"
FT   gene            563566..564495
FT                   /locus_tag="LMHCC_0551"
FT   CDS_pept        563566..564495
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0551"
FT                   /product="sugar transport system"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38908"
FT                   /protein_id="ACK38908.1"
FT                   /translation="MKKVLSQIRANRIWLLMVLPGLLWFLVFSYLPMFGTVIAFKDYKI
FT                   DGKGFLSSIMSSDWVGLENFKFLFQTNDAFIITRNTVLYNLVFIIVGLFLGVALAIIFN
FT                   SLLNKRGAKIYQTGMLFPHFLSWVVVSYFLFSFLSEDSGLMNNILLAFGQDPISWYNDP
FT                   KYWPFILIMMNVWKGLGYGSIVYLAAIAGIDRTYYEAAMIDGAGKWQQIRHVTIPALTP
FT                   LMVILTILNVGKIFNSDFGLFYQLPRNSGPLYPVTDVIDTYVYRGLTSLGDMSMSAAAG
FT                   FYQSIVGFILVLLTNYIVKKINPEYGLF"
FT   gene            564514..565485
FT                   /locus_tag="LMHCC_0552"
FT   CDS_pept        564514..565485
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0552"
FT                   /product="sugar transport system"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38909"
FT                   /protein_id="ACK38909.1"
FT                   /translation="MAEQLEAVSEIEQVRGEMEKPAKDKPAKDIIGFGKKMNVAMNIML
FT                   AFLALICIFPFLYIIVISFSSESSLAANGFQLIPKEWSMEAYEYLWKMKGQLLQSYGIT
FT                   ILVTVIGTVCSVAMIALYSYAISRPQFKYRRQFTFIAFFTMLFSGGMVPAYIVMTQFLH
FT                   LRNSIWAMILPLAMNAFYIMIMRTFFLRSIPEPILEAARIEGAGELRIFLQMVVPLSLP
FT                   GLATIALFSTLGYWNDWFQASLYIDNPNLVPLQSLLMKIENNLEFMRQNSEIAYTAGAF
FT                   KSIPQDGAKMAMVVISTLPIAITYPFFQKYFISGLTIGGVKE"
FT   gene            565505..566962
FT                   /locus_tag="LMHCC_0553"
FT   CDS_pept        565505..566962
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0553"
FT                   /product="ABC transporter, substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38910"
FT                   /protein_id="ACK38910.1"
FT                   /translation="MKKKWGVIIASLCLLLGLSACGSDEKADANEVPTLKWYMIGTPQK
FT                   DTEEVMKEVNKYTEEKIGVKVEMTQIDWGDYGKRMQTVINSGENFDIAYSAAGEFVSYS
FT                   QKGAFLPLNKYLDKEGKKMKAELNDVLWEGATIDGNIYGVPSNKEVGEQQVYVFNKNLV
FT                   DKYKMDVTKVKNFSDLEPMLKTIKENEPSITPIGGNKDFKPAFPYDYLIDNAVPLPFAV
FT                   NQYEDTGKIVNFYEQPETLDILKSLHSFYQKGYVTKDIATSTDPWSYDKENWFVRIEKY
FT                   QPYAENIWDKNTGGKYKVVTQPIAETPIIKNNSVTGAIQAVSVTSQHPEEAVKFLDLLN
FT                   TDEYLRNLVDKGIEGTHYKELDDGKIQDLPARVERYSMPTYALGNHFILKLYEDEPADK
FT                   WDQFKEFNKKSVASPGLGFYFDSSKVRTEIASITNVCNEFAPALLTGTVDPVEYTEKFK
FT                   AKLNDAGMKKVMKEMQKQYDEYRASQD"
FT   gene            567160..568857
FT                   /gene="alsS"
FT                   /locus_tag="LMHCC_0554"
FT   CDS_pept        567160..568857
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="alsS"
FT                   /locus_tag="LMHCC_0554"
FT                   /product="acetolactate synthase, catabolic"
FT                   /EC_number="2.2.1.6"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38911"
FT                   /protein_id="ACK38911.1"
FT                   /translation="MAKLEKDQEKVITQGKSGADLVVDSLINQGVTHVFGIPGAKIDKV
FT                   FDVMEERGPELIVSRHEQNAAFMAAAIGRLTGKPGVVLVTSGPGASNLATGLVTATAEG
FT                   DPVVAIAGNVTRQDRLKRTHQSMDNAALFRPITKYSEEVVHAESIPEAITNAFRSAAEP
FT                   NQGAAFVSLPQDIVNEPNVPVKAIRPLAKPENGPASKEQVAKLVARLKKAKLPVLLLGM
FT                   RASSPEVTGAIRRLLQKTSIPVVETFQAAGVISRDLEDNFFGRVGLFRNQPGDILLNKA
FT                   DLVITVGYDPIEYDPKAWNASGDRTIVHLDDIRADIDHYYQPVTELVGNIALTLDRVNA
FT                   KFSGLELADKELETLKELHAQLEERDVPPESDETNRVHPLSVIQTLRSAIDDNVTVTVD
FT                   VGSHYIWMARHFRSYEPRRLLFSNGMQTLGVALPWGIAATLVHPGEKVVSISGDGGFLF
FT                   SAMELETAVRLRAPLVHLVWNDGSYDMVAFQQKMKYGKEAAVRFGNVDIVKFAESFGAK
FT                   GLRVTNPAELSDVLKEALETEGPVVVDIPIDYRDNIKLGETLLPDQFY"
FT   gene            568974..569969
FT                   /locus_tag="LMHCC_0555"
FT   CDS_pept        568974..569969
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0555"
FT                   /product="putative aryl-alcohol dehydrogenase C977.14c"
FT                   /EC_number="1.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38912"
FT                   /protein_id="ACK38912.1"
FT                   /translation="MEYVKFGNTGLDVSKICLGTMGFGDKDKWIHKWVLDEANSRPIIK
FT                   KALDLGINFFDTANIYSYGESEKIVGRALKDYANRDDVVLATKVQQTMRPDRPNSGGLS
FT                   RKTILSEIDHSLKRLETDYVDLYIIHRFDENTPIEETMEALHDVVKSGKARYIGASAMY
FT                   AWQFQKAQRVAERNGWTKFVSMQNHYNMIYREEEREMIPFCRDEKIAITPYSPLASGRL
FT                   TRDLNETTNRSETDPVQKSKYDDMMNADRGIIERVAELAETHQVSRDKIALAWLLNKDE
FT                   ITSPIIGAQKESHLESAVEALNIQLTAAEVNYLEELYIPHPVVGALPTTK"
FT   gene            570141..570872
FT                   /locus_tag="LMHCC_0556"
FT   CDS_pept        570141..570872
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0556"
FT                   /product="transcriptional regulator, GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38913"
FT                   /protein_id="ACK38913.1"
FT                   /translation="MEYKDLSPAVQSEEQLRQLIQEKVAAGETSFPSERALENELGVSR
FT                   TTLRRSLDTLEKEAVIQKRNRKGIEINQKQTINILQMNSMSSQLPGEQKVEVMSQEIVA
FT                   GKDEVNHFLNLSEDKPVFKLVRRRIVDNKPFSYEISFIDSARFAGIEKIDLNNSSLYNV
FT                   LEKQFAIKPTYGREELRYVSANEKLAEALKVPLHTPLFEVVSKAFDQNDEPFEYSKQYL
FT                   IGNQIKYKINAKNIFDYLEDE"
FT   gene            570874..571575
FT                   /locus_tag="LMHCC_0557"
FT   CDS_pept        570874..571575
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0557"
FT                   /product="transcriptional regulator, GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0557"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38914"
FT                   /protein_id="ACK38914.1"
FT                   /translation="MGAKKPLFEVIASEIKDSINRDEYKPGMLMPNETALQEIFSSSRT
FT                   TIRRAVDLLVEEGLVVRKNGVGLYVQPKLTAQNILEMTGVMKTDTNENLKKDIKDFYIR
FT                   KAGKFYAEKFGIKENELVYSIKFVQKSEHGVTLDRLILPLSLYPDLQAKDFQIINIIEL
FT                   VNSGKYKLFELEQELQLILAGNEQIKNMHVDENDPVFKLSSVFYAENEMPIAIQYHYED
FT                   AESTKYVVDFN"
FT   gene            571595..572062
FT                   /locus_tag="LMHCC_0558"
FT   CDS_pept        571595..572062
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0558"
FT                   /product="PTS system, mannose/fructose/sorbose family, IIB
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38915"
FT                   /protein_id="ACK38915.1"
FT                   /translation="MIQFLRVDHRLLHGQVAVSWFNALDVNTILVANDGVAADDFRKSA
FT                   IRLAKPEAAKLVMKSIDESIEAINSGVTDKYNMLIVVESVEDAYKLIHGTNGKIPMLNL
FT                   GGTKQREGTANFSKAINLTPEEVAKLKELQKEKVDVFMQQVPNEKKVTFEA"
FT   gene            572085..572903
FT                   /locus_tag="LMHCC_0559"
FT   CDS_pept        572085..572903
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0559"
FT                   /product="PTS system, IIC component"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38916"
FT                   /protein_id="ACK38916.1"
FT                   /translation="MEQFGTAILLALAAMLANGEYLFGSSMLSRPLVTCTLAGLIMGDV
FT                   QMGIIMGATLELAFVGSFSIGASIPPEIISGSILGTAFAISTGESTAVALALGIPIASL
FT                   VLVVKNLCFIFVLPYFVHKADKYALEGNSRGISRMQLLGGFLSINLPIGIIVATSYLVG
FT                   SPVIQNVLDAIPAFVITGLGIATGLLPAYGFALLLKLMVNKKNAVFFVFGFALAVYLKV
FT                   PVTGVAIFAACLALILTGYATLKNDNGPKNTNTEPALANDGGINYEDEEF"
FT   gene            572884..573705
FT                   /locus_tag="LMHCC_0560"
FT   CDS_pept        572884..573705
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0560"
FT                   /product="fructose permease iid component (pts system
FT                   fructose-specific eiidcomponent) (eiid-fru) (p30)"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38917"
FT                   /protein_id="ACK38917.1"
FT                   /translation="MKMKSSDVLTKKDLMKVFWRSFTMEWSWNYERQSNLGYGFSMLPA
FT                   LNKIFKNDKDKRISSYQRHLEFYNVTPWLSTFPLGISIAMEEQSAKDKDFDTDSINNIK
FT                   VALMGPLSGIGDSFFWGTLRVIATGIGTSLALQGNMLGPILFLLIFNIPAILTRYYGLF
FT                   IGYNIGANFIEKIQKTGLMDKLSYGASVIGLAVVGAMVATMVNINMPMKFGSGDDAVTI
FT                   QSVFDGIVPGILALGFTFFIFWLDKKGLKAHWILLLIAGIGILGAFTGLLK"
FT   gene            573718..574782
FT                   /locus_tag="LMHCC_0561"
FT   CDS_pept        573718..574782
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0561"
FT                   /product="SIS domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38918"
FT                   /protein_id="ACK38918.1"
FT                   /translation="MKNMDYYIRSEQSVYENIIRSRKELLQKVIQMEKVDYQAIVIFAT
FT                   GSSSNAAFAAQLYMSDKLAIPVYVEEPSTAGNYMLHLNKNTLYIAISQGGHSYSTIHLV
FT                   KEIERQGGIVFTLTSDLTSPIAKESTRAIDLGMGIEEMPYVTLGYSATILMLNLMALEL
FT                   ALLQEKISEAAYQSEIAELKKITSHLPKVVEKSAAWVDAHTQELMEAERVFFIGYGAAY
FT                   GVAREGETKVTETIRITAFGKELEEYMHGPYIGLSEQDYIIFLEPQGLLEDRAEKLKQF
FT                   LQGHVKKIRTFYADAGGEKTDDLLLGVRAAELLTPLFMTIPVHLLSFEISKKKGINLEV
FT                   SAFPEFDQITKSKI"
FT   gene            574805..575800
FT                   /locus_tag="LMHCC_0562"
FT   CDS_pept        574805..575800
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0562"
FT                   /product="sugar isomerase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38919"
FT                   /protein_id="ACK38919.1"
FT                   /translation="MLKFDEQKVRENMEGALKLRPQINEVVDQIHGRGFSNICWLGIGG
FT                   TYASAMQAVVHMKEKTALETFYENAAVFLTTGNKRVTKDTLVVISSVTGSTQEVVDAVK
FT                   KCNEIGATVFGFIDKAEAELATLVDHLISYPLNEQLKFFMVADRFMYLAGEFEDYDAFY
FT                   QEMDQHFAKGIVEVEKAADKFGQEFALKHHQDDIHYFVGAGNQWGATYSYAMCYWEEQH
FT                   WIKTKSIESHEFFHGMFEIVERDTPVTIYVTEDSQRSLSERVVNFIPQICANYTVIDAK
FT                   DYDMPGISAKFRGALSPFIIHAVNNRIDVHVEKINCHPMEIRRYYRQLDY"
FT   gene            575817..576233
FT                   /locus_tag="LMHCC_0563"
FT   CDS_pept        575817..576233
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0563"
FT                   /product="pts system mannose-specific eiiab component
FT                   (eiiab-man)"
FT                   /EC_number="2.7.1.69"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0563"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38920"
FT                   /protein_id="ACK38920.1"
FT                   /translation="MKAIFVCTHGNAAKELIQSAEMICGKQENTSFVPFEVNESAENLQ
FT                   AKIASEVAKLDLTEGILFLTDLKGGTPFNVLVRLLGNFDAVELVAGVNIPLLLEAFISR
FT                   ETLSLKELANQVAETGRLGIYEYAAPLEEIEEDF"
FT   gene            576330..577277
FT                   /locus_tag="LMHCC_0564"
FT   CDS_pept        576330..577277
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0564"
FT                   /product="deoxyribonucleoside regulator"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38921"
FT                   /protein_id="ACK38921.1"
FT                   /translation="MDKQKEQLSVEVARLYYQADLGQQEIATRLGVSRPTVSRLLQNAK
FT                   TKGYVKIEVQDPFSNLTELAVALKEKYQLKNVTVAFSQTNDYSEITKQISQSAAEYLEE
FT                   IIHDGDILGVSWGTTMYKIAQKLAPLKAEIKVVQLKGGVSHSDVNTYAAETLALFGAAY
FT                   DTAPVSLPLPVVLDNPLAKQMVEADRHIKNIIELGKKANIAIFTVGTVRDEALLFRLGY
FT                   FSNQEKARLKEKAVGDICSRFFTIDGEIADEKMDERTIGIDLQDLKQKETAILVAGGER
FT                   KIKAIHGALRGGYANHFITDQFTAKQLLEQNFIN"
FT   gene            577340..578011
FT                   /gene="deoC"
FT                   /locus_tag="LMHCC_0565"
FT   CDS_pept        577340..578011
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="deoC"
FT                   /locus_tag="LMHCC_0565"
FT                   /product="deoxyribose-phosphate aldolase"
FT                   /EC_number="4.1.2.4"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0565"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38922"
FT                   /db_xref="GOA:B8DBT6"
FT                   /db_xref="InterPro:IPR002915"
FT                   /db_xref="InterPro:IPR011343"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR028581"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8DBT6"
FT                   /protein_id="ACK38922.1"
FT                   /translation="MTIAKMIDHTALKPDTTKEQILALTKEAREYGFASVCVNPTWVKL
FT                   SAEQLAGAESVVCTVIGFPLGANTPEVKAFEVKDAIQNGAKEVDMVINIGALKDKDDEL
FT                   VERDIRAVVDAAKGKALVKVIIETCLLTDEEKVRACEIAVKAGTDFVKTSTGFSTGGAT
FT                   AEDIALMRKTVGPNIGVKASGGVRTKEDVEKMIEAGATRIGASAGVAIVSGEKPAKPDN
FT                   Y"
FT   gene            578091..579101
FT                   /locus_tag="LMHCC_0566"
FT   CDS_pept        578091..579101
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0566"
FT                   /product="transcriptional regulator, LacI family"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0566"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38923"
FT                   /protein_id="ACK38923.1"
FT                   /translation="MAATIREIAEKTGVSITTISQILNGKGERFSEVTREKVLKTAKEM
FT                   SYKPNFFAKNMIVSHTNTIGMIVPEVTDPFFSQMVKGAEDYLNKEGYMIMLCNSSNDKE
FT                   REDLYVEELLHRAVDGLIIASPNILLSGVIKRMEEKRSPYILLDRQRNPRQEGNIAIDD
FT                   FKGGYMATEHLIELGHTRIGIIISDTSFYNVHERYEGYLACMKDYKLPVKEAWIVSGDQ
FT                   TMNGGYVATQKLLQENLSAIFATNDLMAMGTYRAALEKNLSIPNDLSVIGFDDIELSEY
FT                   MTPPLTTIRQPIYGIGEIAAELLLKNLQNPTEKLENRLLDISLIKRSSTKNIDNK"
FT   gene            579232..580533
FT                   /locus_tag="LMHCC_0567"
FT   CDS_pept        579232..580533
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0567"
FT                   /product="pyrimidine-nucleoside phosphorylase (pynp)"
FT                   /EC_number="2.4.2.2"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0567"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38924"
FT                   /protein_id="ACK38924.1"
FT                   /translation="MRMVDIISKKRDGKALSTEEIQFFIDGYTNGEIPDYQASALAMAI
FT                   FFQDMNDQERADLTMAMVGSGDTIDLSAIEGIKVDKHSTGGVGDTTTLVLAPLVAAVGV
FT                   PVAKMSGRGLGHTGGTIDKLESIEGFHIELDKKDFIDLVNRDKVAVIGQSGNLTPADKK
FT                   MYALRDVTGTVNSIPLIASSIMSKKIAAGADAIVLDVKTGAGAFMKTDEDAENLAHAMV
FT                   RIGNNVGRNTMAVISDMSQPLGEAIGNALEVKEAIDTLKGQGPEDLTELVLVLGSQMVV
FT                   LAKQAETLDEARAKLIEVIENGAALEKFKTFLSNQGGDASIVDHPEKLPQAKYQIEVPA
FT                   KSSGFVSQIVADEIGIAAMILGAGRATKEDEINLAVGLMLRKKVGDAVKEGESLVTIFA
FT                   DQEDVESVKAKIYENIQISDYATAPTLVHKVITE"
FT   gene            complement(580570..581289)
FT                   /gene="budA"
FT                   /locus_tag="LMHCC_0568"
FT   CDS_pept        complement(580570..581289)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="budA"
FT                   /locus_tag="LMHCC_0568"
FT                   /product="alpha-acetolactate decarboxylase"
FT                   /EC_number="4.1.1.5"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0568"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38925"
FT                   /protein_id="ACK38925.1"
FT                   /translation="MDAVRKNRLFQHSTMAALVGGLFSGTTSFKELLQHGDLGIGTLDQ
FT                   FDGELIILDGEAFQIRSDGQAYKVKPEDTTPYASTTFFDADTSFSVSEPTSKQAVEEKI
FT                   AELVQGPNVFYAVKMTGNFRYVDTRVVPKQQRPYPPLIEAVKEQPTYHFEYITGTIVGF
FT                   WTPAYISGIGVSGYHVHFIDDMRKIGGHVFDYEMLEGTVEVAQQTEFELQLPQTTEFLR
FT                   SDLSTPDMLEQIEAAEN"
FT   gene            complement(581482..582753)
FT                   /gene="ilvA"
FT                   /locus_tag="LMHCC_0569"
FT   CDS_pept        complement(581482..582753)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ilvA"
FT                   /locus_tag="LMHCC_0569"
FT                   /product="threonine dehydratase"
FT                   /EC_number="4.3.1.19"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0569"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38926"
FT                   /protein_id="ACK38926.1"
FT                   /translation="MMELIDLLVTEEDVEKAYEVLKSVVKHTPLEYDFYLSEKYHCNVY
FT                   LKREDLQRVRSFKLRGAFYAISRLSAEQLAKGVVCASAGNHAQGVAYTCKRMTVPATIF
FT                   MPTTTPQQKVSQVKFFGGSNVEVVLVGDTFDASATAAKEFAASHGQTFIPPFDDPDIIA
FT                   GQGSLAVEMVKDLNKAHEQADYVFAGIGGGGLISGVATYLKAKSPITKIIGVEPDGAPS
FT                   MTAALKQNQVVTLDKIDKFVDGAAVKEVGSLTFQHAKVLVDEVTTISEGAVCSTILDMY
FT                   TKQAIVAEPAGALSVAALETYREEIKDKTVVCIVSGGNNDINRMQEIEERSLLHEGLKH
FT                   YFIVNFSQRPGALKEFVNDVLGPHDDITKFEYTKKVNRGNGPVIIGVLLQDKNDYEGLL
FT                   DRVAAFDPSYIPINDNQTLYTLLV"
FT   gene            complement(582769..583350)
FT                   /gene="leuD"
FT                   /locus_tag="LMHCC_0570"
FT   CDS_pept        complement(582769..583350)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="leuD"
FT                   /locus_tag="LMHCC_0570"
FT                   /product="3-isopropylmalate dehydratase, small subunit"
FT                   /EC_number="4.2.1.33"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0570"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38927"
FT                   /db_xref="GOA:B8DBU1"
FT                   /db_xref="InterPro:IPR000573"
FT                   /db_xref="InterPro:IPR004431"
FT                   /db_xref="InterPro:IPR015928"
FT                   /db_xref="InterPro:IPR033940"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8DBU1"
FT                   /protein_id="ACK38927.1"
FT                   /translation="MEEIKVHIGKTVALMNDNIDTDQIIPKSFLKRIERTGFGEFLFDS
FT                   WRYLPNRKPNPDFPLNAPDRQEATILITGDNFGCGSSREHAAWALLDYRFRVIIAGSYS
FT                   DIFYMNCTKNGVLPIVLPREAREKLAKIAADENVTIDLPNQQVISSVGTYPFEIDATWK
FT                   NKFINGLDDIAITFEHIDAIKAYEQKVDSI"
FT   gene            complement(583337..584725)
FT                   /gene="leuC"
FT                   /locus_tag="LMHCC_0571"
FT   CDS_pept        complement(583337..584725)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="leuC"
FT                   /locus_tag="LMHCC_0571"
FT                   /product="3-isopropylmalate dehydratase, large subunit"
FT                   /EC_number="4.2.1.33"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0571"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38928"
FT                   /db_xref="GOA:B8DBU2"
FT                   /db_xref="InterPro:IPR001030"
FT                   /db_xref="InterPro:IPR004430"
FT                   /db_xref="InterPro:IPR015931"
FT                   /db_xref="InterPro:IPR018136"
FT                   /db_xref="InterPro:IPR033941"
FT                   /db_xref="InterPro:IPR036008"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8DBU2"
FT                   /protein_id="ACK38928.1"
FT                   /translation="MGKTLFDKLWNRHVIYGKEGEPQLLYVDLHLIHEVTSPQAFEGLR
FT                   MENRPLRRPDKTFATMDHNVPTEDIFNIQDLVAKKQIEALQTNCEEFGVTLADMGSDRQ
FT                   GIVHMVGPETGLTQPGKVIVCGDSHTATHGAFGAIGFGIGSSEVEHVFATQTIWQQKPK
FT                   SMGIEINGKLPKGVYAKDIILHLIATYGVAFGTGYAVEYYGETIRNMSMEERMTICNMA
FT                   IEGGAKMGMMAPDETTFEYVRGREYAPADMEKAIRDWKTLQTDPDAEYDLHIEMDASIL
FT                   EPYVTWGTNPEMGVPFSKAFPEIKDMNYERAYEYMGLKPGQTAEEIELGYVFIGSCTNA
FT                   RLSDLEEAARIVKGNKVKNNIRALVVPGSRQVRNAAESIGLDKIFIEAGFEWREPGCSM
FT                   CLGMNPDQVPDGVHCASTSNRNFEGRQGKGARTHLVSPAMAAAAAINGHFIDIRKEAII
FT                   SGGN"
FT   gene            complement(584727..585779)
FT                   /gene="leuB"
FT                   /locus_tag="LMHCC_0572"
FT   CDS_pept        complement(584727..585779)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="leuB"
FT                   /locus_tag="LMHCC_0572"
FT                   /product="3-isopropylmalate dehydrogenase"
FT                   /EC_number="1.1.1.85"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0572"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38929"
FT                   /protein_id="ACK38929.1"
FT                   /translation="MTYKITSLAGDGIGPEIMNAGLQVLEAVAKKYNHTFEIERHPFGG
FT                   AGIDQAGDPIPSATLKACQDADAILLGAIGGPKWDNAPKRPEDGLLALRKALGLFANIR
FT                   PIQVPSSITHLSPLKKEIVENTDFIVVRELTGGLYFGEPKHWDDGSALDSLTYTRAEIE
FT                   RIIEKAFEIAATRNKKVTSVDKANVLASSKLWRKIAEEVASRHPDITLEHLYVDAAAML
FT                   MIQRPTTFDVIVTENLFGDILSDEASVITGSLGMLPSASHAENGPSLYEPIHGSAPDIA
FT                   NQNIANPMSMISSVSMMLRQSFSLFEEADAIDTATAKTMQAGFLTADLGGNTSTTDFTN
FT                   EVLKQIEGGE"
FT   gene            complement(585781..587319)
FT                   /gene="leuA"
FT                   /locus_tag="LMHCC_0573"
FT   CDS_pept        complement(585781..587319)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="leuA"
FT                   /locus_tag="LMHCC_0573"
FT                   /product="2-isopropylmalate synthase"
FT                   /EC_number="2.3.3.13"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0573"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38930"
FT                   /db_xref="GOA:B8DBU4"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR002034"
FT                   /db_xref="InterPro:IPR005671"
FT                   /db_xref="InterPro:IPR013709"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR036230"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8DBU4"
FT                   /protein_id="ACK38930.1"
FT                   /translation="MKKIQFFDTTLRDGEQTPGVNFDVKEKIQIALQLEKLGIDVIEAG
FT                   FPISSPGDFECVKAIAKAIKHCSVTGLARCVEGDIDRAEEALKDAVSPQIHIFLATSDV
FT                   HMEYKLKMSRAEVLASIKHHISYARQKFEVVQFSPEDATRSDRAFLIEAVQTAIDAGAT
FT                   VINIPDTVGYTNPTEFGQLFQDLRREIKQFDDIIFASHCHDDLGMATANALAAIENGAR
FT                   RVEGTINGIGERAGNTALEEVAVALHIRKDFYQAETNIVLNQFKNSSDLISRLSGMPVP
FT                   RNKAVIGGNAYAHESGIHQDGVLKNPDTYEIITPALVGVDKNSLPLGKLSGKHAFQTRM
FT                   EEMGYNLSEQELKDAFKRFKQLADAKKEVTEDDLHALILGQSSESADDFELKHLQVQYV
FT                   TGGVQGAIVRIAERDGTLIEDAATGSGSIEAIYNTINRLMKQNIELTNYHIQAITAGQD
FT                   AQAEVHVVIKDKSGAEFHGIGIDFDVLTASAKAYLQASAKSKTGSKQADFEEVK"
FT   gene            complement(587478..588473)
FT                   /gene="ilvC"
FT                   /locus_tag="LMHCC_0574"
FT   CDS_pept        complement(587478..588473)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ilvC"
FT                   /locus_tag="LMHCC_0574"
FT                   /product="ketol-acid reductoisomerase"
FT                   /EC_number="1.1.1.86"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0574"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38931"
FT                   /db_xref="GOA:B8DBU5"
FT                   /db_xref="InterPro:IPR000506"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013023"
FT                   /db_xref="InterPro:IPR013116"
FT                   /db_xref="InterPro:IPR014359"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8DBU5"
FT                   /protein_id="ACK38931.1"
FT                   /translation="MTKVYYEDAVKNNALEGKTVAVIGYGSQGHAHSQNLRDNGNNVII
FT                   GIREGKSAESARNDGFDVYSVSEAAEKADVIMILLPDETQGETYENEIKPNLKAGNALV
FT                   FAHGFNIHFDVINPPSDVDVFLVAPKGPGHLVRRTFVEGGAVPSLFAIYQDATGNARDT
FT                   ALSYAKGIGATRAGVIETTFKEETETDLFGEQAVLCGGATHLIQAGFETLVEAGYQPEL
FT                   AYFEVLHEMKLIVDLMYEGGMEKMRHSISNTAEYGDYVSGPRVVTADTKKAMKEVLTDI
FT                   QNGNFAKSFIDDNKNGFKEFHRMRKEQQGHQIEKVGAELREMMPFVKPQH"
FT   gene            complement(588572..589063)
FT                   /gene="ilvN"
FT                   /locus_tag="LMHCC_0575"
FT   CDS_pept        complement(588572..589063)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ilvN"
FT                   /locus_tag="LMHCC_0575"
FT                   /product="acetolactate synthase, small subunit"
FT                   /EC_number="2.2.1.6"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0575"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38932"
FT                   /protein_id="ACK38932.1"
FT                   /translation="MRRIITATVNNSSGVLNRITGVISRRQYNIDSISVGWTEIPNVSR
FT                   ITIVVHVDSLYEIEQVTKQLNKQIDVLKVSDITDDAHIERELALLKINSPAALRSELNA
FT                   VIEPFRATVIDVGTKNVVIQVTGTSEKIDAFVDTVRPYGIKQMARTGVTGFTRSPKKMG
FT                   "
FT   gene            complement(589064..590785)
FT                   /gene="ilvB"
FT                   /locus_tag="LMHCC_0576"
FT   CDS_pept        complement(589064..590785)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ilvB"
FT                   /locus_tag="LMHCC_0576"
FT                   /product="acetolactate synthase, large subunit,
FT                   biosynthetic type"
FT                   /EC_number="2.2.1.6"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0576"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38933"
FT                   /protein_id="ACK38933.1"
FT                   /translation="MIDTTKTNEKATKKQNKSGAELLIDSLKKQQVDMIFGYPGGAVLP
FT                   LYDAFYDCDIPHILTRHEQGAIHAAEGYARVTGKPGVVVVTSGPGATNVLTGIADAMSD
FT                   SIPLVIFTGQVHTPGIGKDAFQEADMIGLTIPITKYNYQVRDVRDLPKIVNEAFHIAST
FT                   GRKGPVVVDIPKDMGIIQTDTVHPDTIDLPGYQPTYSPNPLQLEKLMHSLSAASKPLIL
FT                   AGAGVNHARATAELLEFAERYQIPIVNTLLGLGSFPQSHDLFLGMGGMHGSYAANMALT
FT                   DCDLLINFGSRFDDRLASAPKEFATKATIAHIDIDPAEIGKIIETQIPIVADINETLTQ
FT                   LLQMELPVHPDTSHWYKLNMTRKNRHPFNFDRTKKAEIKPQRVIELIGEITQGEALVST
FT                   DVGQHQMWAAQFYPFQFDHQIITSGGLGTMGFGFPAAVGAQLAFPDKTVVAIVGDGGFQ
FT                   MTNQELAILNDYQINVKTVIINNGSLGMVRQWQEKFHGERYSHSIFSSQPDFVKLSEAY
FT                   GVKGVRLTNPETLEKDLRKAFAHPGPIVIDVHVAKDELVLPMVPSGKPNHQMEGVE"
FT   gene            complement(590803..592497)
FT                   /gene="ilvD"
FT                   /locus_tag="LMHCC_0577"
FT   CDS_pept        complement(590803..592497)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ilvD"
FT                   /locus_tag="LMHCC_0577"
FT                   /product="dihydroxy-acid dehydratase"
FT                   /EC_number="4.2.1.9"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0577"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38934"
FT                   /db_xref="GOA:B8DBU8"
FT                   /db_xref="InterPro:IPR000581"
FT                   /db_xref="InterPro:IPR004404"
FT                   /db_xref="InterPro:IPR020558"
FT                   /db_xref="InterPro:IPR037237"
FT                   /db_xref="InterPro:IPR042096"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8DBU8"
FT                   /protein_id="ACK38934.1"
FT                   /translation="MRSDKIKKGVEQAPARSLLHATGQIKSPGDMDKPFIAICNSYIDI
FT                   VPGHVHLRELADVAKEAIREAGGIPFEFNTIGVDDGIAMGHIGMRYSLPSREVIADAAE
FT                   TVINAHWFDGVFYIPNCDKITPGMLLASVRTNVPAIFCSGGPMKAGLSAHGKALTLSSV
FT                   FEAVGAFKDGSMSQEDFLDMEANACPTCGSCAGMFTANSMNCLMEILGMAVPGNGTTLA
FT                   VSDARRDLIRESAFHLMDLVKKDIRPRDIITKDAIDDAFALDMAMGGSTNTVLHTLALA
FT                   NEAGIEDYDLERINDIAKRVPYLSKIAPSSSYSMHDVHEAGGVSAIVKELVDLGGAIHP
FT                   DRITVTGKTIRENVADAKINNTDVIHPKENPYSPVGGLSMLFGNIAPKGAAIKVGGVDP
FT                   SVQVFKGEAICFSSHDEAVEAIDNHTVREGHVVVIRYEGPKGGPGMPEMLAPTSSIVGR
FT                   GLGKDVALITDGRFSGATRGIAVGHISPEAAAGGPIALVHDGDIITIDLPNRTLNVDVP
FT                   DEVLEERRKELPKFKAKVKTGYLARYTALVTSAHTGGILQIPEDLID"
FT   gene            593032..593166
FT                   /locus_tag="LMHCC_0578"
FT   CDS_pept        593032..593166
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0578"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0578"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38935"
FT                   /protein_id="ACK38935.1"
FT                   /translation="MKGQVYSQNSFIFIVFYYLFNNSDKKSHISCVLLSNSAKLKVIN"
FT   gene            593188..593715
FT                   /locus_tag="LMHCC_0579"
FT   CDS_pept        593188..593715
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0579"
FT                   /product="acetyltransferase, gnat family"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0579"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38936"
FT                   /protein_id="ACK38936.1"
FT                   /translation="MDNLETDRLILINYTLEMIQATINGTEALEKASGYHVSPDWPGID
FT                   FFFYLPYVLENVKKDDRMIKWTRLVVLKEENKIIGEIGGQGNPDETGEIEIGYSIVPDY
FT                   QNKGYMSEALIGMIAWLEEQPAIHRIFARCYEQNGPSIHVLQHNHFVHIAEKDTEEKQG
FT                   RVMMWEYPIKQS"
FT   gene            593688..594173
FT                   /locus_tag="LMHCC_0581"
FT   CDS_pept        593688..594173
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0581"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0581"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38938"
FT                   /protein_id="ACK38938.1"
FT                   /translation="MGISNKTKLIIIASGKPKIWDKLPDIGPVKARDVYTGTFHRLSKA
FT                   YAEQFAADYLILSPKYGFLRPDDVVSKTYDVRFTMKGTGTDTIQLEELKKQWQKLQINP
FT                   TEPIPMLGGKKFRGLLISITDGKQAFSFPLDGASGIGVMQQRLKQAVETGMPLNRTE"
FT   gene            complement(594156..594293)
FT                   /locus_tag="LMHCC_0580"
FT   CDS_pept        complement(594156..594293)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0580"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0580"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38937"
FT                   /protein_id="ACK38937.1"
FT                   /translation="MLHIITLSLAILMALQTIYFFIRRNVNMGVMFLLITAALLLLSTI
FT                   "
FT   gene            complement(594325..594756)
FT                   /locus_tag="LMHCC_0582"
FT   CDS_pept        complement(594325..594756)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0582"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0582"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38939"
FT                   /protein_id="ACK38939.1"
FT                   /translation="MAENIDDYLEKGMYGAKEINPAEKKKYLGTYRERVLVALTKEEVL
FT                   TQEYLPELEKAILENNDSKLLLNGLLHYNSLRPYIKLAEKCKHEFSIVSRLEGETDIYL
FT                   VLACQKAVNKEDIHLYKEAQVEQEEEPTSLLEKVRKLFN"
FT   gene            complement(594875..596350)
FT                   /gene="zwf"
FT                   /locus_tag="LMHCC_0583"
FT   CDS_pept        complement(594875..596350)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="zwf"
FT                   /locus_tag="LMHCC_0583"
FT                   /product="glucose-6-phosphate dehydrogenase"
FT                   /EC_number="1.1.1.49"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0583"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38940"
FT                   /protein_id="ACK38940.1"
FT                   /translation="MTDELEQKALITIFGGTGDLANRKLYPSLYHLYSKGSLGDNFAVI
FT                   GTARREWSNDFFRDKVKESIKDIDGSEKDADAFASHFYYQSHDVTNKESYVTLKDLSDE
FT                   LDAKYELGGNRLFYLAMAPNFFGTIASRIKSEGFVDTDGFHRLIIEKPFGHDLASAEEL
FT                   NNSLRQAFKEDEIYRIDHYLGKEMIQNISVIRFANSIIESLWNNRYIDNIQVTLTEVLG
FT                   VEDRGRYYDESGALRDMVQNHILQIVSLLAMEPPINLSTREIRHEKVRALRSLRVFEGK
FT                   EVHQSFIRGQYGPGEVDGKELKGYRQEDNVDPHSNTETFVAAKLEIDNFRWAGVPFYIR
FT                   TGKRLAKKTTQIAIQFKDVPLNLFGQQQSLGGNVLVIHIQPDEGITLHLNVKEPGQGMV
FT                   TMPVNLNYIHSSPDGMNTPEAYEKLILDCLRGDATYFSHWDEVSLSWNFIDHVADVWTN
FT                   TKDHFPNYKSGSMGPKEADDLIQRDGFQWFPID"
FT   gene            596652..597572
FT                   /gene="rnz"
FT                   /locus_tag="LMHCC_0584"
FT   CDS_pept        596652..597572
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rnz"
FT                   /locus_tag="LMHCC_0584"
FT                   /product="ribonuclease Z"
FT                   /EC_number="3.1.26.11"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0584"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38941"
FT                   /db_xref="GOA:B8DBV5"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR013471"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8DBV5"
FT                   /protein_id="ACK38941.1"
FT                   /translation="MELVFLGTGAGVPSRGRNVTSIALSMLNERNAIWLFDCGEATQHQ
FT                   IMRSQIKLSKLEKIFITHLHGDHIFGLPGLLSSRSFQGGESDLTIYGPVGITEYVETSL
FT                   RLSGTRLTYKIIFNEIEPGLIFEDKMFSITVDELDHGLRSFGYRIVEKDKPGALNADKL
FT                   IEDGVEPGPIFQKIKKGETVTLADGSVINGKDYIDEPQKGKIISIFGDTKATASELELA
FT                   LNADVLVHEATFEGDKEKLAGEYMHSTTLQAASLAKKANVKKLILTHISSRYDRDASKE
FT                   LLIEAQSVFENTEIAYDLAVFPIGE"
FT   gene            597577..598368
FT                   /locus_tag="LMHCC_0585"
FT   CDS_pept        597577..598368
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0585"
FT                   /product="short-chain dehydrogenase/reductase YqjQ"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0585"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38942"
FT                   /protein_id="ACK38942.1"
FT                   /translation="MNPFLKNKTVLITGASNGLGAEITRQVAASGANVIITARSTEKLI
FT                   ALQKEISSQFSVEAVYFTLDMTDFEQVKQVSAEINTTYQVDVIVNCAGFGLFENAVDIP
FT                   FETIEKMFDTNVLGLIQLTQLILPQMQARKAGHIINIASQAAKIATPKSTVYSATKYAV
FT                   LGFSNALRLELIPDKINVTTINPGPIATNFFDVADKSGNYLETVGKLVLQPEKVARKTV
FT                   QIMGTKRREINLPFVMNIATRLYQVMPQVIEFFGKGAFLKK"
FT   gene            598477..599547
FT                   /locus_tag="LMHCC_0586"
FT   CDS_pept        598477..599547
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0586"
FT                   /product="DNA polymerase IV (Pol IV)"
FT                   /EC_number="2.7.7.7"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0586"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38943"
FT                   /db_xref="GOA:B8DBV7"
FT                   /db_xref="InterPro:IPR001126"
FT                   /db_xref="InterPro:IPR017961"
FT                   /db_xref="InterPro:IPR022880"
FT                   /db_xref="InterPro:IPR024728"
FT                   /db_xref="InterPro:IPR036775"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8DBV7"
FT                   /protein_id="ACK38943.1"
FT                   /translation="MDTSRKIIHIDMDAFYASVEQRDHPEFRGKPLIIGGDPNKRGVVS
FT                   TCSYEARKYGVHSAMPTRQAAKLCPNGIFIHGNMAHYVEVSSQIREIFSRYTDVIEPLS
FT                   LDEAYLDVTENKKGMKSATMVARDIQQTIYRELGLTASAGVSFNKFIAKIASDFKKPAG
FT                   ITVVAPEEAEAFLEQIPVTKFYGVGKVTAEKLHRLGIETGADLKKWSEWDLIRELHKHG
FT                   YQLYRHVRGRSNNIVNPHRDRKSVGKETTFEFNVLDNRILEQSLMKFAKKVEERLIKLQ
FT                   KHGKTVVLKLRYSDFTTITKRLTLNEYTNDANQIYQAAALLLRESYKGQDSIRLIGLTV
FT                   TNLKPVYFENLRLEGL"
FT   gene            complement(599584..600783)
FT                   /locus_tag="LMHCC_0588"
FT   CDS_pept        complement(599584..600783)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0588"
FT                   /product="tellurite resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0588"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38944"
FT                   /protein_id="ACK38944.1"
FT                   /translation="MTENKPSEETNELKDLVIEKEFNQTLDDLLANPFGSDGETAANIV
FT                   NNETDAAPRLVDMLTETNKKQALELSKQIEPGNQAAILGYGAPAQAKLHDFSHSMLAHV
FT                   QKQDVGPIGDIISDLMYRLQEADPDELAARNKNVFTKMFHRVKQSINEITSKYQKIGTQ
FT                   IDRIALKLEHSKKRLMEDNSFLEQLYDKNKDYFQALNIYIAAGELKLEEINTKMLPELR
FT                   KKAEQTGDQMDYQEVNDLTQFADRLDKRVYDLRLSRQITIQQAPQIRLIQNTNQALAEK
FT                   IQSSIMTAIPLWKNQVAIALTLLRQQQAVAAQRQVSETTNELLKRNADMLKTNAIETAR
FT                   ENERGIVDIETLKETQSSLIETLQETLKIQQEGRAKRAVAEKELVTMEQELKERLLEMK
FT                   "
FT   gene            complement(600761..601420)
FT                   /locus_tag="LMHCC_0589"
FT   CDS_pept        complement(600761..601420)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0589"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0589"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38945"
FT                   /protein_id="ACK38945.1"
FT                   /translation="MTVFKKILAFTGSIFLVMLLAGILTSLIHSGLVIAAIVIAVAAIL
FT                   FFFSSKAGDRAQMIATGLTKKEYKYIRTNLEEARVKIIRLQKIMTQNKALYSFQERNKT
FT                   LLLTKRIYGIVKDEPKRFYEAEDFFFSHLDSLVELTEKYAFLEKQPVKDKKIYQTLSDT
FT                   RTLLNDLSRVIEKDLFTLLNQDVNNLDFELEVAKNSISKQKKKFERGTKDDREQAK"
FT   gene            601695..602252
FT                   /locus_tag="LMHCC_0590"
FT   CDS_pept        601695..602252
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0590"
FT                   /product="adp-ribose pyrophosphatase (adp-ribose
FT                   diphosphatase)(adenosine diphosphoribose pyrophosphatase)
FT                   (adpr-ppase) (adp-ribosephosphohydrolase) (asppase)"
FT                   /EC_number="3.6.1.13"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0590"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38946"
FT                   /protein_id="ACK38946.1"
FT                   /translation="MDSLEEKTLHTEKFFSGNIIELQVDDVELPNGEKGKREIVKHPGG
FT                   VAIIPFSADGRMYLVEQFRKPLEKNIIEIPAGKMEPGEDPLVTAKRELEEETGFQSDDL
FT                   TYLTSFYTSPGFANELLYIYVARDLRKMEHPLAQDADEFINLVKVTLEEAEQLIAQQCI
FT                   HDAKTMYAIQYWKMQLLIEENE"
FT   gene            602916..603500
FT                   /locus_tag="LMHCC_0591"
FT   CDS_pept        602916..603500
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0591"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0591"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38947"
FT                   /protein_id="ACK38947.1"
FT                   /translation="MKYYKLMLNNDKKKWKKYEVFSIDFYNNMERIAPKDAYPYLINRE
FT                   YKLKIKAIKKGESPDFASIGTYYLIANARKFNKAEISFNGLELLNVAVEAENNDYVVFH
FT                   FNRKVDCVDFNKSEYIEWPSNYTLEPWENSIAQFFLKPTLQRNKIPSELECFSLDKWGG
FT                   AFNLVVSEKVRDKLASLDEENFLCFQELDII"
FT   gene            604151..605038
FT                   /locus_tag="LMHCC_0592"
FT   CDS_pept        604151..605038
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0592"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0592"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38948"
FT                   /protein_id="ACK38948.1"
FT                   /translation="MEAIKVESLTKNYHKKRAIENVNLSVNEGELYGFIGPNGAGKSTT
FT                   IKVLLNFIYATSGSATVLGKDVVKDSAEIKKMVGYVPSEVRYYPQMTANDIIHYAAKFH
FT                   HIENATQKMNTYYEMFSIDPKKRFGEMSLGNKKKVAIVAGLITEPKLFILDEPTNGLDP
FT                   LMQHYLFKEMTERNKEGMTIFLSSHNLREVQEYCSRAAFIRNGNIIAVEDIANQQMTGK
FT                   VIALKGTNLPLEKLTNAGARVIENEAGKARLIFDDDIKTILPLLQEKEITDLTITNQEL
FT                   EDKFMTLYEGGEVK"
FT   gene            605035..605850
FT                   /locus_tag="LMHCC_0593"
FT   CDS_pept        605035..605850
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0593"
FT                   /product="ABC transporter, permease protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0593"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38949"
FT                   /protein_id="ACK38949.1"
FT                   /translation="MNILHIEWKTRIKSLVVWAVVVIVILGVFMAFFPSMQSSGMQDLV
FT                   NTKMNALPQDMMKILHMDSMADLTNIDAYFAYVFQYIFIAACVYAALIGAQALIKEETD
FT                   GTIEFLYAQPITRTSLVFWKMIGNLLSFVAFWAITFVASVVLVLFLKPSGVDGGNLVME
FT                   LVRVFSSELLVAAVFMSAGFMVSAVLRSAKQASPVALALVFLTYILGIMAGLNDKVDFF
FT                   QYFSPINYAIPSEIMNKGITGTNALISCGVIVVMVAMTFVLYKKKDLKV"
FT   gene            605850..606470
FT                   /locus_tag="LMHCC_0594"
FT   CDS_pept        605850..606470
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0594"
FT                   /product="transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0594"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38950"
FT                   /protein_id="ACK38950.1"
FT                   /translation="MDEKRLKIIEAAMEEFTEKGYQAASTNKICAKAGVSKGLIFHYFG
FT                   SKEKLYVAAVSYAVDFATKEVRLEGEHWADFVEMAIWSTKMKLDFNRKYPAVFGLIMQA
FT                   YGNPPVELKGKLDGFFDKAIERSEAQMNQVLSEMKLKKDVNMDAARKVMAALFKHITET
FT                   STVYLQSHPNATMEDFVPLAKDFTEMMRIVEFGICEEKKDLGE"
FT   gene            complement(606486..607484)
FT                   /locus_tag="LMHCC_0595"
FT   CDS_pept        complement(606486..607484)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0595"
FT                   /product="pyridine nucleotide-disulfide oxidoreductase
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0595"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38951"
FT                   /protein_id="ACK38951.1"
FT                   /translation="MPNEVYDVTIIGGGPIGLFSAFYSGLRSMKTKIIDAEPAVGGKIR
FT                   YFFPEKIIRDIGGIPAITGANLVANLKEQAETFHPTIVCNERVVDVTRLADGTFQLTSH
FT                   NGSIHFSKTIVIATGSGTFEVNKLEALHAEDFPSAIHYDVRNIEQFRNKVVAVSGGGNA
FT                   AIDWAQTLEPIAKQVHLIYRGEDFKAHEESVRELQNSRVEIHIHHEISELIGTNNQLTE
FT                   INVCCNQTQATKTIQTDALFINHGVKVDLGTMAEWGFEQADFGIVVDDEMKTTVPGIFA
FT                   CGDSATYPRKIRIIAAGLHEGPIAINSAKKYLEPTAADEAMISTHHESFIG"
FT   gene            complement(607474..608298)
FT                   /locus_tag="LMHCC_0596"
FT   CDS_pept        complement(607474..608298)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0596"
FT                   /product="ferric enterobactin transport ATP-binding protein
FT                   FepC"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0596"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38952"
FT                   /protein_id="ACK38952.1"
FT                   /translation="MKDLHTDNLQISYDKRIIVDGLDIAIPANKITALVGANGSGKSTI
FT                   LKTMSRLMKPSKGAVYLDGKSIHNESTREIAKQLAILPQNPSAPDGLTVFELISYGRSP
FT                   HQSSFKSITAKDREIIFWSLRVTNLTEFADRPIDSLSGGQRQRAWIAMALAQETDVLFL
FT                   DEPTTFLDMTHQLDVLNLLKQLNQSENRTIVMVVHDLNHASRYAHHMIAIKEGKVIAEG
FT                   TPTSVMTEQTLEDVFNIKADILIDPRSGVPLCLPYETCNGCEIVKELDSIAK"
FT   gene            608463..609404
FT                   /locus_tag="LMHCC_0597"
FT   CDS_pept        608463..609404
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0597"
FT                   /product="iron compound ABC transporter, iron
FT                   compound-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0597"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38953"
FT                   /protein_id="ACK38953.1"
FT                   /translation="MKKGIILLVSMLLIAVVLTACGDNKSAGNEEVEMRTYTMANGKKV
FT                   EIPAHPKRIVASEYLGNIVLLGMKPVGARAKQMENPFLEGRVDGIADIGDPVSAEKVAE
FT                   LKPDLIIVSKEDEFEAMSKIAPTVLIPYATSKNVEEDVRQIADLVGEKKAGEAWLDKFH
FT                   QKAKESRAKLADKLDPNETVGIYEVQDKDFYVMGQNMGRGGQAIYNALQLKAPAKIQKD
FT                   VLDGQDWQKISLEVLPEFAADRMFVTSTSSGSAKDGEKTLKDLTNSPIWKNLPTFKAGN
FT                   VYQMDFDTMFYYDPLAVEGQLDIIVEKLLASN"
FT   gene            609506..610531
FT                   /locus_tag="LMHCC_0598"
FT   CDS_pept        609506..610531
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0598"
FT                   /product="ferrichrome transport system permease protein
FT                   FhuB"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0598"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38954"
FT                   /protein_id="ACK38954.1"
FT                   /translation="MDKSKQIKMNTRPTVAKFILSGGILLLLILALFGIAVGAADINLS
FT                   TVWDALFHYNSSDTQHQIIRSLRVPRVVADMAIGAAFAVAGAIMQGITRNPLADSGLLG
FT                   LNAGSTFMVAVCFAFMPWLSYNSLILFSFVGAAIGAFLVFGVSSLAGSAMSPTRLVLAG
FT                   AAVSSLLTALSEGLAIYFQLSQDLAFWYAGGVAGVKWSQLAAIWPWLLGALIAAILLSR
FT                   SITILSLGDDIAVGLGEKTTFVKIASMVVVLILAGLAVSVVGPVGFIGLIVPHLVRFLV
FT                   GVDYRWIIPCSAVVGAFLTLAADIVARTINPPYETPISVIFALIGVPFFLYVARKERRN
FT                   L"
FT   gene            610531..611553
FT                   /locus_tag="LMHCC_0599"
FT   CDS_pept        610531..611553
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0599"
FT                   /product="ferrichrome transport system permease protein
FT                   FhuG"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0599"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38955"
FT                   /protein_id="ACK38955.1"
FT                   /translation="MYMTTAEKRKKSRRVWTLIILCVLIFCTFTYSVNAGYSKLPFLEV
FT                   IKSFFGMADAGTQLIVTEFRLPRIVIALLVGAGLAVSGTILQGISGNGLADPGILGINN
FT                   GAGLAVMLYISFFPSTMDVPVLFMPFIGFVGAILTAFVVYGLSYSRSEGLLPNRLLLTG
FT                   IAVAAAIAALITLLTVRLDPQNYQRYAEWMAGNIWASSWQYVFALLPWLIVLGAIAFMK
FT                   VKTLDVLSFGDQVATGLGVRVEREKFVLLIVAVGLAAACVSVSGGIAFIGLIGPHIARK
FT                   LVGSAHRWVMVTAALSGGLLLLLADTIGRLIIQPSEIFAGIVVAIIGAPYFLFLLAKAK
FT                   "
FT   gene            611795..612247
FT                   /locus_tag="LMHCC_0600"
FT   CDS_pept        611795..612247
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0600"
FT                   /product="transcriptional regulator, Fur family"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0600"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38956"
FT                   /protein_id="ACK38956.1"
FT                   /translation="MEGRIGRIKAQLHDASYKLTPQREATVRVLLENEKDHLSAEEVFL
FT                   RVKDIAPDTGLATVYRTLELLTELRVVDKINFGDGVSRYDLRQEGAKHFHHHLVCLECG
FT                   SVEEIQEDLLEDVEKIVESKWNFLVKDHRLTFQGICADCRQKTKKE"
FT   gene            612402..613295
FT                   /gene="xerD"
FT                   /locus_tag="LMHCC_0601"
FT   CDS_pept        612402..613295
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="xerD"
FT                   /locus_tag="LMHCC_0601"
FT                   /product="tyrosine recombinase XerD"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0601"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38957"
FT                   /protein_id="ACK38957.1"
FT                   /translation="MNDLIEDFLHFLIVERGLSANTIKAYERDLRYFVSYMDVAKGLTD
FT                   PNTLERSDIVGFMAFARQEGKSPRSVARYIASLRSFFHYLMHDGKMSHDPMIQIETPKQ
FT                   AQGLPKVLNLDDVEKLLSSSDTSTPLGLRDQAMMEILYATGLRVTELVSLKMDDLHLHM
FT                   GFIQTIGKGDKERIIPLGKTATTVLEKYLEEARPKLRRPKYRNDFVFLNHHGQGLTRQG
FT                   FWKILKGIAKESGIEKPITPHTLRHSFATHLLENGADLRSVQELLGHADISTTQIYTHV
FT                   TKLRLKDVYKQFHPRA"
FT   gene            613324..614508
FT                   /gene="deoB"
FT                   /locus_tag="LMHCC_0602"
FT   CDS_pept        613324..614508
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="deoB"
FT                   /locus_tag="LMHCC_0602"
FT                   /product="phosphopentomutase"
FT                   /EC_number="5.4.2.7"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0602"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38958"
FT                   /db_xref="GOA:B8DBX2"
FT                   /db_xref="InterPro:IPR006124"
FT                   /db_xref="InterPro:IPR010045"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR024052"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8DBX2"
FT                   /protein_id="ACK38958.1"
FT                   /translation="MPDKFKRVHVIVMDSVGIGEAPDAAKFGDFDVDTFGHIAKHVGGL
FT                   KMPEMGKLGLSNIREIDGIKKAEKPLAYYTKMQEASNGKDTMTGHWEIMGLYIDTPFRV
FT                   FPDGFPDDLINQIEEKTGRKVIGNKPASGTEIMAELGEEHVKTGALIVYTSADSVLQIA
FT                   AHEDVVPLEELYEICEFCREITLDDPYMLGRIIARPFVGEPGAFVRTPNRHDYALKPFK
FT                   PTVMDALKDGGKDVIAIGKISDIFDGEGVTESIRTKSNMDGMDQFIAVLDKDFNGMSFL
FT                   NLVDFDALFGHRRDPQGYADALVDFDGRLVEVMEKLTDDDLLIITADHGNDPTYSGTDH
FT                   TREFVPLLVYSPRFKNGGSELELRKTFADLGATVADNFEVKMPEYGTSFLKDLK"
FT   gene            614527..615345
FT                   /locus_tag="LMHCC_0603"
FT   CDS_pept        614527..615345
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0603"
FT                   /product="purine nucleoside phosphorylase I, inosine and
FT                   guanosine-specific"
FT                   /EC_number="2.4.2.1"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0603"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38959"
FT                   /protein_id="ACK38959.1"
FT                   /translation="MSLEKVNEAVAKIRESYNGTPKIGLILGSGLGVLADEVNNPTKLS
FT                   YSEIPHFPVSTVEGHAGQFVFGELENKEVVAMQGRFHFYEGYSMQDVTFPVRVMKELGV
FT                   EVLVVTNAAGGVNELYSAGDLMLISDHINFTGTNPLIGPNDEHFGPRFPDMSEAYNLAL
FT                   RVDARLIAQELNLTIREGVYAGFSGPTYETPAEIQMMRTLGADAVGMSTVPEVIIANHA
FT                   GLRVLGISCITNMAAGILDQPLSHTEVIETTDQVRSTFLQYVKAIVAKIS"
FT   gene            615526..616836
FT                   /gene="lysA"
FT                   /locus_tag="LMHCC_0604"
FT   CDS_pept        615526..616836
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lysA"
FT                   /locus_tag="LMHCC_0604"
FT                   /product="diaminopimelate decarboxylase"
FT                   /EC_number="4.1.1.20"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0604"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38960"
FT                   /protein_id="ACK38960.1"
FT                   /translation="MTFERLGTMNVNAEGHLEIGGVDTLKLTEKYGTPLYVYDVALIRD
FT                   RARGFKKTFEELGVKAQVAYASKAFSAVAIYQLMAEEGLSLDVVSGGELYTAIKANFPP
FT                   ERIHFHGNNKSAEEIHMALDYGIGCFVIDNYYEISLLEEILIERNEKASVLIRVTPGIE
FT                   AHTHDYILTGQDDSKFGFGLTNGQAEKAIKQVLHASASFDLIGLHCHIGSQIFETTGFK
FT                   LAARRIMDKLVEWHQTLGFDSKVLNLGGGFGVRYTAEDEPLEPGEYVRQIMDEVRDVAN
FT                   SNDIDIPEIWIEPGRSLVGEAGTTLYKVGSRKEVPGIRNYIAVDGGMSDNIRPALYDAH
FT                   YDAVLAANPEKVAEETVAIAGKCCESGDMLIWDLPLPKSNAGEVLAVFCTGAYGYAMAS
FT                   NYNRIPRPPVVFVENGIDKLIVARETYENLVQNDLSL"
FT   gene            616852..617601
FT                   /locus_tag="LMHCC_0605"
FT   CDS_pept        616852..617601
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0605"
FT                   /product="ScpA/B protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0605"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38961"
FT                   /db_xref="GOA:B8DBX5"
FT                   /db_xref="InterPro:IPR003768"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8DBX5"
FT                   /protein_id="ACK38961.1"
FT                   /translation="MVEMNFKVDAFEGPLDLLLHLIGQLEVDIYDIPMAEITDQYMEFV
FT                   HTMQEMELDVASEYLVMAATLLAIKSKMLLPKQELEIDYDTLEEEEDPRDALVEKLMEY
FT                   KRFKEAAKELKEKEAERSFYFSKPPMDLAEYDDGTKVAELDVSLNDMLSAFNKMLRRKK
FT                   LNKPLHTRITTQEISIDERMDSVLGKLHQQVNHRLRFDELFEEQTKEQLVVTFLALLEL
FT                   MKRKLVEVEQAESFADLYVQGKGEELS"
FT   gene            617598..618194
FT                   /gene="scpB"
FT                   /locus_tag="LMHCC_0606"
FT   CDS_pept        617598..618194
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="scpB"
FT                   /locus_tag="LMHCC_0606"
FT                   /product="segregation and condensation protein B"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0606"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38962"
FT                   /db_xref="GOA:B8DBX6"
FT                   /db_xref="InterPro:IPR005234"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8DBX6"
FT                   /protein_id="ACK38962.1"
FT                   /translation="MNREEQLGILESLLFAAGDAGLSTEQLTEVMEITHIEALNLLELL
FT                   SERYNGSADRGLILLELAGTFQLATKKAHADYLRKLVEVPSNTVLSQASLETLAIIAYR
FT                   QPVTRMEVDEVRGVQTDGPIRTLVAKGLVTDKGRVDGAGRAKLYVTTSEFLDAFGLNSL
FT                   EDLPKLADPAAEEPDQNEMDLFFDRFNQSKEQEEE"
FT   gene            618197..618931
FT                   /gene="rluB"
FT                   /locus_tag="LMHCC_0607"
FT   CDS_pept        618197..618931
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rluB"
FT                   /locus_tag="LMHCC_0607"
FT                   /product="ribosomal large subunit pseudouridine synthase B"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0607"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38963"
FT                   /protein_id="ACK38963.1"
FT                   /translation="MERLQKVIANAGITSRRKAEKLIQEGKVTVNGKVVTELGVKVSGT
FT                   ERIEVEGIQLTKEEHRYFLFYKPRGTVSAVTDDKGRTTVADYFADIPERLYPVGRLDYD
FT                   TSGLLLMTNDGDFANLLMHPKNEVSKTYIARIKGIPEREVIRQLERGVVIDGRKTAPAK
FT                   VKVRSSDKAKDKAIVEITIHEGRNRQVRKMFEAVGFEVQKLSREEYSFLNLRGLNAGER
FT                   RELSHHEVKQLKTEARFGKNKK"
FT   gene            619097..619813
FT                   /locus_tag="LMHCC_0608"
FT   CDS_pept        619097..619813
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0608"
FT                   /product="transcriptional regulatory protein ResD"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0608"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38964"
FT                   /protein_id="ACK38964.1"
FT                   /translation="MSEQVRVLVVDDEDRIRRLLKMYLERENYRIEEASDGDQALSMAL
FT                   NNNYEVILLDLMMPGKDGIEVCRELREFKSTPVVMLTAKGEEANRVQGFEVGADDYIVK
FT                   PFSPREVVLRVKAVLRRAKQSSEESAGGTPGDIITFPHLKIDNEAHRVIVDGKEIGLTP
FT                   KEYDLLYYLAKSPDKVFDRESLLKEVWRYEFFGDLRTIDTHVKRLREKLHDVSEDAARM
FT                   IVTVWGLGYKFEVPED"
FT   gene            619914..621704
FT                   /locus_tag="LMHCC_0609"
FT   CDS_pept        619914..621704
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0609"
FT                   /product="sensor protein ResE"
FT                   /EC_number="2.7.13.3"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0609"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38965"
FT                   /protein_id="ACK38965.1"
FT                   /translation="MKIWNSIVGKIWSTIILLLIGILVISGFLVAMIYEKNNITRITNE
FT                   LEDKTASIITVMQENNEVISAENNNDSALILLDDTMGVIIEQNGKSVYQSQSPDTISSA
FT                   SANKLIQDKTLDEALEKDNSVTMKYNFKTEKSSLPVEISAQKFKLANGETGVVYVYQSY
FT                   HDILKVNEKTMSTLIVSGIIAIVITSILSFVFSSRMAFPLREMKKIAIAVSKGNFDNRV
FT                   PTYTHDEIGELGVAFNDMAKQLKYNVSALRQEKEQLSNILVGMADGVIKFSVDKTIILS
FT                   NPPAEEFLHNWFFSPENTEKVLIPVALNELLNDTLEKKESQVGEITFADHTYVAILTLL
FT                   YTGEHVRSIVAVIRDMTEEKQLEKMKSDFVNNVSHELRTPISMLQGYSEAIIDGVAQSD
FT                   EEVREFAQIIYDESLRIGRLVNDMLDLARMEAGFNQMDNQKLPLAPLLRKVISNFDVLA
FT                   KENFVELGLELETPDLEYSFDPDRMEQVLINLIMNAIRHTGKEGYDGKVILKQTIDEAR
FT                   SNLVITVSDNGSGIAEEDIPYLFERFYKVDKARKRGKAVGTGIGLAIVKNIVEAHNGKI
FT                   SVESELGKGSDFIITLPLYK"
FT   gene            621720..622238
FT                   /locus_tag="LMHCC_0610"
FT   CDS_pept        621720..622238
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0610"
FT                   /product="thioesterase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0610"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38966"
FT                   /protein_id="ACK38966.1"
FT                   /translation="MEKRQTKFCKESLVIKTSRVFPSDTNNHNTLFGGRLMTYIDDTAS
FT                   ISASRHCRTEIVTASTDSVDFLKPIKNDHSVCLESYVASTGRSSMEIFVKIIAENLKTG
FT                   ERYLAATSFLTFVALDADGKTVEVPLVEPETEEQKRIHAGAEARSIARKIRLKENQSLA
FT                   ESLSTDIPW"
FT   gene            622678..623289
FT                   /locus_tag="LMHCC_0611"
FT   CDS_pept        622678..623289
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0611"
FT                   /product="riboflavin transporter"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0611"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38967"
FT                   /protein_id="ACK38967.1"
FT                   /translation="MKNYSMKVFVSVAVLGTLAFILMMLQFPLLPSAPFLKLDFSDIPA
FT                   LIGGLLFGPLAVILVELIKNVLLYIVSGSPVGVPIGEISNFINGIVYVLPIYYLFHWFR
FT                   STKGMVLSTAIGTLVMTVVMSIFNYFILLPFYIKLGGLPADTDVAWLVTYAIIPFSLLK
FT                   GVIVSAVFLLLYSRLKKWIAKNQTIKERRKFEKRQQETSH"
FT   gene            complement(623332..623556)
FT                   /locus_tag="LMHCC_0612"
FT   CDS_pept        complement(623332..623556)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0612"
FT                   /product="ferredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0612"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38968"
FT                   /protein_id="ACK38968.1"
FT                   /translation="MKYCLVEKDTCIACGACSIHAPDVFDYDTEGLAFNILDDNTGTKE
FT                   IPEDLVEMVIDAEFACPSLSIKVSDGPFH"
FT   gene            623710..624717
FT                   /locus_tag="LMHCC_0613"
FT   CDS_pept        623710..624717
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0613"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0613"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38969"
FT                   /protein_id="ACK38969.1"
FT                   /translation="MDKLDNYIMTILEKSITPRKLPFLHTVLAGRRTGQAVQDIHLFQM
FT                   QHLFGLVPNLKANYLESRLSDLVRRGSIVSTENGYVIQEQQVASFATDYPDFLGFTFQR
FT                   QAFAFFAHLRLAVQVVSNIHHHESYYLPVIRDKKIQQFIKHWLKSQDKSSLADALYEEL
FT                   FAWMEKLAVARPAFIVERFSGGELMGYTTEQIATKYQVEKWDVYFEVLHEIHRLLSVMK
FT                   KKPEEWPILVSLVPDELAGLTSSAMQTYSLWQNGADLEAIERIRNLKMSTIHDHFVEIR
FT                   ATLKEADVPNLPEEEVIQTINTKKWNLLREIKAEFPDLDYYQIRLAVVSREGER"
FT   gene            624714..626117
FT                   /locus_tag="LMHCC_0614"
FT   CDS_pept        624714..626117
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0614"
FT                   /product="ATP-dependent DNA helicase, recQ"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0614"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38970"
FT                   /protein_id="ACK38970.1"
FT                   /translation="MNLEQELKEYLGFDAFRPGQKEVIETALAKRNCFAMLPTGTGKTI
FT                   CYQLAGHLMEGLVLIVSPLLSLMQDQMERMRAHGEKRVAALNSFLKREEKSQILANIHL
FT                   YKFIFLSPEMLNNEAVKNLLLKQKISLFVIDEAHCISQWGHDFRPDYLMLGQFIKEANF
FT                   PVTMVLTATATKKVRVDILTQLHLTDCEQIIYSVNRPNISLQVEKFSSQQLKKERLYEL
FT                   VRKLQTPGIIYFSSKKLAESIAHELSEIAELRVAYYHGDMDTEDRIIIQQQFVYGQLDI
FT                   ICATSAFGMGIDKADIRFVIHYHMPADLEAYLQEIGRAGRDGKDSVAILLYANGDEFIQ
FT                   MQLADQDIPDANLMNLTNEQRKTLPETEQRFIEYYQRSGLSTKELTAKMNYRKKWKRAN
FT                   LQQFIGYLHTEDCRRNYILRYFEETPIEATPENCCDLDGAEITYFEKREKIQLKEIPTW
FT                   EAYLSYLLQ"
FT   gene            626436..627155
FT                   /locus_tag="LMHCC_0615"
FT   CDS_pept        626436..627155
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0615"
FT                   /product="LysM domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0615"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38971"
FT                   /protein_id="ACK38971.1"
FT                   /translation="MVKTRKEKREYEEPADYDMNSEGQDEFNNEPPMLSRSDSRKGKKK
FT                   TIFRYPLLNLLIVFFLLIPIVIVIVFVTVQNMGSSNEVKTDTESTVNVSDNTQSKEDKE
FT                   KAKKAAEEKAAAEKAAEEKKAAEAKAEADKKKQEEDAVKAANERKEKEAAEEKAAAEKA
FT                   AADKAAAEKAAQQKANESTQKKAGGSHTVKAGDTLYSIARSAYGQAGAAAGVEKIKQAN
FT                   GLGSNNVPVGTVLTIPQ"
FT   gene            627236..628198
FT                   /locus_tag="LMHCC_0616"
FT   CDS_pept        627236..628198
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0616"
FT                   /product="L-asparaginase (L-asparagine amidohydrolase)
FT                   (L-ASNase)"
FT                   /EC_number="3.5.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0616"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38972"
FT                   /protein_id="ACK38972.1"
FT                   /translation="MAKVALITTGGTIASKKTASGKLASGELSGEELAALCQLPTEIQI
FT                   DIYSTFQLPSMHITLPDLISLKQLIESIFMDETYDGIVVTHGTDSLEETAYFLDLAVTD
FT                   ARPIVVTGSQRAPEEPGTDAYVNIRHAIYTACEMNLRQAGTVVVFNERIFAARYVKKVH
FT                   ASNIQGFSAFGFGYLGIIDNDQVFLYQKPLEHECFDIRLDLPEVVVIKCYIGADGLFID
FT                   AAIDSGVSGIVLEGVGRGQVAPKMMPAIIRALDAGIPVVITTSAEEGNVYTTYDYEGST
FT                   FDLYNRGVILGKDYDSKKARMKLMVLLASQEEINQTNFR"
FT   gene            628214..628888
FT                   /gene="cmk"
FT                   /locus_tag="LMHCC_0617"
FT   CDS_pept        628214..628888
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cmk"
FT                   /locus_tag="LMHCC_0617"
FT                   /product="cytidylate kinase"
FT                   /EC_number="2.7.4.14"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0617"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38973"
FT                   /db_xref="GOA:B8DBY7"
FT                   /db_xref="InterPro:IPR003136"
FT                   /db_xref="InterPro:IPR011994"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8DBY7"
FT                   /protein_id="ACK38973.1"
FT                   /translation="MTKKICIAIDGPAAAGKSTVAKIVAKKLRFVYIDTGAMYRAVTYI
FT                   ALKNNIAYEDEKGIAALLQKTVIRFEPGEIQQVFVGNENVTEVIRSLEITNHVSIVAAH
FT                   PSIREALQERQQVFATEGGIVMDGRDIGTAVLPNAELKIFLLASVEERAERRYKENMAK
FT                   GFAGDLDQLKKEIEERDHLDYTRTHSPLKKADDAIEVDTTSMSIDEVANKILSLAELKI
FT                   NN"
FT   gene            629246..630391
FT                   /locus_tag="LMHCC_0618"
FT   CDS_pept        629246..630391
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0618"
FT                   /product="putative 30S ribosomal protein S1-like protein"
FT                   /note="putative 30S ribosomal protein S1 homolog"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0618"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38974"
FT                   /protein_id="ACK38974.1"
FT                   /translation="MSEDLFDVEVRNFEEGDKVTGTVTSVEDKQVYVGIPDSKLDGVVP
FT                   ISELSNIHVETASDVVSVGDTLDLIVTKVEDDVLVLSKRKVDAEKASDDIKAKFESGEV
FT                   FEAVVSDVVKGGLVVDLGVRAFVPASLVEDHFVEDFADYKGTTLTFKVVEFEPENNRVI
FT                   LSHRAVVETEKASQKQALLSEIKEGDVIEGTVQRLANFGAFVDIGGVDGLVHISQISYK
FT                   HIATPQEALEEGQKVTVKVIGIDPENERISLSIKATLPGPWDGIAEKAPVGSVLEGKVV
FT                   RLVTFGAFVEIFEGVEGLVHISQISHEHIGTPQEVLSEGQTVEVKVLEVNEADKRLSLS
FT                   IKELKDAPVEEADYELPEENTGFQMSDLIGDKLKGLQNDDK"
FT   gene            630535..631845
FT                   /locus_tag="LMHCC_0619"
FT   CDS_pept        630535..631845
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0619"
FT                   /product="GTP-binding protein EngA"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0619"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38975"
FT                   /db_xref="GOA:B8DBY9"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR016484"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031166"
FT                   /db_xref="InterPro:IPR032859"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8DBY9"
FT                   /protein_id="ACK38975.1"
FT                   /translation="MAKPVVAIVGRPNVGKSTIFNRIVGERVSIVEDVPGVTRDRIYNS
FT                   AEWLGKEFNIIDTGGIDLSDEPFLEQIRAQAEIAIDEADVIIFITNGREGVTDADEQVA
FT                   KILYRSNKPIVLAINKVDNPEMRDQIYDFYSLGFGEPYPISGSHGLGLGDMLDAVRAHF
FT                   PKEEEEEYPDDTVKFSLIGRPNVGKSSILNALLGEDRVIVSDIAGTTRDAIDTTYTFDG
FT                   QDYVMIDTAGMRKRGKVYESTEKYSVLRAMRAIERSDVVLVVINAEEGIREQDKRIAGY
FT                   AHDAGRAIIIVVNKWDAINKDEKTINVWTEDIREQFQFLSYAPIVFVSAKTKQRLNNLF
FT                   PLINQVSDNHSLRVQSSMLNDVISDAVAMNPSPMDKGKRLKIFYTTQVAVKPPTFVVFV
FT                   NDPELMHFSYERFLENRIREAFPFEGTPIRVIARKRK"
FT   gene            631868..632884
FT                   /locus_tag="LMHCC_0620"
FT   CDS_pept        631868..632884
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0620"
FT                   /product="glycerol-3-phosphate dehydrogenase (NAD(P)+)
FT                   (NAD(P)H-dependent glycerol-3-phosphate dehydrogenase)
FT                   (NAD(P)H-dependentdihydroxyacetone-phosphate reductase)"
FT                   /EC_number="1.1.1.94"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0620"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38976"
FT                   /db_xref="GOA:B8DBZ0"
FT                   /db_xref="InterPro:IPR006109"
FT                   /db_xref="InterPro:IPR006168"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR011128"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8DBZ0"
FT                   /protein_id="ACK38976.1"
FT                   /translation="MTQKKVAILGAGSWGTGLALVLADNNHKPVIWGNLDKIVNEINES
FT                   HTNSHYLPDIILPTEVKATLSLDEAIDGAEIVVIAIPTNAMRIVCKQLNEALKEPTILV
FT                   HVSKGIEPETNLRMSEVIEEEIDAAKRKALVVLSGPSHAEEVALRHPTTLCASCKDLTA
FT                   AEIVQDRFINNNLRIYTNDDVIGAEIGGALKNIIALGAGISDGLGYGDNAKAALMTRGM
FT                   AEITRLGVAVGSNPQTFYGLTGIGDLIVTCTSVHSRNWRAGNMLGKGENLDEVLEKMGM
FT                   VVEGVRTAKAVHGWAKKLDIDMPITESIYAILFENKDAREAVDLLMGRKKKIEKESF"
FT   gene            632987..633967
FT                   /locus_tag="LMHCC_0621"
FT   CDS_pept        632987..633967
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0621"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0621"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38977"
FT                   /protein_id="ACK38977.1"
FT                   /translation="MEVTRTDKAVTLTWKKEEVSEGTLVFVSSSPNLEASSAPVFKVTN
FT                   EVDHFTYETKDIPVYFFLEGPKGDKTVISERILPLESVFNFRDMGGYASENGKHVKWGK
FT                   LYRSSNLVNINANDAALLQKLHIKWICDLRSSSEVQAQPTPAIEGVLNKHIPIGTAKNE
FT                   ETKLPVTSDTTIYEPLMGESYRVFVQSVEGFREIFTEVLEDAKAGLPFVFHCTAGKDRT
FT                   GVLGALLLTLLDVPEKTIFDDYAITNRYQDDILQEMGGIVALFSSGTEKIDLETFRPMA
FT                   EARPEYLEIAFDEMKKQYGSVANYLEKGIGITAAEKAAFQKEMLE"
FT   gene            634380..634655
FT                   /locus_tag="LMHCC_0622"
FT   CDS_pept        634380..634655
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0622"
FT                   /product="DNA-binding protein HU 1 (DNA-binding protein II)
FT                   (HB)"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0622"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38978"
FT                   /protein_id="ACK38978.1"
FT                   /translation="MANKTDLVNSVAELADLSKKDAAKAVEAVFETIQTSLSKGEKVQL
FT                   IGFGNFEVRERAARKGRNPRTKEEIDIPASKVPAFKPGKALKEAVK"
FT   gene            634890..635459
FT                   /gene="folE"
FT                   /locus_tag="LMHCC_0623"
FT   CDS_pept        634890..635459
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folE"
FT                   /locus_tag="LMHCC_0623"
FT                   /product="GTP cyclohydrolase I"
FT                   /EC_number="3.5.4.16"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0623"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38979"
FT                   /db_xref="GOA:B8DBZ3"
FT                   /db_xref="InterPro:IPR001474"
FT                   /db_xref="InterPro:IPR018234"
FT                   /db_xref="InterPro:IPR020602"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8DBZ3"
FT                   /protein_id="ACK38979.1"
FT                   /translation="MEQIDKQKIADAVKVILEAVGENPDREGLIDTPMRVARMYEEVFA
FT                   GLKKDPSVHFDTIFEEQHEELVLVKDIRFSSMCEHHLVPFFGVAHVAYLPQNGRVAGLS
FT                   KLARVVDDVSRRPQLQERITTTVAEIMMDKLKPLGVMVIMEAEHMCMTIRGVNKPGTKT
FT                   ITSAVRGAFKNDDKLRSEVLALIKHN"
FT   gene            635518..636285
FT                   /locus_tag="LMHCC_0624"
FT   CDS_pept        635518..636285
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0624"
FT                   /product="heptaprenyl diphosphate synthase (heppp synthase)
FT                   subunit 1 superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0624"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38980"
FT                   /protein_id="ACK38980.1"
FT                   /translation="MTYQAREAGLKEVEQLVHEQAVYQYLQENNEGGQMDKDQMLFLHE
FT                   AISGSDLTDAAAYRVVSATLYMILAHDTHEKIDEPGDVVQLTRKEQELTVLAGDFYSAL
FT                   YYRTLAELEMIPLLRALQSGVQETNTAKTNIYQLHVATDEEYLSQLTLTNAAIFAKFAK
FT                   YFMKDDTFIALGCQFFLLKRLQTELATYKEIGASRLKRAFDHGYFAKEAVSNFESWLVA
FT                   IIRDVKMEVERLRTESEPLSNILEKRIIEVLND"
FT   gene            636308..637021
FT                   /gene="menG"
FT                   /locus_tag="LMHCC_0625"
FT   CDS_pept        636308..637021
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="menG"
FT                   /locus_tag="LMHCC_0625"
FT                   /product="2-heptaprenyl-1,4-naphthoquinone
FT                   methyltransferase"
FT                   /EC_number="2.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0625"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38981"
FT                   /db_xref="GOA:B8DBZ5"
FT                   /db_xref="InterPro:IPR004033"
FT                   /db_xref="InterPro:IPR014122"
FT                   /db_xref="InterPro:IPR023576"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8DBZ5"
FT                   /protein_id="ACK38981.1"
FT                   /translation="MTETKEEKVHKVFEKISPSYDRMNSVISFKLHVKWRKETMKLMRV
FT                   QKGTNVLDVCCGTADWSIMMAEEIGPEGHVTGLDFSENMLKVGREKVTEADLHNVELIH
FT                   GNAMELPFPDNSFDYVTIGFGLRNVPDYMQVLREMYRVLKPGGQLACIDTSQPNIPGWK
FT                   QVFNAYFRYVMPVFGKFFAKSYKEYSWLQESTREFPGMARLAEMFQEAGFSYVRYISHS
FT                   GGASATHFGFKKKEQ"
FT   gene            637032..637997
FT                   /gene="hepT"
FT                   /locus_tag="LMHCC_0626"
FT   CDS_pept        637032..637997
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hepT"
FT                   /locus_tag="LMHCC_0626"
FT                   /product="heptaprenyl diphosphate synthase component II"
FT                   /EC_number="2.5.1.30"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0626"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38982"
FT                   /protein_id="ACK38982.1"
FT                   /translation="MKLNFLYANMQKDIDSVEKELKKALSGAAAETTSDAALHLLEAGG
FT                   KRIRPMFVCLSARLAPNADFDAVKNASVAIELIHMASIVHDDVVDDADLRRGRETIKSK
FT                   WGNHIAMYTGDFLFAKSLEYMTEIKDVAAHKMLSHVTVELSTGEIEQLKDKYNFDQSVR
FT                   NYLRRIKRKTALLIAASCGLGGVVSGQSEADYQKLFRFGYYVGMAFQITDDVLDFVGTE
FT                   KELGKPAGEDLRQGNVTLPVFFAMEDPFLKKRISQVTEETPAEEIAVLVEEVKKAGAKP
FT                   AEDIATAYLKKAVEILDSLPQVPELKPLKQIVRVLDKRNY"
FT   gene            638016..638459
FT                   /locus_tag="LMHCC_0627"
FT   CDS_pept        638016..638459
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0627"
FT                   /product="nucleoside diphosphate kinase (NDK) (NDP
FT                   kinase)(Nucleoside-2-P kinase)"
FT                   /EC_number="2.7.4.6"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0627"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38983"
FT                   /db_xref="GOA:B8DBZ7"
FT                   /db_xref="InterPro:IPR001564"
FT                   /db_xref="InterPro:IPR023005"
FT                   /db_xref="InterPro:IPR034907"
FT                   /db_xref="InterPro:IPR036850"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8DBZ7"
FT                   /protein_id="ACK38983.1"
FT                   /translation="MEQTYVMVKPDGVERGLIGEIVTRIEKKGLKIVAGKLMQIDRELA
FT                   EKHYAEHIGKSFFEDLIGFITSGPVFAMVLEGDDAIATARRMMGKTNPLEADPGTIRAD
FT                   YAIHTNRNVIHGSDSLESAKREIQLFFAPQEILSYQKAIDTWI"
FT   gene            638663..639829
FT                   /gene="aroC"
FT                   /locus_tag="LMHCC_0628"
FT   CDS_pept        638663..639829
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroC"
FT                   /locus_tag="LMHCC_0628"
FT                   /product="chorismate synthase"
FT                   /EC_number="4.2.3.5"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0628"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38984"
FT                   /db_xref="GOA:B8DBZ8"
FT                   /db_xref="InterPro:IPR000453"
FT                   /db_xref="InterPro:IPR020541"
FT                   /db_xref="InterPro:IPR035904"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8DBZ8"
FT                   /protein_id="ACK38984.1"
FT                   /translation="MRYLTAGESHGPGLTTIIEGLPAGMPLLAEDVNKELKRRQGGHGR
FT                   GARMRIEKDQVQITAGIRHGKTLGAPVAMFVENKDWKHWETVMSIEPVPEKNEKSRRVS
FT                   RPRPGHADLVGGMKYGHNDMRNVLERSSARETTVRVAAGAVAKKLLHELGIEVAGHVLE
FT                   IGGTRANLTRDYAVREIQETSEASPVRCLDGVAAEEMMQKIDDAKKNGDTIGGIVEVVV
FT                   GGVPAGLGSYVQWDKKLDAKIARAIVSINAFKGAEFGVGFEAARKPGSEVMDEILWSKE
FT                   DGYTRRTNNLGGFEGGMTNGMPIVVRGVMKPIPTLYKPLQSVDIDSKETFNASVERSDS
FT                   CAVPAASVVAEAVVAWEVAVAVLEKFDGDRFDTLKKHVEEHRNLTKEF"
FT   gene            639832..640929
FT                   /gene="aroB"
FT                   /locus_tag="LMHCC_0629"
FT   CDS_pept        639832..640929
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroB"
FT                   /locus_tag="LMHCC_0629"
FT                   /product="3-dehydroquinate synthase"
FT                   /EC_number="4.2.3.4"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0629"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38985"
FT                   /db_xref="GOA:B8DBZ9"
FT                   /db_xref="InterPro:IPR016037"
FT                   /db_xref="InterPro:IPR030960"
FT                   /db_xref="InterPro:IPR030963"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8DBZ9"
FT                   /protein_id="ACK38985.1"
FT                   /translation="MPEITVRAKSKTYPVYINEFALEDVREKWTESLAKFSHVFVLTDE
FT                   HVAELHKAKLDAVLADLPVVTYYVAPNGEEAKTFRVYEDVMTKLIETGLDRKAVLIAFG
FT                   GGVIGDLGGFVAATYMRGIPFYQVPTTVLAHDSAVGGKVAINHPLGKNMIGNFYQPEAV
FT                   IYDTQFFATLPEREMRSGFAEMIKHALISDQTLLRALMDTFTEPKDFYTKDLTPFLQRG
FT                   IEIKANIVAQDETEQGVRAYLNFGHTFGHALEAYGNFGKWLHGEAITYGMIYALTMSEA
FT                   IYGLDFDLAEFKTWLKQLGYDTTFDATVPFSKILENMRHDKKTTFNEISMVLLEEIGKP
FT                   VIFKAEDDLIFETYKRVMRNGGNGI"
FT   gene            640926..641300
FT                   /gene="aroH"
FT                   /locus_tag="LMHCC_0630"
FT   CDS_pept        640926..641300
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroH"
FT                   /locus_tag="LMHCC_0630"
FT                   /product="chorismate mutase"
FT                   /EC_number="5.4.99.5"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0630"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38986"
FT                   /protein_id="ACK38986.1"
FT                   /translation="MRAIRGATTIETNSPEAIYAATKELFEEILTQNEITDSEQLTSVI
FT                   ITVTEDIFAAFPAKAVRETPGFEYVPVMGMQEIPVPNSLPMCIRFMVFTDLHKPLEAIN
FT                   HVYLRGAKVLRPDLVKEEDA"
FT   gene            641300..642382
FT                   /gene="hisC"
FT                   /locus_tag="LMHCC_0631"
FT   CDS_pept        641300..642382
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisC"
FT                   /locus_tag="LMHCC_0631"
FT                   /product="histidinol-phosphate aminotransferase"
FT                   /EC_number="2.6.1.9"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0631"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38987"
FT                   /db_xref="GOA:B8DC01"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR005861"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8DC01"
FT                   /protein_id="ACK38987.1"
FT                   /translation="MKWKKSLTGLSSYKPGKREEEVMAELGLTKITKLSSNENPLGTSP
FT                   KVAALQANSSVETEIYPDGWASSLRTVVADFYQLDEEELIFTAGVDELIELLTRVLLDT
FT                   TKNTVMATPTFVQYRQNALIEGAEVREIPLLVDGAHDLDGMLNAIDDNTTIVWVCNPNN
FT                   PTGNYIDLADIQAFLDKVPSDVLVVLDEAYIEYVTPQPEKHEHLIRTYKNLIITRTFSK
FT                   IYGLASARVGYGIADKAIIEQLNIVRPPFNTTSIGQKLAIEAIKDQAFIEACRTSNANG
FT                   IKQYETFAKRFEQVKLYPANGNFVLIDLGIEAGTIFSYLEKNGYITRSGAALGFPTAVR
FT                   ITIGKEEENSAVIALLEKLL"
FT   gene            642404..643507
FT                   /locus_tag="LMHCC_0632"
FT   CDS_pept        642404..643507
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0632"
FT                   /product="prephenate dehydrogenase"
FT                   /EC_number="1.3.1.12"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0632"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38988"
FT                   /protein_id="ACK38988.1"
FT                   /translation="MKGTVVIVGLGLIGGSIALAIKAKHPEAHIIGIDVSYHSLEVGKS
FT                   LGVIDEIGESILIDGPKADLLIFCCPVKETEQLLTRLPGLRLKKNVIVTDTGSTKGTIM
FT                   EASTALRESGITFIGGHPMAGSHKSGVRAAKELLFENAYYLLTPTKDVAEDKVAELRTW
FT                   LSGTNAKFLVLSPNEHDEITGMLSHLPHIVAAALVNQTQSFTEEHPAAFRLAAGGFRDI
FT                   TRVASSDPRMWTDISISNQKTLTKQLTIWRDSMNEALEMLESEDASSIYAFFDGAKEFR
FT                   DSLPVHQGGAIPSFYDLFVDVPDYPGVISEVTRYLGEEEISLTNIKILETREDIFGVLQ
FT                   ITFQSDEDRDRAKRCIETRSNYTCHYE"
FT   gene            643521..644807
FT                   /gene="aroA"
FT                   /locus_tag="LMHCC_0633"
FT   CDS_pept        643521..644807
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroA"
FT                   /locus_tag="LMHCC_0633"
FT                   /product="3-phosphoshikimate 1-carboxyvinyltransferase"
FT                   /EC_number="2.5.1.19"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0633"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38989"
FT                   /db_xref="GOA:B8DC03"
FT                   /db_xref="InterPro:IPR001986"
FT                   /db_xref="InterPro:IPR006264"
FT                   /db_xref="InterPro:IPR013792"
FT                   /db_xref="InterPro:IPR023193"
FT                   /db_xref="InterPro:IPR036968"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8DC03"
FT                   /protein_id="ACK38989.1"
FT                   /translation="MKLITNKQGLVGAITVPGDKSMSHRSIMFGAIAEGKTVIRHFLRA
FT                   DDCLGTIKAFKALGVKIEETEEEIIVHGTGFDGLKQADGPLDIGNSGTTIRLMMGILAG
FT                   RDFDTVILGDESIAKRPMNRVMLPLQQMGAKMHGKDGSEFAPITINGKQSLKRMEYHMP
FT                   VASAQVKSAIIFAALQAEGETIIHEKEKTRDHTEHMIRQFGGEIEMDGLTIRVKGGQTF
FT                   TGQEMTVPGDVSSAAFFIVAGLITPGSEIELTHVGLNPTRTGIFDVVEQMGGSLVVKDS
FT                   SRSTGKLAGTVVVKTSDLKGTEIGGDIIPRLIDEIPVIALLATQAEGTTIIKDAAELKV
FT                   KETNRIDAVATELNKMGADITPTEDGLIIRGKTPLHAANVTSYGDHRIGMMLQIAALLV
FT                   EEGDVELERAEAVSVSYPTFFEDIRSLLK"
FT   gene            644827..646191
FT                   /locus_tag="LMHCC_0634"
FT   CDS_pept        644827..646191
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0634"
FT                   /product="TPR domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0634"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38990"
FT                   /protein_id="ACK38990.1"
FT                   /translation="MLTTSVLVFYLGEAITFSYERSNGIIEKRLINKEGAEMELANKML
FT                   HALEHEDMALAKKYFDEVVQAGTDEEQYYLAEELFTLGFLDETEDLYELLLAKYKDEGE
FT                   LLVRAAEVALEKDDIDSAQDYLEKVNKEDEAYIESLLVLADLYQMQGLFEVSEQKLLEA
FT                   KQMAPNEPIIDFALGEYYLSQARFASAVQSYQTAVEAGLTIISNGAVSVYERIAEAFAA
FT                   SGAFEEALSYYERALEDKESVDTLFGMGLTAYQAKDYTKAIHALEHLREHDPSYTTLYS
FT                   YLAKSYEENGEPEKAIAVLRDGLTQDEFNKEMFLEAGKLAVTLRLPEEAEEFYRQAIVL
FT                   DEEYSEAIMQLNKLLLAKEDYEGVIELVEGLGEEVISEPQIFWDVSVAYQETEQYNKAK
FT                   ANYELAYSHFTNNPTFLKEYGLFLREEGEYAKSQEVLWNYLELEPEDTEILSLFD"
FT   gene            646227..646772
FT                   /locus_tag="LMHCC_0635"
FT   CDS_pept        646227..646772
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0635"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0635"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38991"
FT                   /db_xref="InterPro:IPR011188"
FT                   /db_xref="InterPro:IPR014957"
FT                   /db_xref="InterPro:IPR014963"
FT                   /db_xref="InterPro:IPR027393"
FT                   /db_xref="InterPro:IPR038091"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8DC05"
FT                   /protein_id="ACK38991.1"
FT                   /translation="MKASISIDEKKDFIRWFLNKHQMKTREAMWVLNYIAGHDQIVKYV
FT                   HFVDNLEGCARGLSLSAHGVESEPFLFFKGNIMTTDPEKAFHDIRLNWDEELYVELHFE
FT                   EAITSPEYALVREDNPFTAVKLADEEKEMADALIYQSVHQFSREKVLQQIDEALDARDE
FT                   VTFHKLVRILQQMDTVKE"
FT   gene            646859..647455
FT                   /locus_tag="LMHCC_0636"
FT   CDS_pept        646859..647455
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0636"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0636"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38992"
FT                   /protein_id="ACK38992.1"
FT                   /translation="MLYSLLANRSFLRLLFFGNLLGAIYGYIWYIPQLQITEPRFWLFV
FT                   PDSPTAILFFTLALVGFLGKKHWPLMEALGFVCLVKYGLWAVGMNIFFMVDQGMLVWGS
FT                   VALILTHGFMAVEGILYAPFYRFRIGHFMIAAVWVFHNDVIDYVLGQMPIYMGLEKFSP
FT                   EIGYATFWLTVLVLWFVYDKTIKNKHLTLEFPHDE"
FT   gene            647542..648225
FT                   /locus_tag="LMHCC_0637"
FT   CDS_pept        647542..648225
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0637"
FT                   /product="Zn-dependent protease"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0637"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38993"
FT                   /protein_id="ACK38993.1"
FT                   /translation="MSFSQYIIYFIIVAAIPLWAQYRVKTTYAHYSKVGVANGLTGAEV
FT                   ARHILDTNGLTNVPVHETKGMLSDHYDPRKKVVFLSEANFRGRSIAGAAVAAHEVGHAI
FT                   QDQQDYAFMRFRSALVPVTMFSSNISWVFLIIGMLANVASFMLLGIILMAVGVLFQLIT
FT                   LPVEFDASKRALVQLESGGLVASSELPQAKKVLSAAAMTYVAAMAVAVLELLRLLLIFT
FT                   NMNRN"
FT   gene            648336..649601
FT                   /locus_tag="LMHCC_0638"
FT   CDS_pept        648336..649601
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0638"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0638"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38994"
FT                   /protein_id="ACK38994.1"
FT                   /translation="MDYDVIVIGGGPSGLMAAISAAEKNKRVLLIEKGPKLGRKLIMSG
FT                   GGRCNVTNRRPAEEIIKHIPGNGRFLYSAFHAFDNEDIIRFFEKLGVALKEEDHGRMFP
FT                   VSNSARSVAEAMIQRMEKLGVKIYMQTAVKQVDYEDGHVKGVTLKDGQEISTSAVIVAV
FT                   GGKSVPRTGSTGDGYAWAKKAGHTITELYPTEVPITSSEPFIKQKVLQGTSLRDVSLSV
FT                   LNAKGKPIITHQMDMIFTHFGVSGPAALRCSMFVLRELKKTGASTVKMRLDLFPNVSAA
FT                   ELSKDVYKLLEENPKKALKNSLSSLLQEKMLLFLLEKADLDETAEYKQVSPKKIEQFIQ
FT                   LLKDFTFEVNGTLDFEKAFVTGGGVSVKEIKPKEMQSKLMEGLFFCGEILDINGYTGGY
FT                   NITCALVTGHTAGAYAAEVSNA"
FT   gene            complement(649648..651927)
FT                   /gene="pflB"
FT                   /locus_tag="LMHCC_0639"
FT   CDS_pept        complement(649648..651927)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pflB"
FT                   /locus_tag="LMHCC_0639"
FT                   /product="formate acetyltransferase"
FT                   /EC_number="2.3.1.54"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0639"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38995"
FT                   /protein_id="ACK38995.1"
FT                   /translation="MTKAWDGFKGTAWQESISVGQFVQDNYTPYDGDESFLEKSTPRTT
FT                   KLNEKINKLVEEMDAKGGVLDMDNAIVSNVASHKAGYVDQENEVIVGLQTDKPFKLAFM
FT                   PNGGLRTAEQCLTDNGYSIDQELHDFYVKNRSTANDGIFRAYTDDIKRARHSHIVSGLP
FT                   DAYSRGRIIGLYQKPALYGVDRLIAEKQQDLKKIAISSDENIRLREEIWLQIKALKDLI
FT                   VLGNEYGLELGRPAENATEAVQWTYMGYLASIKQANGAASSFGRIPIFLDIYIQRDLEK
FT                   GIITEFDAQELIEQLTLKLRMVRFARTDGYNELYASNPTFVTTSMAGMGADGRHRVTKT
FT                   DYRFLHCLDNLGNSAEPNLTVLWDARLPESFKEYCMKMSVKHSSIQYENDKLMQEEGYG
FT                   DMQCISCCVSPLNPEADKDKGETHNLQYFGARVNVLKCLLGAINGGKDDLHKNQVFDVV
FT                   EPITTEYLEYEEVLEKFDKSMDWLTDTYVDAMNIIHFMTDKYNYESMQMAFLPSKVTAN
FT                   MGFGICGFANVVDSLSAIKHAKVKTIRDEDGFVYDYEVEGDFPRYGENDDRADDIAVMV
FT                   LKMFKDKLDSHKLYKDSEATVSVLTITSNVAYSKQCGNSPVHKGPVFDENGKIVKEPEF
FT                   FSPGANPSNKAKGGFLDNLASLSKLPFHYANDGISLTIQGAPKMFGKTTEEQHHNLVGI
FT                   LDGYFTKGGQHINLNVLNHDEVIEKIKAGIPVILRISGYCLNTKDLNEEQKMELCQRMF
FT                   HEKLIG"
FT   gene            complement(652162..653169)
FT                   /locus_tag="LMHCC_0640"
FT   CDS_pept        complement(652162..653169)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0640"
FT                   /product="beta-lactamase"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0640"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38996"
FT                   /protein_id="ACK38996.1"
FT                   /translation="MFYKTKQSLDQLVQNGSTPGISYQIKTNYLEENNIMGLKSVFPEA
FT                   EILPRTTENIYDIASLTKVIATTTRILQLIEQQRFQLNDPIQMYLPDFRYNNVTIMHLL
FT                   THSSGLAQNIPNFSMNTPEDVMRYVYATPQINAPGTSVTYADANFLLLGYLISKIDGNY
FT                   ETSIQNNILEPLSMTDTSFHPANKKQVIPTELDQTRGLIQGDVHDFKAWTAKSGTGHAG
FT                   LFSTLSDLSKFRDALMLQHGAPILSEKTWHLMQINHTPGLNRSRGLGWDLRGESVLYHT
FT                   GFTGTFMVLDLKHQASLIVLSNRVHPSRANPNFVDKRDSIVDTFLEEVTKKKEV"
FT   gene            complement(653172..654815)
FT                   /locus_tag="LMHCC_0641"
FT   CDS_pept        complement(653172..654815)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0641"
FT                   /product="NAD-dependent malic enzyme (NAD-ME)"
FT                   /EC_number="1.1.1.38"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0641"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38997"
FT                   /protein_id="ACK38997.1"
FT                   /translation="MTLKPGFDYMNNPLLNKGTAFSKEERASYQLDGLLPPIIETIEQQ
FT                   AVRIETQIENLETPLHKHQLLTNLYNENRTLYYYVVTKNVTDYLPIIYTPTIGDAVIQY
FT                   HKDYTAPDEALFIDAFAPEKLSASIKNYAKNNPNIDMIVITDGEGVLGIGDWGVNGVKI
FT                   AVGKLAVYTVAAGLAPDRVLPVVIDAGTNNETLLNDPLYLGNKRPRLSESEYDAFIASF
FT                   VNVMKEVFPKAILHWEDFGRANASRILHNYRDKICTFNDDIQGTGAMVVAAVLATIQVS
FT                   KIPLSKQKIIIFGAGTAGIGIADQLSAQWMRETGLPFESAKKHFYLVDRNGLVLDNMTD
FT                   LTTGQKKYAHPSTEWSNVPTDTLENLMEAVHPTMLIGCSGVTGAFKESIVKKMTQYTER
FT                   PAILPLSNPTKLAEATASDLIQWTDGKALIVTGSPSKPVEYQHTTYEIGQANNALLYPG
FT                   LGLGALVTRAKYITDGMLAAASMAVAEQILPNKAGAALLPHVRTLRETSRAVAIAVANQ
FT                   AIKENIHQVELTNVTEAIEREMWQPIYKGV"
FT   gene            complement(654926..655609)
FT                   /locus_tag="LMHCC_0643"
FT   CDS_pept        complement(654926..655609)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0643"
FT                   /product="EAL domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0643"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38998"
FT                   /protein_id="ACK38998.1"
FT                   /translation="MKKPSVREIIDQNHFDTIYEPIVAVENTQIFGYESLTRLKTDHWN
FT                   AISDFIEEAEQDGLQKAFELLTLHNAVKRFNKNGDTPLFVNISYDTFLENQEELHDTLL
FT                   DNGKIVFEFLETSKLPQERMNDLEKQLLLFQKKHETKFAIDDFGSGYADLHRVFAHHSD
FT                   FVKTDRLLLRDLFESDGKKIFFEQLHNYVKKHHKSLIVEGVETKEQLAFLQEIGIPYAQ
FT                   GYYFH"
FT   gene            complement(655628..656632)
FT                   /locus_tag="LMHCC_0644"
FT   CDS_pept        complement(655628..656632)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0644"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0644"
FT                   /db_xref="EnsemblGenomes-Tr:ACK38999"
FT                   /protein_id="ACK38999.1"
FT                   /translation="MKRIILIFILLILIGAGFFFFLRPEPKKTVSAPKETTPTSTSVQT
FT                   YVKENYTAKNGLIVDYKNAQEPHYLAESIGLYMEYLVEVNDSKTFQEQVSHLEKNFITE
FT                   DNFIKWEATDATTTNAIVDDFRITEALYQASEKFSFPSYKKMADKILANTKKYSAEQGV
FT                   PVDFYDFVHKKKADTLHLSYLNIQAMQQINYRDKAYLPIQTVNADPFFTEVFQNGQFQY
FT                   ADPKEVNMIDQMLIALAYFEENGDIEPNFDNFLQTELASKGKIYARYGRETKKPSTENE
FT                   STAVYAFLTQYFNKTNQAKNGKITKELLEKMDTSNPETTHFFDYINKEITLKK"
FT   gene            complement(656629..657756)
FT                   /locus_tag="LMHCC_0645"
FT   CDS_pept        complement(656629..657756)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0645"
FT                   /product="ggdef domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0645"
FT                   /db_xref="EnsemblGenomes-Tr:ACK39000"
FT                   /protein_id="ACK39000.1"
FT                   /translation="MFELVNSYIDSLALFLAILFIQGMSFRKIRQYRPNWFQNGGRRLF
FT                   LSILLGVYYGLAGIYFIYEGAYENNPVIYTNMRILILMVTSVFGGRIPLIFAYLVMLFG
FT                   RISFDIASPVTSRYVILMTLIFAACLLVTFWKKQRFSRFVALIILNFPAILYYFVNNFD
FT                   EGRILQGFEIIEYFLLFFVTALLVFYACNYIDKSNLVIQNLTETAMTDSLTNLPNMRFF
FT                   TQQFGWIFAKSLKKKKSLSLFIIDIDHFKEINDFHGHQAGNTVLAQFSSILKNRTFPPR
FT                   TMFARIGGEEFAVLLQNVGTEQAALIADFFREEVERAKFPYNPASGKVTVSIGVASASS
FT                   HFSTTESLFEAADQALYQAKQSGRNQIAVHQGELE"
FT   gene            complement(657782..658918)
FT                   /locus_tag="LMHCC_0646"
FT   CDS_pept        complement(657782..658918)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0646"
FT                   /product="ggdef domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0646"
FT                   /db_xref="EnsemblGenomes-Tr:ACK39001"
FT                   /protein_id="ACK39001.1"
FT                   /translation="MPNILDSLWNSMALFLSALFFHGMALRSIREKKPAWFQIKFSNEI
FT                   INYALGIYYGLLGVYFIIRGLPGTDSGIYTDMLLNILIVLHLFSSAGPATIALLLIVAG
FT                   KLFLGDALFANLIYVFLIIGFHFVCMEVAKLRLSSVQKVVLVKLSAIPLMLFYLHQKIH
FT                   LLYTINDLPVWILYFLVSFFITFIIVSAAYYIDTSNKLIYDLQQSTILDPLTGLTNFRH
FT                   FEKAFEAAFNHATLKKSNLSVIIIDIDYFKRVNDTYGHLVGNGVLSTFSQMLLKISFPP
FT                   NTVISRIGGEEFAIILPNINVSETEHLAEKIRRKVEKIDVPIVASGSVITISAGIANYD
FT                   GRNYSNPNELLNAADQALYNAKRNGRNQVHIRETEPVV"
FT   gene            659239..660345
FT                   /locus_tag="LMHCC_0648"
FT   CDS_pept        659239..660345
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0648"
FT                   /product="D-amino acid dehydrogenase, small subunit"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0648"
FT                   /db_xref="EnsemblGenomes-Tr:ACK39003"
FT                   /protein_id="ACK39003.1"
FT                   /translation="MQKIVIIGGGIVGASAAYLLSKENVQVTLIDSDEPGQATHAAAGI
FT                   ICPWLSKRRNKYWYELAKNSAAFYKELAGTLEGDTGRNSGYKQVGVLALRKTEEKVTEL
FT                   FDLANERRLDAEVMDEIAKLSEEETKQKFPLVKPGFGSVYVSGAARVNGGLFCETLLYA
FT                   AKENGVKIKSGRAHFSTDGKVRVDGENEHYDKLIIAAGAWLKELLDEASFHTEVLAQKG
FT                   QLLELDFSEFQTDEWPVILPPSAKSIVPFDNGKIIVGATHEKAAGFDTEPTAEGKAEIL
FT                   TEVSQFMEGDLASKVAHVAVGTRPYTPDFAPLIGQLPGFESVFLANGLGASGLTTGPYV
FT                   GKLLADLALGNTVDLALENYEPSKYISR"
FT   gene            complement(660335..661201)
FT                   /locus_tag="LMHCC_0647"
FT   CDS_pept        complement(660335..661201)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0647"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0647"
FT                   /db_xref="EnsemblGenomes-Tr:ACK39002"
FT                   /protein_id="ACK39002.1"
FT                   /translation="MLKTLRTKNICFIMLGTAIYAFGLVNFNIANNLGEGGLAGVTLFL
FT                   LHFFQIDPAYSNLILNIPLFILGWRVLGNRSLIYTGIGTVSLSLFLWIFQRIPYTLDLH
FT                   SDLLLVALFAGGFSGIGLGLVFRYGGTTGGSDIIAKLLNHTKGISMGRTLFAIDAIVLV
FT                   ASLSYLDVRQVMYTLVAVFIGSRVIDFVQEGAYAARGALIISKDNDAIASHVMLAMNRG
FT                   VTVLEGRGGFSKKDQDVLYIVVAKNEIIQLKNIVQAIDPHAFVSVSVVHDVMGEGFTLD
FT                   ENKNPIY"
FT   gene            661342..661677
FT                   /locus_tag="LMHCC_0649"
FT   CDS_pept        661342..661677
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0649"
FT                   /product="MazG nucleotide pyrophosphohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0649"
FT                   /db_xref="EnsemblGenomes-Tr:ACK39004"
FT                   /protein_id="ACK39004.1"
FT                   /translation="MAKTMAEIQKEVDDFIGGFEEGYFSPLAMMARITEETGELAREIN
FT                   HYYGEKPKKTSEPTKTVAEELGDCLFVLTCMANSLDIDMEKAHDTVMAKFKERDKDRWT
FT                   KKEEKAK"
FT   gene            661674..662465
FT                   /gene="dapB"
FT                   /locus_tag="LMHCC_0650"
FT   CDS_pept        661674..662465
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dapB"
FT                   /locus_tag="LMHCC_0650"
FT                   /product="dihydrodipicolinate reductase"
FT                   /EC_number="1.17.1.8"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0650"
FT                   /db_xref="EnsemblGenomes-Tr:ACK39005"
FT                   /db_xref="GOA:B8DC19"
FT                   /db_xref="InterPro:IPR000846"
FT                   /db_xref="InterPro:IPR022663"
FT                   /db_xref="InterPro:IPR022664"
FT                   /db_xref="InterPro:IPR023940"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8DC19"
FT                   /protein_id="ACK39005.1"
FT                   /translation="MRVAVSGFKGRMGHEVVKTVLREADLELVAVLDHEPKEKNINEIV
FT                   EFSSLDVPVFGNLSEMLEEIKPDCVVDFTTPKVGYSNTKTILEHGVRAVVGTTGFTPEQ
FT                   ISELRSIAESKKIGALIAPNFAVGAVLMMQFAQKAAKYFPNVEIIELHHDNKLDAPSGT
FT                   AVKTAEMMAETREFVKQGAADEVELIEGARGSEYEGMRIHSVRLPGLVAHQEVIFGAEG
FT                   QGLTIRHDSYDRISFMSGVALSVRKTKELETLIYGLENILD"
FT   gene            662481..662885
FT                   /gene="mgsA"
FT                   /locus_tag="LMHCC_0651"
FT   CDS_pept        662481..662885
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mgsA"
FT                   /locus_tag="LMHCC_0651"
FT                   /product="methylglyoxal synthase"
FT                   /EC_number="4.2.3.3"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0651"
FT                   /db_xref="EnsemblGenomes-Tr:ACK39006"
FT                   /db_xref="GOA:B8DC20"
FT                   /db_xref="InterPro:IPR004363"
FT                   /db_xref="InterPro:IPR011607"
FT                   /db_xref="InterPro:IPR018148"
FT                   /db_xref="InterPro:IPR036914"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8DC20"
FT                   /protein_id="ACK39006.1"
FT                   /translation="MHIALIAHDEKKDLMVGFATAYKHLLEPHQLYATGTTGLRIIEAT
FT                   GLTVHRFKSGPLGGDQQIGARISENKMDLVIFLRDPLTAQPHEPDVTALIRLCDVYEIP
FT                   LATNIGTAEILIRGLGAGFLDWRDLRRNDE"
FT   gene            662900..664081
FT                   /locus_tag="LMHCC_0652"
FT   CDS_pept        662900..664081
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0652"
FT                   /product="cca-adding enzyme (trnanucleotidyltransferase)
FT                   (trna adenylyl-/cytidylyl-transferase)
FT                   (trnacca-pyrophosphorylase) (trna-nt)"
FT                   /EC_number="2.7.7.72"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0652"
FT                   /db_xref="EnsemblGenomes-Tr:ACK39007"
FT                   /db_xref="GOA:B8DC21"
FT                   /db_xref="InterPro:IPR002646"
FT                   /db_xref="InterPro:IPR023068"
FT                   /db_xref="InterPro:IPR032810"
FT                   /db_xref="InterPro:IPR032828"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8DC21"
FT                   /protein_id="ACK39007.1"
FT                   /translation="MNDVFLKALPVLQKLTTAGFEAYFVGGSVRDYLLNRTISDVDIAT
FT                   SAFPEEVKEIFQTSYDTGIAHGTVTVRENNEFYEVTTFRTEGTYEDFRRPSEVTFIRSL
FT                   EEDLKRRDFTMNAIAMDEHFALHDPFSGQLAIQNKEIKAVGKASERFHEDALRMMRAVR
FT                   FLSQLDFELDKETEKALESQIELLQHTSVERMTVEWIKMMKGKAAKRAIELLLKVKMET
FT                   YLPGLKDEKPALSEFASWDWEKRTTEESIWLGLVVAVKPNNVNAFLKAWKLPNKTIQLV
FT                   NKAYQDALKMKETWLTDELYHAGKAVFSLVNELNVIRGQENNQHKLSQAYEALPIHSKK
FT                   DLAITGADLLKWSGESAGPWVKETLDKVECGVLSNEINNEKIQIKRWLGYHEE"
FT   gene            664071..665048
FT                   /locus_tag="LMHCC_0653"
FT   CDS_pept        664071..665048
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0653"
FT                   /product="biotin-(acetyl-CoA-carboxylase) ligase"
FT                   /EC_number="6.3.4.15"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0653"
FT                   /db_xref="EnsemblGenomes-Tr:ACK39008"
FT                   /protein_id="ACK39008.1"
FT                   /translation="MKNNREKLLALFTESDGTYLSGQEIADSLGCSRTAVWKQMEALRK
FT                   EGFEIEAVRNRGYRLSATAEQYTKDALLLGLETKFIGQHLEIHESVSSTQIIAHQQIES
FT                   SPEGTVIVADEQTAGKGRLLRPWSSKKGEGIWMSVILKPQIPIQKVPQFTFIASLAITE
FT                   AIENITKLEPKIKWPNDIYIGKRKICGVLTEMQAEAETIHAVIIGMGINVNQQEFPEEI
FT                   KDKASSLKLELGESISRKALLQEILTSLEKYYELFLDKGFAPIKLLWETKAIPFGEKLT
FT                   ASTTKGKIHGQVKGISDEGVLLLQDALGEVHSIYSADILLDNEK"
FT   gene            665196..665669
FT                   /locus_tag="LMHCC_0654"
FT   CDS_pept        665196..665669
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0654"
FT                   /product="bacteriocin transport accessory protein,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0654"
FT                   /db_xref="EnsemblGenomes-Tr:ACK39009"
FT                   /protein_id="ACK39009.1"
FT                   /translation="MKKILLLLTLITVILTLGACGDNKKETEEKANQTEKESASFLTTI
FT                   STKDFKQKMADKTTGFVYVGRPTCEDCQAFQPILKKELKKRQPDQKMAYYNTDKASEKS
FT                   RDDMIALLEKMDIDSVPTMVYLKDGKVAATYAATDEPAKLTNWMNKVSGEVSE"
FT   gene            665836..666669
FT                   /gene="panB"
FT                   /locus_tag="LMHCC_0655"
FT   CDS_pept        665836..666669
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="panB"
FT                   /locus_tag="LMHCC_0655"
FT                   /product="3-methyl-2-oxobutanoate hydroxymethyltransferase"
FT                   /EC_number="2.1.2.11"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0655"
FT                   /db_xref="EnsemblGenomes-Tr:ACK39010"
FT                   /db_xref="GOA:B8DC24"
FT                   /db_xref="InterPro:IPR003700"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8DC24"
FT                   /protein_id="ACK39010.1"
FT                   /translation="MKKPVDFFAMKENGEKITMITAYDYPSAKNVEQAEADMILVGDSL
FT                   GMVVLGYDSTVPVTMDDMIHHTKAVKRGAPDTFVVTDMPFMTYHGSVDETIQNARKIIQ
FT                   ESGAHAVKLEGAGEVVNKIARLTEAGAPVVAHLGLTPQSVGLTGSYKVRAKSAQEAQEL
FT                   MDNALAVEAAGAIAIVLEAIPRQLAEKVSKALSIPTIGIGAGVETDGQVLVYHDIIGYG
FT                   ISRRAKFVKAYAEIDETIEPALASYVKEVKAATFPEVKHSFTMAEEDLKGLYGRE"
FT   gene            666673..667530
FT                   /gene="panC"
FT                   /locus_tag="LMHCC_0656"
FT   CDS_pept        666673..667530
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="panC"
FT                   /locus_tag="LMHCC_0656"
FT                   /product="pantoate--beta-alanine ligase"
FT                   /EC_number="6.3.2.1"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0656"
FT                   /db_xref="EnsemblGenomes-Tr:ACK39011"
FT                   /db_xref="GOA:B8DC25"
FT                   /db_xref="InterPro:IPR003721"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR042176"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8DC25"
FT                   /protein_id="ACK39011.1"
FT                   /translation="MLIIRNKQDLKEAILKQKQANKTIGYVPTMGFLHEGHMTLVSHAR
FT                   KETDFVVMSVFVNPTQFGPNEDFDAYPRDEAHDAKLAEEGGVDILFVPTVEEIYPTELA
FT                   TKLHVTKRVSVLDGADREGHFDGVVTVLTKLFHLVNPDNAYFGQKDAQQVAVVSGLVED
FT                   YFFPINLRIIATVREADGLAKSSRNVYLTEKERKEAPVIHEALLLGRELIESGETNEAK
FT                   IVQVMTDKINEQPSHENIAYLALYSYPEFTPVTDWTKGIIIAAAVKYSKARLIDNELIN
FT                   VKRR"
FT   gene            667534..667917
FT                   /gene="panD"
FT                   /locus_tag="LMHCC_0657"
FT   CDS_pept        667534..667917
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="panD"
FT                   /locus_tag="LMHCC_0657"
FT                   /product="aspartate 1-decarboxylase"
FT                   /EC_number="4.1.1.11"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0657"
FT                   /db_xref="EnsemblGenomes-Tr:ACK39012"
FT                   /db_xref="GOA:B8DC26"
FT                   /db_xref="InterPro:IPR003190"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8DC26"
FT                   /protein_id="ACK39012.1"
FT                   /translation="MFRTMMNGKIHRATVTEANLNYVGSITIDSAILEAVDMLPNEKVQ
FT                   IVNNNNGARIETYIIPGEPGSGVICLNGAAARHVQVGDVVIIMSYGMFTAEEAKTHEPK
FT                   IVVLDEKNHIEMILPEEKAHTTL"
FT   gene            668014..670800
FT                   /locus_tag="LMHCC_0658"
FT   CDS_pept        668014..670800
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0658"
FT                   /product="DnaQ family exonuclease/DinG family helicase,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0658"
FT                   /db_xref="EnsemblGenomes-Tr:ACK39013"
FT                   /protein_id="ACK39013.1"
FT                   /translation="MKQKRYIVVDLETTGNQASREDRIIQFAACFVESGKRLETYTTFL
FT                   NPEKPIPAFIQELTGISPKDVKNAPLFEDVAPIIAGLLEDTIFVAHNVSFDWTFLEREM
FT                   TRAGISLGKMKKLDTVELARIMYPGIDSYKLQDLSDEFNLGHDKPHRADSDAEVTADLL
FT                   LLLLEKLENLPLPVIRQMTTISGSLKSYLPELLFEIEMRKERENKLLDPAFVEHRGLVI
FT                   RKKEVEKPTYSRADLLEFPETDEAKMALFKKAGAPLYARSGQFEMMNLVFQAMKSGKHA
FT                   LIEAGTGIGKSLGYFLPAIYQAKQAELPVVISTYTNLLQAQLFEKDVPLLTKLTGFKVK
FT                   ASLLKGRDHYLNLFKFEQLLQEVDTQYDVVVTKLKLLVWLTETTTGDIDEVNLSSGGEL
FT                   FWNRMKHTGWFLSEKHDPWLAHDFYKFNIKQAKNADLVIVNHALLLNDHFSGRETLPKY
FT                   AFAVIDEAHHFADSARMQGSFVLSYRKIKYFLNQLGSLEKYSLLTRLAMAFPEADSLYD
FT                   LDIAAMKLSDAVEEFFGLLKMQLNFARKNLQEVVLVENSEKDAWNDQVYYAAEKVLYLL
FT                   KESEKNMETLLEQGKREENELGEAESAFLEEMYAFLLDWQNMVKQLEQMLHKKSPILTI
FT                   YLQADKNHSISSIRLKAVLMEVEPTLGKEFFAKKESVIMTSATLTVKGKFDYLRKSLGL
FT                   EEEQIMEKRIPSPFDYKENARVMIPDDMPPIKDTPIERYTSELAKYIRHIAVKTNGRML
FT                   VLFTASDMLQKTYYHMKNEKSLEEYVLLAQGVSAGSAARLTKQFQMFDKAILLGTTSFW
FT                   EGIDIPGEDLSCLVIVRLPFAPMDDPYTKAQISLRKERGENAFQTYSLPEAVLRFKQGF
FT                   GRLIRRESDRGIVFVFDNRVDTTKFGKAFLESIPSAPILKGKQADLLEEVSEFFKEG"
FT   gene            670845..671429
FT                   /locus_tag="LMHCC_0659"
FT   CDS_pept        670845..671429
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0659"
FT                   /product="peptidase propeptide and ypeb domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0659"
FT                   /db_xref="EnsemblGenomes-Tr:ACK39014"
FT                   /protein_id="ACK39014.1"
FT                   /translation="MYLCENENAYRRSNSGNLEIEMSEITLRNRKPKRKIGKWIAIILG
FT                   IIIVFVVAAFLYIRYAEKPVTNAETEALDRISGQVDLKTTDQFYLYNGPKEVYYVLTGK
FT                   NSKNQNIIVWVPKKKSDKVYVKFASDGITKQQARDKVTKEKNPKKILHVNLGMEKETPI
FT                   WEVAYLDKNDKLNYFDINFETGEWYREIENL"
FT   gene            671452..672633
FT                   /locus_tag="LMHCC_0660"
FT   CDS_pept        671452..672633
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0660"
FT                   /product="aspartate aminotransferase (transaminase a)
FT                   (aspat)"
FT                   /EC_number="2.6.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0660"
FT                   /db_xref="EnsemblGenomes-Tr:ACK39015"
FT                   /protein_id="ACK39015.1"
FT                   /translation="MDLPLSKRVKGVAPSPTLAITAKAKQMKQEGIDVIGLGAGEPDFN
FT                   TPQNIIDAAIESMNKGFTKYTPSSGIIELKQAIVDKLQKDQFLNYETNQIFVGTGAKHV
FT                   LYSAFQTILDPGDEVIIPVPYWVTYPEQVKLAGGIPVFVETGFDADFKISAANFEKAIT
FT                   KKTKAIVLNSPNNPSGMCYTKEELIAIGEVAEKHQIYILSDEIYEKLYYGNKADLVSIA
FT                   SLSDRLYDLTIVINGVSKAYSMTGWRIGYAAANKEIIAGMSKLADHLTSNPTANAQYAA
FT                   LEAYVGSQEVPEKMYQAFEERMERFYPELSSIPGFKPKKPDGAFYFFIEVKEAAHKKGF
FT                   QDVDAFVAALLEEAKVAVIPGSGFGMPDYIRLSYATNPDLFQEAINRIKSFMK"
FT   gene            672647..673939
FT                   /gene="asnS"
FT                   /locus_tag="LMHCC_0661"
FT   CDS_pept        672647..673939
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="asnS"
FT                   /locus_tag="LMHCC_0661"
FT                   /product="asparaginyl-tRNA synthetase"
FT                   /EC_number="6.1.1.22"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0661"
FT                   /db_xref="EnsemblGenomes-Tr:ACK39016"
FT                   /protein_id="ACK39016.1"
FT                   /translation="MKITINQASEFVGKEVTIGAWLANKRSSGKIAFLQLRDGTGFMQG
FT                   VVVKAEVGDDIFATAKALTQETSLFVTGTINEDTRSPFGYEMAVSGVEVISESHDYPIT
FT                   PKEHGTEFLMDHRHLWLRSNRQHAIMKIRNEIIRASYEFFNKEGFLKIDPPILTGSAPE
FT                   GTTELFHTKYFEEDAFLSQSGQLYMEAAAMAFGKVFSFGPTFRAEKSKTRRHLIEFWMI
FT                   EPEMAFYKLEDSLQVQENYVAFLVKAVLDNCRLELDRLGRDVSHLEKMVAPFPRITYTE
FT                   AIERLHELGFDDIVWGDDFGAPHETAIADSFEKPVFITHYPKAIKPFYMPEDPENDQVV
FT                   LCADMIAPEGYGEIIGGSERIHDLETLQARMEDFDLDQEAYSWYLDLARYGSVPHSGFG
FT                   LGLERTVAWISGTEHVRETIPFPRLLNRLYP"
FT   gene            674085..674804
FT                   /locus_tag="LMHCC_0662"
FT   CDS_pept        674085..674804
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0662"
FT                   /product="DNA replication protein DnaD"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0662"
FT                   /db_xref="EnsemblGenomes-Tr:ACK39017"
FT                   /protein_id="ACK39017.1"
FT                   /translation="MNPKILEKWMAEGQVTLPQVLVKNYAIIGLNEIELVLLLQIQSFA
FT                   AEAEFFPSMEMLTNRTTLPLEETIKTMDSLLKKGVIAIEQSQDNSRMISEQYNLAPLWG
FT                   KLVALYENKEADSKQEKELTKQTNLYSLFEAEFGRPLSPMEAEMLSAWVEQDRTSPDLI
FT                   KEALKEAVISQKLNFRYIDRILLNWSKQGVKTIEDAKRVAEEFHQNGRTSQPINQTEVK
FT                   KSAGSIPLYDWLEKRKG"
FT   gene            674815..675474
FT                   /gene="nth"
FT                   /locus_tag="LMHCC_0663"
FT   CDS_pept        674815..675474
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nth"
FT                   /locus_tag="LMHCC_0663"
FT                   /product="endonuclease III"
FT                   /EC_number="4.2.99.18"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0663"
FT                   /db_xref="EnsemblGenomes-Tr:ACK39018"
FT                   /protein_id="ACK39018.1"
FT                   /translation="MLSNKQTVLCIEEMAKMFPAAHCELVHKNTFELLVAVVLSAQCTD
FT                   VLVNRVTASLFEKYHSPEDYLAVPLEELMDDIRSIGLYRNKAKNIQGLSEKILTEFNGE
FT                   VPRTHAELESLPGVGRKTANVVLSVGFDIPAIAVDTHVERISKRLGICRWKDSVVEVEE
FT                   TLKRKLPKELWSDAHHYMIFFGRYHCKARNPECPTCPLLYLCREGKKQAKVRGFDG"
FT   gene            675467..675955
FT                   /locus_tag="LMHCC_0664"
FT   CDS_pept        675467..675955
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0664"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0664"
FT                   /db_xref="EnsemblGenomes-Tr:ACK39019"
FT                   /protein_id="ACK39019.1"
FT                   /translation="MAEFKYAVELTHPDFPAPDVILEEYDPESIYVSGLPFWQEQQFFT
FT                   KGGGVIPWKNETERACRKLAKHMTNLAESMEADLKVHKKPSPVTVRDALGIFLSILFWS
FT                   NHRPVQLDNLMDQIKTLETKPLNLDERLEYVLKRGNTYLGFRQLNELMLEQRKLIAKR"
FT   gene            complement(676001..678481)
FT                   /locus_tag="LMHCC_0665"
FT   CDS_pept        complement(676001..678481)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0665"
FT                   /product="penicillin-binding protein 1A/1B (PBP1)"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0665"
FT                   /db_xref="EnsemblGenomes-Tr:ACK39020"
FT                   /protein_id="ACK39020.1"
FT                   /translation="MADKPQTRSQYRNKQSSGSKKKPQKRGKRVVANIFKTIFFVGLFF
FT                   AFFGIAAGATVFYDYAKDAPKLTDSKLRDPLSSKLLDKDGKVFAEVGTERREYIEYKDI
FT                   PETLKNAILTTEDARFYEHDGIDPIRLGGAVVANLTDGFGAEGASTLSQQIIKMSYLDY
FT                   TNKTLARKAQEAWLALQLEEKYSKNDILEIYVNKVYMSDRVHGMQTAAEHYFGKNVKDL
FT                   TLAETALLAGMPQSPNNYNPYEHPEAAKKRRDQVLTNMYTHDKITKEEMTAAQKSPITT
FT                   GLRSKKDREDKIYKYDSYVTQVLSEIPKEYDVYRDGLTIHTALDRDAQEYTEKMLNTNE
FT                   IVNFTDDEMQAGIVLQDTKTGRVQAIGGGRNQKVTRGYNYATQVKRSVGSTMKPIADYG
FT                   PAFEYLDWSTAHILEDEPYTYTGGTPINNWDFGYKGPISVRQALYQSRNIPALKTLQAV
FT                   GLDKSEQFVNKLGITYDKGQNVESNAIGANSSNPMQMAGAYAAFGNKGIYNKPHTVTKI
FT                   VLSDGQTEIDTEPQSTVAMKESTAYMVSDVLKDVLSIGTGTSAAVPGVPAAGKTGTTNI
FT                   PPEFTSKYYYPSGAARDSWFAGYTTNYSIAVWTGYDDKKKYVSASEQKIAQRMFSKLMA
FT                   HASAGKTTADFKMPSNVVSVPILKGSNPIARAAAGTASDKVSYELFLSGTAPTKTASTP
FT                   EDEKKKAEEEAKKKAEEEKKKTEEEKKKEEEAKKKAEEEAKKKAEEEAKNLTAPAGLRA
FT                   SYNTGSKQINVSWSAVDGATYEVTVNGSTTTVSSTSVSVSGGNPGDTVSINVVAVKDGK
FT                   RSPASSTTVKIPDS"
FT   gene            complement(678513..679118)
FT                   /gene="recU"
FT                   /locus_tag="LMHCC_0666"
FT   CDS_pept        complement(678513..679118)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recU"
FT                   /locus_tag="LMHCC_0666"
FT                   /product="recombination protein U"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0666"
FT                   /db_xref="EnsemblGenomes-Tr:ACK39021"
FT                   /db_xref="GOA:B8DDL2"
FT                   /db_xref="InterPro:IPR004612"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011856"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8DDL2"
FT                   /protein_id="ACK39021.1"
FT                   /translation="MAIGYPNGKKYAASQEELPQQKRKAPVTYGKRGMSLEDDLNDTIA
FT                   YYLTHEIAVIHKKPTPVQIVSVDYPKRSSAKIKEAYFKTPSTTDYNGVYKGKYVDFEAK
FT                   ETQNTTSFPLSNFHDHQMTHMANVLKQDGIVFVIIAFQKLGETHFIPFEKFYPFWERMQ
FT                   SGGRKSVTIAEIQDVSDQIPYGLNPRLDFLQSIDKLYF"
FT   gene            679365..679730
FT                   /locus_tag="LMHCC_0667"
FT   CDS_pept        679365..679730
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0667"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0667"
FT                   /db_xref="EnsemblGenomes-Tr:ACK39022"
FT                   /protein_id="ACK39022.1"
FT                   /translation="MELLNRTEKLLLQNEKNWELYLSNREEAKPFDFYKDMKPFVDEAK
FT                   NSADAFLELAIPWVNKERPPYLGELQLRQACDNVQMTAVSAFNGKSFYKHFLDHYQSTK
FT                   YTLTRVRDFLKRKEEMM"
FT   gene            679727..680272
FT                   /locus_tag="LMHCC_0668"
FT   CDS_pept        679727..680272
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0668"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0668"
FT                   /db_xref="EnsemblGenomes-Tr:ACK39023"
FT                   /db_xref="InterPro:IPR010697"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8DDL4"
FT                   /protein_id="ACK39023.1"
FT                   /translation="MKSIAVTGYKNFELGIFKKDADEAVYIKETIKRHLLPLVEDGLEW
FT                   VIISGQLGIELWAGDVVAELKEEYPIKLAILEPFEKQSANWNEANQLWANEVLEKADYH
FT                   AFITKRPYESPAQFAARDGFIIDNTDGALLVYDLEKEGSPKFFYDRALQAKEQANYYLE
FT                   CIDFYALQEVVDDMNQTF"
FT   gene            680404..680745
FT                   /locus_tag="LMHCC_0669"
FT   CDS_pept        680404..680745
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0669"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0669"
FT                   /db_xref="EnsemblGenomes-Tr:ACK39024"
FT                   /db_xref="GOA:B8DDL5"
FT                   /db_xref="InterPro:IPR007793"
FT                   /db_xref="InterPro:IPR011229"
FT                   /db_xref="InterPro:IPR019933"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8DDL5"
FT                   /protein_id="ACK39024.1"
FT                   /translation="MTSEQFEYHLTGKEILEKEFKTGLRGYSPEDVDEFLDMVIKDYST
FT                   FTQEIEALQAENIRLVQELDNAPLRTSTQPAPTFQAAAQPAGTTNFDILKRLSNLEKHV
FT                   FGNKLDDNE"
FT   gene            681326..682474
FT                   /locus_tag="LMHCC_0670"
FT   CDS_pept        681326..682474
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0670"
FT                   /product="methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0670"
FT                   /db_xref="EnsemblGenomes-Tr:ACK39025"
FT                   /protein_id="ACK39025.1"
FT                   /translation="MKTFQLVATAASGLEAIVGKEVARLGYDPKVENGKVYFEGDLSAI
FT                   ARANLWLRVADRVKIVVGVFKATTFDELFEKTKALPWEDYLPLDAQFPVAGKSVKSTLY
FT                   SVPDCQAIVKKAIVNRVSEKYRRSGRLMETGALFKLEVSILKDEVTLTIDTSGAGLHKR
FT                   GYRLAQGSAPIKETMAAALVLLTSWHPDRPFYDPVCGSGTIPIEAALIGQNIAPGFNRE
FT                   FVSETWDWMPKQVWADARQEAEDLANYDQPLNIIGGDIDARLIEIAKQNAVEAGLGDLI
FT                   TFRQLQVADFQTEDEYGVVVANPPYGERLEDEEAVRQLYREMGIVYKRMPTWSVYVLTS
FT                   YELFEEVYGKKATKKRKLYNGYLRTDLYQYWGPRKPRPKKED"
FT   gene            682494..684002
FT                   /locus_tag="LMHCC_0671"
FT   CDS_pept        682494..684002
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0671"
FT                   /product="thermostable carboxypeptidase 1 (Carboxypeptidase
FT                   Taq)"
FT                   /EC_number="3.4.17.19"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0671"
FT                   /db_xref="EnsemblGenomes-Tr:ACK39026"
FT                   /protein_id="ACK39026.1"
FT                   /translation="MVETLEEEFLAYIKKMEALEEALALVYWDLRTGTPAKGMEGRSDV
FT                   IGVLSEEIFNMQTSEEMAAFIAGLNQDKENLSEITRKTLEESQKTYDLNKKIPSKEYAE
FT                   YTKLVAQAETAWTTAREQNDFAAFEPFLTKILEMKRKFVEYWGYEENKYDTLLDQYEPG
FT                   VTVSVLDSVFEKVRDGIMAIREKIENEGVKPDATILNTKISEAKQKEFSIRILNKMGFD
FT                   FEAGRLDETVHPFATGLNTGDVRITTRYNENDFKMAVFGTIHEGGHAIYEQNFDAALVG
FT                   TPLANGASMGIHESQSLFYEIIIGSSLAFWKSNYADFQAITKPAFDQVKLEDFYRAVNI
FT                   SESSLIRIEADTLTYPLHIMIRYELEKALINGELEVKDLPKAWGDKYEEYLGIRPDNDT
FT                   NGVLQDIHWAGGDFGYFPSYALGLMYAAQFFNQMQKEIPNIDAIIASDDYSELKIWLTE
FT                   HVHKFGKTKKPLEILTDTTGEGLNPTYLLDLLEKRYAYVYQFNK"
FT   gene            684128..684808
FT                   /gene="xpt"
FT                   /locus_tag="LMHCC_0672"
FT   CDS_pept        684128..684808
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="xpt"
FT                   /locus_tag="LMHCC_0672"
FT                   /product="xanthine phosphoribosyltransferase"
FT                   /EC_number="2.4.2.22"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0672"
FT                   /db_xref="EnsemblGenomes-Tr:ACK39027"
FT                   /protein_id="ACK39027.1"
FT                   /translation="MSSLYKEVTPKIGGFYTASLFLEKQFFYFERRIVLKLLEEFIQEK
FT                   GTVLPGNVLKVDAFLNHQIDPVLMQAMGNEFAKRFQDLGITKIVTIESSGIAPAVFAGL
FT                   ALSVPVVFARKKKSVTLTDNLFTSTVYSYTKKESNDISVSKQFLTADDTILVIDDFLAN
FT                   GQAALGLLEIAEHAGAKVAGIGIVIEKSFQQGRELLNKTGIPVYSLARIASLENEEILF
FT                   LEEE"
FT   gene            684815..686122
FT                   /locus_tag="LMHCC_0673"
FT   CDS_pept        684815..686122
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0673"
FT                   /product="xanthine permease"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0673"
FT                   /db_xref="EnsemblGenomes-Tr:ACK39028"
FT                   /protein_id="ACK39028.1"
FT                   /translation="MLGKGKIAALGFQHVLAMYAGAVIVPLLIGGALGFNGEEMTYLVS
FT                   IDIFMCGIATLLQLTVNRFFGIGLPVVLGCAVQAIAPIILIGQDMGIGAIYGSIIVSGL
FT                   FVLLIAPFFSKVVRFFPPVVTGSVVTVIGLTLIPVAINNLAGGEGAKDFGSMYNLGLGF
FT                   GTLLLIILVYRFGQGFSKAIAVLIGLVGGSLFAALYKGISLGPVSEASWFHMPKPFYFG
FT                   TPTFEWPAIITMILIALVSMVESTGVYFALSDITERKLTQKDLTRGYRAEGLAIMLGGV
FT                   FNTFPYTAYSQNVGLVQLSGIKTRKVIYAAAGFLIVLGLIPKIGAVTTIIPTPVLGGAM
FT                   VAMFGMVVAQGIKMLGKVNFTSQENLLIIACAVGVGLGVTVVPDLFNAFPSFVRLFTSN
FT                   GIVAGSVTAITLNIIFNMIPHRKDKKVADPEPQHAK"
FT   gene            686314..687372
FT                   /locus_tag="LMHCC_0674"
FT   CDS_pept        686314..687372
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0674"
FT                   /product="chitinase C1"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0674"
FT                   /db_xref="EnsemblGenomes-Tr:ACK39029"
FT                   /protein_id="ACK39029.1"
FT                   /translation="MNGKQVMVGGLSLLLVGAGLGAFGSQAQAATDDASVMPDISNKQV
FT                   LVGYWHSWKSSGNDGYQQGTSADIALKDTPKAYNVVDVSFMKGDGVNRIPTFKPVGIND
FT                   SDFRAQVGALNKEGRAVLLALGGADGHVELKAGDEEAFANEIIRQVETYGFDGLDIDLE
FT                   QSAITAGDNKTVIPAALKIVKDHYKAEGKNFLITMAPEFPYLKPGSAYESYLTSLANYY
FT                   DYIAPQLYNQGGDGVWVDETNQWIAQNNDTLKESFLYYMADSFINGTRGYLKIPANKFV
FT                   FGLPANVDAAATGYVKDPQIVKNVFTRLQAKGTPVKGIMTWSVNWDAGKNKAGVPYNNG
FT                   FSNAYGPIVGTK"
FT   gene            687495..687764
FT                   /locus_tag="LMHCC_0675"
FT   CDS_pept        687495..687764
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0675"
FT                   /product="ribosomal protein S14"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0675"
FT                   /db_xref="EnsemblGenomes-Tr:ACK39030"
FT                   /protein_id="ACK39030.1"
FT                   /translation="MAKKSKVAKHERQQALVEQYAELRRTLKAEGRYDELRKLPRDSSP
FT                   SRLHNRCELTGRPHGYMRKFGMSRIRFRELAHQGQLPGVTKASW"
FT   gene            687842..688714
FT                   /locus_tag="LMHCC_0676"
FT   CDS_pept        687842..688714
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0676"
FT                   /product="5-3 exonuclease family protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0676"
FT                   /db_xref="EnsemblGenomes-Tr:ACK39031"
FT                   /protein_id="ACK39031.1"
FT                   /translation="MNENRENLLVVDGMALLFRAFYATAVSKQFMFNQHGIPTNGVQGF
FT                   MRHMFAAIRQSNPTHTLICWDMGSQTFRNELYDGYKAGRTAPPEEMIPQFDLAKEVAAG
FT                   FGFVNLGVPGFEADDCIGTITVQASNTIATTVLSGDKDLLQLIAPTNDVWIMQKGYGNY
FT                   KRYDEATFFEEMGISPRQFIDVKALMGDTSDGYPGVRGIGEKTAIKLIQEFESIEGVLN
FT                   NLDKLKPAQQTKIQEDLAMLELSQKLARIHTEVPLEIDLPSLKYDGFREDAFAVVEKYG
FT                   LKTLTRDIE"
FT   gene            complement(688733..689134)
FT                   /gene="rnhA"
FT                   /locus_tag="LMHCC_0677"
FT   CDS_pept        complement(688733..689134)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rnhA"
FT                   /locus_tag="LMHCC_0677"
FT                   /product="ribonuclease HI"
FT                   /EC_number="3.1.26.4"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0677"
FT                   /db_xref="EnsemblGenomes-Tr:ACK39032"
FT                   /protein_id="ACK39032.1"
FT                   /translation="MEVFVDGASAGNPGPSGAGIVLKAEGIYEQFAIPLAVMTNHEAEF
FT                   IAIKLGLEEAIKKQATLIRLYSDSKVAIEAIHKRHAKNPLFKPHLEAILEMADSFELFF
FT                   AEWRNVSQNKQADHLARQAIKKQKQPGVK"
FT   gene            complement(689257..689457)
FT                   /locus_tag="LMHCC_0678"
FT   CDS_pept        complement(689257..689457)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0678"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0678"
FT                   /db_xref="EnsemblGenomes-Tr:ACK39033"
FT                   /protein_id="ACK39033.1"
FT                   /translation="MQNGKVKWFNNEKGYGFIESDGGEDIFVHFTAIQGDGYKSLEEGQ
FT                   AVTFEVVEGNRGAQAANVEKA"
FT   gene            689821..690249
FT                   /locus_tag="LMHCC_0679"
FT   CDS_pept        689821..690249
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0679"
FT                   /product="transcriptional regulator MntR (Manganese
FT                   transport regulator)"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0679"
FT                   /db_xref="EnsemblGenomes-Tr:ACK39034"
FT                   /db_xref="GOA:B8DDM5"
FT                   /db_xref="InterPro:IPR001367"
FT                   /db_xref="InterPro:IPR022687"
FT                   /db_xref="InterPro:IPR022689"
FT                   /db_xref="InterPro:IPR022897"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR036421"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8DDM5"
FT                   /protein_id="ACK39034.1"
FT                   /translation="MPTPSMEDYIEKIYSLIETKGYARVSDIADELFVHPSSVTKMVQK
FT                   LDKDEYLIYEKYRGLILTPKGTQMGKRLLERHALLESFLSIIGVDPSHIYHDVEGIEHH
FT                   LSWNSIDRIGDVVQFFENHPDALKTLKAMETTKPETKE"
FT   gene            690406..692088
FT                   /gene="fhs"
FT                   /locus_tag="LMHCC_0680"
FT   CDS_pept        690406..692088
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fhs"
FT                   /locus_tag="LMHCC_0680"
FT                   /product="formate--tetrahydrofolate ligase"
FT                   /EC_number="6.3.4.3"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0680"
FT                   /db_xref="EnsemblGenomes-Tr:ACK39035"
FT                   /db_xref="GOA:B8DDM6"
FT                   /db_xref="InterPro:IPR000559"
FT                   /db_xref="InterPro:IPR020628"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8DDM6"
FT                   /protein_id="ACK39035.1"
FT                   /translation="MSNKVKSDIEIASKAEILPVTTIAEHLGLDADALELYGKYKAKLS
FT                   YDTIHSLKDKETGKLVLVTAINPTPAGEGKSTVTVGLGDALSKKDKKTVIALREPSLGP
FT                   TMGIKGGATGGGYAQVIPMEDINLHFTGDFHAITAANNALSAFIDNHMQQGNDLDIDGR
FT                   RIVWKRVVDLNDRALRKVVVGLGGPIQGVPREDGFDITVASEIMAIICLASDLKDLKKR
FT                   LSEIVIGYNYKKEPITVGEMGYEGALTLLLKDALKPNLVQTLEHTPAIVHGGPFANIAH
FT                   GCNSVSATSTALRLGEYVVTEAGFGADLGAEKFLDIKVPALGKAPDCVVIVATIRALKM
FT                   HGGALKTELSEENVDALAKGFTNLQKHTESIQTFGIPYVVAINKFITDSDAEVAKLEAL
FT                   CEEHGIPFSLTEVWEKGGDGGLELADKVIAAVESGEADYKRIYDDAWSIEEKLEAIVTK
FT                   VYGGIGVELSSKAQKQIVEFKKYGWDRYPICMAKTQYSLSDDPTLLGRPTDFVIHIREF
FT                   IPKLGAGFVVALTGDVMTMPGLPKKPAALNMDVDENGNAQGLF"
FT   gene            692208..694100
FT                   /locus_tag="LMHCC_0681"
FT   CDS_pept        692208..694100
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0681"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0681"
FT                   /db_xref="EnsemblGenomes-Tr:ACK39036"
FT                   /protein_id="ACK39036.1"
FT                   /translation="MKQLKVENLTKTYGEKSLFENISLTITEGERIGLIGVNGTGKSTL
FT                   LQIISGSESGDKGTVTKAKDYTIGYLAQDPEFNEANTVLSAVFDGDTAALRAMRKYEEV
FT                   LLAMSLDAENTKLHDAYTAASQEMDASAAWDMNTEAKTILERLGITDLTAKISELSGGQ
FT                   RKRVGLAQVLIETPDLLILDEPTNHLDFQSIRWLEEYLNRFKGAVLLVTHDRYFLDRVT
FT                   NHMVELDRGSAYRYVGNYEKFMESKAIRMENEVRESEKNKNLYRKELAWMRRGPQGRAT
FT                   KQNARQDRFHDLEKKVKTKTDDSELAIDFVTSRLGKDVFELKNLEKRFDEKQVLQDFSL
FT                   IIQPGERLGITGNNGTGKSTLLNMLAGKLAPDAGEVVTGQTVQIGYYTQQNEEMDPDMR
FT                   MIAYLQEAGEQVTTSGGEVISVSAMLERFLFPPNSHGKKIGSLSGGEKRRLFLLRILME
FT                   RPNVLLLDEPTNDLDTQTLTVLEDYLESFNGTVITVSHDRYFLDKVVNKLLVFRAIGEV
FT                   EIFYGEYSDYLKELVTKAKPAKSMKKMANTSVEKAAPEKKEKVKLTYQEQLEWDGIEDA
FT                   ISELEQTIESLNETLEQTGADFTKAAEISELITAKETELEQMMERWEFLSQYAE"
FT   gene            694113..695057
FT                   /gene="thyA"
FT                   /locus_tag="LMHCC_0682"
FT   CDS_pept        694113..695057
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thyA"
FT                   /locus_tag="LMHCC_0682"
FT                   /product="thymidylate synthase"
FT                   /EC_number="2.1.1.45"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0682"
FT                   /db_xref="EnsemblGenomes-Tr:ACK39037"
FT                   /db_xref="GOA:B8DDM8"
FT                   /db_xref="InterPro:IPR000398"
FT                   /db_xref="InterPro:IPR020940"
FT                   /db_xref="InterPro:IPR023451"
FT                   /db_xref="InterPro:IPR036926"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8DDM8"
FT                   /protein_id="ACK39037.1"
FT                   /translation="MKQYLDLEKYVLENGTQKGDRTGTGTISTFGYQMRFDLQEGFPIM
FT                   TTKRVPFKLVVSELLWFLHGDTNIRYLLQHNNNIWNEWAFERFVKSDDYKGEDMTDFGL
FT                   RAERDPAFKEVYQAEMEKFKTRILEDEAFANKYGELGNIYGKQWREWKTSQGETIDQLA
FT                   DLIEMIKTNPNSRRLIVSAWNPEDIPNMALPPCHSLFQFYVADGKLSCQLYQRSADIFL
FT                   GVPFNIASYALLTHLIAREVGLEVGEFIHTMGDAHLYNNHIEQVKEQLSRTPHKLPKLV
FT                   LSDKPATIFDFDVADISLDGYNPDPAIKAPISV"
FT   gene            695073..695555
FT                   /gene="folA"
FT                   /locus_tag="LMHCC_0683"
FT   CDS_pept        695073..695555
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folA"
FT                   /locus_tag="LMHCC_0683"
FT                   /product="dihydrofolate reductase"
FT                   /EC_number="1.5.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0683"
FT                   /db_xref="EnsemblGenomes-Tr:ACK39038"
FT                   /protein_id="ACK39038.1"
FT                   /translation="MIIFVWAQDRAGNIGKDNKMPWHLPGDLQFFKKTTTGKTLVMGRK
FT                   TYESLGKALPNRKTIVLTRDQGLKLDDAEILHSKEAVLALAETGEPIYIVGGAEIYRLF
FT                   MDVADQLIVTKIDAEFEADTAFPKVDWENFSEVAKEFHEKDEKNKYNYTFYTYERN"
FT   gene            695608..696483
FT                   /locus_tag="LMHCC_0684"
FT   CDS_pept        695608..696483
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0684"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0684"
FT                   /db_xref="EnsemblGenomes-Tr:ACK39039"
FT                   /protein_id="ACK39039.1"
FT                   /translation="MLSKMEINKRALKENMALLACPICGEAFEFREPQSFVCLEGHGFD
FT                   IAKPGYVHLLKQAHKTKYDQALFESRKKVIASGFFEKLIERVTEIIAEKKKEQLVLYDA
FT                   GCGEGSHLARVVSNLQATGVYVQAVGLDIAKEGVKQAARDYPGTSWTVADLANCPNQAE
FT                   TADVILNILSPSNYVEFKRLLKKDGFLLKVVPEANYLRELREFIYVDEKSSYSNESVTS
FT                   RLAEKLSVEHVERVTYKAPIAKELFADFLEMTPLGWHIEADKKSELLGNPPEELTVDLQ
FT                   IIIANRAHLL"
FT   gene            696552..698063
FT                   /locus_tag="LMHCC_0685"
FT   CDS_pept        696552..698063
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0685"
FT                   /product="phosphoglucomutase/phosphomannomutase family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0685"
FT                   /db_xref="EnsemblGenomes-Tr:ACK39040"
FT                   /protein_id="ACK39040.1"
FT                   /translation="MNQSETKALEALQNGSDIRGIAIATEKYQITLTDERVEKIAYGFA
FT                   KWLKEEKKVEGQAKVAIGHDSRLSAERLKAALIKGLTFAGINVVDVGLATTPAMFMATQ
FT                   YEDYDCDAGIMITASHLPFMYNGLKLFTKSGGAEHEDIDYIVAHADKSFIENGLNLGKV
FT                   TKQDLLSTYAADLTDKIRAGITDAADKMKPLQGSHIIVDAGNGAGGFFAEKVLAELGAD
FT                   ISGSQFLDPDGNFPNHIPNPDNEEAMASLKKAVLASGADLGVIFDTDVDRAAIMDKNGE
FT                   SLNRNPLIAVISSIILEEKPGTTIVTDSTTSGHLQTFIEAKGGKQHRFKRGYRNVINEA
FT                   LRLNANGTPSEIAIEVSGHAALKENYFLDDGAYLIAKILMTYATLRKNGQDLPDLIADL
FT                   KEPAESEEIRLSITATDFKAYGKEVLADFLTFVEADPDMELEPVNQEGIRVNTKGALGE
FT                   GWFLLRMSLHEPVMPMNLESDEAGGIRKVKDRLAGFFAKKAELKM"
FT   gene            698201..698824
FT                   /locus_tag="LMHCC_0686"
FT   CDS_pept        698201..698824
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0686"
FT                   /product="DedA family protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0686"
FT                   /db_xref="EnsemblGenomes-Tr:ACK39041"
FT                   /protein_id="ACK39041.1"
FT                   /translation="METWITSIMADFGYIGIFVLIMVENLFPPIPSEIILTFGGFMTTV
FT                   TSLNVVMVIIVATLGSVVGAILLYKVASYFGKERFTKIVLKYGRILRLKESDIERAENF
FT                   FLKYGSWAVFLCRMIPLIRSLISIPAGMTKMKMSKFLILTTAGSLLWNTVLIGLGAMLG
FT                   ESWSEIVVFMDSFSTIIYSIIAILVVVGLGFFFRARFKKTLDEE"
FT   gene            698918..699901
FT                   /locus_tag="LMHCC_0687"
FT   CDS_pept        698918..699901
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0687"
FT                   /product="membrane spanning protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0687"
FT                   /db_xref="EnsemblGenomes-Tr:ACK39042"
FT                   /protein_id="ACK39042.1"
FT                   /translation="MRIGMRTVKTAIAATLAIILAEWLHLEYAVSAGIIAILSVQNTKK
FT                   GSLQLAIQRVYSTVLALSIAAVFFMLIGYNAVSFGLYLLIFIPLAVRLHVADGIVVSSV
FT                   LVSHILLEQSLSFFWFKNELLLMAVGAGIAIILNLYMPKMEDELKRSQQKIEAIMRQIL
FT                   TEMTQGLRNQSEYHDEFGLLNQLKGTLDYAQEKAARNLDNQFFASSHYYSQYVDMRLVQ
FT                   YRILTQMKRHLVAFDHSSEQSMALAEITEKTAQTLDEHNTAEDLVAEITKMVHEFRSSK
FT                   LPETRAEFENRAILFQFMNDLRYLLEMKRDFYAEFGLKEKEMTRGR"
FT   gene            699905..700282
FT                   /locus_tag="LMHCC_0688"
FT   CDS_pept        699905..700282
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0688"
FT                   /product="lactoylglutathione lyase"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0688"
FT                   /db_xref="EnsemblGenomes-Tr:ACK39043"
FT                   /protein_id="ACK39043.1"
FT                   /translation="MIEKIGQVMLYVENQAAVRDFWVEKLDFVVVSEEVVNGEIQWIEI
FT                   APTKGVETTFVLQNKKKVAEMNPEMNLGTPSILLFGNNVAELYEEYKNKGITVGDLVDL
FT                   PMGRVFNFSDNEGNYFAICEK"
FT   gene            complement(700332..702971)
FT                   /gene="ppdK"
FT                   /locus_tag="LMHCC_0689"
FT   CDS_pept        complement(700332..702971)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ppdK"
FT                   /locus_tag="LMHCC_0689"
FT                   /product="pyruvate, phosphate dikinase"
FT                   /EC_number="2.7.9.1"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0689"
FT                   /db_xref="EnsemblGenomes-Tr:ACK39044"
FT                   /protein_id="ACK39044.1"
FT                   /translation="MRKFVYQFSEGSKEMKNLLGGKGANLAEMTNIGLPVPPGFIISTD
FT                   ACNDYTANNKHLSEAIFEEVKIHLAELEKQTGKIFGFAENPLLVSVRSGAPFSMPGMMD
FT                   TVLNLGLNDQAAEGLANLTGDARSAYDSYRRFIQMFGDVVFEIPSYQFEQALSRIKKAN
FT                   DYRLDTELNATDLSELIDAYKLIFSQATGTDFPQDPLEQLRLAIIAVFNSWMNPRAVIY
FT                   RRLHDIDASFGTAVNIQAMVFGNTGETSGTGITFTRNPSTGEKKVFGEFLLNAQGEDVV
FT                   AGIRTPEPIIALQERMPTVYKELLYTCELLENHYLDMQDIEFTIEKGKLYVLQTRSGKR
FT                   TAKAAIQAAVDFVQEGKITREEAIMRVETKQLNQLLHPTFLESALKNGQVIATGLPASP
FT                   GAATGQIFFEAKEAVQAAERGIPVILVRNETSPEDIEGMARSNAILTAHGGMTSHAAVV
FT                   ARGMGKCCIAGCAELIINEHEKTLLLSNGEALHEGDYLSLDGSTGKVYLGEIALTEAQI
FT                   GGHFNELMAWADAEKRLMIRVNADTPSDFKKALLFGAEGIGLCRTEHMFFDEKRIPYVR
FT                   QMILAESLNERESVLAILKEMQKADFSELFRIADGRAVNIRLLDPPLHEFLPKMKQEIE
FT                   QLAGAMNRTVPQITNRINELKEANPMLGHRGCRLAITFPEIYRMQAEAIIESAIIVHNE
FT                   GIDVHPEIMIPLIATKNELSYIKKELQQAVQAIFDREQVVIPYDIGTMIEIPRACVTAD
FT                   EIAEEAAFFSFGTNDLTQLTYGFSRDDATKFLADYYEKDILPKDPFVSIDKNGVGALVE
FT                   MAVTRGRMTSEHLKMGVCGEHGGDPESIQFFHQLGLSYVSCSPYRVPIARLAAAQAALA
FT                   EKHLIPTI"
FT   gene            complement(702990..703802)
FT                   /locus_tag="LMHCC_0690"
FT   CDS_pept        complement(702990..703802)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0690"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0690"
FT                   /db_xref="EnsemblGenomes-Tr:ACK39045"
FT                   /protein_id="ACK39045.1"
FT                   /translation="MENPVIIYVISDAIGETAQHIIRAVTAQFSLNKPADIRRHAFIRD
FT                   ESALLETLEEAKAADGIVVQTLVQAKLAEYATNFCVQNNIPNVDLLHTLTAAVEAKTGL
FT                   KSKQDPGNMRRLDSNYFDRIAAIEFAVKYDDCKDPRGLLDADIVLVGVSRTSKTPLSSF
FT                   LANQNWKVANVPLVPEIPIPAELFQIPAERIIGLTTTPEKLAQIRKVRLKSIGLDEASS
FT                   YSSEKRILEELEYGYDTFKKLGCQVIHVEDKAIEETAALITEIITSYH"
FT   gene            complement(703815..704432)
FT                   /locus_tag="LMHCC_0691"
FT   CDS_pept        complement(703815..704432)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0691"
FT                   /product="CBS domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0691"
FT                   /db_xref="EnsemblGenomes-Tr:ACK39046"
FT                   /protein_id="ACK39046.1"
FT                   /translation="MIPIELSPRQHQIVAYVRANEPATGDSIAAHLKLTRATIRADLSI
FT                   LTMTGILDARPKVGYFYSGLETNPIHFDEIRQLKVADIMTQPFFAKKETSVYDAIVMLF
FT                   MEDIGSLYVVDEDLLVGLVSRKDLLKGALADADTKATPIATIMTRMPNLVTVTKNDTVL
FT                   HAAEQLVFHQIDSLPVLENTKVVGKISKTRITALFVDTIKKV"
FT   gene            complement(704555..705187)
FT                   /locus_tag="LMHCC_0692"
FT   CDS_pept        complement(704555..705187)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0692"
FT                   /product="hemolysin-3 (Hemolysin III) (Hly-III)"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0692"
FT                   /db_xref="EnsemblGenomes-Tr:ACK39047"
FT                   /protein_id="ACK39047.1"
FT                   /translation="MNVTSYNWKEEVANAITHGIGFILSIPALVLLIIFAAGKDNPLYL
FT                   TSFLIYGISLMLLYICSTLLHSFKPCKARTVFNIMDHAAIYVLIAGSYTPFVLITIQGT
FT                   LGWTLFGVIWGLAIAGIIYKIFMTGKLKLLSTSVYLLMGWMVMFAIKPLYAGLTPTGFW
FT                   LLATGGIMFTVGAVFYSIPRVPYMHAIWHLFVIAGTAFMYFCILFYV"
FT   gene            705367..706206
FT                   /locus_tag="LMHCC_0693"
FT   CDS_pept        705367..706206
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0693"
FT                   /product="degV family protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0693"
FT                   /db_xref="EnsemblGenomes-Tr:ACK39048"
FT                   /protein_id="ACK39048.1"
FT                   /translation="MRKIKIITDSTAGLTLEEAAKWNIDVLYLTVEIDGKVYNPKTDIT
FT                   PEEFMVRMAETKELPKSSQPAIGSFVEAYEKYTAEGYEILSIHLTEKLSGTVNAARQAA
FT                   DMVEGNITVVDCDYTARGQAFQVLKAAEMAKSGDYSVEEIHTKINDIRDKTKLYIVVVT
FT                   LDNLIKGGRVGRMQGFLGSLLNIKLIAKLTDGQLEEETKVRSNKKVLQYCLNLIKDEPK
FT                   KIQHLDVVHADGLNLADDFIAESKEITGLTEIPLFFADPVISTHAGTGAFAFMYYTD"
FT   gene            706221..707006
FT                   /locus_tag="LMHCC_0694"
FT   CDS_pept        706221..707006
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0694"
FT                   /product="conserved hypothetical protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0694"
FT                   /db_xref="EnsemblGenomes-Tr:ACK39049"
FT                   /protein_id="ACK39049.1"
FT                   /translation="MTKKKWLWLTGSVLVIALLVGAVFGIKYYKESKEIPINLVAMGDS
FT                   LTEGVGDENKEGGYVGIIPKELEEEPNIPSVKTSNYGVSGNKITQLEKRLKTNKDFQED
FT                   VKNANVITITIGGNDVMAILQSRLLNVNVDDFTKANKEFQQELETLLKDIRSYNKDAAI
FT                   FLMGIYNPYTTYFSDIKQFDEIISDWNEASKKTIQQDSNAYFVPIAKVLEDRNADNKDK
FT                   PNSLLSDDYFHPNHTGYEKMTTELDKAIVKQLNEGNIPK"
FT   gene            707022..707636
FT                   /locus_tag="LMHCC_0695"
FT   CDS_pept        707022..707636
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0695"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0695"
FT                   /db_xref="EnsemblGenomes-Tr:ACK39050"
FT                   /protein_id="ACK39050.1"
FT                   /translation="MQRETRSAPKKPKRNYWKWVCITLISVLLISAGWIYVAVFKLSPQ
FT                   DEPTPSLISNKSMVEFQTSTTKADLNQLISSYIEDFSKDQDIGYKVFVANNVNFTAEAE
FT                   IFGEPVELRLKFSPEVVDNGNVELTLKDMSVGALPLPVSYVMNYVSKNYKFPDWVTIMP
FT                   KKEKIYLSLDKLKLQGDTKVRADTLNLKKDDISFTLLVPVK"
FT   gene            707672..708205
FT                   /gene="msrA"
FT                   /locus_tag="LMHCC_0696"
FT   CDS_pept        707672..708205
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msrA"
FT                   /locus_tag="LMHCC_0696"
FT                   /product="peptide-methionine (S)-S-oxide reductase"
FT                   /EC_number="1.8.4.11"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0696"
FT                   /db_xref="EnsemblGenomes-Tr:ACK39051"
FT                   /db_xref="GOA:B8DDP2"
FT                   /db_xref="InterPro:IPR002569"
FT                   /db_xref="InterPro:IPR036509"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8DDP2"
FT                   /protein_id="ACK39051.1"
FT                   /translation="MTKESLEKATFAGGCFWCMVKPFDTQPGIEKVVSGYTGGHTVNPT
FT                   YKEVCSGTTGHTEAIQITFDPAVFPYEKLVEVYWQQTDPTDAAGQFVDRGDSYRPVIFY
FT                   HNEEQKEIAEKSKAALDASGRFKKPIVTEIAKAETFYPAEEYHQDFYKKEKAHYEGYQV
FT                   ASGRAAFIDANWKG"
FT   gene            708212..708649
FT                   /gene="msrB"
FT                   /locus_tag="LMHCC_0697"
FT   CDS_pept        708212..708649
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msrB"
FT                   /locus_tag="LMHCC_0697"
FT                   /product="methionine-R-sulfoxide reductase"
FT                   /EC_number="1.8.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0697"
FT                   /db_xref="EnsemblGenomes-Tr:ACK39052"
FT                   /db_xref="GOA:B8DDP3"
FT                   /db_xref="InterPro:IPR002579"
FT                   /db_xref="InterPro:IPR011057"
FT                   /db_xref="InterPro:IPR028427"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8DDP3"
FT                   /protein_id="ACK39052.1"
FT                   /translation="MDESKKNERLQQLTDIQYNVTQKAGTERPFQNEFYDNVAKGIYVD
FT                   IVSGKPLFSSNDQYDAGCGWPSFTKPIDEAEVIEHRDLTHGMIRTEVKSADADSHLGHV
FT                   FPDGPQDKGGLRYCINSAALRFIPVDKLEEEGYQAYKKIFE"
FT   gene            708732..709637
FT                   /locus_tag="LMHCC_0698"
FT   CDS_pept        708732..709637
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0698"
FT                   /product="oxidoreductase, Gfo/Idh/MocA family"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0698"
FT                   /db_xref="EnsemblGenomes-Tr:ACK39053"
FT                   /protein_id="ACK39053.1"
FT                   /translation="MLKVAVVGLGGIAQKAYLPVFAEMENIEVHLYTRDAQKLKHLSEK
FT                   YRFDHYHQSIHSMIESGVNAAFVHSSTASHPEVIRTFLAHHIPVYVDKPIADNLSEVEE
FT                   LTRLAEEQNTLLMTGFNRRYAPKYQELKALTDTNMIIMQKNRAAQPGEARTFIYDDFIH
FT                   VIDTVRFLLDAKIEQLHVVPVWQENLLASITVQITAGGKVATAIMNRDSGVNEERLAVM
FT                   TPSAKYEVENVTETHIYEGTTERFERFGDWETTLYKRGFVSIIQAFLTAVRNGEKAPIS
FT                   KEDALETHRLAEEILRKIEN"
FT   gene            709700..709933
FT                   /locus_tag="LMHCC_0699"
FT   CDS_pept        709700..709933
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0699"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0699"
FT                   /db_xref="EnsemblGenomes-Tr:ACK39054"
FT                   /db_xref="InterPro:IPR010673"
FT                   /db_xref="InterPro:IPR023089"
FT                   /db_xref="InterPro:IPR036806"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8DDP5"
FT                   /protein_id="ACK39054.1"
FT                   /translation="MGRSFYHFLMTYRDPKLTDQKTEFANNAYRDHSFPKQTRNYHILC
FT                   DYLEFNAPYLPGMSIFDELWDAYLLDEEKNKH"
FT   gene            709945..710646
FT                   /gene="deoD"
FT                   /locus_tag="LMHCC_0700"
FT   CDS_pept        709945..710646
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="deoD"
FT                   /locus_tag="LMHCC_0700"
FT                   /product="purine nucleoside phosphorylase"
FT                   /EC_number="2.4.2.1"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0700"
FT                   /db_xref="EnsemblGenomes-Tr:ACK39055"
FT                   /db_xref="GOA:B8DDP6"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR004402"
FT                   /db_xref="InterPro:IPR018016"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8DDP6"
FT                   /protein_id="ACK39055.1"
FT                   /translation="MSVHIEAKQGEIAETILLPGDPLRAKYIAETFLEDVVLFNQVRGM
FT                   LGFTGTYKGEKVSVMGTGMGIPSISIYVNELIQSYDVKNLIRVGTMGGIQADVKVRDVV
FT                   IAQAASTDSQINRNTFAGVDFAPVADFSLLKKAYDAGIEKGLSLKVGNVFSADRFYNDQ
FT                   LDKQQLADYGVLGIEMEAAALYTLAQKYGRRALAILTVSDHIFTGEETSAEERQTTFND
FT                   MIVVALEAAIK"
FT   gene            710705..711529
FT                   /locus_tag="LMHCC_0701"
FT   CDS_pept        710705..711529
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0701"
FT                   /product="D-alanyl-D-alanine carboxypeptidase family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0701"
FT                   /db_xref="EnsemblGenomes-Tr:ACK39056"
FT                   /protein_id="ACK39056.1"
FT                   /translation="MSSLLTIALAISISCVHTVEDQYFGGTNADSLAKVEQKSSGNQTL
FT                   AELEKDPLYPYIDKQNKLTKKDGIEYIENEENMLVLANKDYSLQPTYTPPDLVRPNVTF
FT                   SFGNQQVEKAQLRKEAATALEEMFTAANKDGKKLFAVSGYRSYKRQQEVFQAEVNAKGD
FT                   QKAREAVAYPGTSEHQTGLAMDISSESQSYELTEAFGTTPEGKWLQENAHNYGFILRYM
FT                   KGREAITQYQYESWHYRYVGKDAATIIYENNWTLEEFFEHVEALQKKVDAAK"
FT   gene            711655..711948
FT                   /locus_tag="LMHCC_0702"
FT   CDS_pept        711655..711948
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0702"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0702"
FT                   /db_xref="EnsemblGenomes-Tr:ACK39057"
FT                   /protein_id="ACK39057.1"
FT                   /translation="MKHDQPIVPRKEEETKLLQNRLRRIEGQIRGIAQMVEDDRYCTDI
FT                   LVQISAANKALKNVGLQVLEHHTAHCVVDAAKNGEDDVMEDLLKAIRQFSKT"
FT   gene            711963..714176
FT                   /locus_tag="LMHCC_0703"
FT   CDS_pept        711963..714176
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0703"
FT                   /product="copper-translocating P-type ATPase"
FT                   /EC_number="3.6.3.4"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0703"
FT                   /db_xref="EnsemblGenomes-Tr:ACK39058"
FT                   /protein_id="ACK39058.1"
FT                   /translation="MSDKYVRQDLNVFGMTCAACSTRIEKSLNKAEGVEKANVNLVTEN
FT                   AAVYYDPEVTSTEDLIKVVKHAGYDAAEKMSKEEKDAVLEKNFKKEVRRFILSAVLSLP
FT                   LLLTMVTHIPYIHEMAFAETIGNWINPTIQLVLATIVQFYIGWRFYDGAYKALRGKSAN
FT                   MDVLVALGTSAAYFYSVVEYIRHMIDPSVMPHYYFETSAVLITLILLGKLLESYATSRT
FT                   TESIAGLLELQAKEATVIREGKEWLVPVDSLEIGDIILVRPGEKVPMDAEIISGETSID
FT                   EAMITGEPVPVEKKPGDSVIGATINFDGAFQAKITKRMEETVLESIIRLVEEAQGIKAP
FT                   IQRLADRISGIFVPIVLGIAAVTFIIWYLVTGTVDGSLEAAIAVLVIACPCALGLATPT
FT                   AIMAGTGKGAESGILFKGGEHLERTSKVDTIVFDKTGTLTEGKLEVSDKKAANDHFFPY
FT                   LFLMEQQSEHPIAKAIIKMLEPENMDVSAVKQGKIRAKAGHGMTGNLDDSKVELGAYRY
FT                   VSSLTTIPKEDDELIESWMHAGKTVVAMAIDGVYAGALALSDTPRPEAKEAIQKLKAQG
FT                   IKTAICSGDQSVVVENMAKDLGIDMFFAEQLPNDKSALVEKLQQEGHIVAFVGDGINDA
FT                   PALAASDIGISIGTGTDIAIETGDVTLVSHRLTLIPETIELSKATMRNIRQNFFWALAY
FT                   NCAGIPIAALGLLAPWVAGLAMAFSSVSVVTNALRLKRYKFKS"
FT   gene            714189..714395
FT                   /locus_tag="LMHCC_0704"
FT   CDS_pept        714189..714395
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0704"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0704"
FT                   /db_xref="EnsemblGenomes-Tr:ACK39059"
FT                   /protein_id="ACK39059.1"
FT                   /translation="MEKLTLNVEGMTCSHCEARVTKALSEVSGVKSAVVSLDEGTATVE
FT                   FEQGQVTEDALIDAVEEAGYEVA"
FT   gene            714549..716039
FT                   /locus_tag="LMHCC_0705"
FT   CDS_pept        714549..716039
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0705"
FT                   /product="periplasmic protease"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0705"
FT                   /db_xref="EnsemblGenomes-Tr:ACK39060"
FT                   /protein_id="ACK39060.1"
FT                   /translation="MEESPQNEPEKVEKDEEQKSKPGNGYIKMKLFPFIMLLFAFVFVT
FT                   ALVTTIVMSLGDDKQVKVSIPERKEFTKLYDVYDEITSKYYKDTKSTTMIDGAISGMVN
FT                   SLDDPYSTFMSKKESSEFNDTISASFEGIGAEIQEKDGAIVVVSPIKNSPAEKAGLRPQ
FT                   DIITQVDGKSVKGDTATEATQKIRGEKGTKVTLTIQRSNEDKPFDVTITRDEIPIETVY
FT                   KEMGSDKIAHVTISTFSETTYDELEKALKSLEKDGMKGLVIDLRGNPGGLLDQAVSIAS
FT                   LFVPDGKIVVQEQGKDGDKSAIKADSSSHGDYKVKVPTTMLIDGGSASASEILAAAAKE
FT                   SGGIKLVGTKSFGKGTVQTATTLSDESTLKLTVAKWLTPNSEWIHEKGITPDVVVNMPN
FT                   YATMTIPSSTKVYQNGDFGDDVRTIETMLKALDYNVGKVDGLYDIDTKYAVERFQAANK
FT                   LDVTGIMTGVTTDKLVELTQKHLKETDPQLQKAKALVK"
FT   gene            716076..716492
FT                   /locus_tag="LMHCC_0706"
FT   CDS_pept        716076..716492
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0706"
FT                   /product="transcriptional regulator, MarR family"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0706"
FT                   /db_xref="EnsemblGenomes-Tr:ACK39061"
FT                   /protein_id="ACK39061.1"
FT                   /translation="METYLEIETLIKRIFNSFRHEVEAVLDKRLSGSEYRVLSLISSGL
FT                   TKTSELAKTLDVSASHITAITDTLVEEQFITRHRSEVDRRIIELRLTPNAEEFVQEIDK
FT                   KKKEMIVKRFAVFSEQEQAEFRKLLKKLADGSIK"
FT   gene            716651..717373
FT                   /locus_tag="LMHCC_0707"
FT   CDS_pept        716651..717373
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0707"
FT                   /product="manganese transport system ATP-binding protein
FT                   MntA"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0707"
FT                   /db_xref="EnsemblGenomes-Tr:ACK39062"
FT                   /protein_id="ACK39062.1"
FT                   /translation="MKIQGLTIAYKQKVAIDNVTLQIASGKLTGIVGPNGAGKSTLLKG
FT                   MMGLIPREQGQVTLADKPLSYWRKKIAYVPQRSEVDLTFPITVFDMVLLGTYPALGLIK
FT                   RPGKKEKQLALDALEQVEMTGFMKRQIGELSGGQLQRVFIARALAQHAEIFFLDEPFAG
FT                   IDMTSEALIMRLLKKLRDNGKTIVVVHHDFHKVAAYFDDIILLNKKLVAHGPVEQTFTE
FT                   EKIQFAYGDAPIAFATGV"
FT   gene            717377..718219
FT                   /locus_tag="LMHCC_0708"
FT   CDS_pept        717377..718219
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0708"
FT                   /product="manganese transport system membrane protein MntB"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0708"
FT                   /db_xref="EnsemblGenomes-Tr:ACK39063"
FT                   /protein_id="ACK39063.1"
FT                   /translation="MLFLEGLMQYSFLQKALITSVTVGIVSGVIGSFIILRGMSLMGDA
FT                   ISHAVLPGVAISYMMGINFFIGAATFGIAAALGIGFVNQKSRIKNDTAIGIVFSAFFAL
FT                   GIILISFAKSSTDLYHILFGNVLAVRSSDMWMTIIIAIIVISLVALFYKEFLVSSFDPV
FT                   MAEAYGLNVKFLHYFLMLLLTLVTVSALQTVGIILVVAMLITPAATAYLLTNKLSKMIV
FT                   LASTFGAVSAIIGLYFSYIFNLASGAAMVLVATIIFFIAFLFAPKQGLLFSKKREVIE"
FT   gene            718216..719148
FT                   /locus_tag="LMHCC_0709"
FT   CDS_pept        718216..719148
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0709"
FT                   /product="manganese ABC transporter substrate-binding
FT                   lipoprotein (Adhesin B) (Saliva-binding protein)"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0709"
FT                   /db_xref="EnsemblGenomes-Tr:ACK39064"
FT                   /protein_id="ACK39064.1"
FT                   /translation="MKKMLVVALFALVVVLAGCSSQNSDSKKTDGKLNVVATYSILADI
FT                   VKNVGGDKIELHSIVPVGVDPHEYDPLPANIQSAADADLIFYNGLNLETGNGWFDRMLE
FT                   TADKSRDDKEQVVELSKGVKPKYLTEKGKTSETDPHAWLDLHNGIIYTENVRDALVKAD
FT                   PDNAAFYKDNAAKYIAKLDALDKEAKQKYADLPENQKTLVTSEGAFKYFAARYGLKAAY
FT                   IWEINTESQGTPDQMKQIVGIVEKEKVPNLFVETSVDPRSMESVSKETGVPIFAKIFTD
FT                   STAKKGEVGDTYLEMMRYNLDKIHDGLAN"
FT   gene            719485..720309
FT                   /locus_tag="LMHCC_0710"
FT   CDS_pept        719485..720309
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0710"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0710"
FT                   /db_xref="EnsemblGenomes-Tr:ACK39065"
FT                   /protein_id="ACK39065.1"
FT                   /translation="MEDGKYKVLTTENILGSAGFIFALTGLTYAIIEMFTGWTPLLGWI
FT                   VLTVGLILSIIGIFKNPKDAGISGTTISVIAISLLIVNGASFNSKSSIKPPIDSNNIRA
FT                   SYTNQMDMETLQTLYNPETILEHKKKKLKEAPTLENGVIENEQIKIQITSHKIIPIGAK
FT                   GNESGDKPIIAFWFEVTNKSSLSASALGSWGEYIAIYQDTRSDLLNTLKSTTLDDAQFL
FT                   DSASRLSEEIEIGATVKCAIAYGLDDDEIPVDLAHRDFFSEEVYGKINYQIK"
FT   gene            complement(720412..721782)
FT                   /locus_tag="LMHCC_0711"
FT   CDS_pept        complement(720412..721782)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0711"
FT                   /product="mate efflux family protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0711"
FT                   /db_xref="EnsemblGenomes-Tr:ACK39066"
FT                   /protein_id="ACK39066.1"
FT                   /translation="MQQTVTYGAKWKQFLTIFTPIVITQLTLFSMTFFDTTMSGNYSNQ
FT                   ALAGVAIGSSFWAPVNAAFSGLLMAITPIIAQLIGAKKEKQVKNTVHNGLYIALFLAFI
FT                   LILINFLVVPTILTHMPVTAEVAHIARHFLNGICIGIPAFFISAILRSFIDSLGLTRVT
FT                   MFTTLCTVPFNIFLNYCFIFGNFGFPEMGGAGSGYATGITYWLVVLVSVILIQTQTRLR
FT                   KFGIFKSLTALRFSKVKEIIGIGVPNGLTILFETSIFSAVTILMGAFGTETIAAHQSAN
FT                   SVCTLLYAFPLSVASTLTILGGYETGAKRLKDAKQYRHIGMTAAILIGCVNGAILFFFR
FT                   DTIAGFYTNDSALIDLIMHFLVYAILFQFADAVLSPVLGALRGYKDVTITTIVAFISYW
FT                   LIGLPVGYGLSFTNLGPFGYWIGLSTGLFVAAFILSLRVRKTEQKLSLNAKNAEISS"
FT   gene            721956..723239
FT                   /locus_tag="LMHCC_0712"
FT   CDS_pept        721956..723239
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0712"
FT                   /product="xanthine/uracil permease family protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0712"
FT                   /db_xref="EnsemblGenomes-Tr:ACK39067"
FT                   /protein_id="ACK39067.1"
FT                   /translation="MQKFFNKVFRLNEHKTNIRTEFLAGMIGFFTVAYIIVVNSSILAE
FT                   AGVPYQGAVLATIFISALGCLIMGFWANAPLILMPGMGINALFAYTLVQGMGLSWQVAL
FT                   AAVTMSGLLFMILAFTPLAGKLNEAIPPILKQAITVGLGLFLIFLGLEKGGIVTRGKHA
FT                   IIAVGDLGDPFVLATLVTLLLTMILVIRKIPGAFLWSLIIGTVVGVMFGVAGKAGGASI
FT                   SVAPWSDVLFKADFSGMASVGFWSAVFTMTMVIVFETVGLTNGQVRQLKQTEKLPRILK
FT                   ASSLTAFLSGLFGTSPTISALESGSMFASGAKTGLATITTGLFFIASLFLMPVLSFIPN
FT                   SAIAPILIIIGMSMLQEFKEMDLSNAAETFSALLIIVLIPLTYSIADGIAAGFIAYPIL
FT                   RAFTKNEERTSPVMYVIAALFLLQFIIQ"
FT   gene            723321..723785
FT                   /gene="lspA"
FT                   /locus_tag="LMHCC_0713"
FT   CDS_pept        723321..723785
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lspA"
FT                   /locus_tag="LMHCC_0713"
FT                   /product="signal peptidase II"
FT                   /EC_number="3.4.23.36"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0713"
FT                   /db_xref="EnsemblGenomes-Tr:ACK39068"
FT                   /db_xref="GOA:B8DDQ9"
FT                   /db_xref="InterPro:IPR001872"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8DDQ9"
FT                   /protein_id="ACK39068.1"
FT                   /translation="MYYYLITLAVIALDQLTKWIVVQNMEIGQKIEVIPGFLYWTSYRN
FT                   DGAAWSILEGHMWFFYLITVIVIGIIIYIMQKYAKGKRLFSISLAFILGGAIGNFIDRI
FT                   LHQEVVDFVQTVWGNYYFPIFNVADAALSVGVVLMLVYVFVDDRKTKGIK"
FT   gene            723785..724693
FT                   /gene="rluD"
FT                   /locus_tag="LMHCC_0714"
FT   CDS_pept        723785..724693
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rluD"
FT                   /locus_tag="LMHCC_0714"
FT                   /product="ribosomal large subunit pseudouridine synthase D"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0714"
FT                   /db_xref="EnsemblGenomes-Tr:ACK39069"
FT                   /protein_id="ACK39069.1"
FT                   /translation="MQNETLIIEESHARERVDKVIAEMMGKSRSAIQLMLKSGDITVNG
FT                   ELAKPNYKVQVGDEIHYEVREPEELEVLAEDIPLDIYFEDKDMLVVNKPEGMVVHPSAG
FT                   HASGTLVNALLFHCDDLSGINGKIRPGIVHRIDKDTSGLLMVAKNDHAHESLAKQLKDK
FT                   TSDREYIALVHGDIVHQKGTIEAPIGRAKEDRQKMAVVRDGKEARTHFEVLERLPGYTL
FT                   INCKLDTGRTHQIRVHLKYIGHPLAGDPKYGPKNTIKGNGQFLHAAKLGFDHPTTNERM
FT                   TFEAPLPSSFEKALKSLRQED"
FT   gene            complement(724711..725535)
FT                   /locus_tag="LMHCC_0715"
FT   CDS_pept        complement(724711..725535)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0715"
FT                   /product="stas domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0715"
FT                   /db_xref="EnsemblGenomes-Tr:ACK39070"
FT                   /protein_id="ACK39070.1"
FT                   /translation="MSIMNSLLQQKETVVQGWLTYYVSVDDPYIFTLKNDHRLMDETGF
FT                   VLENLFIGMTEDLGKMNTFAHELGKAQFITSLGISRILFHIRLLEEFLLDYASENNIEP
FT                   TNYRELYLFSIKLHQVFSSFTQHLIEGYNRAHEQMMLQKENQIIKESTKLIWIAEKVFL
FT                   LPLIGKITDDRAKQITETALYEACEQPVNYLIIDLSGVQLESPHIGDYIDHFFSSLKLV
FT                   GVTPIITGMQPQTAKVMVQANLTEQRGIKTFATLRQATKTLMKEKEARNARK"
FT   gene            726085..726636
FT                   /locus_tag="LMHCC_0716"
FT   CDS_pept        726085..726636
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0716"
FT                   /product="bifunctional protein PyrR"
FT                   /EC_number="2.4.2.9"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0716"
FT                   /db_xref="EnsemblGenomes-Tr:ACK39071"
FT                   /db_xref="GOA:B8DDR2"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR023050"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8DDR2"
FT                   /protein_id="ACK39071.1"
FT                   /translation="MQKQVVVMDEAAIKRALTRVSYEIIERNKGTKNLALVGIKTRGIY
FT                   LAERLHKRILEIEGIDVPVGDIDITLYRDDLSFKDDKTREPAVHGTNIPFDINGKKVVL
FT                   VDDVLYTGRTVRAAMDALMDVGRPAQIHLAVLADRGHRELPIRADYVGKNIPTSGNERV
FT                   EVRLTDVDHAEDAVIINKNE"
FT   gene            726765..728051
FT                   /locus_tag="LMHCC_0717"
FT   CDS_pept        726765..728051
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0717"
FT                   /product="uracil permease (Uracil transporter)"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0717"
FT                   /db_xref="EnsemblGenomes-Tr:ACK39072"
FT                   /protein_id="ACK39072.1"
FT                   /translation="MTETTETVTKPVLDIHERPSFNKWIILSIQHLFTMFGSTIFVPSV
FT                   TGLSPGVALVSSGLGTLAYLGITRGKIPAYLGSSFTFIAPITALLAAKSGGGPGAVMVG
FT                   TFSVGVVYAIVSLIVYYAGVDWIQKVLPPIVVGPVIMVIGLSLAPSAAAMAMGTNNGKY
FT                   SLETLAVAVITLLATIIAMMFFKGFMGLIPILFGFTVGYLTSMAFGMVDYTLIKNASFF
FT                   QIPDFSIPFVNIDPVITVTVILSMAPLAFVTMAEHMGHQLLLNRITNKNFFKDPGLHRS
FT                   LLADGTASIIASFIGGPPVTTYGENIGVLAITKVYSVFVIGGAAVFAILFGFIGYINAV
FT                   ITSVPTAVLGGISLLLFGVIATSGLRMMIENKIDLSVNRNMIIASVVLVVGIGGLFIQA
FT                   GTFQLSGMALAAVIGIILNLVLPAEHRSA"
FT   gene            728136..729047
FT                   /gene="pyrB"
FT                   /locus_tag="LMHCC_0718"
FT   CDS_pept        728136..729047
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrB"
FT                   /locus_tag="LMHCC_0718"
FT                   /product="aspartate carbamoyltransferase"
FT                   /EC_number="2.1.3.2"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0718"
FT                   /db_xref="EnsemblGenomes-Tr:ACK39073"
FT                   /db_xref="GOA:B8DDR4"
FT                   /db_xref="InterPro:IPR002082"
FT                   /db_xref="InterPro:IPR006130"
FT                   /db_xref="InterPro:IPR006131"
FT                   /db_xref="InterPro:IPR006132"
FT                   /db_xref="InterPro:IPR036901"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8DDR4"
FT                   /protein_id="ACK39073.1"
FT                   /translation="MKNLLSMEALTVHEIEHLLGQAAQFKRGKKATFTEQAFAVNMFFE
FT                   PSTRTHTSFEVAEKKLGVEVVSFDAASSSMTKGETLYDTLLTMQAVGVNVAVIRHSEEN
FT                   YYEGLENLDIAIVNGGDGCGEHPSQSLLDLFTIKEQFGTFQGLKVAIAGDIRHSRVANS
FT                   NMKVLKRLGAELFFSGPREWFDESCLAYGTYLPVDEMVEKVDVMMLLRVQHERHSGTEA
FT                   FTKESYHEKFGLTIERAAKLKADAIIMHPSPVNRDVEIADSLVESEKSRIVTQMTNGVF
FT                   IRMAILEAILKEQEMRAKLCTY"
FT   gene            729035..730315
FT                   /locus_tag="LMHCC_0719"
FT   CDS_pept        729035..730315
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0719"
FT                   /product="dihydroorotase (DHOase)"
FT                   /EC_number="3.5.2.3"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0719"
FT                   /db_xref="EnsemblGenomes-Tr:ACK39074"
FT                   /db_xref="GOA:B8DDR5"
FT                   /db_xref="InterPro:IPR002195"
FT                   /db_xref="InterPro:IPR004722"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8DDR5"
FT                   /protein_id="ACK39074.1"
FT                   /translation="MYVLKNGQVLNASGELENKDVLIQNGKVNLIADSIEVTSGEEFDA
FT                   TGKLIAPGFIDVHVHLREPGGEHKETILTGTQAAARGGYTTICSMPNTKPVPDSKEVME
FT                   NLQAKIKETAEVRVLPYASITTSLGTDELVDFEALKEAGAFAFTDDGVGVQLAGTMYEA
FT                   MKRAAALDMAIVAHCEDNSLIYGGVVHDGIFAEKEGLKGIPNIAESVQIARDVLLAEAA
FT                   GCHYHVCHISTKESVRVVRDAKRAGIRVTAEVSPHHLILDEEAIPGNDGNWKMNPPLRS
FT                   KADRAALLEGLLDGTIDFIATDHAPHAAEEKNVPMEQAAFGIVGLETGFPLLYTHFVKT
FT                   NEWTLKQLIDWMTVKPAECFKLPYGKLEEGSVADIVVLDLEKEATIDPATFYSKGKNTP
FT                   FVGETCIGWPVATFAEGTLVYNEGEIK"
FT   gene            730312..731403
FT                   /gene="carA"
FT                   /locus_tag="LMHCC_0720"
FT   CDS_pept        730312..731403
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="carA"
FT                   /locus_tag="LMHCC_0720"
FT                   /product="carbamoyl-phosphate synthase, small subunit"
FT                   /EC_number="6.3.5.5"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0720"
FT                   /db_xref="EnsemblGenomes-Tr:ACK39075"
FT                   /protein_id="ACK39075.1"
FT                   /translation="MTKRILMLEDGNYFIGDAIGSEKETIGEVVFNTGMTGYQETITDP
FT                   SYYGQIITFTYPLVGNYGVNRDDFESINPAVKGVVVREAAEFPSNWRNQITLDQFLKEK
FT                   GIPGIAGIDTRKLTKLIRKEGTLKGILAAETANKEELLHHLRSVRLPVDQVHEVSSAKA
FT                   FASPGDGKRVVLVDYGVKSSILRELNKRNCYVTVVPYNTTAEEILAMHPDGVMLSNGPG
FT                   DPKDVPEALEMIRGIQGKLPLFGICLGHQLFALANGADTFKLKFGHRGANHPVKELATG
FT                   RVDFTAQNHGYAVEKDSLIGTDLKVTHIELNDETVEGLAHKEYPAYTVQYHPEANPGPS
FT                   DVNYLFDEFMEMMNGKEEGELHA"
FT   gene            731396..734608
FT                   /gene="carB"
FT                   /locus_tag="LMHCC_0721"
FT   CDS_pept        731396..734608
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="carB"
FT                   /locus_tag="LMHCC_0721"
FT                   /product="carbamoyl-phosphate synthase, large subunit"
FT                   /EC_number="6.3.5.5"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0721"
FT                   /db_xref="EnsemblGenomes-Tr:ACK39076"
FT                   /db_xref="GOA:B8DDR7"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005480"
FT                   /db_xref="InterPro:IPR005483"
FT                   /db_xref="InterPro:IPR006275"
FT                   /db_xref="InterPro:IPR011607"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR033937"
FT                   /db_xref="InterPro:IPR036897"
FT                   /db_xref="InterPro:IPR036914"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8DDR7"
FT                   /protein_id="ACK39076.1"
FT                   /translation="MPKRDDIKTILVIGSGPIVIGQAAEFDYAGTQACLSLKEEGYRVV
FT                   LVNSNPATIMTDAEMADKVYIEPITLDFVSRIIRKERPDAILPTLGGQTGLNMAMELSA
FT                   AGILDECNVEVLGTDLTAIKKAEDREAFRDLMNELGEPVPESDIIHNLDEAYTFVERIG
FT                   YPVIVRPAYTLGGSGGGICHNEQELIETVTSGLKLSPVTQCLLEKSIAGFKEVEYEVMR
FT                   DANNNAMVVCNMENIDPVGIHTGDSIVVAPSQTLSDREYQLLRDVSLKIIRALEIEGGC
FT                   NVQLALDPDSYNYYVIEVNPRVSRSSALASKATGYPIAKLAAKIAVGLTLDEVRNPVTG
FT                   TTFAHFEPTLDYVVAKIPRFAFDKFEQADRRLGTQMKATGEVMAIGRSWEEALLKAVRS
FT                   LEIGADHLLLEEAENADEATLERKICFPEDDRLFFLAAALRRGQTIEQLHAKTKIDLFF
FT                   LYKLSKTIELENRIKENPHNQEILAEAKRAGFSDAFLATCWNVDEQAIYDLRKAQNLFP
FT                   VYKMVDTCAAEFESTTPYFYSTYEEENESTRSAKESVIVLGSGPIRIGQGVEFDYATVH
FT                   SVWAIQQAGYEAIIINNNPETVSTDFSISDKLYFEPLTLEDVMHVIEIEQPLGVVVQFG
FT                   GQTAINLADGLAKRGVKILGTSLEDTDRAENRDAFEKALEILQIPQPAGKTATSVEEAI
FT                   NVATDIGYPVLVRPSYVLGGRAMEIVESEEALKHYMTNAVKVNPKHPVLVDRYVSGQEV
FT                   EVDAISDGENVLIPGIMEHIERAGVHSGDSIAVYPAQRLSSQVKNTIVDYTTRLATGLN
FT                   IIGMLNIQYVVDGEEVFVIEVNPRSSRTAPFLSKITEIPMANVATRVILGENLIDLGYT
FT                   PGLAPEKQEIFVKVPVFSFAKLRSVDTSLGPEMKSTGEVMGKDVTLEKALYKGFVASGT
FT                   TMHDYGTVLLTVADRDKEEAVELAKRFNRIGFTIMATKGTASTLEEADIPVSQVKKIGE
FT                   NQETLIDYIRNGQVTLVVNTLTTGKRPERDGFQIRRESVENGIPVCTSLDTAEAILRVL
FT                   ESRSFELESMNASEVKQPKARV"
FT   gene            734631..735395
FT                   /locus_tag="LMHCC_0722"
FT   CDS_pept        734631..735395
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0722"
FT                   /product="dihydroorotate dehydrogenase electron transfer
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0722"
FT                   /db_xref="EnsemblGenomes-Tr:ACK39077"
FT                   /db_xref="GOA:B8DDR8"
FT                   /db_xref="InterPro:IPR000951"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR012165"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR019480"
FT                   /db_xref="InterPro:IPR023455"
FT                   /db_xref="InterPro:IPR037117"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8DDR8"
FT                   /protein_id="ACK39077.1"
FT                   /translation="MLQTEMKVIQQTEIADKVYELILTGECVADMSPGQFLMLKPSRSD
FT                   LLMRRPISICSYDKTAKTCILLYRVEGDGTRDFSKLSEGDTIDVLGPLGKGFDIDQTPA
FT                   PKTALLIGGGIGVPPMYQLGKELAGKGVQVTFVNGFQSAKDSFYEKEMTAYGTVHIATV
FT                   DGSLGTQGFVTDVTKNFPEEPDVIYSCGPKAMLQAVKASFPETKTYLSLEERMACGIGA
FT                   CYACVCPKADDTKKQFKVCEDGPVFRADEVSL"
FT   gene            735392..736306
FT                   /locus_tag="LMHCC_0723"
FT   CDS_pept        735392..736306
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0723"
FT                   /product="dihydroorotate dehydrogenase B, catalytic subunit
FT                   (dihydroorotate oxidase b) (dhodehase b) (dhodase b) (dhod
FT                   b)"
FT                   /EC_number="1.3.98.1"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0723"
FT                   /db_xref="EnsemblGenomes-Tr:ACK39078"
FT                   /db_xref="GOA:B8DDR9"
FT                   /db_xref="InterPro:IPR001295"
FT                   /db_xref="InterPro:IPR005720"
FT                   /db_xref="InterPro:IPR012135"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR024920"
FT                   /db_xref="InterPro:IPR033888"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8DDR9"
FT                   /protein_id="ACK39078.1"
FT                   /translation="MNRLAVEIPGLSLKNPIMPASGCFGFGQEYSKYYDLNELGAIMAK
FT                   AVTPEPRLGNPTPRVAETASGMLNAIGLQNPGLEHVLAHELPFLEQFETPIIANVAGAT
FT                   EDDYVQVCARIGESKAVKAIELNISCPNVKHGGIAFGTDPEVAHRLTKAVKNVATVPVY
FT                   VKLSPNVADIVSIAQAIEAAGADGLTMINTLLGMRIDLKTRKPIIANGTGGLSGPAIKP
FT                   VAIRMIHQVRAVSNIPIIGMGGVQTVDDVLEFLIAGADAVAVGTMNFTDPFICPKLISE
FT                   LPKRMDELGISSLQELKKERANQ"
FT   gene            736303..737004
FT                   /gene="pyrF"
FT                   /locus_tag="LMHCC_0724"
FT   CDS_pept        736303..737004
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrF"
FT                   /locus_tag="LMHCC_0724"
FT                   /product="orotidine 5-phosphate decarboxylase"
FT                   /EC_number="4.1.1.23"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0724"
FT                   /db_xref="EnsemblGenomes-Tr:ACK39079"
FT                   /db_xref="GOA:B8DDS0"
FT                   /db_xref="InterPro:IPR001754"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR014732"
FT                   /db_xref="InterPro:IPR018089"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8DDS0"
FT                   /protein_id="ACK39079.1"
FT                   /translation="MNKPIIALDFQTYEEVEQFLAKFSGEALSVKVGMELFYSNGPIIV
FT                   EKIKQQNHEIFLDLKLHDIPNTVKSAMVGLAKLGVDMVNVHAAGGKNMMEAALEGLEIG
FT                   SGSGKRPKIIAVTQLTSTSEASMQSEQLIKTSLLESVLHYSALTNQAGLNGVVCSALEA
FT                   EAIKQQNGADFLRVTPGIRLASDAADDQIRVVTPEKARLIGSTDIVVGRSITRANDPVA
FT                   AYNQVLKEWNV"
FT   gene            737001..737630
FT                   /gene="pyrE"
FT                   /locus_tag="LMHCC_0725"
FT   CDS_pept        737001..737630
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrE"
FT                   /locus_tag="LMHCC_0725"
FT                   /product="orotate phosphoribosyltransferase"
FT                   /EC_number="2.4.2.10"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0725"
FT                   /db_xref="EnsemblGenomes-Tr:ACK39080"
FT                   /protein_id="ACK39080.1"
FT                   /translation="MSIEKQVAEQLLEIKAVFLKPNDPFTWASGIKSPIYCDNRLTLGF
FT                   PKVRQFIAKSLAEKIKQTFGEVDVVAGTATAGIPHAAWVSDLLDLPMVYVRSKAKEHGK
FT                   GNQIEGPITKGQKVVVIEDLISTGGSSLKAVEALEEAGAEVVGIAAIFTYGLDKGKQLL
FT                   EASGTKLVTLTNYDELIEVALNENYVTAEDMATLKEWKKNPENWGK"
FT   gene            complement(737672..738271)
FT                   /locus_tag="LMHCC_0726"
FT   CDS_pept        complement(737672..738271)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0726"
FT                   /product="short chain dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0726"
FT                   /db_xref="EnsemblGenomes-Tr:ACK39081"
FT                   /protein_id="ACK39081.1"
FT                   /translation="MKILLIGASGTLGSAVKDRLEKKAEVITAGRHSGDVTVDITSVDS
FT                   IKKMYEQVGKVDAIVSATGSATFSPLTELTPEKNAVTISSKLGGQINLVLLGIDSLNDR
FT                   GSFTLTTGIMMEDPIVQGASAAMANGAVTAFAKSAAIEMPRGIRINTVSPNVLEESWDK
FT                   LESFFQGFVPVPAAKVARAFEKSVFGAQTGESYKIY"
FT   gene            complement(738358..740070)
FT                   /locus_tag="LMHCC_0727"
FT   CDS_pept        complement(738358..740070)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0727"
FT                   /product="fibronectin/fibrinogen-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0727"
FT                   /db_xref="EnsemblGenomes-Tr:ACK39082"
FT                   /protein_id="ACK39082.1"
FT                   /translation="MAFDAMFLKAMTEELAEHGESGRIMKIHQPFSHELVLYIRKNREN
FT                   KRLLISSHPSYARIQWTDDIPENPATPPMFCMLLRKYLEGAIIESITQLPNERILQFSI
FT                   RGKDDIGENRFCDLFVEIMGRHSNITLVDRAKNVIVDCIKHVSPAQNSYRTLLPGATYV
FT                   LPPATDKLHPFEVTSEQILDRLDFSAGRMDKQLVQHFAGFSPLLAREIVFRAGNLTADS
FT                   LVAAFFEVMELVNAHLGSAAVPNEWRIQNKEDYYFFPLRHVDAETTEFANLSTLLDHFY
FT                   IGKARRDRVHQFAHDLEKLLSNELARSRLKIEKLENTLLETEKADIYRIQGELLTANLH
FT                   LMERGMAEITVENFYDDMKKMTIPLDTRKTPSANAQSYFSRYQKLRNAVEVVKEQIALT
FT                   KEEITYLESVESQLETSGPQDVEEIRQELAEQGYLRYKQKKGGRKKATLPTPEKYTSST
FT                   GLSILVGKNNKQNDYLTNKLARNNEYWFHVKDLPGSHVVIQSNNPDETSITEAAMIAAY
FT                   YSKARLSATVPVDGTLVKHVKKPNGAKPGYVIYDNQTTYFVTPDEKLVLSLKN"
FT   gene            740227..741102
FT                   /locus_tag="LMHCC_0728"
FT   CDS_pept        740227..741102
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0728"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0728"
FT                   /db_xref="EnsemblGenomes-Tr:ACK39083"
FT                   /protein_id="ACK39083.1"
FT                   /translation="MVKSMTGFGRATKEFEAFKVTIELKAVNHRYSEFLFRMPKQLAYL
FT                   EGKLKKTISKQIKRGRIEVFFSITGEQISKRELHIDWDLADSYYRFIKQASARYELQEL
FT                   PTMADLLQEPAYLSIEEEAEASSELERLVLETLARATERLDEMRSMEGAELLLYFKQHL
FT                   AALEKSLEIIQAEIPNTEKHYQEKIETRLQNVVGDQFDSSIVLTEVAMLLEKADINEEV
FT                   ERTKSHLKQFYGIILLEEPIGRKLDFLIQEMNREVNTIGSKASSLKITEQVVEMKTTLE
FT                   KIREQVQNVE"
FT   gene            741118..741738
FT                   /gene="gmk"
FT                   /locus_tag="LMHCC_0729"
FT   CDS_pept        741118..741738
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gmk"
FT                   /locus_tag="LMHCC_0729"
FT                   /product="guanylate kinase"
FT                   /EC_number="2.7.4.8"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0729"
FT                   /db_xref="EnsemblGenomes-Tr:ACK39084"
FT                   /protein_id="ACK39084.1"
FT                   /translation="MMTERGLLIVLSGPSGVGKGTVREAVFKDPETSFDYSISMTTRLP
FT                   REGEQDGVDYYFRSREVFEQAIKDGKMLEYAEYVGNYYGTPLEYVEEKLAAGVDIFLEI
FT                   EVQGAMQVRKAMPEGIFIFLTPPDLSELKNRIIGRGTESMEVVEERMETAKKEIEMMAS
FT                   YDYAVVNDVVANAVQKIKGIVETEHLKTERVIHRYKKMLEGLQ"
FT   gene            741738..741941
FT                   /gene="rpoZ"
FT                   /locus_tag="LMHCC_0730"
FT   CDS_pept        741738..741941
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoZ"
FT                   /locus_tag="LMHCC_0730"
FT                   /product="DNA-directed RNA polymerase, omega subunit"
FT                   /EC_number="2.7.7.6"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0730"
FT                   /db_xref="EnsemblGenomes-Tr:ACK39085"
FT                   /db_xref="GOA:B8DDS6"
FT                   /db_xref="InterPro:IPR003716"
FT                   /db_xref="InterPro:IPR006110"
FT                   /db_xref="InterPro:IPR012293"
FT                   /db_xref="InterPro:IPR036161"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8DDS6"
FT                   /protein_id="ACK39085.1"
FT                   /translation="MLYPSIDNLLLKIDSKYSLVTVAAKRARYMQLENDKGVLPSYQSD
FT                   KFVGKALEEIHAGKLVLKNDDK"
FT   gene            742095..743294
FT                   /gene="coaBC"
FT                   /locus_tag="LMHCC_0731"
FT   CDS_pept        742095..743294
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="coaBC"
FT                   /locus_tag="LMHCC_0731"
FT                   /product="phosphopantothenoylcysteine
FT                   decarboxylase/phosphopantothenate--cysteine ligase"
FT                   /EC_number="4.1.1.36"
FT                   /EC_number="6.3.2.5"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0731"
FT                   /db_xref="EnsemblGenomes-Tr:ACK39086"
FT                   /protein_id="ACK39086.1"
FT                   /translation="MQGKNILLAVSGGIAVYKAVALTSKLTQAGANVKVMMTEHAQEFV
FT                   PPLSFQVLSKNDVYTDTFDEKKSSVVAHIDLADWADLVIVAPATANVIGKMANGIADDM
FT                   VTTTILAIEAPVWVAPAMNVHMIQHPAVIRNINRLYADGVRFIEPEEGYLACGYVGRGR
FT                   LEEPEKIVLRIAEFFQEDKNLLQGKNVLVTAGATREKLDPVRYFTNHSTGKMGFSIAES
FT                   AARHGAKVTLVTTSKALPVPPGVEAIYVESAEEMYQAVDEHKVSQDIFVMTAAVADYTP
FT                   AKVSDQKLKKQPGDFAIEMKRTKDILLEIGQHKTADQVVIGFAAETENLEANARKKLTS
FT                   KNADMIVANDISVAGAGFSGDTNIVTFYRKDGSSEALPILDKKEVAEYIIKETANFLRK
FT                   "
FT   gene            743299..745692
FT                   /locus_tag="LMHCC_0733"
FT   CDS_pept        743299..745692
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0733"
FT                   /product="primosomal protein N (ATP-dependent helicase
FT                   PriA)(Replication factor Y)"
FT                   /EC_number="3.6.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0733"
FT                   /db_xref="EnsemblGenomes-Tr:ACK39087"
FT                   /protein_id="ACK39087.1"
FT                   /translation="MINIAKVIVDVPAMQVDRPFDYYIPEDLEELIRPGMRVSVPFGNR
FT                   KIQGFVIALGETEENPKLKGIDGVMDLAPVLNEELMELGDWLAEDTLSFRVSAYQAMLP
FT                   AALRAKYEKYFLRLDEENEELEQLFEGYETLDWKVAEARGLLKQIGKWVREGSVEVVYQ
FT                   VKNKITSKKVRVVNCLKSPHQLAEIIEDMPKNAKAQSRVLAFFQAFEGNEITAAELKKQ
FT                   AETTDATLKKLVDLGLLSIQEKIVSRDPYENHQFEKSESLQLLPDQQTACEKITAATNQ
FT                   ETFLIHGVTGSGKTEIYLQTIEAKLKEGKEAIVLVPEISLTPQMVERFKSRFGSEVAVL
FT                   HSALSSGEKYDEWRKIERKEARVVVGARSAVFAPFENLGIIIIDEEHEASYKQEDNPRY
FT                   HARDVAIWRATKYQCPVVLGSATPSLESFARAKKGVYTLIELPSRVNDRAMPEVSVVDM
FT                   REELRKENRTEFSTELLEKIKDRIAKKEQTVLMLNRRGYSSFVMCRDCGYVVECPNCDI
FT                   SLTYHQSSNQMKCHYCGHEERVPQKCPSCEGEHIRYFGTGTQKVEESLTKLIPEARVIR
FT                   MDVDTTRTKGAHEKLLKSFRNHEADILLGTQMIAKGLDFPDITLVGVLNADTMLHLPDF
FT                   RASERTFQLLTQVSGRAGRHERTGEVIVQSYNPEHYSIEFAKKHDFIGFYNHEMQLRKM
FT                   GSYPPFYYLTMINVSDENEMKAIRTIQEMAQFLRGKLGPDAVILGPVPSTITRIKNKYR
FT                   YQCIIKYKIEPNLKKELKTLITHYQKDQQKGLTITIDVQPYVLM"
FT   gene            745706..746644
FT                   /gene="fmt"
FT                   /locus_tag="LMHCC_0734"
FT   CDS_pept        745706..746644
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fmt"
FT                   /locus_tag="LMHCC_0734"
FT                   /product="methionyl-tRNA formyltransferase"
FT                   /EC_number="2.1.2.9"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0734"
FT                   /db_xref="EnsemblGenomes-Tr:ACK39088"
FT                   /db_xref="GOA:B8DDS9"
FT                   /db_xref="InterPro:IPR001555"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR005793"
FT                   /db_xref="InterPro:IPR005794"
FT                   /db_xref="InterPro:IPR011034"
FT                   /db_xref="InterPro:IPR036477"
FT                   /db_xref="InterPro:IPR037022"
FT                   /db_xref="InterPro:IPR041711"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8DDS9"
FT                   /protein_id="ACK39088.1"
FT                   /translation="MTKIIFMGTPEFSVPVLTQLASTYDVVAVVTQPDRPVGRKRVLTP
FT                   PPVKKAALELAIPVYQPEKLRTSSELEELIALEADLLVTAAYGQILPNSLLESPKHGAI
FT                   NVHASLLPEYRGGAPVHYALLDGKTETGVTIMYMVEKLDAGDMISQRKIPITDEDNTGT
FT                   MFDKLSKLGAELLMDTLPDFLAGKITAIPQDPEKVTFARNISREQEKIDWTKPGRTIFN
FT                   QIRGLSPWPVAYTTLEEKPFKIWEATYEETKESGEPGAILADKTTLKIVTGDGTLIVPT
FT                   VIQPAGKPKMDIHSFMSGAGRNLSKTTRFGE"
FT   gene            746645..747979
FT                   /gene="sun"
FT                   /locus_tag="LMHCC_0735"
FT   CDS_pept        746645..747979
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sun"
FT                   /locus_tag="LMHCC_0735"
FT                   /product="ribosomal RNA small subunit methyltransferase B"
FT                   /EC_number="2.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0735"
FT                   /db_xref="EnsemblGenomes-Tr:ACK39089"
FT                   /protein_id="ACK39089.1"
FT                   /translation="MKKQKTVRAIALELIIKIENNQSYSHLLINDALKKQKLNPLDKGL
FT                   LTELVYGTTQRKITLDYYLAPFLNKEPDNWVKNLLRMSVYQLTFLDKVPEHAILNEAGD
FT                   IAKDLGHQGVTKFVNGVLRNVIRKGVPSIDAIKDPVQKIAVETSLPEWLAKRWADQYGI
FT                   KKLREIGLAFLVAPHQSIRVNQTEIPTEQLIKELNDQGITVTRNEFIEEALLVEKGSVA
FT                   ETKAYKDGKCSIQDESSMLAAYALQLEDNLTVLDACAAPGGKTTHIAEKMHGTGMVHAL
FT                   DIHEKKTKLIDQAAKRLQLLNIRTAHLDARTASTMFEPETFDRILVDAPCSGFGVLRRK
FT                   PDIKYAKTEKDIHKLAEIQLAILDDVSQLVKENGILVYSTCTIDKEENETVLRAFLEKH
FT                   PEFALEPVVLPEKLAQIKKDDFIQLLPTDIGSDGFFVSSLRKVKS"
FT   gene            748001..748759
FT                   /locus_tag="LMHCC_0736"
FT   CDS_pept        748001..748759
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0736"
FT                   /product="protein phosphatase PrpC"
FT                   /EC_number="3.1.3.16"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0736"
FT                   /db_xref="EnsemblGenomes-Tr:ACK39090"
FT                   /protein_id="ACK39090.1"
FT                   /translation="MHAEFRTDRGRIRHHNEDNGGVFENKDNQPIVIVADGMGGHRAGD
FT                   VASEMAVRLLSDAWKETTALLTAEEIETWLRKTIQEVNKEIALYAESEMDLNGMGTTLV
FT                   AAIMAQSQVVIANVGDSRGYLLQNHVLRQLTEDHSLVHELLRTGEISKEDAMNHPRKNI
FT                   LLRALGVEGKVEVDTFVVPFQTSDTLLLCSDGLTNMVPETEMEEILKSKRTLSEKADVF
FT                   ITKANSYGGEDNITVLLVERDLTQKGRDAS"
FT   gene            748756..750723
FT                   /locus_tag="LMHCC_0737"
FT   CDS_pept        748756..750723
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0737"
FT                   /product="serine/threonine-protein kinase PrkC"
FT                   /EC_number="2.7.11.1"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0737"
FT                   /db_xref="EnsemblGenomes-Tr:ACK39091"
FT                   /protein_id="ACK39091.1"
FT                   /translation="MMIGKRLSDRYKILHAIGGGGMANVYLAHDIILDRDVAVKILRID
FT                   LADESNLIRRFQREAQSATSLVHPNIVSVYDVGEENDLHYIVMEHVDGMDLKQYIHENH
FT                   PISYEKAVDIMLQIVSAVAIAHQHHIIHRDLKPQNILIDHDGVVKITDFGIAMALSETS
FT                   ITQTNSLLGSVHYLSPEQARGGMATQKSDIYSLGIVLYELLTGKVPFDGESAVSIAIKH
FT                   LQADIPSAREQNPEIPQSLENIIIKATAKDPFLRYQNAEEMEKDLQTCLNKDRLNEPKY
FT                   VFPTDDGDTKAIPIIATKDTMQNLDKTIVPEGKVAAAEAVPEEKKGKKKKKMSKKKKIT
FT                   LIVFSVIAIFIIGILLLWLLGKSPDEVAVPDVSGKTEDQAVALLQKEGFVIGKTAEKNS
FT                   DEIAEGKVINTDPEAGEMKEKGTKINLFVSIGSKKITMDDYTGRSYTDTKAILEQQGFK
FT                   NISSEEAYSSEVGKGMIISQTPTQGTEVVAKSTDVKFVVSKGAEPITLKDLRGYTKTAV
FT                   EDYASPLGLKVSSKEENSSTVEKGQVISQSPSAGTAMNAGDTIEIVISAGPKEKQVKEV
FT                   TKTFNIPYTPSDEDNPQPQKVQIYIQDKDHSMTSAYREMSITQNTSVEITFQIEEGSSA
FT                   GYKIISDDKVIDEGTVPYPN"
FT   gene            750742..751617
FT                   /gene="rsgA"
FT                   /locus_tag="LMHCC_0738"
FT   CDS_pept        750742..751617
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rsgA"
FT                   /locus_tag="LMHCC_0738"
FT                   /product="ribosome small subunit-dependent GTPase A"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0738"
FT                   /db_xref="EnsemblGenomes-Tr:ACK39092"
FT                   /protein_id="ACK39092.1"
FT                   /translation="MLEGQIIKALSGFYYVFSEGKVYQCRARGNFRKRNISPLVGDDVE
FT                   FQIENKTDGYILDVMSRENALVRPPVANIDIAILVFSAVEPDFSTNLADRFLVAIEKED
FT                   IKPVICISKMDLASESEKEQIAVYKDIYEAIGYDVFVTNDEPDKEAIKDYISGKTAVIA
FT                   GQSGVGKSTLLNSLNSDLTLKTAEISNSLGRGKHTTRHVELMPIGDGFVADTPGFSSIE
FT                   WDDLQPETLQFCFPEMEDRRSGCKFRGCMHENEPNCAVKTAVEANEIAEFRYKHYIQIL
FT                   QELKNRKPRY"
FT   gene            751620..752276
FT                   /gene="rpe"
FT                   /locus_tag="LMHCC_0739"
FT   CDS_pept        751620..752276
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpe"
FT                   /locus_tag="LMHCC_0739"
FT                   /product="ribulose-phosphate 3-epimerase"
FT                   /EC_number="5.1.3.1"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0739"
FT                   /db_xref="EnsemblGenomes-Tr:ACK39093"
FT                   /protein_id="ACK39093.1"
FT                   /translation="MGKIAPSILSADFANLARDIKEVENCGADYIHIDVMDGHFVPNIT
FT                   FGPAVVQAIRPETKLPLDVHLMIENPDTYIPEFAKAGADYITVHVEACTHLHRTLQLIR
FT                   SYGVKAGAVLNPATPIDVLQHVLNELDMVLFMTVNPGFGGQKFIPEVLEKISAFKKIVD
FT                   EKGLDIEIEVDGGVDHETAKLCRDAGANVFVAGSYIYGNKNRQTPIDKLRAVVGE"
FT   gene            752340..752984
FT                   /locus_tag="LMHCC_0740"
FT   CDS_pept        752340..752984
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0740"
FT                   /product="thiamine pyrophosphokinase"
FT                   /EC_number="2.7.6.2"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0740"
FT                   /db_xref="EnsemblGenomes-Tr:ACK39094"
FT                   /protein_id="ACK39094.1"
FT                   /translation="MKIINIMVGGPASEIPDLAQYTSAEISWVGVDRGAKRLLDHGIVP
FT                   TVAMGDFDSLSKEELAHLKTKVADVHEFPAEKDETDTEIGLSWAMEQNPDKIRIFGATG
FT                   GRLDHLLANLMMLTKPRFLNAVPVVEMIDRYNYIKMYTPGSYTIEKLPDKKYVAFTTMK
FT                   DVTGLTLKGFAYPLENATYPVGSALSSNEFVEKKGEFSFKSGMILLTQSND"
FT   gene            complement(753081..753269)
FT                   /gene="rpmB"
FT                   /locus_tag="LMHCC_0741"
FT   CDS_pept        complement(753081..753269)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmB"
FT                   /locus_tag="LMHCC_0741"
FT                   /product="ribosomal protein L28"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0741"
FT                   /db_xref="EnsemblGenomes-Tr:ACK39095"
FT                   /db_xref="GOA:B8DDT6"
FT                   /db_xref="InterPro:IPR001383"
FT                   /db_xref="InterPro:IPR026569"
FT                   /db_xref="InterPro:IPR034704"
FT                   /db_xref="InterPro:IPR037147"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8DDT6"
FT                   /protein_id="ACK39095.1"
FT                   /translation="MAKECVITGRKSRSGNKRSHAMNSSKRTWKANLQKVRILVNGKPK
FT                   KVWVSARALKSGKVERV"
FT   gene            753568..753933
FT                   /locus_tag="LMHCC_0742"
FT   CDS_pept        753568..753933
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0742"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0742"
FT                   /db_xref="EnsemblGenomes-Tr:ACK39096"
FT                   /protein_id="ACK39096.1"
FT                   /translation="MAIEIDTKLGKIDITSDVIATIAGGAAEENFGIVGMASRHQIRDG
FT                   LTDILRRENYTKGVIVRQEEEGIHIDMYIIVSFGTKISEVAHNVQERVKYTLEKTLGIT
FT                   VESVNIYVQGVRVIKES"
FT   gene            753948..755606
FT                   /locus_tag="LMHCC_0743"
FT   CDS_pept        753948..755606
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0743"
FT                   /product="DAK2 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0743"
FT                   /db_xref="EnsemblGenomes-Tr:ACK39097"
FT                   /protein_id="ACK39097.1"
FT                   /translation="MSIYQLDSEKFAAMIALGAENLAKNADFVDSLNVFPVPDGDTGTN
FT                   MNLSMTSGAEEVAKNDKETISAVGANLAKGLLMGARGNSGVILSQLFRGFSKAIENKET
FT                   LNAEEFAGAFVKGVETAYKAVMKPVEGTILTVAREAAKAGVAAASEHQDIELVMEAILK
FT                   QGKVALEKTPDLLPVLKEVGVVDSGGQGLIIIYEGFYGALTGKMAEAPDYMASMGELIN
FT                   AEHHRHVQDFMSTEDIHFGYCTEIIVKINENKPGQKPFDEEQFRQDLSKLGDSLLVAAD
FT                   DEVVKVHVHVEHPGEVLNYGQQYGSLLKMKVENMREQHNEIVGDDKAPAKEKAAYGIVT
FT                   VSAGEGLKKLFESMGVSVVLSGGQTMNPSTEDIVKAIESANAEQVFVLPNNKNIQMAAE
FT                   QAAQILGDDKVQIIPTKTIPQGLTAVLSFQADQDFLANAEAMRAAIEDVASGQVTTAVR
FT                   DTTVEGVEIKKDSFIGMVEGKIKVSCATLEEAAYETLEKLLDDDSEIVTIIVGEDSDTS
FT                   KAETLADKVTEAFPDVEVEIHEGDQPVYPYIFAVE"
FT   gene            755637..756308
FT                   /gene="sdaAB"
FT                   /locus_tag="LMHCC_0744"
FT   CDS_pept        755637..756308
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sdaAB"
FT                   /locus_tag="LMHCC_0744"
FT                   /product="L-serine dehydratase, iron-sulfur-dependent, beta
FT                   subunit"
FT                   /EC_number="4.3.1.17"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0744"
FT                   /db_xref="EnsemblGenomes-Tr:ACK39098"
FT                   /protein_id="ACK39098.1"
FT                   /translation="MILVKFNSVFDIIGPVMIGPSSSHTAGASRIGAIARAVFNEQPSQ
FT                   VDIHLYGSFAKTYKGHGTDVALIGGLLGFEPDDPRMKESPKLAEEWGMRIQFIEEVEEP
FT                   PHPNTVKLVLKHGMQQMTLIGASIGGGKVEIIRLNEFELEFTGTAPAILILHQDKFGAI
FT                   AAVSSVIADHKINIGQMKVSRKVKGDEALMVIEVDQHVEQALISKIAELPGIYQVASVM
FT                   I"
FT   gene            756455..757345
FT                   /gene="sdaAA"
FT                   /locus_tag="LMHCC_0745"
FT   CDS_pept        756455..757345
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sdaAA"
FT                   /locus_tag="LMHCC_0745"
FT                   /product="L-serine dehydratase, iron-sulfur-dependent,
FT                   alpha subunit"
FT                   /EC_number="4.3.1.17"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0745"
FT                   /db_xref="EnsemblGenomes-Tr:ACK39099"
FT                   /protein_id="ACK39099.1"
FT                   /translation="MFRTVAELVDIAERENLTIAEIMIKREMNISGLPREEITAAMERN
FT                   LDIMEEAIREGEAGVTSTTGLTGGDAVLMQDYIKKGNFLSGEVLLDSVAKAIATNEVNA
FT                   SMGVICATPTAGSAGVVPGVLFSLKDRLEMSREDMVNFLFTAGALGYVVANNAFISGAA
FT                   GGCQAEIGSASAMASAAIVAAAGGTPEQSAHAMAMTMKNMLGLVCDPVAGLVEVPCVKR
FT                   NALGSSQAIISADMALAGIKSRIPCDEVIEAMHRVGLQMPSSLRETAEGGLAATPTGRA
FT                   IQRKIFGLSPEDKRE"
FT   gene            757338..759386
FT                   /gene="recG"
FT                   /locus_tag="LMHCC_0746"
FT   CDS_pept        757338..759386
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recG"
FT                   /locus_tag="LMHCC_0746"
FT                   /product="ATP-dependent DNA helicase RecG"
FT                   /EC_number="3.6.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0746"
FT                   /db_xref="EnsemblGenomes-Tr:ACK39100"
FT                   /protein_id="ACK39100.1"
FT                   /translation="MSELKRIPTTEIKGIGEETAKTLKELGLSTVHDLLWNFPYRYEDY
FT                   RLRDLSEVAHEERITIQGEVLTEATVAFYGRKKSKLSFRVSTEGQVIKIDFFNQPYLKS
FT                   KISVGETVTISGKWDKSRAQVTASKIKIGAVENEEELEGVYRLKGTLRNKTMQKYTRLA
FT                   FDSYSQDIEEVIPSNLLEKYQLMDRLEAVRILHFPKNNEELKQARRRMVYEEFLLFQLK
FT                   MQFFRKIEREKSGGISINYDVEDLRHYIDSLPFPLTKAQKRVVNEICGDMLSHFHMNRL
FT                   LQGDVGSGKTVVASIAMYAAAKSGFQSALMVPTEILAEQHANSLVELLQPFDITVGLLT
FT                   SSVKGKQRRELLAMLENGSIDVLIGTHALIQDEVIYHRLGLVITDEQHRFGVAQRRVLR
FT                   EKGEYPDVLFMTATPIPRTLAITAFGEMDVSIIDELPAGRKEIETYWVKHQMLDRVIGF
FT                   MEKEIDKGHQVYIICPLIEESEKLDVQNAIDVFNILQNKWGTKYIPGLMHGKLLPADKE
FT                   QIMRDFNDKKIDCLVSTTVVEVGVNVPNATMMVIYDADRFGLAQLHQLRGRVGRGADQS
FT                   YCILIADPKTEVGKERMMIMSETNDGFVVSERDLELRGPGDFFGRKQSGVPEFKVADMV
FT                   HDYRVLEIARQDAVHMIFEEGMLENKNYEKLVALLEEEGVFTEQKLD"
FT   gene            759567..760136
FT                   /locus_tag="LMHCC_0747"
FT   CDS_pept        759567..760136
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0747"
FT                   /product="transcription factor FapR (Fatty acid and
FT                   phospholipid biosynthesisregulator)"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0747"
FT                   /db_xref="EnsemblGenomes-Tr:ACK39101"
FT                   /db_xref="GOA:B8DDU2"
FT                   /db_xref="InterPro:IPR017275"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8DDU2"
FT                   /protein_id="ACK39101.1"
FT                   /translation="MKKYSKKDRQMKLQVAIEENPFITDEQLAEKFGVSVQTIRLDRVA
FT                   LSIPELRERIKHVASVTYADAVKSLPIDEVIGEIIDIQLSKSAISIFDVRSEHVFKRNK
FT                   IARGHHLFAQANSLATAVIPNEIALTTQATVRFVRSVNEGERIIAKAKVRPATDNRAIT
FT                   IVDVKSYVGDEIVLKGKFEMYHATQK"
FT   gene            760157..761170
FT                   /gene="plsX"
FT                   /locus_tag="LMHCC_0748"
FT   CDS_pept        760157..761170
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="plsX"
FT                   /locus_tag="LMHCC_0748"
FT                   /product="fatty acid/phospholipid synthesis protein PlsX"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0748"
FT                   /db_xref="EnsemblGenomes-Tr:ACK39102"
FT                   /db_xref="GOA:B8DDU3"
FT                   /db_xref="InterPro:IPR003664"
FT                   /db_xref="InterPro:IPR012281"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8DDU3"
FT                   /protein_id="ACK39102.1"
FT                   /translation="MKIAVDAMGGDHAPKEIVLGVMKAVAQYKDVEILLFGDETKINEY
FT                   LTDKTRVKIIHTDEKIESDDEPVRAVKRKKKASMVLAAQAVKDGEADACISAGNTGALM
FT                   STGLFVIGRIKGIDRPALAPTLPTVTGKGFVMLDLGANAEAKPEHLLQFGLMGSVYAEK
FT                   VRKIDRPRVALLNIGTEETKGNDLTKKSFELMKNQDAYEFIGNIEARDLLMDVADVVVT
FT                   DGFTGNMVLKSIEGTGAAFLSMLKMSLLNGFKNKVAASFLKKDLMALKAKMDYSEYGGA
FT                   CLFGVQAPVVKAHGSSNANGIFTTIRQVREMVEKQVVETIKAEVDKVKVGGTESND"
FT   gene            761163..762104
FT                   /gene="fabD"
FT                   /locus_tag="LMHCC_0749"
FT   CDS_pept        761163..762104
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fabD"
FT                   /locus_tag="LMHCC_0749"
FT                   /product="malonyl CoA-acyl carrier protein transacylase"
FT                   /EC_number="2.3.1.39"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0749"
FT                   /db_xref="EnsemblGenomes-Tr:ACK39103"
FT                   /protein_id="ACK39103.1"
FT                   /translation="MTKIAFVFPGQGAQKIGMGQDVAAEYPEAKKIYDDADERLGFSIT
FT                   EIITEGPIELLTKSENAQPALVSTSVAILRALETYGVKADYVAGHSLGEYSALVAGGFL
FT                   EASDAIYLVRKRGELMEAAVPNGAGAMAAVLGVDRETLKTITEEVTKEGDAVQLANLNC
FT                   PGQIVISGTTAGVEKAGEKAKESGAKRVLPLAVSGPFHSSLMEPAALAFRDVLAEVKIS
FT                   DGQIPVVNNVDAKETTDKSEISDKLIKQIYSPVLWEDIVEELIKNGVDTFVEIGSGKVL
FT                   AGLIKKINRDVTVLSAGDAESVKSVAATLKGE"
FT   gene            762108..762851
FT                   /gene="fabG"
FT                   /locus_tag="LMHCC_0750"
FT   CDS_pept        762108..762851
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fabG"
FT                   /locus_tag="LMHCC_0750"
FT                   /product="3-oxoacyl-(acyl-carrier-protein) reductase"
FT                   /EC_number="1.1.1.100"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0750"
FT                   /db_xref="EnsemblGenomes-Tr:ACK39104"
FT                   /protein_id="ACK39104.1"
FT                   /translation="MTLQGKVAVVTGGSRGIGRDIAIKLAKEGANIFFNYNGSPEAAEE
FT                   TAKLVAEHGVEVEAMKANVAIAEDVDAFFKQAIERFGRVDILVNNAGITRDNLLMRMKE
FT                   DEWDDVININLKGTFLCTKAVSRTMMKQRAGKIINMASVVGLIGNAGQANYVASKAGVI
FT                   GLTKTTARELAPRGINVNAVAPGFITTDMTDKLDEKTKEAMLAQIPLGDYGTTEDIANA
FT                   VLFLASDASKYITGQTLSVDGGMVM"
FT   gene            762958..763191
FT                   /gene="acpP"
FT                   /locus_tag="LMHCC_0751"
FT   CDS_pept        762958..763191
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acpP"
FT                   /locus_tag="LMHCC_0751"
FT                   /product="acyl carrier protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0751"
FT                   /db_xref="EnsemblGenomes-Tr:ACK39105"
FT                   /db_xref="GOA:B8DDU6"
FT                   /db_xref="InterPro:IPR003231"
FT                   /db_xref="InterPro:IPR006162"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8DDU6"
FT                   /protein_id="ACK39105.1"
FT                   /translation="MAEVLEKVTKIIVDRLGVEESKVTLEASFKEDLGADSLDVVELVM
FT                   ELEDEFGVEISDGDAENINTVGDAVKYIEANA"
FT   gene            763224..763367
FT                   /locus_tag="LMHCC_0752"
FT   CDS_pept        763224..763367
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0752"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0752"
FT                   /db_xref="EnsemblGenomes-Tr:ACK39106"
FT                   /protein_id="ACK39106.1"
FT                   /translation="MLLIFAVVTSAREMSNAGGLFFKVTRFVGSFSKQLFASGCLENEL
FT                   AY"
FT   gene            763385..764074
FT                   /gene="rnc"
FT                   /locus_tag="LMHCC_0753"
FT   CDS_pept        763385..764074
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rnc"
FT                   /locus_tag="LMHCC_0753"
FT                   /product="ribonuclease III"
FT                   /EC_number="3.1.26.3"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0753"
FT                   /db_xref="EnsemblGenomes-Tr:ACK39107"
FT                   /db_xref="GOA:B8DDU8"
FT                   /db_xref="InterPro:IPR000999"
FT                   /db_xref="InterPro:IPR011907"
FT                   /db_xref="InterPro:IPR014720"
FT                   /db_xref="InterPro:IPR036389"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8DDU8"
FT                   /protein_id="ACK39107.1"
FT                   /translation="MNQWEELQESVGFDFKDVELLKQAFTHSSYVNEHRRENVKDNERL
FT                   EFLGDAVLELTVSDYLFNKYPDMAEGHMTKMRAAIVCEPSLVEFAEAVHFSKYVRLGKG
FT                   EEKAGGRTRPALLADVFESFIGALYLDNGIDKVVTFLERVIFPKIDAGAYLQTVDYKTQ
FT                   LQEIVQRDRDVLIEYDILGETGPAHNKAFDAQVIVNGQVLGKGSGRTKKQAEQSAAQFA
FT                   INQLTHR"
FT   gene            764097..767657
FT                   /gene="smc"
FT                   /locus_tag="LMHCC_0754"
FT   CDS_pept        764097..767657
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="smc"
FT                   /locus_tag="LMHCC_0754"
FT                   /product="chromosome segregation protein SMC"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0754"
FT                   /db_xref="EnsemblGenomes-Tr:ACK39108"
FT                   /protein_id="ACK39108.1"
FT                   /translation="MLLKRLEMNGFKSFADKVAIDFVPGMTAVVGPNGSGKSNITEAIR
FT                   WVLGEQSAKSLRGGRMGDVIFAGSDTRKPINFAEVSLILENEDHFLPLDYSEVAVTRRI
FT                   YRNGDSEFLINKENCRLKDIVDLFMDSGLGRESFSIISQGKIDEILNSKPEERRSIFEE
FT                   AAGVLKYKHRKKQAENKLFETEENLNRVQDILYELEGQLEPLEMQASIAKDYLFQQEEL
FT                   EKYEVTLLASEISSLTEKLAEVRKEFGENQTVLIKLREELHAEEAVISREKQALNETDI
FT                   ALDNLQERLLVETEKLEQLEGERNLQLERKKHSSENEQVYAETLAAITEKITALEEQKE
FT                   VLSSSKLEKETALEIAVKAKKELEATLAKYDDLSEEAIENRKSDYIDLRHTQTTINNDL
FT                   GYIERQIGQINSRIDKLDLENSHHVDDRKDMLSQIETTKTHLTKIQSELTEQMEIYREV
FT                   QQTLAKQEAIFGTQERALYKHYETVQQMKSRKETLEELADDYAGFFQGVREVLKAKKEI
FT                   PGILGALVELVEIPAKYQQAMETALGASAQNVVVEDDRVAREAISFLKKTKSGRATFLP
FT                   LSTIQPRELPAATKNALSNQPAFIALASEVISFDEKVSPVILNALGTTILAKDLKGANT
FT                   LARLVNFRYRIVTLEGDVVNAGGSMTGGATKGGKSSILTRKHELGQLAEKIAELNEATR
FT                   EMESAVQLAKDSMAKKREELEETRGIGENLRLQEKELLGKLDRETENLERFNKQLQLYD
FT                   IEKADGSEELNKLLERKETLLHEQVEIAKQIEATDEEIKAMTSSSKALESKRAADLESL
FT                   SSLKAQIAAKREQLQSATEAVERVTTTLHENYEQKEAAEQKLASLKTNLTSVHTSEESA
FT                   RKSIEELRKDKAETSEKLTQTRQTRAELQEKLELLEAELTQKNNQISFYVEQKNNAEIS
FT                   IGRLEVDITNRIDRLQEAYLLTPEQAEEKILPEVNTEQARSKVRLLKRSIDELGIVNIG
FT                   AIEEFERIQERFDFLNGQQADLLAAKETLFKVMDEMDEEMKIRFSESFEAIKTEFAIVF
FT                   PELFGGGSAELVLLDPENLLTTGIDIVVQPPGKKLQNLSLRSGGERALTAIALLFAIIR
FT                   VRPVPFCILDEVEAALDEANVTRFSRYLKQFESGTQFIVITHRKGTMEEADVLYGVTMQ
FT                   ESGVSKLVSVRLEETAELIK"
FT   gene            767672..768658
FT                   /gene="ftsY"
FT                   /locus_tag="LMHCC_0755"
FT   CDS_pept        767672..768658
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsY"
FT                   /locus_tag="LMHCC_0755"
FT                   /product="signal recognition particle-docking protein FtsY"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0755"
FT                   /db_xref="EnsemblGenomes-Tr:ACK39109"
FT                   /protein_id="ACK39109.1"
FT                   /translation="MTFFKKLKDKITQQTDSVSGKFKDGLSKTRGNFSGKINEMVARYR
FT                   KVDEDFFEELEEILIGADVGFETVMELVDTLRREVQLRNISDPKDVQEVIVEKLVEIYQ
FT                   GDEKEDEALHIEEDGLTVILFVGVNGVGKTTSIGKMAHRFKQEGKKVMLAAGDTFRAGA
FT                   IDQLEVWGERTGVDVIKQAEGSDPAAVMFDAVQAAKARKADVLLCDTAGRLQNKVNLMN
FT                   ELEKVKRVITREIPNAPHEVLLVLDATTGQNAFVQAKQFKETTDVTGIILTKLDGTAKG
FT                   GIVIAIRNELDIPVKFVGLGEQMDDLQAFDANEYVYGLFADMVDNEK"
FT   gene            768792..769103
FT                   /locus_tag="LMHCC_0756"
FT   CDS_pept        768792..769103
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0756"
FT                   /product="Putative helix-turn-helix protein, YlxM /
FT                   p13-like protein"
FT                   /note="Putative helix-turn-helix protein, YlxM / p13 like"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0756"
FT                   /db_xref="EnsemblGenomes-Tr:ACK39110"
FT                   /protein_id="ACK39110.1"
FT                   /translation="MNLLFDFYQELLTTKQKAYVSFYYLDDYSLGEIAEEFEVSRQAIY
FT                   DNIKRTEESLEKYEEKLGMLKKYQQREKLFSQLEAQLTKKNFLDEQVKDTLEQLKNID"
FT   gene            769116..770468
FT                   /gene="ffh"
FT                   /locus_tag="LMHCC_0757"
FT   CDS_pept        769116..770468
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ffh"
FT                   /locus_tag="LMHCC_0757"
FT                   /product="signal recognition particle protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0757"
FT                   /db_xref="EnsemblGenomes-Tr:ACK39111"
FT                   /protein_id="ACK39111.1"
FT                   /translation="MAFEGLAGRLQETMNKIRGKGKVNEADVKEMMREVRLALLEADVN
FT                   FKVVKQFIKTVSERAVGADVLKSLTPGQQVIKIVQEELTSLMGGEESKIGTADRPPTVI
FT                   MMVGLQGAGKTTTSGKLANLLRKKYNRKPLLVAADIYRPAAIKQLETLGKQLDMPVFFL
FT                   GDQVSPVEIAKQAIAKAKEEHLDYVIIDTAGRLHIDETLMDELKQVKEIATPTEILLVV
FT                   DSMTGQDAVNVAQSFNEQLEITGVVLTKLDGDTRGGAALSIRSVTGKPIKFIATGEKME
FT                   ALETFHPDRMASRILGMGDVLSLIEKAQTDVDAEKMKAMEQKMKDNSMTLDDFLDQLQQ
FT                   VKQMGPLDELLKMMPGANKMKGLDNMNVDDKQLGHIEAIIKSMTKNEKDNPDIINASRR
FT                   KRIARGSGRPVQEINRLLKQFAEMKKMMKQMTGGGKGKKGKNPFGNFKMPF"
FT   gene            770610..771557
FT                   /locus_tag="LMHCC_0758"
FT   CDS_pept        770610..771557
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0758"
FT                   /product="protein-tyrosine phosphatase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0758"
FT                   /db_xref="EnsemblGenomes-Tr:ACK39112"
FT                   /protein_id="ACK39112.1"
FT                   /translation="MKHWVKVTGAGILGATILLGGCGAQSEEKAEANVKTEQTLKPGSQ
FT                   IKLEGAVNVRDLGGYKTTDGLTIKPHKLIRSAELANLSDSDKKKLVNTYNLSHIVDFRT
FT                   NSEVAAKPDPKLTDVDYTHDSVMKDNGASTSTQDLTASLAKMDNPETFLINANKSFITD
FT                   ETSIQAYKEFFDILLANQDGSVLWHCTAGKDRAGFGTALVLSALGVDKNTVIDDYMLSN
FT                   KYRADENKKAIEAVAAKTDNKKVIDGMTAIMEVRESYINAAFDEIDAKYGSMDNFLKEK
FT                   LGLTDAKKEQLKKPIFIKKVSPLKRAFFLRTNRI"
FT   gene            771983..774871
FT                   /locus_tag="LMHCC_0759"
FT   CDS_pept        771983..774871
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0759"
FT                   /product="peptidoglycan bound protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0759"
FT                   /db_xref="EnsemblGenomes-Tr:ACK39113"
FT                   /protein_id="ACK39113.1"
FT                   /translation="MMKKQRVDYKRRLDQKRAQKAKLIAALITTTTMMVAPVTVNYDSF
FT                   NHQFALSGIQADAATVDLLGNSNLNTQYSNGKLVITLSGNQLVSASAISTYYPYFELPS
FT                   ELSSILSNPNIRANTKIDYKIAYLGIGGIGLFNQGTVNGSNSSNFFIDTSRNAIGAKVN
FT                   HLLGVGVGSVSTFTLTIDLLALGVTALPSANDGKLDFAARTGDGLLDVDLLNSNAARGF
FT                   ITTDVGDADADADADADADADADADADADADADADADADADADADADADADADADADAD
FT                   ADADADADADADADADADADADADADADADADADADADADADADADADADADADADADA
FT                   DADADADADADADADADADADADADADADADADADADADADADADADADADADADADAD
FT                   ADADADADADADADADADADADADADADADADADADADADADADADADADADADADADA
FT                   DADADADADADADADADADADADADADADADADADADADADADADADADADADADADAD
FT                   ADADADADADADADADADADADADADADADADADADADADADADADADADADADADADA
FT                   DADADADADADADADADADADADADADADADADADADADADADADADADADADADADAD
FT                   ADADADADADADADADADADADADADADADADADADADADADADADADADADADADADA
FT                   DADADADADADADADADADADADVDIDWRDFLVEKPTVNPIYEGTKTITGSSIYKNMNI
FT                   NALLKSLQSDAPAGTTFYINLTLPDGTVIGNVLIHADGTYTINIPNYNLKAGDVIHLQV
FT                   TAKYGNEVKTSEDVAVTVLPLADSDADADADADADADADADADADADADADADADADAD
FT                   ADADADADGGTNPSTNGGTTGTSNGGTGITVTNMSSNGSGTMLSSGYSADGTTSISASD
FT                   LPSTGDTNSSLPWVGLGLFSLAGAFLLRLFRK"
FT   gene            774945..776603
FT                   /locus_tag="LMHCC_0760"
FT   CDS_pept        774945..776603
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0760"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0760"
FT                   /db_xref="EnsemblGenomes-Tr:ACK39114"
FT                   /protein_id="ACK39114.1"
FT                   /translation="MPWRGILDELENKIIDQLTEDEEHATYNGKWHGFLTIGYKNKRAI
FT                   VINFSYLCLANLINEMKKSAIKNQTEEAISFKIDVAVDYQLENLGEWNKKALKTKKNYY
FT                   RRGIALNENFKIALMEQEINANAILLPGDEGLAINVENMNRYLIQTNKNQAQLNLTVDS
FT                   TIVTFNTIGWFFDGKKIHVLETTELEHGHRNTEQLTPDNVSELVKHAGNYLTRQVNQTG
FT                   EFNYGWFACFDKKIKHYNSLRHASTTYSMLEAFELTGEKAILEAATKALTYLEQNFIYE
FT                   KEDLAFLIEPELREVKLGGSAATLLALTKYMKITGTKTYLPLCRKIANAILSLQDADGK
FT                   FTHVLEYPSLEVKDIFRIIYYDGEAVFGLLRLYEIDRDSKWLDAAAKSFDHFIRDNYWQ
FT                   NHDHWLSYCANEITKYLPDEAYYEFGLKNAFDNLSFIYERETTFPTFLELTVATKEMSL
FT                   RMGKEGLDALLRGYSLDELEKTITKRALYQLNGYFYPELAMYYKNPARIEGSFFIRHQS
FT                   FRVRIDDVEHNISGYVRYYHLLKQGEISAEAETVK"
FT   gene            776706..776978
FT                   /gene="rpsP"
FT                   /locus_tag="LMHCC_0761"
FT   CDS_pept        776706..776978
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsP"
FT                   /locus_tag="LMHCC_0761"
FT                   /product="ribosomal protein S16"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0761"
FT                   /db_xref="EnsemblGenomes-Tr:ACK39115"
FT                   /db_xref="GOA:B8DDV6"
FT                   /db_xref="InterPro:IPR000307"
FT                   /db_xref="InterPro:IPR023803"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8DDV6"
FT                   /protein_id="ACK39115.1"
FT                   /translation="MAVKIRLKRIGSKKKPFYRIVVADSRFPRDGRSIETIGTYNPLLD
FT                   PVEVKIDEEATLKWMHNGAKPSDTVRNLLSREGIMEKFHNQKLGK"
FT   gene            776995..777225
FT                   /locus_tag="LMHCC_0762"
FT   CDS_pept        776995..777225
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0762"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0762"
FT                   /db_xref="EnsemblGenomes-Tr:ACK39116"
FT                   /protein_id="ACK39116.1"
FT                   /translation="MEELILSIVKPLVDHPEDVVITPEETDTSLTYKLSVSKEDMGRVI
FT                   GKQGRIAKAIRTLVYAVGSKNDKKIRLEIIE"
FT   gene            777336..778070
FT                   /locus_tag="LMHCC_0763"
FT   CDS_pept        777336..778070
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0763"
FT                   /product="glutamine amidotransferase, class-I"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0763"
FT                   /db_xref="EnsemblGenomes-Tr:ACK39117"
FT                   /protein_id="ACK39117.1"
FT                   /translation="MKPVIGITGNRLVKGVDVFYGHRVTYTQQRYVDAIQKVGGFPIAL
FT                   PIDDPSVAVQAISLVDGLLLTGGQDITPQFYLEEPSQEIGAYFPPRDSYEIALVRAALD
FT                   AGKPIFAICRGMQLVNVALGGSLYQDISQVETKALQHLQRVDEQLGSHTIDIEPTSELA
FT                   KHHPNKKLVNSLHHQFIKKLAPSFKVTARTADGMIEAVEGDNLPSWYLGVQWHPELMFQ
FT                   TDPESEQLFQALVDESKKTMVK"
FT   gene            778098..778484
FT                   /locus_tag="LMHCC_0764"
FT   CDS_pept        778098..778484
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0764"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0764"
FT                   /db_xref="EnsemblGenomes-Tr:ACK39118"
FT                   /protein_id="ACK39118.1"
FT                   /translation="MEIIQKVVVKQILTEASKQELIEYYTEQKRQIEQECDQLHFEQKK
FT                   MERKSKFQPERVADYFTHELDLRREKKKLIQFQMEQLEVLELGSEIREREMETIIDVQV
FT                   GDKWDKSIFDKTIVVKDGIIVEIR"
FT   gene            778494..779012
FT                   /gene="rimM"
FT                   /locus_tag="LMHCC_0765"
FT   CDS_pept        778494..779012
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rimM"
FT                   /locus_tag="LMHCC_0765"
FT                   /product="16S rRNA processing protein RimM"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0765"
FT                   /db_xref="EnsemblGenomes-Tr:ACK39119"
FT                   /db_xref="GOA:B8DDW0"
FT                   /db_xref="InterPro:IPR002676"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR011033"
FT                   /db_xref="InterPro:IPR011961"
FT                   /db_xref="InterPro:IPR027275"
FT                   /db_xref="InterPro:IPR036976"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8DDW0"
FT                   /protein_id="ACK39119.1"
FT                   /translation="MEKMYNVGKIVNTHGLIGEIRVIATTDFPEERFQVGNTVYLFEKN
FT                   SKKPEKLIIRSHRKHKNFDLLMFEGFTGIHQVERMKEGVLKIKEAQLTDLEENEFYFHE
FT                   IIGCTVVTTDGEELGEITEILTPGANDVWVVKGSDKKEKLIPYIADVVKEININDKKIT
FT                   IEVMEGLLD"
FT   gene            779012..779749
FT                   /gene="trmD"
FT                   /locus_tag="LMHCC_0766"
FT   CDS_pept        779012..779749
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trmD"
FT                   /locus_tag="LMHCC_0766"
FT                   /product="tRNA (guanine-N1)-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0766"
FT                   /db_xref="EnsemblGenomes-Tr:ACK39120"
FT                   /db_xref="GOA:B8DDW1"
FT                   /db_xref="InterPro:IPR002649"
FT                   /db_xref="InterPro:IPR016009"
FT                   /db_xref="InterPro:IPR023148"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8DDW1"
FT                   /protein_id="ACK39120.1"
FT                   /translation="MKIDILSIFPDMFSGVTGNSIIKKAIENERVAVEVTDFREYAEGK
FT                   HHIVDDYPYGGGAGMLLKAQPIFDAVQAVKEKQPETKPRVILMDPAGKRFDQKMAEEFA
FT                   EEEHLVFICGHYEGYDERIREHLVTDEVSIGDYILTGGEIGAMIVMDSVIRLLPGVLGN
FT                   KDSAVTDSFSTGLLEHPHYTRPADFRGMKVPDILLSGNHAWIEEWRDKESLKRTYERRP
FT                   DLLKNYPLTDKQKTWLKEWSDSK"
FT   gene            779769..780158
FT                   /locus_tag="LMHCC_0767"
FT   CDS_pept        779769..780158
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0767"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0767"
FT                   /db_xref="EnsemblGenomes-Tr:ACK39121"
FT                   /protein_id="ACK39121.1"
FT                   /translation="MAIFGTPDEKETKKSERQKEREAYVQEENDQKRIGQRWQDIQVST
FT                   GPINVNHDILTVVFAKSVRPRIKSDPEAYLETVGFENLLQELQKKALDAGGNGLIHCSF
FT                   TEQFVDGLVYQLAYGTAVNIKITRF"
FT   gene            complement(780189..780905)
FT                   /locus_tag="LMHCC_0768"
FT   CDS_pept        complement(780189..780905)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0768"
FT                   /product="metallo-beta-lactamase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0768"
FT                   /db_xref="EnsemblGenomes-Tr:ACK39122"
FT                   /protein_id="ACK39122.1"
FT                   /translation="MKITAKHQYWQITTLPYLFPVNCYLILEKDGLTLIDTGILAHAKG
FT                   IISLIHKLKLPLKRILLTHAHGDHIGGLVAVKAAFPEALVMIGSREKLLVETKKIYAFE
FT                   AQKPLKGSYSDKLPAKVDQVLKDGDMVGSLLIIDTPGHTPGSISFFDERNGHLFVGDLF
FT                   QTRGGAAICGEKRWLFPFPAMGSWDLSTSIASAEKLQLLDVTEIACGHGPVMNMADFNV
FT                   TNVLQRARKQVENEKD"
FT   gene            complement(780902..781513)
FT                   /locus_tag="LMHCC_0769"
FT   CDS_pept        complement(780902..781513)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0769"
FT                   /product="NADPH-dependent fmn reductase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0769"
FT                   /db_xref="EnsemblGenomes-Tr:ACK39123"
FT                   /protein_id="ACK39123.1"
FT                   /translation="MAKVVAIIGDPREKGTSRDLFQKYLAVFQEQPTIEVKIYDIREVA
FT                   FDPNLPEGYRTEQTPDIIALKNDVRSADLLLFSYPVWWFNVPAVLKGVIDHLFWRGESY
FT                   SFRDKKYFLTGPWRKKRARLIYTIGGMEIQHRLFARPALTALRYPLWMSGVFSVKVTSI
FT                   DRLDLSIRRTDDYYDKKVTRAAKRDIQFLLKKQIRKKVFA"
FT   gene            complement(781513..781947)
FT                   /locus_tag="LMHCC_0770"
FT   CDS_pept        complement(781513..781947)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0770"
FT                   /product="transcriptional regulator, MerR family"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0770"
FT                   /db_xref="EnsemblGenomes-Tr:ACK39124"
FT                   /protein_id="ACK39124.1"
FT                   /translation="MEQWTVKEMAAYVGISADTLRYYEKNKIIVPNRLENGYRVYNAEH
FT                   LLELKFILVMKYARFSLSEIKLMMEWLRSEPSVACNTASKELLALKAAEIKQTIAHYTK
FT                   IAALLEELPQIDEVQDYSTVQKDVNTFVEHIFTDIRKDGF"
FT   gene            782155..782499
FT                   /gene="rplS"
FT                   /locus_tag="LMHCC_0771"
FT   CDS_pept        782155..782499
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplS"
FT                   /locus_tag="LMHCC_0771"
FT                   /product="ribosomal protein L19"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0771"
FT                   /db_xref="EnsemblGenomes-Tr:ACK39125"
FT                   /db_xref="GOA:B8DDW6"
FT                   /db_xref="InterPro:IPR001857"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR018257"
FT                   /db_xref="InterPro:IPR038657"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8DDW6"
FT                   /protein_id="ACK39125.1"
FT                   /translation="MNKLIDEITKSQLNPDVPNFRPGDTVRVHAKVVEGTRERIQLFEG
FT                   VVIKRRGAGISETFTVRKISNSVGVERTFPVHTPRIAKLEVIRRGKVRRAKLYYLRNLR
FT                   GKAARIKEIR"
FT   gene            783015..783548
FT                   /locus_tag="LMHCC_0772"
FT   CDS_pept        783015..783548
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0772"
FT                   /product="matrixin superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0772"
FT                   /db_xref="EnsemblGenomes-Tr:ACK39126"
FT                   /protein_id="ACK39126.1"
FT                   /translation="MRKKTLAVFLVFTVLVALLAPTNANAYTKLGRVMTKASAKNFKIY
FT                   INGSAKGFKNIIISGAKSWNPSPYLNTVSVGNDVKPNFTVSSSNTNKGSVLAVCNSTYN
FT                   TSNKLISKNEITLYKGFRSLSNNHKIETVAHEFGHGFGLGHVKTRNAIMLDKGFINKTK
FT                   PQTDDFNGIKSLYK"
FT   gene            783564..784223
FT                   /locus_tag="LMHCC_0773"
FT   CDS_pept        783564..784223
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0773"
FT                   /product="lipoprotein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0773"
FT                   /db_xref="EnsemblGenomes-Tr:ACK39127"
FT                   /protein_id="ACK39127.1"
FT                   /translation="MKRKITMIICLVSLSLLTACSNSKSVKEKPVEEQTSQSGSETIES
FT                   RNGVVSSHGKYLELAEDVNALEKDAPIIIKATKKSEKVTVTKETKENVFPTDFYTMSDV
FT                   QINSIEKDTTGKLKENMTIKVLEYSVENVTVDGEEYDLTIDGYKNMEKGEAYTLFLEKN
FT                   PDGDNYILSNAIISKFPVEELPKEELFLDGGDPTEETVVIEEIYQEVYEDVLKEYN"
FT   gene            complement(784350..784502)
FT                   /locus_tag="LMHCC_0774"
FT   CDS_pept        complement(784350..784502)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0774"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0774"
FT                   /db_xref="EnsemblGenomes-Tr:ACK39128"
FT                   /protein_id="ACK39128.1"
FT                   /translation="MGFKKLFSILERSFFIISLFVISKGLPSMRGAAELIEKAYELYFY
FT                   SWLFI"
FT   gene            complement(784510..784767)
FT                   /locus_tag="LMHCC_0775"
FT   CDS_pept        complement(784510..784767)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0775"
FT                   /product="phage super infection exclusion"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0775"
FT                   /db_xref="EnsemblGenomes-Tr:ACK39129"
FT                   /protein_id="ACK39129.1"
FT                   /translation="MMKMSKAGIYDQLTSEAGEKFSAEAGKYAIDNLKADYNANALAKA
FT                   EDYQKTMAMAPEAIRDQLTSSAGEKFTAEEADYAIQNLSK"
FT   gene            complement(784791..785057)
FT                   /locus_tag="LMHCC_0776"
FT   CDS_pept        complement(784791..785057)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0776"
FT                   /product="prophage Lp1 protein 5"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0776"
FT                   /db_xref="EnsemblGenomes-Tr:ACK39130"
FT                   /protein_id="ACK39130.1"
FT                   /translation="MEKGKQKKPLYKKWWFWLIVVIAVGAIGSALGGNDTAADDTKNTE
FT                   KVETKKVDKADDEAKKKEEKAAEEKKAEEKKKKKAFHLNINQL"
FT   gene            785591..786094
FT                   /gene="infC"
FT                   /locus_tag="LMHCC_0777"
FT   CDS_pept        785591..786094
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="infC"
FT                   /locus_tag="LMHCC_0777"
FT                   /product="translation initiation factor IF-3"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0777"
FT                   /db_xref="EnsemblGenomes-Tr:ACK39131"
FT                   /protein_id="ACK39131.1"
FT                   /translation="MLVNDGIRAREVRLIDQDGEQLGVKSKIDALQIAEKANLDLVLVA
FT                   PTAKPPVARIMDYGKFRFEQQKKDKEARKNQKVIVMKEVRLSPTIDEHDFDTKLRNARK
FT                   FLEKGDKVKCSIRFKGRAITHKEIGQKVLDRFAKACEDLCTIEQRPKMDGRSMFLVLAP
FT                   LHEK"
FT   gene            786116..786316
FT                   /gene="rpmI"
FT                   /locus_tag="LMHCC_0778"
FT   CDS_pept        786116..786316
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmI"
FT                   /locus_tag="LMHCC_0778"
FT                   /product="ribosomal protein L35"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0778"
FT                   /db_xref="EnsemblGenomes-Tr:ACK39132"
FT                   /db_xref="GOA:B8DDX3"
FT                   /db_xref="InterPro:IPR001706"
FT                   /db_xref="InterPro:IPR018265"
FT                   /db_xref="InterPro:IPR021137"
FT                   /db_xref="InterPro:IPR037229"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8DDX3"
FT                   /protein_id="ACK39132.1"
FT                   /translation="MPKMKTHRGSAKRFKRTGSGKLKRRHGFTSHMFANKSQKQKRKLR
FT                   KSAMVSAGDFKRIRQMVAKMK"
FT   gene            786356..786715
FT                   /gene="rplT"
FT                   /locus_tag="LMHCC_0779"
FT   CDS_pept        786356..786715
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplT"
FT                   /locus_tag="LMHCC_0779"
FT                   /product="ribosomal protein L20"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0779"
FT                   /db_xref="EnsemblGenomes-Tr:ACK39133"
FT                   /protein_id="ACK39133.1"
FT                   /translation="MPRVKGGTVTRKRRKKIVKLAKGYYGSKHLLFKVANQAVMKSYQY
FT                   AYRDRRQKKRDFRRLWIARINAAARMQDLSYSKLMHGLKLAGIDINRKMLADLAVNDIA
FT                   SFNTLADSAKKALAK"
FT   gene            complement(786756..787511)
FT                   /gene="xth"
FT                   /locus_tag="LMHCC_0780"
FT   CDS_pept        complement(786756..787511)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="xth"
FT                   /locus_tag="LMHCC_0780"
FT                   /product="exodeoxyribonuclease III"
FT                   /EC_number="3.1.11.2"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0780"
FT                   /db_xref="EnsemblGenomes-Tr:ACK39134"
FT                   /protein_id="ACK39134.1"
FT                   /translation="MKLISWNVNGLRAAVKKGFLEYFEEVDADIFCLQETKLQEGQIEL
FT                   DLPAYKDYWNYAVKKGYSGTAIFTKVEPLSVQYGLGVPEHDTEGRVITLEFEEFFMVTV
FT                   YTPNSQAELKRLDYRMTFEDAILEYVKNLDKTKPVVLCGDLNVAHEEIDLKNPKTNRKN
FT                   AGFSDEERAKFSAFLDAGFIDSFRYFYPDLTDAYSWWSYRMNARARNTGWRIDYFVVSE
FT                   RLKDKLVDAKIHADVLGSDHCPVELELNL"
FT   gene            787595..788125
FT                   /locus_tag="LMHCC_0781"
FT   CDS_pept        787595..788125
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0781"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0781"
FT                   /db_xref="EnsemblGenomes-Tr:ACK39135"
FT                   /protein_id="ACK39135.1"
FT                   /translation="MRNYVVLLRAVNVAGKNKVNMKNLQAALQEVGFQNVITYIQSGNL
FT                   VLSSMLQTEPEVATKITEVMKATFDLNIDVFVFSEQNYNQIIANNPFPPETIGEEERWM
FT                   AAFYNENIAIARQKNDQAEVIAIGRVLYIHIFSNQIHTLKLPVFLGEYKKTITTTRNWR
FT                   TTLQLQTLLDSLE"
FT   gene            788183..789415
FT                   /gene="pepT"
FT                   /locus_tag="LMHCC_0782"
FT   CDS_pept        788183..789415
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pepT"
FT                   /locus_tag="LMHCC_0782"
FT                   /product="peptidase T"
FT                   /EC_number="3.4.11.-"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0782"
FT                   /db_xref="EnsemblGenomes-Tr:ACK39136"
FT                   /db_xref="GOA:B8DDX7"
FT                   /db_xref="InterPro:IPR001261"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR010161"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8DDX7"
FT                   /protein_id="ACK39136.1"
FT                   /translation="MKEELLKRFTKYVKVDTQSNEESTVCPTTPGQMELANILVTELKE
FT                   IGMQEVTVDEFGYVMATLPSNTTKEVPVIGFLAHLDTATDLTGKNVQPQVHENYDGKDI
FT                   VLNKDLNVVLSPKQFPELADYKGKTLITTDGTTLLGADDKAGITEIMVAMNYLINHPEI
FT                   KHGKIRVAFTPDEEIGRGPERFDVEAFGAKYAYTMDGGPLGELEYESFNAAGAKITFNG
FT                   NSVHPGTAKNKMVNAVKMAMEFNARIPKDEAPEYTEGYEGFYHLISLNGDVEQAKAYYI
FT                   IRDFDHLKFVERKTHIASIAKELEEKYGEGSVELKLNDQYYNMREKIEPVKEIVDIVSA
FT                   AMRNLDIEPKISPIRGGTDGAQLSYKGLPTPNIFGGGENFHGKFEYVALESMVKATEVI
FT                   IEVARLFEEKE"
FT   gene            complement(789434..789796)
FT                   /locus_tag="LMHCC_0783"
FT   CDS_pept        complement(789434..789796)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0783"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0783"
FT                   /db_xref="EnsemblGenomes-Tr:ACK39137"
FT                   /protein_id="ACK39137.1"
FT                   /translation="MYETMIAKAGVRELLGMDTSLIYGSFAYKMEGEWMDLTGLWISNA
FT                   DALIFYLENEDVYLLKKFAYERIEKVEQKVSILSMTKKLILHLNNKESYTLLVANGEAK
FT                   VFAARVNERIEKVSLG"
FT   gene            complement(789846..790619)
FT                   /locus_tag="LMHCC_0784"
FT   CDS_pept        complement(789846..790619)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0784"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0784"
FT                   /db_xref="EnsemblGenomes-Tr:ACK39138"
FT                   /protein_id="ACK39138.1"
FT                   /translation="MFAFENVYLKRDNKTILSDINWVVNEKENWAILGLNGSGKTTLLQ
FT                   LLNGYLWPSSGRLQVLGHIFGQTSLPELRKAIGWVSNALDHQLKDYELSEQIVLSGKFA
FT                   SIGIYAKVTADELALAKKWLIDCGGISLIGKPYKILSQGERQIVLIARALMASPKLLIL
FT                   DEPCNGLDLFAKERLLERIKKIAELPESPTMLFVTHHTEEILPCFDNIILLRDGEITHH
FT                   GKTENLLTEEVLQDFYQKPVELIRIKDGSIAVYPK"
FT   gene            790685..791290
FT                   /locus_tag="LMHCC_0785"
FT   CDS_pept        790685..791290
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0785"
FT                   /product="HD domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0785"
FT                   /db_xref="EnsemblGenomes-Tr:ACK39139"
FT                   /protein_id="ACK39139.1"
FT                   /translation="MKQEEIIIAAQQWMQSHFEKEATGHDWEHIKRVWHLSKQIQSVEG
FT                   GDKFTIELAALFHDYNDSKLTEDPLQATEIITTWLREKEIPKEVISKIIRIIQAVSFKN
FT                   GKNPIHASTIEEKIVQDADRLDAIGAIGIARTFTYGGAHNREIANQNHPENTTLQHFYD
FT                   KLLLIQDQLKTTTAQEIAVEKQKIMQDFIHALEKELKI"
FT   gene            791635..793172
FT                   /gene="rrsB"
FT                   /locus_tag="LMHCC_R004"
FT   rRNA            791635..793172
FT                   /gene="rrsB"
FT                   /locus_tag="LMHCC_R004"
FT                   /product="16S ribosomal RNA"
FT   gene            793426..796355
FT                   /gene="rrlB"
FT                   /locus_tag="LMHCC_R005"
FT   rRNA            793426..796355
FT                   /gene="rrlB"
FT                   /locus_tag="LMHCC_R005"
FT                   /product="23S ribosomal RNA"
FT   gene            796435..796549
FT                   /gene="rrfB"
FT                   /locus_tag="LMHCC_R006"
FT   rRNA            796435..796549
FT                   /gene="rrfB"
FT                   /locus_tag="LMHCC_R006"
FT                   /product="5S ribosomal RNA"
FT   gene            796677..797201
FT                   /locus_tag="LMHCC_0787"
FT   CDS_pept        796677..797201
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0787"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0787"
FT                   /db_xref="EnsemblGenomes-Tr:ACK39140"
FT                   /db_xref="GOA:B8DDY1"
FT                   /db_xref="InterPro:IPR019264"
FT                   /db_xref="InterPro:IPR022930"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8DDY1"
FT                   /protein_id="ACK39140.1"
FT                   /translation="MDNGIFIVATIFVVNILYVTIYTVRLLLTMKGYRYLAALSSVFEM
FT                   IIYVVALSLVLDNLNNIANVLAYAIGFGVGIIVGMKIEERIALGYITVNVITKEYNLDL
FT                   PNQIRDLGYGVTSWLASGRDGERMMLEILTQRKNERKLYKHIIEIDSGAFIVSSEPKQI
FT                   HGGFWVKQVRK"
FT   gene            797407..797895
FT                   /gene="purE"
FT                   /locus_tag="LMHCC_0789"
FT   CDS_pept        797407..797895
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purE"
FT                   /locus_tag="LMHCC_0789"
FT                   /product="phosphoribosylaminoimidazole carboxylase,
FT                   catalytic subunit"
FT                   /EC_number="4.1.1.21"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0789"
FT                   /db_xref="EnsemblGenomes-Tr:ACK39141"
FT                   /protein_id="ACK39141.1"
FT                   /translation="MPAVIGVIMGSTSDWDTMKKACDVLDELEIAYEKKVVSAHRTPDL
FT                   MFQYAEQARERGLKIIIAGAGGAAHLPGMVAAKTTLPVIGVPIKSKALNGMDSLLSIVQ
FT                   MPGGVPVATVAIGESGAVNAGLLAAQILSITDDAITNRLEKRRATLEETVLESSDSLG"
FT   gene            797888..799012
FT                   /gene="purK"
FT                   /locus_tag="LMHCC_0790"
FT   CDS_pept        797888..799012
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purK"
FT                   /locus_tag="LMHCC_0790"
FT                   /product="phosphoribosylaminoimidazole carboxylase, ATPase
FT                   subunit"
FT                   /EC_number="4.1.1.21"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0790"
FT                   /db_xref="EnsemblGenomes-Tr:ACK39142"
FT                   /protein_id="ACK39142.1"
FT                   /translation="MDKKYLLTNSTIGIIGGGQLGRMLALAAKAMGYRIIVLDPTAECP
FT                   AAQVSDEQIIADYDDKVALRELSEKADVVTYEFENIDYDALKMTQNLVSVPQGSELLSI
FT                   TQDRILEKAYLESANINIAPYAVIVEQDEIESEIKSIGYPAVLKTAQGGYDGKGQVVLH
FT                   DERDIETAARLLRYGSCVLEAWIPFEKEISVVVARNLDGQVETFPVAENVHVNNILHTT
FT                   TAPADVADDVHEEAEEIARKLADVLQLCGVLAVEMFVTSSGAIYVNELAPRPHNSGHFT
FT                   IEACSISQFTQHIRAIVGLPLVKPELLKPALMINILGQHVDDVNKQMVNYPHWFVHYYG
FT                   KKEAKINRKMGHITVLTDEPKAVLQDLEETQIWK"
FT   gene            799031..800323
FT                   /gene="purB"
FT                   /locus_tag="LMHCC_0791"
FT   CDS_pept        799031..800323
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purB"
FT                   /locus_tag="LMHCC_0791"
FT                   /product="adenylosuccinate lyase"
FT                   /EC_number="4.3.2.2"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0791"
FT                   /db_xref="EnsemblGenomes-Tr:ACK39143"
FT                   /protein_id="ACK39143.1"
FT                   /translation="MLERYTRKEMGNIWTEQNRYQAWLEVEILACEAWAELGDIPKEDV
FT                   AKIRANAKFDVDRIHEIELETRHDVVAFTRSVSESLGAERKWVHYGLTSTDVVDTANSY
FT                   LLKQANEILRKDLENFIAIIGEKAKEHKYTVTMGRTHGVHAEPTTFGLKLALWYEEMKR
FT                   NLERFNFAADGVEFGKISGAVGTYANIDPFVEAYVCEKLGTTPAPISTQTLQRDRHAEY
FT                   LATLALIATSVEKFAVEVRALQKSEVREVEEFFAKGQKGSSAMPHKRNPIGSENVTGLA
FT                   RVIRGHMVTAYENVPLWHERDISHSSAERIILPDSTILLDYILNRFGNIVKNLTVFPEN
FT                   MKRNMDRTLGLIYSQRVLLALIDKGLAREAAYDVVQPRAMEAWEKQVPFRELVEQDATI
FT                   TENLSAEEIADCFDYNYHLKNVDLIFDRLGL"
FT   gene            800404..801117
FT                   /gene="purC"
FT                   /locus_tag="LMHCC_0792"
FT   CDS_pept        800404..801117
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purC"
FT                   /locus_tag="LMHCC_0792"
FT                   /product="phosphoribosylaminoimidazole-succinocarboxamide
FT                   synthase"
FT                   /EC_number="6.3.2.6"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0792"
FT                   /db_xref="EnsemblGenomes-Tr:ACK39144"
FT                   /db_xref="GOA:B8DDY5"
FT                   /db_xref="InterPro:IPR001636"
FT                   /db_xref="InterPro:IPR018236"
FT                   /db_xref="InterPro:IPR028923"
FT                   /db_xref="InterPro:IPR033934"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8DDY5"
FT                   /protein_id="ACK39144.1"
FT                   /translation="MTNELVYEGKAKRLFKTEEAGVLRVAYKDDATALNGVRKESFAGK
FT                   GELNNQITSLIFSHLAEAGIESHFIRAISETEQLVKEVSIIPLEVVVRNVMAGSLAKRL
FT                   GKEEGEPIPNAIVEFYFKEDALDDPFINDDHVLYLEIATTNEMDEIRQAARSINKVLQE
FT                   LFTQMNITLIDFKLEFGRDAAGNILLADEISPDTCRLWDKETNQKLDKDVFRRNIGNLT
FT                   DVYTEVLNRLKQVQN"
FT   gene            801129..801374
FT                   /gene="purS"
FT                   /locus_tag="LMHCC_0793"
FT   CDS_pept        801129..801374
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purS"
FT                   /locus_tag="LMHCC_0793"
FT                   /product="phosphoribosylformylglycinamidine synthase, PurS
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0793"
FT                   /db_xref="EnsemblGenomes-Tr:ACK39145"
FT                   /protein_id="ACK39145.1"
FT                   /translation="MYNVKVYVTLKKSVLDPQGVAVKDAAKSMGYEEVEDVRIGKFMEL
FT                   KVAKSDRDIHEVLNEMCDKLLTNPVMEDYRYEIEEA"
FT   gene            801378..802061
FT                   /gene="purQ"
FT                   /locus_tag="LMHCC_0794"
FT   CDS_pept        801378..802061
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purQ"
FT                   /locus_tag="LMHCC_0794"
FT                   /product="phosphoribosylformylglycinamidine synthase I"
FT                   /EC_number="6.3.5.3"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0794"
FT                   /db_xref="EnsemblGenomes-Tr:ACK39146"
FT                   /db_xref="GOA:B8DDY7"
FT                   /db_xref="InterPro:IPR010075"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8DDY7"
FT                   /protein_id="ACK39146.1"
FT                   /translation="MKFAVIQFPGSNCDLDMLHAIRDSIGEEAEYVWHAETSLAGFDAV
FT                   LLPGGFSYGDYLRTGAIAKFSSIMPEVLRFAEMGKPVLGVCNGFQILTEIGLLPGALIR
FT                   NNNLHFICKTVPLRVANASTMFTELYEEGEIIQVPVAHGEGNYYCDDETLLKLKENNQI
FT                   VFTYDSVNPNGSRADIAGIVNERGNVLGMMPHPERAVEEIIGGTDGLRLFESVVKAWKE
FT                   EQVNA"
FT   gene            802054..804273
FT                   /gene="purL"
FT                   /locus_tag="LMHCC_0795"
FT   CDS_pept        802054..804273
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purL"
FT                   /locus_tag="LMHCC_0795"
FT                   /product="phosphoribosylformylglycinamidine synthase II"
FT                   /EC_number="6.3.5.3"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0795"
FT                   /db_xref="EnsemblGenomes-Tr:ACK39147"
FT                   /db_xref="GOA:B8DDY8"
FT                   /db_xref="InterPro:IPR010074"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="InterPro:IPR041609"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8DDY8"
FT                   /protein_id="ACK39147.1"
FT                   /translation="MPNMEPTTKEIKEQKIYQEMGLTDSEYELVCSILGREPNYTETGL
FT                   FSVMWSEHCSYKNSKPVLRKFPTEGKQVLQGPGEGAGIVDIGDGLGVAFKVESHNHPSY
FT                   VEPYQGAATGVGGIIRDVFSMGARPIAMLNSLRFGELDTPHAKYLVSEVVAGIAGYGNS
FT                   IGIPTVGGEIQFDPCYTKNPLVNAMCVGLIEAKDIQKGQAKGIGNPVMYVGAKTGRDGI
FT                   HGATFASVEFSEEGEQQRSAVQVGDPFMEKLLLEACLDVIRDHSDILVGIQDMGAAGLV
FT                   SSSSEMASKAGAGLELIMDDVPQRELNMTPYEMLLSESQERMLLCVKKGHVEEIQALFE
FT                   RYGLEAVVIGQVTDDKMYKIIHHGEVVANVPVDALAEDAPVYHKPSKEPARYQAFQEEK
FT                   AFVPAMDDVVGVWKELLAQPTIASKRHIYEQYDYQVRTDTAVVPGSDAAIVRVRGTEKA
FT                   IAMTTDCNSRYLYLDPEVGGAIAVAEAARNIVCSGGKPLAITDGLNFGNPEKPEIFWEI
FT                   EKAADGISAACLELDTPVISGNVSLYNETDGTGIYPTPVIGMVGLVEDLAHITTQDFKN
FT                   SGDVIFLIGETKAEYSGSELQKLQQGKISGRAPELDLATEKKYQQLLLTAIQEGLVASS
FT                   HDLAEGGFGVALAEATFKAGLGADVEVPFALNQLFSESQSRFLVSVKPENEAAFAQLME
FT                   LEKVYRLGVVTEDDTIRVKHKEDQVTAKTTELRSIWEGAIPCLLK"
FT   gene            804258..805685
FT                   /gene="purF"
FT                   /locus_tag="LMHCC_0796"
FT   CDS_pept        804258..805685
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purF"
FT                   /locus_tag="LMHCC_0796"
FT                   /product="amidophosphoribosyltransferase"
FT                   /EC_number="2.4.2.14"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0796"
FT                   /db_xref="EnsemblGenomes-Tr:ACK39148"
FT                   /protein_id="ACK39148.1"
FT                   /translation="MLAEVKGLNEECGIFGIWDHPNAAEITYYGLHSLQHRGQEGAGIV
FT                   STDGETLKGHRNLGLLADVFKHGELDDLKGKAAIGHVRYATAGQKNLGNVQPFLFHFHS
FT                   SSLALAHNGNLVNAKSLRRELEEEGAIFQTSSDTEVLAHLIKRSHTGDFVEDLKVALNK
FT                   VKGGFAYMLLTEDTMYAALDPNGFRPLSIGRIGDSYVVASETCAFETVGAEFVRDVEPG
FT                   ELIIINDDGLRIEKFTENVTHSICSMEYIYFARPDSNIAGINVHSARKRSGKRLAKEAF
FT                   IDADVVTGVPDSSISAAIGYAEEAGLPYELGLIKNRYVARTFIQPSQELREQGVRMKLS
FT                   AVRGVVEGKRVVMIDDSIVRGTTSKRIVQLLREAGAAEVHVRIASPPLAYPCFYGIDIQ
FT                   TRNELIASNYSVDEICRIIGADSLEYLSEEGLVDSIGRPYPNEPYGGLCMAYFNGDYPT
FT                   PLYDYEAEYLASLEAEK"
FT   gene            805704..806753
FT                   /gene="purM"
FT                   /locus_tag="LMHCC_0797"
FT   CDS_pept        805704..806753
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purM"
FT                   /locus_tag="LMHCC_0797"
FT                   /product="phosphoribosylformylglycinamidine cyclo-ligase"
FT                   /EC_number="6.3.3.1"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0797"
FT                   /db_xref="EnsemblGenomes-Tr:ACK39149"
FT                   /db_xref="GOA:B8DDZ0"
FT                   /db_xref="InterPro:IPR004733"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8DDZ0"
FT                   /protein_id="ACK39149.1"
FT                   /translation="MAENAYSKAGVDVEAGYQVVERIKKHVARTERLGAMGALGSFGGM
FT                   FDLSSLHLKEPVLVSGTDGVGTKLLLAIEADKHDTIGIDCVAMCVNDILAQGAEPLFFL
FT                   DYIATGKTDPVKMEQIVKGVADGCEQAGAALIGGETAEMPDMYGSDDYDLAGFTVGAVE
FT                   KQKLITEGAVKEGDTLIGIPSSGIHSNGYSLVRKIFFKDNELTLDAEISELDVPLVEEL
FT                   LKPTRIYVKPVLEVLKEVDVHGITHVTGGGFVENLPRMLTNDLAVKVELGSWPVLPIFD
FT                   VMKKYGQLNEMEMYEIFNMGIGMVLAVAKADVERTLEVLVQNGEAAYVIGEVTTRENDA
FT                   VIFTGGTKG"
FT   gene            806750..807316
FT                   /gene="purN"
FT                   /locus_tag="LMHCC_0798"
FT   CDS_pept        806750..807316
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purN"
FT                   /locus_tag="LMHCC_0798"
FT                   /product="phosphoribosylglycinamide formyltransferase"
FT                   /EC_number="2.1.2.2"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0798"
FT                   /db_xref="EnsemblGenomes-Tr:ACK39150"
FT                   /protein_id="ACK39150.1"
FT                   /translation="MNIAIFASGNGSNFQALVDDEFIKPHVKLLVCDKPNAYVLERANK
FT                   QDIPVFLFEAKNYPDKEAFETEILLELRGLEIDLLVLAGYMRLIGPTLLAEFPEQIVNL
FT                   HPSLLPEFKGKDAIGQAIQANVSETGVTAHFVDAGMDTGPIIDQVKVPIEHAETVDTLA
FT                   GKIHQVEHIFYPKVIRGLIQNGGND"
FT   gene            807322..808851
FT                   /gene="purH"
FT                   /locus_tag="LMHCC_0799"
FT   CDS_pept        807322..808851
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purH"
FT                   /locus_tag="LMHCC_0799"
FT                   /product="bifunctional purine biosynthesis protein PurH"
FT                   /EC_number="2.1.2.3"
FT                   /EC_number="3.5.4.10"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0799"
FT                   /db_xref="EnsemblGenomes-Tr:ACK39151"
FT                   /db_xref="GOA:B8DDZ2"
FT                   /db_xref="InterPro:IPR002695"
FT                   /db_xref="InterPro:IPR011607"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR024051"
FT                   /db_xref="InterPro:IPR036914"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8DDZ2"
FT                   /protein_id="ACK39151.1"
FT                   /translation="MKRALISVSDKNGIVPFAEKLVELGVEIISTGGTKAAFEQAGVPV
FT                   TGIEEVTEFPEMLDGRVKTLHPAIHGGLLARRDTAEHMEAIAAHDIKPIDLVVVNLYPF
FT                   QETIQKSGVTLEEAIENIDIGGPSMLRSAAKNYAAVTVVVDTVDYDTVLTELEEHGATT
FT                   FETRQRLAAKVFRHTAAYDALIAEYLTNITGETFPEKVTLTYNRKQVLRYGENPHQDAA
FT                   FYTEPGTVENSISSAKQLHGKELSYNNIRDADAALKIASEFTEPVAVAVKHMNPCGVGV
FT                   GENIEEAYLKAYEADETSIFGGIVALNKEVDAKTAEHMSKIFLEIIIAPSFSEEAFAIL
FT                   TKKKNIRLLTVPFAGSVKGFEKTSVNGGLLIQASDSVIEDTASYEVVTEKQPTEAEMKA
FT                   LIAQWKIVKHVKSNAIVVGSDKQTLGIGAGQMNRIGSALIALEQAGEKAKGAVLASDAF
FT                   FPMDDTVEAAAKAGITAIIQPGGSIKDKESIAMANKYGISMVLTHVRHFKH"
FT   gene            808876..810138
FT                   /gene="purD"
FT                   /locus_tag="LMHCC_0800"
FT   CDS_pept        808876..810138
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purD"
FT                   /locus_tag="LMHCC_0800"
FT                   /product="phosphoribosylamine--glycine ligase"
FT                   /EC_number="6.3.4.13"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0800"
FT                   /db_xref="EnsemblGenomes-Tr:ACK39152"
FT                   /protein_id="ACK39152.1"
FT                   /translation="MNLLVVGSGGREHAISKKLLESNNVENVYCAPGNDGMRLDNIQLV
FT                   AISETDKAGLIDFAKKAEIAFVIVGPEVPLLEGVVDALEEAGIKAFGPKANAALIEGSK
FT                   DFAKQFMEKYAIPTAASRTFTDYAEAKAYLDERGVPIVIKADGLAAGKGVTVALEMEEA
FT                   VLALKDMMLEEKFGDASLKVVIEDFLAGEEFSLMAFVNGEEVYPMAIAQDHKRAYEGDK
FT                   GPNTGGMGAYSPVPHISETVVDEAVEKILLPAAKGMVKEGRYFRGILYAGLILTAEGPK
FT                   VIEFNARFGDPETQVVLPRLESDFAALIDALLHNEKPDVRFKKSGITLGVVLASAGYPE
FT                   HYEKGNKLTGLNDVAEGVAIYHAGTKQDENGDFISDGGRVLLLAKEAETMTDARTLLYP
FT                   EMQKLDNPNFFYRIDIGTKAE"
FT   gene            810277..810573
FT                   /locus_tag="LMHCC_0801"
FT   CDS_pept        810277..810573
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0801"
FT                   /product="putative TrpR-like protein YerC/YecD"
FT                   /note="putative TrpR homolog YerC/YecD"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0801"
FT                   /db_xref="EnsemblGenomes-Tr:ACK39153"
FT                   /protein_id="ACK39153.1"
FT                   /translation="MQIEKLRGQGLDEFFQGILTLENLEECYAFFDDVCTVNEIQSMAQ
FT                   RFQVAKMLHDGKTYNVIESETGASTATISRVKRSLHYGNDMYDVVFSRMTKPE"
FT   gene            810587..810844
FT                   /locus_tag="LMHCC_0802"
FT   CDS_pept        810587..810844
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0802"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0802"
FT                   /db_xref="EnsemblGenomes-Tr:ACK39154"
FT                   /protein_id="ACK39154.1"
FT                   /translation="MLKKFNSKTYQIVIISILALAVIYFVINMIATGTGLDFSLLWHWV
FT                   FIICFIFTTLANVREKRAIGTAIGLSGILICVTSIVLMAI"
FT   gene            complement(810889..812244)
FT                   /locus_tag="LMHCC_0803"
FT   CDS_pept        complement(810889..812244)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0803"
FT                   /product="sodium:neurotransmitter symporter family protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0803"
FT                   /db_xref="EnsemblGenomes-Tr:ACK39155"
FT                   /protein_id="ACK39155.1"
FT                   /translation="MQENREEWGSKVGFILASAGSAIGIGAIWKLPYVAATAGGGAFFL
FT                   LFLVLTLLVVMPLLIAEFVIGRGSGGDAVQAYKTLAPGTKWNLLGKLGVVGASILFSFY
FT                   SVVGGWIITYLIKTLAGGIAGENQASLLHDFQVTTANPWISVGATILFILLNVIVISRG
FT                   VVSGIEKMSKFMMPALFILFIVLIIRSLTLPGAMEGVAFFLRPDFSHFTAQTVLITLGQ
FT                   AFFSLSVGISVMVTYSSYLNRSTSLPQSAISVSLMNVFVSLLAGLAIFPAAFSFNITPD
FT                   AGPGLLFVILPSIFNQMPFGMLFFIIFLILFLFAALTSSFSMLEATVAPLMNAGVNRKK
FT                   ASLWMGLVIVLMAIPSALSFGVWSDVQIFGLSIFDAADYLVSNIILPVGALFIAIFVGY
FT                   RLPRELLLKEFTTSSHFGKKVFILWLFLIKYIAPIAIIFVFLSATGLIDFLF"
FT   gene            812451..813128
FT                   /locus_tag="LMHCC_0804"
FT   CDS_pept        812451..813128
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0804"
FT                   /product="PcrB family protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0804"
FT                   /db_xref="EnsemblGenomes-Tr:ACK39156"
FT                   /db_xref="GOA:B8DFG3"
FT                   /db_xref="InterPro:IPR008205"
FT                   /db_xref="InterPro:IPR038597"
FT                   /db_xref="InterPro:IPR039074"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8DFG3"
FT                   /protein_id="ACK39156.1"
FT                   /translation="MKHLFKLDPAKNLPMNDLTKLVHSGTDGFIIGGTDNVQIEAVQKL
FT                   YELLGETDLPIFLEISNESMILPEADHFLIPVVLNTENSKWTHGLHQELIKEMGAFIPW
FT                   KRVTAEGYVILNKDAKVAHLTEAKTDLTDEDIVAYARLAENIFHLPIFYVEYSGMYGDP
FT                   EVVRKAGAALSNTKFWYGGGIRSKEQAAEMAKYADTIIVGNIIYEDLEKALETATIFRK
FT                   KTV"
FT   gene            813193..815388
FT                   /gene="pcrA"
FT                   /locus_tag="LMHCC_0805"
FT   CDS_pept        813193..815388
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pcrA"
FT                   /locus_tag="LMHCC_0805"
FT                   /product="ATP-dependent DNA helicase PcrA"
FT                   /EC_number="3.6.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0805"
FT                   /db_xref="EnsemblGenomes-Tr:ACK39157"
FT                   /protein_id="ACK39157.1"
FT                   /translation="MNAKELVDGLNPEQRRAVESTEGPLLIMAGAGSGKTRVLTHRIAY
FT                   LVRERGVNPYNILAITFTNKAAREMKSRIGNLMGGEAESIWISTFHSMCVRILRRDIDR
FT                   IGYERNFTILDGSDQLSVIKGILKEKNVDPKKFEPRGILASISNAKNELITASEYIKEA
FT                   SGFYDKMVGEVYEKYEKKLKKNQALDFDDLIMVTIQLFERVPDVLEYYQRKFQYIHVDE
FT                   YQDTNHAQYLLVKQLASRFKNLCVVGDSDQSIYGWRGADISNIMSFEKDYPNAKTILLE
FT                   ENYRSTKRILEAANRVIENNGNRKPKNLWTSNAEGKKIFYHKALTEKEEAAYVVMKIQE
FT                   EVNNSNRPLSDFAILYRTNAQSRVMEEYFMKSNMAYTMVGGTKFYDRKEIKDILAYLRL
FT                   ISNNEDDISLTRIINVPKRGVGPGTLDKLNNVATTYDLSLFEVLNRIELAGISPKISKD
FT                   LVAFHDLIRGFTQMQDFLSVTELVEEILEKTGYRAMLKNERTIEAQTRLENIDEFLSVT
FT                   QNFEKENDDKTLIAFLTDLALVADVDKLEEDNEEQNGAVTLMTLHSAKGLEFPVVFLVG
FT                   MEEGIFPHSRAIYEEEEMEEERRLAYVGITRAEEELFLTSAYSRMLYGRPSSNQESRFI
FT                   GEIPRDLLELGNENKLKADKPYAKPRMPQKTTTAYKSSGAETLGWTVGDKASHKKWGVG
FT                   TVVSVKGEGSGMELDIAFPSPTGVKRLLAEFAPIEKV"
FT   gene            815414..817429
FT                   /gene="ligA"
FT                   /locus_tag="LMHCC_0806"
FT   CDS_pept        815414..817429
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ligA"
FT                   /locus_tag="LMHCC_0806"
FT                   /product="DNA ligase, NAD-dependent"
FT                   /EC_number="6.5.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0806"
FT                   /db_xref="EnsemblGenomes-Tr:ACK39158"
FT                   /db_xref="GOA:B8DFG5"
FT                   /db_xref="InterPro:IPR001357"
FT                   /db_xref="InterPro:IPR001679"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR004149"
FT                   /db_xref="InterPro:IPR004150"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013839"
FT                   /db_xref="InterPro:IPR013840"
FT                   /db_xref="InterPro:IPR033136"
FT                   /db_xref="InterPro:IPR036420"
FT                   /db_xref="InterPro:IPR041663"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8DFG5"
FT                   /protein_id="ACK39158.1"
FT                   /translation="MADKKRYEELINILDQYSYDYYVIDNPTVEDAEYDQKMQELLKIE
FT                   EAHPEWVTPESPSKRVGGEVLEGFKKVAHDTPMLSLANAFNQEDLADFDRRIRDKVGDD
FT                   IAYMCELKIDGLAVSLQYENGKYKQGATRGDGTIGEDITANLRTIRSIPMKLQKDYSIE
FT                   VRGEAFMPKRSFQKLNEIREEEGQMLFANPRNAAAGSLRQLDTKIAASRNLDIFLYAVA
FT                   DFGEMGVETHSAGLDMLETLGLKVNKERRLCNSLEEVYAYIEEWTEKRAGLAYDIDGIV
FT                   LKLNNLEQQRQMGTTVKSPRWSIAYKFPAEEVPTKLLDIELNVGRTGVITPTAVLEPVR
FT                   VAGTTVSRASLHNEDLITEKDIRIGDTVLIKKAGDIIPEVIKSITEERSGSEEPFHMPK
FT                   NCPTCDSELVRLEEEVALRCINPKCPAQIKEGLIHFVSRNAMNIDGLGEKVIIQLFSQH
FT                   LIKDVADLFFLSKEKLLELERMGEKSVTNLLASIEASKQNSLEKLLFGLGIRHVGAKAA
FT                   KSLAIHFDTMDNLKVADKETLTSINDIGEKMADSIVTYFANEEVHDLLEELKRAGVNMT
FT                   YTGPKLEDMSEEELVFAGKTVVLTGKLEKLTRNDAKALIESLGGNVSGSVSKKTDVVVA
FT                   GSDAGSKLAKAEELAIPIWSEEDLIEYLPDEGGLNE"
FT   gene            817426..818541
FT                   /locus_tag="LMHCC_0807"
FT   CDS_pept        817426..818541
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0807"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0807"
FT                   /db_xref="EnsemblGenomes-Tr:ACK39159"
FT                   /protein_id="ACK39159.1"
FT                   /translation="MKKLIIAALGLTLVLSGCAPKLDSNDKVVQKDDSKAETGIMTKNQ
FT                   ISSNYYKTVLPYKASKSRGLVVSNIYSRYDINELEAGLMRVSQNKYSPDNYLFQEGQYL
FT                   DKETLEKWLDRKSDKNPNGLNPESNGNGENRNPIYLAHILEQDYLKQTDKDTVALGGIS
FT                   IALAMNSVDYYQKEKYGDTYEQAISDSDLLAQGKEMSATVLNRIRQTKGLENVPVTIAI
FT                   YKQGARDAVAPGNYIAYATANGDSLSGWKDIDEKNYVLPSTESAKDHKTDNDNFLNFKK
FT                   AIEDYYPNFTGVVGRGRYEDGQLAELNIDIPLQFYGEAEIIGFTQYVTDLVGQHIPKTA
FT                   DLQVNISTTDGPAALITRKANEDAATAHIYD"
FT   gene            818665..818958
FT                   /gene="gatC"
FT                   /locus_tag="LMHCC_0808"
FT   CDS_pept        818665..818958
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gatC"
FT                   /locus_tag="LMHCC_0808"
FT                   /product="glutamyl-tRNA(Gln) amidotransferase, C subunit"
FT                   /EC_number="6.3.5.-"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0808"
FT                   /db_xref="EnsemblGenomes-Tr:ACK39160"
FT                   /db_xref="GOA:B8DFG7"
FT                   /db_xref="InterPro:IPR003837"
FT                   /db_xref="InterPro:IPR036113"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8DFG7"
FT                   /protein_id="ACK39160.1"
FT                   /translation="MSNISKETVEKVANLAKLEVSETEATAFAGQLGKIIELVEQLNTL
FT                   DTTNVEPTSHAIDVSNVLREDVATKGLDRKEVLKNAPDEQDGMFKVPTIMEQ"
FT   gene            818982..820433
FT                   /locus_tag="LMHCC_0809"
FT   CDS_pept        818982..820433
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0809"
FT                   /product="glutamyl-tRNA(Gln) amidotransferase subunit A
FT                   (Glu-ADTsubunit A)"
FT                   /EC_number="6.3.5.-"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0809"
FT                   /db_xref="EnsemblGenomes-Tr:ACK39161"
FT                   /db_xref="GOA:B8DFG8"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR004412"
FT                   /db_xref="InterPro:IPR020556"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8DFG8"
FT                   /protein_id="ACK39161.1"
FT                   /translation="MGLFDFSVKELHDKLVKKEISPFDLVSESFNRIESVEDKVGSFIT
FT                   LNKEAAFGVAEELGDAGIDPNNMLAGLPIGIKDNIVTKSLRTTAASKILENFDPIYDAT
FT                   VVSKLKNAQTINIGKLNMDEFAMGSSTETSYFHKTHNPWDLSRVPGGSSGGSASAVAAG
FT                   EVLFSLGSDTGGSIRQPAAFCGVVGMKPTYGRVSRFGLIAFASSLDQIGPITKNVEDNA
FT                   YLLEAISGLDANDSTSINQPVERFSDSLTGDIKGLRIGVPKEYLGEGVDPGVKQAVLDA
FT                   LKTLEKLGATWDEVSLPHSEYGVASYYILASSEASSNLSRFDGVRYGYRSPNATTLEEL
FT                   YTKTRSEGFGDEVKRRIMLGTYALSSGYYDAYYKKAQQARTLIKQDFVNVFENYDVIIG
FT                   PSSPTTAFKIDGMINDPITMYSNDILTVPINLAGVPAISVPCGFSDGLPVGLQIIGNYF
FT                   EESLLYKVAHAFEQETTFHKEKPNL"
FT   gene            820445..821875
FT                   /locus_tag="LMHCC_0810"
FT   CDS_pept        820445..821875
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0810"
FT                   /product="aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
FT                   subunit B (Asp/Glu-ADT subunit B)"
FT                   /EC_number="6.3.5.-"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0810"
FT                   /db_xref="EnsemblGenomes-Tr:ACK39162"
FT                   /db_xref="GOA:B8DFG9"
FT                   /db_xref="InterPro:IPR003789"
FT                   /db_xref="InterPro:IPR004413"
FT                   /db_xref="InterPro:IPR006075"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR017958"
FT                   /db_xref="InterPro:IPR017959"
FT                   /db_xref="InterPro:IPR018027"
FT                   /db_xref="InterPro:IPR023168"
FT                   /db_xref="InterPro:IPR042114"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8DFG9"
FT                   /protein_id="ACK39162.1"
FT                   /translation="MNFETVIGLEVHVELKTNSKIFSSAPAHFGAEPNTNTTVVDLGMP
FT                   GVLPVLNKRAVEFGMKAAMAINCEIAEHTKFDRKNYFYPDNPKAYQISQFDKPIGEHGW
FT                   IEIEVGGKKKKIGITRLHLEEDAGKNTHTSHGYSLVDINRQGTPLIEIVSEPDIRSAEE
FT                   AYAYLEKLKSIIQYTGVSDVKMEEGSMRCDANISIRPIGQEEFGVKTELKNLNSFNNVR
FT                   KGIEYEEKRQAEVLKSGGIIEQETRRFEEATGKTSLMRIKEGSDDYRYFPEPDLVDLFI
FT                   DDAWKERIRAEIPELPDKRQIRYINDLGLPAYDAMVLTLTKEMSDFFEATLAAGADAKQ
FT                   ASNWLMGEVSAYLNAEQKELHETGLTPENLAGMIKLIEAGTISSKIAKKVFRELAQNGG
FT                   DAEQLVKDKGLVQISDEGALRTIISEILDNNEQSIVDFKNGKDRAVGFLVGQVMKATKG
FT                   QANPPMVNKLLLEEMNKR"
FT   gene            822021..822953
FT                   /locus_tag="LMHCC_0811"
FT   CDS_pept        822021..822953
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0811"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0811"
FT                   /db_xref="EnsemblGenomes-Tr:ACK39163"
FT                   /protein_id="ACK39163.1"
FT                   /translation="MQKHARVIYNPTSGREIIKKNLADVLSILEQAGYVTSAHATTAEP
FT                   DDAKHAAEEAVRDRFDLVVAAGGDGTINEVINGIAEKEYRPKVGIIPTGTTNDFARALH
FT                   VPRDVIKATKIIAAGQSVAMDIGKANETYFINIGGGGRLTELTYDVPSRLKTMLGQLAY
FT                   YLKGIEMLPSLKATKVKVEYDQGVFEGEVMFFLLGLTNSIGGFEKIAPDAKLDDGKFSL
FT                   IIVKKVNLAEFIRLVTLALRGDHIKEPNVIYVKSEKVIVNSEDKMLINLDGELGGETPM
FT                   EFRNLRQHIEFFASVDDIPATDLFIKENS"
FT   gene            823101..823856
FT                   /locus_tag="LMHCC_0812"
FT   CDS_pept        823101..823856
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0812"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0812"
FT                   /db_xref="EnsemblGenomes-Tr:ACK39164"
FT                   /protein_id="ACK39164.1"
FT                   /translation="MTSGHLFKKFTVIIIVLIIAIAAAVFFFWQVDAEEQAPKVTKTEL
FT                   IESNKVWINNQMQVPIQDNIILSIPAANTNTTIATNGDLILETTNEDILKELASTDNRY
FT                   KGIKAYRLRIEAKKVSEYITNTKYRYPTTTIQKKFANYEITSGERSVQTEKTPVTIEDT
FT                   TNNNIKVSLKTSYSSDDAEVAAGIFDSQIPEETTITDNTKALTTNKNVTIYPKTFIYDF
FT                   TLQKNTMLVFKEQEEAVIKEPIGIEYIIK"
FT   gene            823880..825241
FT                   /gene="rumA"
FT                   /locus_tag="LMHCC_0813"
FT   CDS_pept        823880..825241
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rumA"
FT                   /locus_tag="LMHCC_0813"
FT                   /product="23S rRNA (uracil-5-)-methyltransferase RumA"
FT                   /EC_number="2.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0813"
FT                   /db_xref="EnsemblGenomes-Tr:ACK39165"
FT                   /protein_id="ACK39165.1"
FT                   /translation="MEASLLKKNQSIELTIEDLTHDGSGVGKIDGYPLFIPNTLPGEKV
FT                   TAKIIKLNKNYGFARMETIESVSADRVEPPCAVYSKCGGCSLQHLSYDGQLAFKRNQVE
FT                   ETMKRIGKLNVDVPETLGMENPWRYRNKSQVPVGFVNGKLTAGFYQKRSHAIIDMSTCL
FT                   IHNEQGDFAVQKTREILAKYGTEPYDEKTGKGDIRHIMTRFAHTTGQLMLVLVTTKERM
FT                   PFKNEIVQDLVEQLELTSIVQNINPHKTNVIFGDRTKTLWGKDIIEDTIHGIRFAISAR
FT                   SFYQVNPLQTEVLYQQAIDAAELTGEETVIDAYCGIGSISLCLAKKAKHVYGVEIVDQA
FT                   IQDARANAELNELTNTTFETGKAEEVIPAWYKAGIEADVLVVDPPRKGCDEKLLETILA
FT                   MKPKKVVYVSCNPGTLARDMKILTDGGYVAKKVQPVDMFPMTTHIEAVTVLHLN"
FT   gene            825295..825420
FT                   /locus_tag="LMHCC_0814"
FT   CDS_pept        825295..825420
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMHCC_0814"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMHCC_0814"
FT                   /db_xref="EnsemblGenomes-Tr:ACK39166"
FT                   /protein_id="ACK39166.1"
FT                   /translation="MWSTNKLTDEISNNQVQFLFNHEIKKWSKEKKLTFSRKVVV"
FT   gene            825579..826133
FT                   /locus_tag="LMHCC_0815"
FT   CDS_pept        825579..826133