(data stored in SCRATCH3701 zone)

EMBL: CP001184

ID   CP001184; SV 1; circular; genomic DNA; STD; PRO; 874478 BP.
XX
AC   CP001184; ABET01000000-ABET01000006;
XX
PR   Project:PRJNA20247;
XX
DT   18-OCT-2008 (Rel. 97, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 5)
XX
DE   Ureaplasma urealyticum serovar 10 str. ATCC 33699, complete genome.
XX
KW   .
XX
OS   Ureaplasma urealyticum serovar 10 str. ATCC 33699
OC   Bacteria; Tenericutes; Mollicutes; Mycoplasmataceae; Ureaplasma.
XX
RN   [1]
RP   1-874478
RA   Shrivastava S., Methe B.A., Glass J., White K., Duffy L.B.;
RT   "Genome sequence of Ureaplasma urealyticum serovar 10 ATCC-33699";
RL   Unpublished.
XX
RN   [2]
RP   1-874478
RA   Shrivastava S., Methe B.A., Glass J., White K., Duffy L.B.;
RT   ;
RL   Submitted (03-OCT-2008) to the INSDC.
RL   J. Craig Venter Institute, 9704 Medical Center Drive, Rockville, MD 20850,
RL   USA
XX
DR   MD5; 1bc6aa7052c6bc78ede8185f2270790f.
DR   BioSample; SAMN02603440.
DR   EnsemblGenomes-Gn; EBG00001137992.
DR   EnsemblGenomes-Gn; EBG00001137993.
DR   EnsemblGenomes-Gn; EBG00001137994.
DR   EnsemblGenomes-Gn; EBG00001137995.
DR   EnsemblGenomes-Gn; EBG00001137996.
DR   EnsemblGenomes-Gn; EBG00001137997.
DR   EnsemblGenomes-Gn; EBG00001137998.
DR   EnsemblGenomes-Gn; EBG00001137999.
DR   EnsemblGenomes-Gn; EBG00001138000.
DR   EnsemblGenomes-Gn; EBG00001138001.
DR   EnsemblGenomes-Gn; EBG00001138002.
DR   EnsemblGenomes-Gn; EBG00001138003.
DR   EnsemblGenomes-Gn; EBG00001138004.
DR   EnsemblGenomes-Gn; EBG00001138005.
DR   EnsemblGenomes-Gn; EBG00001138006.
DR   EnsemblGenomes-Gn; EBG00001138007.
DR   EnsemblGenomes-Gn; EBG00001138009.
DR   EnsemblGenomes-Gn; EBG00001138010.
DR   EnsemblGenomes-Gn; EBG00001138011.
DR   EnsemblGenomes-Gn; EBG00001138012.
DR   EnsemblGenomes-Gn; EBG00001138013.
DR   EnsemblGenomes-Gn; EBG00001138014.
DR   EnsemblGenomes-Gn; EBG00001138015.
DR   EnsemblGenomes-Gn; EBG00001138016.
DR   EnsemblGenomes-Gn; EBG00001138017.
DR   EnsemblGenomes-Gn; EBG00001138018.
DR   EnsemblGenomes-Gn; EBG00001138019.
DR   EnsemblGenomes-Gn; EBG00001138020.
DR   EnsemblGenomes-Gn; EBG00001138021.
DR   EnsemblGenomes-Gn; EBG00001138022.
DR   EnsemblGenomes-Gn; EBG00001138023.
DR   EnsemblGenomes-Gn; EBG00001138025.
DR   EnsemblGenomes-Gn; EBG00001138026.
DR   EnsemblGenomes-Gn; EBG00001138027.
DR   EnsemblGenomes-Gn; EBG00001138028.
DR   EnsemblGenomes-Gn; EBG00001138029.
DR   EnsemblGenomes-Gn; EBG00001138030.
DR   EnsemblGenomes-Gn; EBG00001138031.
DR   EnsemblGenomes-Gn; EBG00001138032.
DR   EnsemblGenomes-Gn; EBG00001138033.
DR   EnsemblGenomes-Gn; EBG00001138034.
DR   EnsemblGenomes-Gn; EBG00001138035.
DR   EnsemblGenomes-Gn; EBG00001138036.
DR   EnsemblGenomes-Gn; EBG00001138037.
DR   EnsemblGenomes-Gn; EBG00001138038.
DR   EnsemblGenomes-Gn; EBG00001138039.
DR   EnsemblGenomes-Gn; EBG00001138040.
DR   EnsemblGenomes-Gn; UUR10_0124.
DR   EnsemblGenomes-Gn; UUR10_0125.
DR   EnsemblGenomes-Gn; UUR10_0126.
DR   EnsemblGenomes-Gn; UUR10_0129.
DR   EnsemblGenomes-Gn; UUR10_0131.
DR   EnsemblGenomes-Gn; UUR10_0160.
DR   EnsemblGenomes-Gn; UUR10_0161.
DR   EnsemblGenomes-Gn; UUR10_0266.
DR   EnsemblGenomes-Gn; UUR10_0300.
DR   EnsemblGenomes-Gn; UUR10_0301.
DR   EnsemblGenomes-Gn; UUR10_0302.
DR   EnsemblGenomes-Gn; UUR10_0304.
DR   EnsemblGenomes-Gn; UUR10_0305.
DR   EnsemblGenomes-Gn; UUR10_0306.
DR   EnsemblGenomes-Gn; UUR10_0307.
DR   EnsemblGenomes-Gn; UUR10_0308.
DR   EnsemblGenomes-Gn; UUR10_0315.
DR   EnsemblGenomes-Gn; UUR10_0457.
DR   EnsemblGenomes-Gn; UUR10_0568.
DR   EnsemblGenomes-Gn; UUR10_0569.
DR   EnsemblGenomes-Gn; UUR10_0570.
DR   EnsemblGenomes-Gn; UUR10_0571.
DR   EnsemblGenomes-Gn; UUR10_0572.
DR   EnsemblGenomes-Gn; UUR10_0573.
DR   EnsemblGenomes-Gn; UUR10_0574.
DR   EnsemblGenomes-Gn; UUR10_0575.
DR   EnsemblGenomes-Gn; UUR10_0580.
DR   EnsemblGenomes-Gn; UUR10_0581.
DR   EnsemblGenomes-Gn; UUR10_0586.
DR   EnsemblGenomes-Gn; UUR10_0598.
DR   EnsemblGenomes-Gn; UUR10_0599.
DR   EnsemblGenomes-Gn; UUR10_0600.
DR   EnsemblGenomes-Gn; UUR10_0601.
DR   EnsemblGenomes-Gn; UUR10_0623.
DR   EnsemblGenomes-Gn; UUR10_0693.
DR   EnsemblGenomes-Tr; EBT00001729210.
DR   EnsemblGenomes-Tr; EBT00001729211.
DR   EnsemblGenomes-Tr; EBT00001729212.
DR   EnsemblGenomes-Tr; EBT00001729213.
DR   EnsemblGenomes-Tr; EBT00001729214.
DR   EnsemblGenomes-Tr; EBT00001729215.
DR   EnsemblGenomes-Tr; EBT00001729216.
DR   EnsemblGenomes-Tr; EBT00001729217.
DR   EnsemblGenomes-Tr; EBT00001729218.
DR   EnsemblGenomes-Tr; EBT00001729221.
DR   EnsemblGenomes-Tr; EBT00001729222.
DR   EnsemblGenomes-Tr; EBT00001729223.
DR   EnsemblGenomes-Tr; EBT00001729224.
DR   EnsemblGenomes-Tr; EBT00001729225.
DR   EnsemblGenomes-Tr; EBT00001729226.
DR   EnsemblGenomes-Tr; EBT00001729227.
DR   EnsemblGenomes-Tr; EBT00001729228.
DR   EnsemblGenomes-Tr; EBT00001729229.
DR   EnsemblGenomes-Tr; EBT00001729230.
DR   EnsemblGenomes-Tr; EBT00001729231.
DR   EnsemblGenomes-Tr; EBT00001729232.
DR   EnsemblGenomes-Tr; EBT00001729233.
DR   EnsemblGenomes-Tr; EBT00001729234.
DR   EnsemblGenomes-Tr; EBT00001729235.
DR   EnsemblGenomes-Tr; EBT00001729236.
DR   EnsemblGenomes-Tr; EBT00001729237.
DR   EnsemblGenomes-Tr; EBT00001729238.
DR   EnsemblGenomes-Tr; EBT00001729239.
DR   EnsemblGenomes-Tr; EBT00001729240.
DR   EnsemblGenomes-Tr; EBT00001729241.
DR   EnsemblGenomes-Tr; EBT00001729242.
DR   EnsemblGenomes-Tr; EBT00001729243.
DR   EnsemblGenomes-Tr; EBT00001729244.
DR   EnsemblGenomes-Tr; EBT00001729245.
DR   EnsemblGenomes-Tr; EBT00001729246.
DR   EnsemblGenomes-Tr; EBT00001729247.
DR   EnsemblGenomes-Tr; EBT00001729248.
DR   EnsemblGenomes-Tr; EBT00001729249.
DR   EnsemblGenomes-Tr; EBT00001729250.
DR   EnsemblGenomes-Tr; EBT00001729251.
DR   EnsemblGenomes-Tr; EBT00001729252.
DR   EnsemblGenomes-Tr; EBT00001729253.
DR   EnsemblGenomes-Tr; EBT00001729254.
DR   EnsemblGenomes-Tr; EBT00001729255.
DR   EnsemblGenomes-Tr; EBT00001729256.
DR   EnsemblGenomes-Tr; EBT00001729257.
DR   EnsemblGenomes-Tr; EBT00001729258.
DR   EnsemblGenomes-Tr; UUR10_0124-1.
DR   EnsemblGenomes-Tr; UUR10_0125-1.
DR   EnsemblGenomes-Tr; UUR10_0126-1.
DR   EnsemblGenomes-Tr; UUR10_0129-1.
DR   EnsemblGenomes-Tr; UUR10_0131-1.
DR   EnsemblGenomes-Tr; UUR10_0160-1.
DR   EnsemblGenomes-Tr; UUR10_0161-1.
DR   EnsemblGenomes-Tr; UUR10_0266-1.
DR   EnsemblGenomes-Tr; UUR10_0300-1.
DR   EnsemblGenomes-Tr; UUR10_0301-1.
DR   EnsemblGenomes-Tr; UUR10_0302-1.
DR   EnsemblGenomes-Tr; UUR10_0304-1.
DR   EnsemblGenomes-Tr; UUR10_0305-1.
DR   EnsemblGenomes-Tr; UUR10_0306-1.
DR   EnsemblGenomes-Tr; UUR10_0307-1.
DR   EnsemblGenomes-Tr; UUR10_0308-1.
DR   EnsemblGenomes-Tr; UUR10_0315-1.
DR   EnsemblGenomes-Tr; UUR10_0457-1.
DR   EnsemblGenomes-Tr; UUR10_0568-1.
DR   EnsemblGenomes-Tr; UUR10_0569-1.
DR   EnsemblGenomes-Tr; UUR10_0570-1.
DR   EnsemblGenomes-Tr; UUR10_0571-1.
DR   EnsemblGenomes-Tr; UUR10_0572-1.
DR   EnsemblGenomes-Tr; UUR10_0573-1.
DR   EnsemblGenomes-Tr; UUR10_0574-1.
DR   EnsemblGenomes-Tr; UUR10_0575-1.
DR   EnsemblGenomes-Tr; UUR10_0580-1.
DR   EnsemblGenomes-Tr; UUR10_0581-1.
DR   EnsemblGenomes-Tr; UUR10_0586-1.
DR   EnsemblGenomes-Tr; UUR10_0598-1.
DR   EnsemblGenomes-Tr; UUR10_0599-1.
DR   EnsemblGenomes-Tr; UUR10_0600-1.
DR   EnsemblGenomes-Tr; UUR10_0601-1.
DR   EnsemblGenomes-Tr; UUR10_0623-1.
DR   EnsemblGenomes-Tr; UUR10_0693-1.
DR   EuropePMC; PMC3020887; 20739488.
DR   EuropePMC; PMC3047005; 21255110.
DR   EuropePMC; PMC4122457; 25093900.
DR   EuropePMC; PMC4356753; 25645833.
DR   EuropePMC; PMC4576132; 26195516.
DR   EuropePMC; PMC4958210; 27246773.
DR   EuropePMC; PMC6237260; 30532293.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00011; RNaseP_bact_b.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00559; L21_leader.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   SILVA-LSU; CP001184.
DR   SILVA-SSU; CP001184.
DR   StrainInfo; 354804; 0.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..874478
FT                   /organism="Ureaplasma urealyticum serovar 10 str. ATCC
FT                   33699"
FT                   /strain="ATCC 33699"
FT                   /mol_type="genomic DNA"
FT                   /serovar="10"
FT                   /db_xref="taxon:565575"
FT                   /culture_collection="ATCC:33699"
FT   gene            17..1390
FT                   /gene="dnaA"
FT                   /locus_tag="UUR10_0001"
FT   CDS_pept        17..1390
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="dnaA"
FT                   /locus_tag="UUR10_0001"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /note="identified by match to protein family HMM PF00308;
FT                   match to protein family HMM PF08299; match to protein
FT                   family HMM TIGR00362"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60210"
FT                   /db_xref="GOA:B5ZAH4"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZAH4"
FT                   /protein_id="ACI60210.1"
FT                   /translation="MSNNYQNLYDSAIKKIPYDLISDQAYEILEKAKVHKVYDGVLYII
FT                   VASAFEKTIINGNFINIISKYLSEEFKKENIVNFQFIVENEKVLINSNFLVKETVIKNR
FT                   FNFSDEIMRYNFNNLVISDFNRKAVKAIESLLSTNYENSSMCNPLFLFGKVGIGKTHIV
FT                   AAAGNQFANSNPNLKIYYYEGQDFFRKFCSASAKGTSHVEEFKKEIASANLLIFEDIQN
FT                   IQSRDSAAELFFNIFNDIKLNGGKIILTSDRTPNELNGFHDRIISRLASGLQCKISQPD
FT                   KNEAIKIINNWFEFKKKYQITDEAKEYIAEGFHTDIRQMIGNLKQICFWADNDLNENLV
FT                   ITKDFIIECSVENDIPSNIIVKQQLKPEQVIEIIAKELNLKVDLIKSTTRKNSIVWARD
FT                   IVCYVLKNKLNLTLTEIGKLLSGREHTTISHSVNKVEKILADKNSQEALQINLIIDKF"
FT   gene            1528..1815
FT                   /gene="rpmE"
FT                   /locus_tag="UUR10_0002"
FT   CDS_pept        1528..1815
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="rpmE"
FT                   /locus_tag="UUR10_0002"
FT                   /product="ribosomal protein L31"
FT                   /note="identified by match to protein family HMM PF01197;
FT                   match to protein family HMM TIGR00105"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60174"
FT                   /db_xref="GOA:B5ZAH5"
FT                   /db_xref="InterPro:IPR002150"
FT                   /db_xref="InterPro:IPR027491"
FT                   /db_xref="InterPro:IPR034704"
FT                   /db_xref="InterPro:IPR042105"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZAH5"
FT                   /protein_id="ACI60174.1"
FT                   /translation="MKDIHPVSKPCVYNCVTCKKEFVINSAAKNTEVAIEVCSNCHTFF
FT                   IGKQNATTTLRGRAEKLNNRFEAGLNNINKKPEKKKVQGKSEPRKSLNEL"
FT   gene            1957..3036
FT                   /gene="prfA"
FT                   /locus_tag="UUR10_0003"
FT   CDS_pept        1957..3036
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="prfA"
FT                   /locus_tag="UUR10_0003"
FT                   /product="peptide chain release factor 1"
FT                   /note="identified by match to protein family HMM PF00472;
FT                   match to protein family HMM PF03462; match to protein
FT                   family HMM TIGR00019"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60091"
FT                   /db_xref="GOA:B5ZAH6"
FT                   /db_xref="InterPro:IPR000352"
FT                   /db_xref="InterPro:IPR004373"
FT                   /db_xref="InterPro:IPR005139"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5ZAH6"
FT                   /protein_id="ACI60091.1"
FT                   /translation="MEYNKKLYEAIERVAVKNKTLKQELETITSDFKKIKEINIQLKKT
FT                   TKIAEAFAKYKQKIDAGIVAEELLNTEKDLELVELAQMDLDDAKASIPVIENELKIMLL
FT                   PTDPNDDKNVIVEMRPAAGGDESSIFVGNLFDTYRAYTESNNWKMKIIEMTPNAVGFSF
FT                   ISFMISGEEVYSRMKFESGVHRVQRVPATESKGRVHTSTITVAVLPEQDEVDVVINPSD
FT                   LRIDTYRASGAGGQHVNRTESAVRITHIPTGVVAACQEGKSQIENRETAMKMLRAKLWE
FT                   AAQEQQNAEFANLRKNQVGTGDRSEKIRTYNYPQNRVTDHRISLTLNKLDQIMMGELDE
FT                   IIDALITDEQTNLMANLGI"
FT   gene            3036..3908
FT                   /locus_tag="UUR10_0004"
FT   CDS_pept        3036..3908
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0004"
FT                   /product="methyltransferase, HemK family"
FT                   /note="identified by match to protein family HMM PF05175;
FT                   match to protein family HMM TIGR00536"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59752"
FT                   /db_xref="GOA:B5ZAH7"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR004556"
FT                   /db_xref="InterPro:IPR007848"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZAH7"
FT                   /protein_id="ACI59752.1"
FT                   /translation="MTYHQLVYQAQLLLQKNQRNTQVAFELLYGLDDEVKDFYSFSNNR
FT                   LKLVDLSLECKYFELLNEFINEKPLERILGYGYFCGRRFCVDENVFAFRVETELLVDVI
FT                   NKIIKQSTHQIKSVIDVCCGSGVLGLSVKMNFNNLDVSLLDISLDAISNSKKNAQYHNI
FT                   EGINYLHKSMQKYFLHTKKRFDLIICNPPYIKSDYQLDKQVLDYDPLNALVDFENKDGI
FT                   SFYLFIINNISLICNKKFTIVFEIGYDQKTILENVLKKNEFPIFYYFINDYNNLYRILV
FT                   ISNIKYENL"
FT   gene            3895..4455
FT                   /locus_tag="UUR10_0005"
FT   CDS_pept        3895..4455
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0005"
FT                   /product="Sua5/YciO/YrdC/YwlC family protein"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60003"
FT                   /db_xref="GOA:B5ZAH8"
FT                   /db_xref="InterPro:IPR006070"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZAH8"
FT                   /protein_id="ACI60003.1"
FT                   /translation="MKIYRITNLNAIYDALVANKCVLIPTDTIIGLLAKNQDVIYEIKR
FT                   RDRNKKIVRFVADYKLLGDLTVEQEQFLDLFWPGSVTVIKNGVSYRMPNSPYILKLIQK
FT                   LGPLYCSSANISGEEPVKNHNEAIFKFGANSKLIYVEAQQQIGVPSTIVDIDKWEYVRR
FT                   GANIEMVDMFIKELKYNNTKEKE"
FT   gene            4460..4921
FT                   /locus_tag="UUR10_0006"
FT   CDS_pept        4460..4921
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0006"
FT                   /product="sugar-phosphate isomerase, RpiB/LacA/LacB family"
FT                   /note="identified by match to protein family HMM PF02502;
FT                   match to protein family HMM TIGR00689"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60280"
FT                   /db_xref="GOA:B5ZAH9"
FT                   /db_xref="InterPro:IPR003500"
FT                   /db_xref="InterPro:IPR036569"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZAH9"
FT                   /protein_id="ACI60280.1"
FT                   /translation="MIKKIYFGNDHAAYEIKDQIIAHLKQKGYEIIDEGAQVELGSVNY
FT                   SPYALKVANDVVNDAKNDSLGILLCGTGIGMNMAASKVKGARVALIYNESSAKLAKEHN
FT                   NANVITIGARENSLEQIIKMIDDFLESKFVGERHQKRLDIITEYEKNQK"
FT   gene            5046..5606
FT                   /locus_tag="UUR10_0007"
FT   CDS_pept        5046..5606
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0007"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59866"
FT                   /db_xref="GOA:B5ZAI0"
FT                   /db_xref="InterPro:IPR006603"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZAI0"
FT                   /protein_id="ACI59866.1"
FT                   /translation="MSNILSNVSSSSLFSTAPSAAAENTSNLVSQLVPEAYTASGISIA
FT                   ISVFSVIGTIVIALSVLPQTIKTLRERDTASLSLLLFLFNGIATAFLTLYGIGLVTVHP
FT                   NSLTFLRDIQNGNFIYNREEWVAGYLVCGIFLIMGEALCSVTSFIVLFYKVNNMIKAKN
FT                   MGMNEEEYYEKQIKPFLKVKGAN"
FT   gene            5609..6085
FT                   /locus_tag="UUR10_0008"
FT   CDS_pept        5609..6085
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0008"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60172"
FT                   /db_xref="GOA:B5ZAI1"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZAI1"
FT                   /protein_id="ACI60172.1"
FT                   /translation="MSFTSLLQNSVWEVGNGAIVTDQAPYLGIAPDYQDAYGFPTHPWG
FT                   IFFQVIGAILVFGAYLPAVIKVLVSKRTENLAIGMWIISIAGLALLAVFAWLGVSTNPG
FT                   GFILVALSETLSCIASIIVFALKIVNKSKAKAAGMTELEYCNLHYPIVKKLPKR"
FT   gene            6232..7854
FT                   /gene="mgtE"
FT                   /locus_tag="UUR10_0009"
FT   CDS_pept        6232..7854
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="mgtE"
FT                   /locus_tag="UUR10_0009"
FT                   /product="magnesium transporter"
FT                   /note="identified by match to protein family HMM PF00571;
FT                   match to protein family HMM PF01769; match to protein
FT                   family HMM PF03448; match to protein family HMM TIGR00400"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60104"
FT                   /db_xref="GOA:B5ZAI2"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR006667"
FT                   /db_xref="InterPro:IPR006668"
FT                   /db_xref="InterPro:IPR006669"
FT                   /db_xref="InterPro:IPR036739"
FT                   /db_xref="InterPro:IPR038048"
FT                   /db_xref="InterPro:IPR038076"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZAI2"
FT                   /protein_id="ACI60104.1"
FT                   /translation="MKNKQNTSNLNNNTNINQNFLSQNILKAYEHKDIAGLKKLLKSKR
FT                   IDKIVESLEAIDDTQIILFVLVATKDGICGEIFKYLNTELKSKIIDDASLQQLRIILFE
FT                   LYNDDVTILKNDFPMHTKKILLSLDSQQRAAIKQLSEFDEDEAGSIVNSDFFTINQSIS
FT                   VKEALIEIKRMYNDFEQSNIIYVVDDYNRLKGYVTIHSLLFADSFDLKISSVVKEDVFY
FT                   VRSDEDIDAVLDIFRKYQIEQLAVVDKNDQLIGYISDNDILPVINTETTTDIYKMYGIS
FT                   ELDFPYIKSSVFVLFKSRLLWLAVLMISATCTGFLIDKFQNVGQLVTAGLSTLVIVPII
FT                   PAMTGTSGNAGSQAAASVIRALSIGEITTKEYNKVLAKEFLVGVLIGLVLAVINFARLI
FT                   IYFAIIKPDLQQYNVLYNNITNNPHSQMIVGAIVSAGSSVALFFAIVISKLLGGILPLL
FT                   ATKLKIDPTIMSTPILSTLLDMVTTIILFGFGILFLLIIVDKVKVEELNNMRESIHAVK
FT                   NINSLLPKQNFLLNNSNYLNHLA"
FT   gene            8011..8511
FT                   /locus_tag="UUR10_0010"
FT   CDS_pept        8011..8511
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0010"
FT                   /product="50S ribosomal protein L10"
FT                   /note="identified by match to protein family HMM PF00466"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60156"
FT                   /db_xref="GOA:B5ZAI3"
FT                   /db_xref="InterPro:IPR001790"
FT                   /db_xref="InterPro:IPR002363"
FT                   /db_xref="InterPro:IPR022973"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5ZAI3"
FT                   /protein_id="ACI60156.1"
FT                   /translation="MANVRPSVVFKQQEVDHMADILKNSKSFIVFEYHGLTAANILALR
FT                   NVLHSSNSKLFVLKNNITARAFEKAGVTGFEDRLTGPNAIAVAMDDEIAAIKAVNDVAK
FT                   EFDFVKIKGAYLENKFADTHKIDQLAAIPGREGLYSMLLSCFTAPLRNVLYGLKAVAEQ
FT                   KGE"
FT   gene            8536..8901
FT                   /gene="rplL"
FT                   /locus_tag="UUR10_0011"
FT   CDS_pept        8536..8901
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="rplL"
FT                   /locus_tag="UUR10_0011"
FT                   /product="ribosomal protein L7/L12"
FT                   /note="identified by match to protein family HMM PF00542;
FT                   match to protein family HMM TIGR00855"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60062"
FT                   /db_xref="GOA:B5ZAI4"
FT                   /db_xref="InterPro:IPR000206"
FT                   /db_xref="InterPro:IPR008932"
FT                   /db_xref="InterPro:IPR013823"
FT                   /db_xref="InterPro:IPR014719"
FT                   /db_xref="InterPro:IPR036235"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5ZAI4"
FT                   /protein_id="ACI60062.1"
FT                   /translation="MSKLTIEQFIAAIKEMSMLELNDLVKAIETEFGVSAAAPVAVAAA
FT                   PAAAEAPTEVTIKLVEAGANKVGVIKLIREITGLGLMEAKTAAETAGSVIKEDVKTEEA
FT                   NEIKKKFDELGAKVQLV"
FT   gene            complement(9125..10675)
FT                   /locus_tag="UUR10_0012"
FT   CDS_pept        complement(9125..10675)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0012"
FT                   /product="putative membrane protein"
FT                   /note="identified by match to protein family HMM PF02608"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59988"
FT                   /db_xref="GOA:B5ZAI5"
FT                   /db_xref="InterPro:IPR003760"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZAI5"
FT                   /protein_id="ACI59988.1"
FT                   /translation="MKKLNKKKLFLSLGSVFALSSVVAITASCSQKSTLNYSQFYWTSP
FT                   TSDDDNGFQTKYKSMANDGKRALLMPGFQHPEKLQNALANDKFDANSIALILDAVYNND
FT                   NKAEFYKGADRVADVYFKVDEAAFLGGIAAAYMLNSNQSVFGKDNKLTWGGYVALNAKN
FT                   TTNYLAGFDLGVKWANEKLKGKSVKQEGTQETKTWIEVEQVYASESSAGGFQPENDNAK
FT                   KIIRELITKGVDLILPVAITQVGVAVTEAIATTSHNVGVIGVDVEVENDEAINKKTDKF
FT                   INTNLSGNKNGVVRFSITKRLDVATVKLLENAISGQSLSKGKDEIIIGSEIDPRDKYKL
FT                   GVNTVGNLSDGVVGISPSAYHYVIDAFNLAQANESDKISTYDQLVNKITNDELFKTLDK
FT                   KPLVEGYLDVKKETDNDAALLENKTIDPRVNGGTLYKSAKGTYYFYPVAKSTYISNSSS
FT                   NKFKELWDGAKTNEEKQSLIGLILSYAGAKVKDGGYSEATYNGLKEFYAKHGIKIPTL"
FT   gene            complement(11068..11997)
FT                   /locus_tag="UUR10_0013"
FT   CDS_pept        complement(11068..11997)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0013"
FT                   /product="ribose/galactose ABC transporter"
FT                   /note="identified by match to protein family HMM PF02653"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59901"
FT                   /db_xref="GOA:B5ZAI6"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZAI6"
FT                   /protein_id="ACI59901.1"
FT                   /translation="MPSLSLINDASIYAAILILGALSGFFCERVGIANISINGQMIIGA
FT                   LVFTLFSTIIYKYMGTKTETEYTFIVCLIIAGILTIPTSLLFGFLTIKLKTNQVIAGTA
FT                   INLLASGVATFVTYPLGDKIANKTSLSSDYLGLMKIGDGINTIYIGSILILIAVVLITI
FT                   GLIIMMKKTPFGLRLYAIGENPNAADAQGINVYKYQWIAVSISGFIAGIGGGLYMYASR
FT                   SPFGGEVGGIGFLALAILIAGAWRIPLIVVVSIAFAVITKTFSQIDKIPQEIGKLIPYV
FT                   ITLIALISFSKYSVAPKNVGIPFDKSKR"
FT   gene            complement(11997..14207)
FT                   /locus_tag="UUR10_0014"
FT   CDS_pept        complement(11997..14207)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0014"
FT                   /product="ribose/galactose ABC transporter"
FT                   /note="identified by match to protein family HMM PF02653"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59743"
FT                   /db_xref="GOA:B5ZAI7"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZAI7"
FT                   /protein_id="ACI59743.1"
FT                   /translation="MLKFKTVLTCDNLFKGQERKTITKKFLSTVFAIFVAIVVSAILVG
FT                   ILGYDIRDFFIRLFTKWVGSPDIYLTKVAILGIAALSFIFAFKAGLFNIGISGQMLGSG
FT                   LIMLLVVKNMQIANINMPNVLGQFFLLIIAMLAGAMFAVFIGILKVFLKINEVVSSILL
FT                   NWIMFYITRYVVFTAQGKMYNPTPDQVGSRSIPFADNYSLFHLASGYGYLFALLIFISL
FT                   AIIIWIILKYTVFGHKVLSVGKSFDAAKYAGYRTKIISLATFAISGALAGALAMVNYTS
FT                   TTTNAIVISQASDALPTQGYDGIAMGLISLTHPLATIPVSFLMGLLQQSADNLGGSFPQ
FT                   DLSGIIISFVMLGAAMFILFERISPVYWIYHLIYTYKGKDYYRDYENKNNNTISEYKAI
FT                   YIEINKKRNQYLQELKELRKELDKFKNQKQYNGVNEQYQHTVNYIKTTYNNWLKVEYSK
FT                   YLEQMKNNVMQLKKHLIIERATLVYYPEINTTRKVKNKLKHFENISAKKLSRIKDKIHN
FT                   EDFLIKNLVAKEIGKYAQSKSFDYNKLKYLLQQYENNDSILTIDLIDELSLILKDEQVQ
FT                   VMFNEFKQASNENNLEHISSLKNEIMSYINSLLDSRLEQLSSILKSKNLVHDEQMDAII
FT                   SLLNPNDKIFNKIIVSRNKHLENYAKEITKLETKTTSQSDEIEKNTKQHSTSYLTKYYQ
FT                   KTKQHINKIKLDQKQKLLLEDWLTTAYQKAITNQQNMKEVIS"
FT   gene            complement(14210..15817)
FT                   /locus_tag="UUR10_0015"
FT   CDS_pept        complement(14210..15817)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0015"
FT                   /product="methylgalactoside permease ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59961"
FT                   /db_xref="GOA:B5ZAI8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZAI8"
FT                   /protein_id="ACI59961.1"
FT                   /translation="MEIKTNQCPYAIEMHEITKTFLNGTVIANKDVNLFVKKNEIHAII
FT                   GENGAGKSTLMSILFGIYKQDSGSIKINGRIVNFNSAKDASKTGIGMVHQHFKLIDTLS
FT                   VLDNVILGSEGTVQLGMIRRKKIAKELKKIIQEYGLNINLKSKISKITVGQQQKTEILK
FT                   LLYRDIDILIFDEPTAVLSEDEIQAFLQMLKDFKAAGKTIIVITHKLNEIKEVADSATV
FT                   IRRGHYIDSFDVKEKTVAEMAELMVGRKLVEIKNVDPITSDEKVFEVKNLDIQSIVKKQ
FT                   KDITKVKSSPTGDDVSLLAANNNNLINFSIRKGEIFAIAGVEGNGQSELAQIISGLLKG
FT                   NKEAKIILDNQEIEHASIKNRYRLGLSYVPEDRHKHGLVLDDTIAMNTILQQVDDKPYS
FT                   SLGFFNNSEISKHAINIIKKYDVRGTTRGTSDARGLSGGNQQKLIIGREFERSHKLILL
FT                   VQPTRGLDLGAIEFIHEQTLEEKRKGNAILLISYELDEILSLADTIAVIHNGYFISVGD
FT                   RFVMTRQKIGELMAGEKI"
FT   gene            complement(15873..17453)
FT                   /locus_tag="UUR10_0016"
FT   CDS_pept        complement(15873..17453)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0016"
FT                   /product="putative membrane protein"
FT                   /note="identified by match to protein family HMM PF02608"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60260"
FT                   /db_xref="GOA:B5ZAI9"
FT                   /db_xref="InterPro:IPR003760"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZAI9"
FT                   /protein_id="ACI60260.1"
FT                   /translation="MKKSKINKKILFASFAGVATLASVAAIAASCNDSNKNNGGTSQDG
FT                   NYVSKLVLENFYSKPAGDIGDNPGYHRTYNSLYDDGARMLGLISFSHSGPIAEYFKSSN
FT                   AKKDLSAVLIDDKFSGNEGKDRIASVSYRVDQAAFLTGIAAAYYLNANQETFGKDGKLT
FT                   WGGYVGLHFTSTSTFIQGFKFGVQWANEKLKDKNINQEDANGTNKKWMNVEQVFANKYV
FT                   AGSFKPDEEGATNIINDLITKKADVILPVAGPQTNIATSIVSNATDPSVIIGVDTAQEL
FT                   DDVTNRKRITNKTVNDGKTILFSIVKRVDLAMKGAIENASKGAQLTDDITKDAYKLGTH
FT                   TEASLDKSTYVDDTPLVELSNAGRVYLEQAAKLAGLKAITYAQIVDAIQNEDLFKLLSQ
FT                   KGTTTLENVATKTNDGWTLKNEYSNKPFTELQKLLGGEVYINKLDKKLYPYSLTGSSYL
FT                   EEDKTKRSASQEFKKAWDAATTPEAKEKLAKVVLGQNNAVIKDKSFSESAYNGLAAFYK
FT                   SKKIIIPKI"
FT   gene            complement(17621..18418)
FT                   /locus_tag="UUR10_0017"
FT   CDS_pept        complement(17621..18418)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0017"
FT                   /product="deoxyribonuclease, TatD family"
FT                   /note="identified by match to protein family HMM PF01026;
FT                   match to protein family HMM TIGR00010"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59820"
FT                   /db_xref="GOA:B5ZAJ0"
FT                   /db_xref="InterPro:IPR001130"
FT                   /db_xref="InterPro:IPR015991"
FT                   /db_xref="InterPro:IPR018228"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZAJ0"
FT                   /protein_id="ACI59820.1"
FT                   /translation="MLEKIKIIDTHTHPNIEPLIDEFDDIIAECYKQGVGLNIVGVDLK
FT                   SSQIAIEQAKKFAFLTCSVAIHPNDLHNIEEDFVALEKLVKENVDYISCIGECGLDYYH
FT                   EQEYDHDFQKYWFKKHIELAKKYHKPLMLHIRNAHDDAIAILKELDVKDAIIHCFTDKK
FT                   KYAEQYIKMGYYLSYPGVITFKPTKNNQIDELHEAIKITPLDKILVETDAPYLTPTPKR
FT                   GQINYPYYVLYTSAFIANLLGITYEKMQNILLQNALRILNFKK"
FT   gene            complement(18420..19736)
FT                   /gene="trmE"
FT                   /locus_tag="UUR10_0018"
FT   CDS_pept        complement(18420..19736)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="trmE"
FT                   /locus_tag="UUR10_0018"
FT                   /product="tRNA modification GTPase TrmE"
FT                   /note="identified by match to protein family HMM PF01926;
FT                   match to protein family HMM PF08477; match to protein
FT                   family HMM TIGR00231; match to protein family HMM
FT                   TIGR00450"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60076"
FT                   /db_xref="GOA:B5ZAJ1"
FT                   /db_xref="InterPro:IPR004520"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR018948"
FT                   /db_xref="InterPro:IPR025867"
FT                   /db_xref="InterPro:IPR027266"
FT                   /db_xref="InterPro:IPR027368"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031168"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZAJ1"
FT                   /protein_id="ACI60076.1"
FT                   /translation="MSTIVALATAPMNCAIHIIRISGPQAFEMINKISTTKIKKETFKI
FT                   WYTTLKDNDQVLDEVLVNTFVGPKTFTGEDLVEINCHGGVIVANLIIKILIKYGCQPAQ
FT                   RGEFSRRALLNKKMDLSKIEAINNLVNAKNELSVKGVIGALLGRVSQSISDFKHELFMI
FT                   IGQIEVNIDYPEYDDVEQVDAINLKQRLLVLNEKIKKIIDQSKKFLPINKGIKVLIIGK
FT                   PNVGKSTLLNALCNEQKAIVTDIPGTTRDVIESSINIDNITLNILDTAGIHSTNDFVEN
FT                   LGINKAKELINKVDLVLYLVPANNQQDLELYDLIKDQKHLLVYTKKDLIDQYSDDQIYI
FT                   NAKDNDIQALIDKIKELFYVQEFDNANIDVLQSQRQIGILENVNYLIDNAITNLEKGDT
FT                   VDLVVADLEFCNLRLNELLGIGSEYDFLDDLFKNFCVGK"
FT   gene            complement(19739..20533)
FT                   /locus_tag="UUR10_0019"
FT   CDS_pept        complement(19739..20533)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0019"
FT                   /product="DNA polymerase III delta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60159"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZAJ2"
FT                   /protein_id="ACI60159.1"
FT                   /translation="MKYSFANLLIQSPKTSLTLGVEQIMLAFINEKNHEQQAYYINKVK
FT                   NNQYFDLKIYDSLSMKKSDVIDLQNAFLYDGIEDINLKFYLIKNIDLASKYVLNALLKF
FT                   IEEPPKNTIAIFSTKNLNQVLKTIKSRCQLFYLPANYDLYHQLIKQINQPISATECDLI
FT                   FDDLDELKTLLENNEINEVLAYHAKLNDIKSFETLNDLKETFKNLSILQIHYLLKLIFI
FT                   KINNINSKQAILDLMRANLKININKNSLFTIIYTIIIENRGD"
FT   gene            complement(20533..21222)
FT                   /gene="tmk"
FT                   /locus_tag="UUR10_0020"
FT   CDS_pept        complement(20533..21222)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="tmk"
FT                   /locus_tag="UUR10_0020"
FT                   /product="thymidylate kinase"
FT                   /EC_number="2.7.4.9"
FT                   /note="identified by match to protein family HMM PF02223;
FT                   match to protein family HMM TIGR00041"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60028"
FT                   /db_xref="GOA:B5ZAJ3"
FT                   /db_xref="InterPro:IPR018094"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR039430"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZAJ3"
FT                   /protein_id="ACI60028.1"
FT                   /translation="MLTKNSNELKSPKKGLFIVFEGIDGAGKTSILKQLLDVLKEPKLV
FT                   NKIFLTREPGGKNNTAAELIRDFFLKNLEAFDPLTLAYLYASSRAEHVKKTINPNLEKG
FT                   HIVISDRFVHSSYIYQGIVQNQSLEVIHHVNQQAIGNLEIDYIFYFDVSVNNALNRMKN
FT                   RFDNTNAFDSQNKQFYEKLLKQYPSVFNAYNQPKKIIFIDANKSENEVLCEVKERLLEI
FT                   FKEHKYI"
FT   gene            complement(21206..22069)
FT                   /locus_tag="UUR10_0021"
FT   CDS_pept        complement(21206..22069)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0021"
FT                   /product="triacylglycerol lipase"
FT                   /note="identified by match to protein family HMM PF00561"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59951"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZAJ4"
FT                   /protein_id="ACI59951.1"
FT                   /translation="MELIKTNTLNFYFEPAKNELKKGSIVFIHGLDASPHYFFLINQSL
FT                   LEYDCYFVGLPAHGLTPVNSKKELNIPAFAELFINWINEIDLKEFYLLGHSLGAGVASL
FT                   VGFIVPQRVQKLILVCPYHYQYLNPFLNKKLFNAWVLFPNPFLKFKTDVILKKLYIDYR
FT                   NNYKTLPETRWDSISREYPRVARDISLLCLSLLNIKFNHELKMAQRNLIMPTLVMVSKQ
FT                   DELIDYRLALKVFRNNSQISTYIFNNSGHIPFIEEPKLFTNILLSFLEDRFIEQEESES
FT                   NDVNEK"
FT   gene            complement(22174..23196)
FT                   /locus_tag="UUR10_0022"
FT   CDS_pept        complement(22174..23196)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0022"
FT                   /product="ferrichrome ABC transporter"
FT                   /note="identified by match to protein family HMM PF01032"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60145"
FT                   /db_xref="GOA:B5ZAJ5"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZAJ5"
FT                   /protein_id="ACI60145.1"
FT                   /translation="MRIKTRFQQFLKYQFEQKTFFRFKKNKVFLPFVLLILTISLMLIA
FT                   VAGASRFVNVFSYLIDWKIISQLLISGIALGISGYIIQRLTKNRLADSSLLGMGNINLV
FT                   ILTVLFLIFDFGQLQVQRRIEYILPFIYLIGSLIICFFIHFLCNSSGGYIFKRIIISGI
FT                   VINLITIVIAQSLRILMSKESSMYLKIILLGNIESRTDFCFYFCLAMLIISIIWLMANS
FT                   TKLKIMVTNQQLSEQLGINSKSLTLQTFVCISLLVSTSYSLSGNVIFVGIVAANVAFNY
FT                   AKNKICNGIINAGLMGGIVLLVSYIFVVLILKLSADQVILLVPIISGPYFLYQVILLKN
FT                   "
FT   gene            complement(23197..24138)
FT                   /locus_tag="UUR10_0023"
FT   CDS_pept        complement(23197..24138)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0023"
FT                   /product="ferrichrome ABC transporter"
FT                   /note="identified by match to protein family HMM PF01032"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60116"
FT                   /db_xref="GOA:B5ZAJ6"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZAJ6"
FT                   /protein_id="ACI60116.1"
FT                   /translation="MLTSFIFLFNIIYTNKTFIWQSFYFQKASSEEVFLLFFYSPIILL
FT                   VCGVGLVCSGFSLQSTTRNGLAGPSTLGIFPLAALGSILSQLITKSFSNIFIGYAFGIV
FT                   FSLIALGINFLFIKMTPHKKTFKPILFGFSLGAIITAINVLIANFHSSIVASPIQLLGS
FT                   VGVYSSIERFYIGVPIVFISTIVLLCYAKKIQILYTSHYLAKSLGININRMYWITSICS
FT                   IFIAISTTFLIGGLSLIAIVMPHLSRLLFKRTNYLFQMIAAIFLTCILLQLLGLVVEFF
FT                   SKFNIVFLVATVLAIPMIVLLKWELGWKVNKN"
FT   gene            complement(24239..25639)
FT                   /locus_tag="UUR10_0024"
FT   CDS_pept        complement(24239..25639)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0024"
FT                   /product="putative ABC substrate-binding protein-iron"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60349"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZAJ7"
FT                   /protein_id="ACI60349.1"
FT                   /translation="MKISFKCKLISVISIIGLSIIFATLTSCANLKQPRLYNSNWLVEN
FT                   ANWKRNNFFRNPYKIHLEFARQLDDVLNFNELKKRLPKPMQNVKSFTEWSQKITQLIKD
FT                   DVNNVAMLEGIQKMRKRKATVLVLENRDELVNNKENYNKFSILTPPDLPLIYSNPFTEV
FT                   PGLGLNFPEPINEDVKDVIDRYQSIGHSALRTNPLESVLKQISSFYKTADYVFYMYDSN
FT                   LFTSNKYKNNYRNRHQLFKKITSHKDFYPHKLLRNRYSKIIFIDRSLFWWGSFAMVGQS
FT                   LIIKELLRIFASKEFSKIKWNYKPFDKSELINLFDHKPSIQERNSIIKSHYINENTTLD
FT                   YGYKIVGTWADSIDHLISFGLKPDAIVDYASFNNISLKTQGFSNYLKKFVDYDKLEKTY
FT                   KTPNDSEKSEFINKDFAIYAGAAYLLNSINKLIVIKNAGSWAIGTTQGINDPKTQFKTR
FT                   INIAKSNL"
FT   gene            complement(25694..26797)
FT                   /locus_tag="UUR10_0025"
FT   CDS_pept        complement(25694..26797)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0025"
FT                   /product="ferrichrome ABC transporter"
FT                   /note="identified by match to protein family HMM PF01032"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59821"
FT                   /db_xref="GOA:B5ZAJ8"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZAJ8"
FT                   /protein_id="ACI59821.1"
FT                   /translation="MHNYTFRFKLFKQIQNQTTKKLKPLILLVAAIILIATIFSIWIWN
FT                   ISYANFYDQTLNKYVYFSLNESLKLIFSGQFLDSSNIKYLNLQATFWASIASILSGISL
FT                   AIAGCVTQALTRNPLADSSTLGIVQSSVFMIVIAFSHNIISFGGLFGFAIVGGIVASII
FT                   LLILVFATRNKLSYVKITLAGLAIGVFFNTIAYFVRIQSAKGSSINFKYVLGGSENIYP
FT                   THIDPFLTLWVSAVLILIGVIIACVLSHKLTLLEIGDEKAKNLGSSIIIVKILAIVSTI
FT                   FLISPTILLVGNIAFVGLFAPHIVRKVFGIRDYRYVMPLSGLFGAMITSLGLILYRETI
FT                   YINSSIWMSFIGAPVLAYLGWKHWNRA"
FT   gene            complement(26969..28024)
FT                   /locus_tag="UUR10_0026"
FT   CDS_pept        complement(26969..28024)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0026"
FT                   /product="30S ribosomal protein S2"
FT                   /note="identified by match to protein family HMM PF00318;
FT                   match to protein family HMM TIGR01011"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59723"
FT                   /db_xref="GOA:B5ZAJ9"
FT                   /db_xref="InterPro:IPR001865"
FT                   /db_xref="InterPro:IPR005706"
FT                   /db_xref="InterPro:IPR018130"
FT                   /db_xref="InterPro:IPR023591"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5ZAJ9"
FT                   /protein_id="ACI59723.1"
FT                   /translation="MSQMENSTKKVESVADVEVVATENAKVEQKPTSPADAIQLKVNAN
FT                   STIKNLKTLVSIVKLTESGAHIGLNPKKWNPKMANYIHAKRSNNHVIDILKTILFLDRA
FT                   YKFLQEVAQNGGTVMFVGTRGRVVKELIKAEAERTNSFYVTQRWLGGTLTNFANISRSL
FT                   KKFNSNLALLESEEINKYSKKEQIAINKETAKLEKFYGGIKTMKQRPDVLILVDPVNDV
FT                   NAIKEARKLNIPVIALANTNADPQLIDYIIPVNNYSVKSITLILGVLADAIAELRGEPT
FT                   KIVGRPDSEIVLPETKSSWRQNNYDPSKRGYNPKYVNHKSTFNKFNNKKPAEATSQAKT
FT                   NEKIVIKAETN"
FT   gene            complement(28122..29096)
FT                   /locus_tag="UUR10_0027"
FT   CDS_pept        complement(28122..29096)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0027"
FT                   /product="putative ABC substrate-binding protein-iron"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60041"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZAK0"
FT                   /protein_id="ACI60041.1"
FT                   /translation="MNKKIKTLIVSSSLSIGLLSLVATNIAACSSSIKSKQEYEIYPTI
FT                   KGYEQRDFSKILASEFIKIIKTNIQFSSTNKDVKYELYDARLNELDEDVIDLIIRYELK
FT                   GQTHTYKKVLKGFKNAKQYRLFLENKKYLEDEKNRDALYLTPTVNSSIDISKTTIAEAL
FT                   KWQLSYLSINNGNRDLKYEILKITKSEVANSINVEIRISKGNGENLVSITYSRTLNGFI
FT                   SDEYKKVYLANLEEIKQAKNQIEPQLLDEKTKQKTVKEVIENYKTLFKLPTQTGFIYEI
FT                   QSVETDVNNKTAVVFNIIVKKGENSQQATLRYTKVITGFVENK"
FT   gene            complement(29111..29857)
FT                   /locus_tag="UUR10_0028"
FT   CDS_pept        complement(29111..29857)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0028"
FT                   /product="putative ABC substrate-binding protein-iron"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59943"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZAK1"
FT                   /protein_id="ACI59943.1"
FT                   /translation="MKTKFKKIIILFLGLPVLAIPFIVSACSQLKINQDVILTYRPTVS
FT                   LAKEFTNDNNTIDDVLKKVKINKDDTNNLLVYDLSKSPKNVQYKIVDIKKDSEQILKVT
FT                   INAKIQKYKQSINYDFYFQPFLTPKEKEDKTIFQQNLNIIKSAWDYDQKQKTGFFDLKI
FT                   KTEYQKKSLVEIKTLGEKAFDFGKDLNPQLKVDPKFKDINIKIIDINYFEPLNEKQREL
FT                   VIEIVITKGENEQQAQLFKKIKVNLN"
FT   gene            complement(29863..31983)
FT                   /locus_tag="UUR10_0029"
FT   CDS_pept        complement(29863..31983)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0029"
FT                   /product="protein tex"
FT                   /note="identified by match to protein family HMM PF00575;
FT                   match to protein family HMM PF09371"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60179"
FT                   /db_xref="GOA:B5ZAK2"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR006641"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018974"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR023319"
FT                   /db_xref="InterPro:IPR023323"
FT                   /db_xref="InterPro:IPR032639"
FT                   /db_xref="InterPro:IPR037027"
FT                   /db_xref="InterPro:IPR041692"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZAK2"
FT                   /protein_id="ACI60179.1"
FT                   /translation="MIDLIIKTLVQKLKIEAKYITNVLDLLADNNTIAFIARYRKHLTN
FT                   NMDEFQIQAIAHEYEYLTKLNKRKEAIIKNLEQKGLLTDDLLESINNCQRLVDLENLYE
FT                   PYASNKKTKASMAIEKGLEPLALLILKNNPNCNIKEVAKQYLNEQVLSVDEAIAGACDI
FT                   IAQKVANDATLRQMLYETISKHAKLITKINKIANDPTENFALYYEFSCPIKYLKAYQLM
FT                   AIDRANELKIITFKLDFKKEFLIDFAINKYTRKNKSDSYDYIKLAVNDGFDRLLIPSVS
FT                   NAVYKEKLDEAHQQSAQIFSDNLQQLLLQKPLKDHIVLGFDPGYAHGCKLAVVDKNNQL
FT                   LHTDIIYPHKPQELIEQAKNTLISLINKYQINTIAIGNGTASNESVIFISDLIKEFKLN
FT                   INYCVISEDGASIYSASLIASEEFPNLSVEKRSAISIARRIIDPLGELIKIDPKSIGVG
FT                   QYQHDINKNILEQKVDFCIDYCVNQVGVDVNTASIPLLSKVSGLNKRSAKKIFEYVKEH
FT                   QSIKSREQLKTIPYVTDKVFEQAAGFLRINNSLNFLDKTSIHPESYAIVNQLCEYIKLP
FT                   INDLINNHQVLNQLNPNDLTNVLKTDVYTIENIINNLKNPLQDVRDDYDIPILRSQMVD
FT                   INDLKVGMLVQGTIRNQTQFGSFVDIGLKNDALLHISHYSEQDNLHVNKNINAYIDKID
FT                   TIAQKISLKLRP"
FT   gene            32091..34334
FT                   /locus_tag="UUR10_0030"
FT   CDS_pept        32091..34334
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0030"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60084"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR022382"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZAK3"
FT                   /protein_id="ACI60084.1"
FT                   /translation="MNLKAKRFLKVITIISPIIIIPTIIASCAQTNSSTPNNPVKTPKS
FT                   SVEVVNINPYKTKQMLASNINKEQINAYFIFVFNLIKEDQKIEEKILEKNDYEIINWAG
FT                   NDNDGTLSINVLIKATKQSYLISTQAVFLTNKQNSYLQELKYKTPAVYSIDDILKLSND
FT                   PYNLIYNNPYYQEQLLRAKVYFNQNEANIADSKLYMNKIGYSEFGDDVQKRLENAFKVR
FT                   YDEQNIYQINSPQILVKETKTVTSYTDEQTNNSYSINVELIKKLIQINPFGKLPTNFAQ
FT                   LVNLIKKEEYPKFLTITKNEPINNVVVKDIYYRIIDRYAKLEFILEIYNQKTKQTVYLS
FT                   ANFNQKNSQLLKNEDYFQYIFDRTISLNLLTTKDGKNVELNSGTGWIVDRIVDDSLPKN
FT                   KIKLLVATNNHVMSWSNLAISKDNKTKSRWFSKQEYANYLENNAGLISSNIYEDKDRYQ
FT                   CLLWGTAPLKSPVSNKYNSLSGISFSNLAKVYNITSQNFVNRAWYLPQLSANGIKINEE
FT                   LKTWYQVNQESIKSIKNGTLDFALVPMVFDIEDIKEKLPNYYKVLNTKDEANWYIGLGN
FT                   SKKYLPQLQLFSGGYPGDRNFNSSAIVSWRGSKSYGSLIQAFDREIENESILDYYGPKR
FT                   INNIDAYQKVDEGYLNKLFNVGTRVITSDEIGDLGSGSSGSMIIDSNFNLVGIHFASLN
FT                   SRAYGAPNDSMIGNLFVAQSQDLSGDIDVRAAVIKKLKAENIYTYKLNPKVSS"
FT   gene            35150..35623
FT                   /locus_tag="UUR10_0032"
FT   CDS_pept        35150..35623
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0032"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60203"
FT                   /db_xref="InterPro:IPR039564"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZAK4"
FT                   /protein_id="ACI60203.1"
FT                   /translation="MVYKLWDINWRWPNLALPRYYDYPVQKFLENKDAKNNYEVEYKLG
FT                   SYYWETIKNINDNNPVIVSTTKTMHAFVVYGYDESTQMLLINWLWGDSRAITLVNYWKL
FT                   AASGSILKLFYTLKPKKNIKPNLKKVFNYKGQYYDGNEMTEIYNSLQKGNIYP"
FT   gene            complement(35597..35839)
FT                   /locus_tag="UUR10_0031"
FT   CDS_pept        complement(35597..35839)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0031"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60306"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZAK5"
FT                   /protein_id="ACI60306.1"
FT                   /translation="MLTQKIQDSIIAKILLINENRKKKAKAIGEWYHSDAFPFILATMA
FT                   MIIKYKQKQVIKIKANKKVLINCHKTLLWVNVSLL"
FT   gene            35970..36506
FT                   /locus_tag="UUR10_0033"
FT   CDS_pept        35970..36506
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0033"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59971"
FT                   /db_xref="GOA:B5ZAK6"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZAK6"
FT                   /protein_id="ACI59971.1"
FT                   /translation="MIVFINQNYYYIKRIHNLLIPIRIDEIKILEYSYIYLLRYGFYIL
FT                   LTVFIAKFIHDKRSMIKVLSLYLFINFILMIIGTSFTFLEHTNFYNGMLTYWTTFSCAL
FT                   LYPEIINDNFQWISSFNYNLKNTIYENNFIAYLPYFCSFIILIILIKKVSWKSITISSN
FT                   SYQDHFASKYLFKLS"
FT   gene            complement(36559..37086)
FT                   /locus_tag="UUR10_0034"
FT   CDS_pept        complement(36559..37086)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0034"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59725"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZAK7"
FT                   /protein_id="ACI59725.1"
FT                   /translation="MSKKINNNKTPRNKVKNNNVSKDNDDIVISLCYENWVKGERVDSL
FT                   TTYTKDENQFFKNIIYILNTLFPYVYKNWKNKGINDHCHPIKQNNVFSKYIKLIKKLHP
FT                   NLLKNDNEELELYQLGLGRSIRVICSRIDNTLFPLLIDHHHLGYESQSYNDKDTKKYDY
FT                   CPLRKYNKNQDN"
FT   gene            complement(37094..37567)
FT                   /locus_tag="UUR10_0035"
FT   CDS_pept        complement(37094..37567)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0035"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59860"
FT                   /db_xref="InterPro:IPR025272"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZAK8"
FT                   /protein_id="ACI59860.1"
FT                   /translation="MKEITPLIVANWFLTKESMTLKKVQKLVYYAYSWYLILMNEKVDD
FT                   LKNKLFDEKIKAWVHGPAIPMLYNEFKEHKYNSIPKINDFNEQEYFNLDTIDILNQVWD
FT                   EYGHYSANQLESITHQEDPWIKARKGFGPLDSCNAVISDKEIFSYYIKQMKIN"
FT   gene            complement(37709..39241)
FT                   /locus_tag="UUR10_0036"
FT   CDS_pept        complement(37709..39241)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0036"
FT                   /product="type I restriction enzyme"
FT                   /note="identified by match to protein family HMM PF02384"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60271"
FT                   /db_xref="GOA:B5ZAK9"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR003356"
FT                   /db_xref="InterPro:IPR022749"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR038333"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZAK9"
FT                   /protein_id="ACI60271.1"
FT                   /translation="MENNKQTKINIDDIANDLWASCDELRGNISSEQYMHIIIGIIFLK
FT                   TISDKYNYAINALKDKYKDKFNDSIKNDSDLISEFFPLGLIVPDEAHWNYISGFTTDSS
FT                   IGEKIDQAFLKIENQNPRLKGLFNKQYNSPELDKTRLGNVVRKFNDYDFSQFNEDLVGR
FT                   IYEYFLGEFFRKQGQKGGEFYTPKTVVELLIDILDPNDNIKMYDPACGTGGMFVQARNY
FT                   LHEQNKDYNKLVIYGQEYQSQTWKLAKINLLLNGFNENDIHLGRGSEDTFKEDLHKGQK
FT                   FDIIVANPPFNLKKWYREELLNDERFSWGMPPENNANYAWLLHIISKLNSRGKAGVILA
FT                   NGSLSSSNKEESLLRKKMIEENIVDAIISLPDKLFYTTQISASIWFFNKNKENENVLFI
FT                   EASKMGELKTKKLRFLTKDNISKIKNVYDKHEQGEDVNVVGFAKTCTIDEIIENDYSLV
FT                   PGRYVGFEQEVIDHEQLNHEIKGLQEELSVLFDELEDLIPQAKESIKKVLEK"
FT   gene            complement(39245..42313)
FT                   /locus_tag="UUR10_0037"
FT   CDS_pept        complement(39245..42313)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0037"
FT                   /product="type I site-specific deoxyribonuclease, HsdR
FT                   family"
FT                   /note="identified by match to protein family HMM PF00271;
FT                   match to protein family HMM PF04313; match to protein
FT                   family HMM PF04851; match to protein family HMM TIGR00348"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60344"
FT                   /db_xref="GOA:B5ZAL0"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR004473"
FT                   /db_xref="InterPro:IPR007409"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR021810"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040980"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZAL0"
FT                   /protein_id="ACI60344.1"
FT                   /translation="MSDSNISYDEKYLEEQVIEKIKALDYEYIDPRSFLEKRDSKQEII
FT                   DWTKLDEAIRRINKRIEDYEVNDIINKIQNELNNANLLDRNKKLLSFMVHGISIWNQKE
FT                   EINKTRKIIDLDRINNNDFVVTNQLIVRSTHPEWENQIPDVVIYINGVPVVIIELKTMK
FT                   SSNDILLEAGAQIQRYVDFIQDIFSFNLFSIISNGAISKIGTFPKKDDDFEIWRNEQFS
FT                   SDIFDTIKFLLAPKNLFDLLRNFIFFTNKGNKIFPKYYQYFGIKKGISSIQKAWDENQQ
FT                   KAGIIWHTQGSGKSLSMVMLVSNLKKCLDLKRLTALVITDRKDLDGQLFNTFSICEDYL
FT                   HQTPYQISSCEDLKKSLQDVKQDGVYFSTIQKFNDEIELSDRKDILIISDEAHRSHNNY
FT                   LAIDENNEENNSNKPYSYLLRKAFPNAIFIGFTGTPIENKDVSTSEIFGDVIHKYTLSQ
FT                   ATEDKSIVPINYENAQVEFKLDEEKLKLIDEQNEKENQEIKNNHKKDANDIIVKKDIKK
FT                   IEEILQILQSDERIKIIVKHFIKHYEARRGVLKDKAMFVAMNRLCAEKYYHEILRNRPD
FT                   WVNKIKLIITPNKKDSPELTKIIGSEQDRKNVINQFKDPNSEIKILIVVDMLLTGYDVP
FT                   SLDVIYFDRVLKMHNLMQAMARVNRKYIDKDNPNIKKEAGLVVDYIGIFKRIQEALKFY
FT                   WDGNQTKNKFKFEEKYQNVDDILANYNDALKNVYDKYFSDLNVAKLIDEKNYLALVDEV
FT                   FNKSLTSEFIHDVKNIRVAYKMVISTLSEEIIERSNLLFATAAYIKNTNDGNVDYDEYN
FT                   KALRESLKDSVAFFDIKEPEHKQIHKLVDIESFVSNIKKNEDMGNQQKKQMLFNRFLNK
FT                   IKNSVNISIIAKTKLSQKLEMVFERFKMDSLSYEEFIQYIFNEFGDDLINDEIENNEEK
FT                   FYVKMFVDAVRLNEDQSDEEIESIAYEIYDAITMQGKRLIEKSWLHSEANRKDVRRIIK
FT                   EVLIFKNYPPENREKTSYDIVEQIEEILDNRGN"
FT   gene            complement(42544..42933)
FT                   /locus_tag="UUR10_0038"
FT   CDS_pept        complement(42544..42933)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0038"
FT                   /product="reStriction-modification enzyme mpuuiii s
FT                   subunit"
FT                   /note="identified by match to protein family HMM PF01420"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60132"
FT                   /db_xref="GOA:B5ZAL1"
FT                   /db_xref="InterPro:IPR000055"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZAL1"
FT                   /protein_id="ACI60132.1"
FT                   /translation="MYDGEFITISADGAYAGTVFLQNGKFSITNVCFILMKNKDIDFKF
FT                   NNKFVYYILKKEQEINRLKSQVGSSRPAVREYSLKEIKINLPNMEIQEEFSKIVEPLLN
FT                   LSTKANRIEKILNDCLLKNVKKLIV"
FT   gene            complement(42999..43640)
FT                   /locus_tag="UUR10_0039"
FT   CDS_pept        complement(42999..43640)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0039"
FT                   /product="restriction modification enzyme subunit s2a"
FT                   /note="identified by match to protein family HMM PF01420"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59914"
FT                   /db_xref="GOA:B5ZAL2"
FT                   /db_xref="InterPro:IPR000055"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZAL2"
FT                   /protein_id="ACI59914.1"
FT                   /translation="MSIIYKLGSLVNIYKGSTLITKKYIDENQGIYPVISSKTTENGIY
FT                   GFINRYDYEKNKITMSLIGENAGTFFWQEKNFSLTNNACVFISNKNINYNYKYLFITLK
FT                   KHEYKIKEFIVIGSARPMISSNHLKLVDVNLPSIEIQDAIISIIEPIEKVINNIKNIKI
FT                   KIESLINKYFDFLYSDLEDSNFKKYILGDLFTINRGQIINSKYIYIYITT"
FT   gene            complement(43791..44909)
FT                   /locus_tag="UUR10_0040"
FT   CDS_pept        complement(43791..44909)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0040"
FT                   /product="restriction-modification enzyme subunit s3a"
FT                   /note="identified by match to protein family HMM PF01420"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60218"
FT                   /db_xref="GOA:B5ZAL3"
FT                   /db_xref="InterPro:IPR000055"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZAL3"
FT                   /protein_id="ACI60218.1"
FT                   /translation="MSINKHKMLDISEIISGRGPKNVKNLQDFASQHGKINWLLVKNLI
FT                   NNSINNDFEKYNLDEEKHSLVKLNKNELVYSMYATPGIVAINEFYDNLYINQSFCKIIP
FT                   NENICLKKFLFYWLIKNKNYALSLSSGTTQSNLNINKIRNFVIYLPPIEEQNAIISIIE
FT                   PLEKSIKTINLLQTKIGLFIEKTFNFINNNLANADLIEFSLKDLLNIKRGLPITEKDLL
FT                   NNPGNYPLISASSKNNGIFGYFNDYMYDGKNITISMNGNAGCIFYQIGKFSANSDVLVL
FT                   SNSNKNLTNIDYIYYLLKTKEKEIQNLAIGTTRFRLGNSVIEKFKVLLPNMEIQKEFSK
FT                   IVEPLLNLSTKVNKIEKNLNECLLKIVKKLII"
FT   gene            45017..46237
FT                   /locus_tag="UUR10_0041"
FT   CDS_pept        45017..46237
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0041"
FT                   /product="restriction-modification enzyme subunit s3b"
FT                   /note="identified by match to protein family HMM PF01420"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60134"
FT                   /db_xref="GOA:B5ZAL4"
FT                   /db_xref="InterPro:IPR000055"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZAL4"
FT                   /protein_id="ACI60134.1"
FT                   /translation="MSIKLKDIIYAKRGSTITSNEFKINPGSYPLISASAQNNGVFGYI
FT                   NYYMYEGGHITISMNGNAGCVFYQKDKFSANSDVLVLSNIDNKISNNKFIFYWLKKHEN
FT                   TKIKSLCKGTTRLRLSNDDVLNLEINLPPIEEQNAIISIIEPHEKLFIKYSNLVDISSV
FT                   ENTKKDVDNLISIIEPIERIIKNLKAIKYKLETIMNNFFVVFYLFNNEENSNKYKLRNI
FT                   GKFKGGISTLDKNNYDSGINFINYMDIYKNFVINDDIKLRLYNASEKDIKSYIVSYGDL
FT                   LLTASSETKEEIAFSSVYLSNKQAIFNGFSKIYKYDQNILLPIYAAFYFRSEFFRKEVI
FT                   KLATGYTRFNLSIKDAKNIEISINNFEFQKKFSKIVEPLLNLSTKANKIEKILNDSLLK
FT                   ITKKLIV"
FT   gene            46334..47722
FT                   /locus_tag="UUR10_0042"
FT   CDS_pept        46334..47722
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0042"
FT                   /product="divergent AAA domain family"
FT                   /note="identified by match to protein family HMM PF04326;
FT                   match to protein family HMM PF08220"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60049"
FT                   /db_xref="GOA:B5ZAL5"
FT                   /db_xref="InterPro:IPR001034"
FT                   /db_xref="InterPro:IPR007421"
FT                   /db_xref="InterPro:IPR025831"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR038461"
FT                   /db_xref="InterPro:IPR038475"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZAL5"
FT                   /protein_id="ACI60049.1"
FT                   /translation="MNLKQYLGETNFYDKKEKLEKKKIKSWLKSVCAFANGQGGKLIFG
FT                   VNENNDVLGLENYLNDSEFISETIKTKIDNIPEFDIEINEYENKIILILTIFPGRNPPY
FT                   FLVDNGSKTPYKRVGNQSVIASRNDLLNWCLRSQNRTYDSLVSNKLLKDVSFLMLKNEY
FT                   QKHTENLWEDKFLKSFELIDNNNCLTNAGALFADGYQVYQSRVFCTRWNGKTKTNGLIE
FT                   ALDDAEFEGNLLFLLNSSIDFIKRNSKNMWRKGVLYRIQYPEYPIKAVQEVIVNALIHR
FT                   DYSIIGSEVHIDMYDDRLEVYSPGGMYDGNFVQNINPYNVWSIRRNPILADLFARMNLM
FT                   ERRGSGLKNILEIYASKENYREDLKPEFRSTESAFFVVLKNLNYQEQNISKNENQKISP
FT                   SQRRQKIIEFIQQNPKTTAYELTKVFFVSINTIERDLAKLVHDGYVEFVGSSKNGEWKI
FT                   KTNQ"
FT   gene            47798..49642
FT                   /gene="gidA"
FT                   /locus_tag="UUR10_0043"
FT   CDS_pept        47798..49642
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="gidA"
FT                   /locus_tag="UUR10_0043"
FT                   /product="tRNA uridine 5-carboxymethylaminomethyl
FT                   modification enzyme GidA"
FT                   /note="identified by match to protein family HMM PF01134;
FT                   match to protein family HMM TIGR00136"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59879"
FT                   /db_xref="GOA:B5ZAL6"
FT                   /db_xref="InterPro:IPR002218"
FT                   /db_xref="InterPro:IPR004416"
FT                   /db_xref="InterPro:IPR020595"
FT                   /db_xref="InterPro:IPR026904"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5ZAL6"
FT                   /protein_id="ACI59879.1"
FT                   /translation="MKKYDVIVIGAGHAGLEAAFATSNLNLQTALITLDEKGIGMMPCN
FT                   PSIGGPAKGIVTREIDALGGIQGKAADATTMQMKILNSSKGPGVWAIRAQIDKIAYQRW
FT                   FKQQIKQQKNLDLIIAEVSDLLVENNIVKGVILSDQKIIQADYVIITTGTYLKSITHRG
FT                   SVCVDEGADGTKNAKFLSDVLVKLGFELIRLKTGTPARIKKDSIDFTNMVLEPGTNQKI
FT                   AFSHYHPVYKPYDKQLPCHIIYTNEQTHQIIRENLNKSAMYGGMISGIGPRYCPSIEDK
FT                   IVKFSEKPRHQIFVEPESYELDSMYLGGFSTSMPIDVQEKMIRSLPGLEDCEILKYAYA
FT                   IEYDAIDPTQLYPSLESKLVNNLFFAGQINGTSGYEEAAAQGLMAAINVSQKHKNKEPI
FT                   VLGRDQAYIGVMIDDIVTKGVVEPYRLLTSRAEHRLALRNDNADDRLMKIGFEIGLLKP
FT                   EVYDQYLNNLKQINEVLNWLKTTTVGQIDDLKFTTLKTNSYLIDYLKRPEVKLNDLLIY
FT                   CPIKIEDEQIINKVQIQVKFEGYIKNQEENLKQLKRLNNIKLHGIVDYKEVPNISLETI
FT                   DKLNKIKPLDLEQASRISGVNLTDIAMIKYYLERIKND"
FT   gene            49635..50345
FT                   /gene="gidB"
FT                   /locus_tag="UUR10_0044"
FT   CDS_pept        49635..50345
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="gidB"
FT                   /locus_tag="UUR10_0044"
FT                   /product="16S rRNA methyltransferase GidB"
FT                   /EC_number="2.1.-.-"
FT                   /note="identified by match to protein family HMM PF02527;
FT                   match to protein family HMM TIGR00138"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60140"
FT                   /db_xref="GOA:B5ZAL7"
FT                   /db_xref="InterPro:IPR003682"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZAL7"
FT                   /protein_id="ACI60140.1"
FT                   /translation="MTRKDFFNVLTRYFPWVDEQTFISFEKYKTIIQKYNQIFNLTRLD
FT                   SDDKIYQNFFLDSLAPYKELDFFTQNTNLKLIDIGSGSGIPGVVLKIIFKNLNLTLLEA
FT                   NQKRCEFLKILTQELGLNDVLIWNMRAEDLTQSMRESFDVATSRAVASLDKILEISAAF
FT                   VKVNGYLIQPKSIKFYEEELKAKNIIKTLYLERIALKDFWENDYHHLVGVYLKKQITPL
FT                   QFPRPWNLILKKPL"
FT   gene            complement(50361..50513)
FT                   /locus_tag="UUR10_0045"
FT   CDS_pept        complement(50361..50513)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0045"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59874"
FT                   /db_xref="GOA:B5ZAL8"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZAL8"
FT                   /protein_id="ACI59874.1"
FT                   /translation="MFKEIKNVNEIPSVRFVLITLITWGIYPITRKIDPKMPITKIITG
FT                   NELII"
FT   gene            50551..50730
FT                   /locus_tag="UUR10_0046"
FT   CDS_pept        50551..50730
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0046"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59979"
FT                   /db_xref="GOA:B5ZAL9"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZAL9"
FT                   /protein_id="ACI59979.1"
FT                   /translation="MIFNKHNGIPTALPLCLANTIVGILGLVILIYKVKNIKKAKLYLM
FT                   DEKTYYEKYVLNNL"
FT   gene            50796..51143
FT                   /locus_tag="UUR10_0047"
FT   CDS_pept        50796..51143
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0047"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60308"
FT                   /db_xref="GOA:B5ZAM0"
FT                   /db_xref="InterPro:IPR006603"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZAM0"
FT                   /protein_id="ACI60308.1"
FT                   /translation="MFAFLPQTLLTIKTKNTAALTISMFIICFIARLCFSLSAILTIIV
FT                   YIHNQDYGLSLYALTLPVLICHGINMLLNLIIAFIKINNVYKAKIHKMNESEYIIFAYA
FT                   QKLKEKVSIKK"
FT   gene            51313..53829
FT                   /locus_tag="UUR10_0048"
FT   CDS_pept        51313..53829
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0048"
FT                   /product="lipoprotein"
FT                   /note="identified by match to protein family HMM PF04200"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59871"
FT                   /db_xref="InterPro:IPR007326"
FT                   /db_xref="InterPro:IPR022381"
FT                   /db_xref="InterPro:IPR022382"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZAM1"
FT                   /protein_id="ACI59871.1"
FT                   /translation="MKKLKLITLSLSPIPIVAIMATACSTTKKEKEVDHKQDELTTINS
FT                   NLQLEYPQNKDIETSAAIKEEIKPLNLPSGVVFSIKEISPKADDESTLIVKYTLKKGNI
FT                   TKEFKKEINGFKKIRKDQNISNLKDMHDDFKTIFNNIKLKDTFDFKLKGLFNSNFGEYD
FT                   KLLPSQIINNFAQGVETRINTNQDRLGIEVIDVSYPNRNFGSANREGNLKMSLLVTDKK
FT                   TKQVFIKSIIAYGFKTNAMGLDENGSIPGGGADLVKPKVDENNYFSKTQLERYEIDNQA
FT                   YLNGLKGQHMGKTWQQVRPELGDNEQKIKEFDEKAKGVSQDAYASAAYKGFTLPVYDKN
FT                   GDFKGLSINESSYGQARSWVDTRGRDEWKTTGLPRTLPNEKYRDEALQTLGISSLTLKD
FT                   GKKDTWDKSSGTTWILDYQKTNDNKYPTKWYFATNLHVADTITDKTTSIDLMKLMDSVK
FT                   TKTTLRLSNLDENIYRFGFASKNNEFLLNHGLKKIYDGRDFLKTKPTEYLTEQQKEKYK
FT                   DAGSFVDFAVFELDFEQLKLLSVWNNQLNSNGGVITKYDHSSAQDLAKIITSDYANHSD
FT                   KQIKFLPKSYLNDYSKIDVPLRSTSYKFEGKDELFALGWPNSTRDGFFERYVDDDQTKY
FT                   RTTDNFSLWTNSDYRFFGKLTEQEGGQPAFPTERTERGNYLSYAIGYRSFIDKPGVLDA
FT                   FISAPHTGNDLYKSLDGKKYINMGLEYMPRHYAPAGGASGSSVRNQNNEIVGIYHVSNE
FT                   FASTGLATAFRSEGYDYKGLYGDKYKELPQYDLIYGGGKDQATGQSYREKMEEIYKNNN
FT                   NIKTALFPNGFDQYDEKFKFNNNQSK"
FT   gene            53852..56200
FT                   /locus_tag="UUR10_0049"
FT   CDS_pept        53852..56200
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0049"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60147"
FT                   /db_xref="InterPro:IPR030941"
FT                   /db_xref="InterPro:IPR030942"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZAM2"
FT                   /protein_id="ACI60147.1"
FT                   /translation="MKFIKRKTKLLTITIGAVAVSSILLGGIFYGTSQKSPSSFGIASI
FT                   DQKENFINKDNLDYQKARPSIKDSNLKEIPKPKPQPKPKPQPTPFPDPIPTPPKKEELK
FT                   KPEIKPEEPKKPEIKPEPKPQPIPQPTPPVETKPKEELLPPSPPPPKEEPKPEPDPQPQ
FT                   PQQVPNNSNSRIIEINGVRVEAEVEVPPPRDIAEYDKQNNLVNPNPYINDSVGKIKNVK
FT                   VTDELRKATGKLVQGNLGRWDYKHLINDLLTLKPEEIEKYVKNDKSGYYAKVWYRFSRL
FT                   FESENVVNFLTEQGKKEYPEMKSKFVSKDHKYAWLYQHLDLTKFTQLSNESEAYLKEGY
FT                   TPDPDNAYVDKDGKISSHAYSPAKGYNSVTSRMENDNWNRRVFGYKSWYGRTPGNLVEG
FT                   NYPGWKKTNVTQEFHQYGVSDGDGITVNKLTREKTEDGRLNEGYVVDIDADNPQGYEKT
FT                   KKLIQTLKEKNINITGYRIHNMGKSDSSQKFVDILKTLPNQLPLLELFFSAGSHNTSSL
FT                   IALKDKKIKELGLFTLGNSLLDDWSINPNALRNVEWINSNDYNVSFNYKQGADIATRIT
FT                   FDTLAFDESDYNDNASDIKSKLKQINDGLRMVYWTRNNEPIFQGSFGPGLDPDHKESGN
FT                   SYPQGLDFSRVPQIRSLRGLIFKDEQKTSNNKDRKLRRINFYNNSTTYKMSIEDLNEAG
FT                   FNEHIVSGEPGEKSKITFSNGSGTTKIQIDGDQELSANGISNLSAMFNFAESLQRTIVV
FT                   NNTNSALANQLRNAGYSIESTTDAGLIDI"
FT   gene            56231..58735
FT                   /locus_tag="UUR10_0050"
FT   CDS_pept        56231..58735
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0050"
FT                   /product="lipoprotein"
FT                   /note="identified by match to protein family HMM PF04200"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60006"
FT                   /db_xref="InterPro:IPR007326"
FT                   /db_xref="InterPro:IPR022381"
FT                   /db_xref="InterPro:IPR022382"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZAM3"
FT                   /protein_id="ACI60006.1"
FT                   /translation="MKKNKLITLALILPITILTPIIIASCTNKSKVKKSSSLDNIASNL
FT                   KLEYSNNKANAQASSVQKDEIKKPLNLPSDVIFSIKDLCVNPKDQSVLIVKYTLKRGNE
FT                   IQEYTYKIKGFKSIFEKDKIVNDLSQANEDFRKIVDNIRLKDTFDFKLVAFPNQNYDQL
FT                   LPSQIYKNYYQGIEIQQHKYQNELDIKIINFLYPDGDFGSANKNGTLKLSLMLTDKKNN
FT                   QVYYKLLEVSGFKSNPYGVDENGTIPGIGTERLKPKNQDDYFSKTQLQRYEIDNEGYLQ
FT                   ILKRQNNDKNWKELRPDLNATVSDIKHFDEKAKNVGQDSYESAAYKGFTLPVYESDGKI
FT                   SGLALAGKDTPKGPSWVDAIGRNQWQIGGLPRTLPNEKYRQEAMQTFSLGILNNDPHKN
FT                   NTYNKTAGTTWILDYQKTSDNKYPTKWYFATNLHVADAINENTSSINLMRLMDSAQIKT
FT                   TFRLSNLDENIYNFGFRSKEHGKNLLNHGLKKIFDGRDFLKTKPAEYLINSQKEKYKDV
FT                   GNFTDFAVFELDFEKLELVNVWKNFLGENNGLVTKYNNYNPQELAKVITSNYANNENNQ
FT                   IKFLSKSYLSDYSKIDVPLKYRQEDAKTWFKKYDELFALGWPNSTEDFFFKAYVDDDQL
FT                   KYRTRDNFSLWTNSDYRFFNNLTQQEGGQPAFPPERTERGNYLSYAIGFRSFIQKPGIV
FT                   DAFIAVPQIGNNLYTSSDNKKYINMGLEYLPKHFAPAGGASGTSVRNQKNELVAIYHAK
FT                   YDSSKTGLAAAFRSEGYDYQGLYGNYNLPQYDLIYGGGKDQTEKKSYREAMKDIYQNNN
FT                   IKTALFPDGFDKIPDGFKFNNN"
FT   gene            58772..61147
FT                   /locus_tag="UUR10_0051"
FT   CDS_pept        58772..61147
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0051"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60048"
FT                   /db_xref="InterPro:IPR030941"
FT                   /db_xref="InterPro:IPR030942"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZAM4"
FT                   /protein_id="ACI60048.1"
FT                   /translation="MKFIKRKTKLLTITIGAVAVSSILLGGIFYGTSQKSPSSFGIASV
FT                   DQKENFINKDNLDYQKARPSIKDNNLKEIPKPKPQPKPEPQPTPFPDPIPTPPKKEELK
FT                   KPEIKPEELKKPEIKPEPIPKPKPQPIPQPTPPVETKPKEELLPPSPPPPKEEPKPEPD
FT                   PQPQPQQIPNQSTVRKIELNGVLVDAEVEVPPPRQTFKYDQDNGLSNLNPYTNISVGKI
FT                   KKVFVTDELRHKSADLVRGNLKRGDYQSLVKDLLDPNIKPEEIDSYIAMVDKSGYHAKL
FT                   WSKFKKLFDTDNVVNFLNEQGKKEYPNMKTKFVSNAHKYAWLYAHLDFSKFTKLSANSE
FT                   KYLQEGLTPDPDNSYVNENGELDSYAYSPAKEYNTVTSRLANDNANRRVFGYNEWYNRS
FT                   PNGLANGDYPGWNKSDATAEFKQYGIKDGDGIKVYKLERQKPQEGKLNTGYIVDIDADN
FT                   PDGYQKTKELIQKLNNQNKKITGYRIRNMGKSDSGQKFSDILKALPNELPLLELFFSAG
FT                   SHNTSALSALETKHIKELGLYTLGNSLLDEWSINPNALRKVEWINSNDYNVSSEYKQGS
FT                   DIATRITFDTLSFDKNDFNDNANDLRTKLKRINDGLRMVYWTRNNEPFFQGGFGPGLNP
FT                   DHKEVGNSYPQGLDFSRVPQIRSLRGLIFKDEQKASNNRERKLRRVNFFNDKENYEMSI
FT                   NDLNEAGFSEHIVTNEPMPPKSKITFSNGNATKRIYIKGNGSLTASGIQNLATLFNLAE
FT                   SLDSKSVVVDSNNSELKSQLEGLGYKVSDASDANYIDI"
FT   gene            61162..63765
FT                   /locus_tag="UUR10_0052"
FT   CDS_pept        61162..63765
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0052"
FT                   /product="lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60130"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR022381"
FT                   /db_xref="InterPro:IPR022382"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZAM5"
FT                   /protein_id="ACI60130.1"
FT                   /translation="MKIKKLIASVSIITPIVFVSALAASCVNNKHEDKNIVHNSSDHGN
FT                   NKKNNFTNDLNQNLTTHEFKSNLISTSQLDNIAKLINFTYENKANTYLKNILINQLKHS
FT                   PIQNQDFKLEIIGLYPKQNSLQDLIIYYKLTNQKTKEIKGYYFELNGFKKPDNTIFSNQ
FT                   LTPELKKIIDTIQFKKTFDLAINNQQVLNYENVLPSQIKNQLLMGLKVIQKEYTDKIKL
FT                   SVLDVLFINEGGQINANKLGAFSLLLEVLDLKSKKTFQILIPVDKFKTNPYGADEYDLL
FT                   PTQVNNGFAPTSLAQINQYNNADQQTRYLYDNENYLKSLKAYQRNVNWYQIRQDLINNK
FT                   QKINEFDQKAPQVFQDSYESAARKGFTLPVYDEDGKYQGLSFNETEIGKSVSWVDAIGK
FT                   DQWKINGLARTLPNDMYKQIALQTFGIQIQTPNGKPRESDIVAGTMWIMDYQKRNDNKY
FT                   PTKWYFGTNLHVAEALKSTTTVFGINKIMPTVKTKTTLGLANADDNIYRFSLVSKDNQP
FT                   NMDKPISNGIKTIYDGRDFLKLNPSDLLTSKLKNKYHNLQEFVDFAVFEIDFEKIKLGS
FT                   VTKNFYSGSDWSVDKYNNLDPSELAKLITNDYAQKPNEQIKFLSKSYLNDYARINVPLD
FT                   SKYNQAFDTNKYDELYAVGWPSSASDYFLDPIKDQKQFESRRESYSLWINSNYQFYNKL
FT                   NHNPPLFPLTQINRGDFLSYNIGYRSFTNKPGLLDAFIASPITGKTIHKSTDNQNYIGF
FT                   GLNYLPMHYSPIGGSSGTSLRNQKNELVGIWHVGNGFAQTGLAVAFRSEGYDYHGLYGS
FT                   YNLPQYDLIYGGGKNQKTSYRQAMMALYKNKNIATALFPNGFGEDQIPSAFKFKN"
FT   gene            63795..65285
FT                   /locus_tag="UUR10_0053"
FT   CDS_pept        63795..65285
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0053"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60216"
FT                   /db_xref="GOA:B5ZAM6"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZAM6"
FT                   /protein_id="ACI60216.1"
FT                   /translation="MMNTKTFTSVNRVIYDDNYSLKQQQKSSFINQFLKGLLSAITLLF
FT                   FILLLIFAENTLFGLGFGDENKSMMISKSLNAFFDLHSPKYLQLNFLIVFRFFILSFTL
FT                   FYALIKNFTNLYWHRVTIKKYLPWFVLYLVIATISFLLFFTFFSVWPKEVFNLVFLLLV
FT                   LFLLNLSYEIFNYFISKKTNPLLYGNYKNLIITMVFQALLLLFVIITPFVWINTGKSPN
FT                   FLFVDNRFYTRIVDIFTVQSGKNFIILIAFFFFLITFIVLANTNFFALVINKRYDRNYV
FT                   KNNLWFILLLFSAIFIWLLRVFAYKHENENLPIGNNHLLWVYILQSFFAIIILILYMVF
FT                   TLKKRLSAKSSLNTLLNLVVTQTILSLSLFLVTLFNSKSVVSLINVFITITVQMSVFGF
FT                   YIFQNKNISTKLLVLLKVIMILIILTAAIVGFDYLLTSDHHNNYLFSNIQPKMNLVQIM
FT                   LLLNFSLSFTLISYLTIKFTMVIFKINKLNKELNNEKK"
FT   gene            65272..65787
FT                   /locus_tag="UUR10_0054"
FT   CDS_pept        65272..65787
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0054"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60301"
FT                   /db_xref="InterPro:IPR021222"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZAM7"
FT                   /protein_id="ACI60301.1"
FT                   /translation="MKKNRSNLTPTTNYFDVFNTYKEKKASVDLITYEELMASVLFDNK
FT                   LGFESEVYLDFVKKFTLAFEKKLDIWFENFIINFNLNLKFSTTIMIPILVTKANSTTDA
FT                   INFRNDQNPVYNNFLISYNQKIKKLLLQNHPVQILPHLILFKSNLNGSLVLVFSEKIIA
FT                   SIEQKSGN"
FT   gene            65790..66704
FT                   /locus_tag="UUR10_0055"
FT   CDS_pept        65790..66704
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0055"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60034"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZAM8"
FT                   /protein_id="ACI60034.1"
FT                   /translation="MQLKDLINKKKNLNNINLKVSNERNIFLINIMKLNQRLTFFSKNA
FT                   FEIKESILSLKRIYNIKHDMLRHEERKIFKFLNKINDRVLWIYLTEEQKYSTDSYSRYE
FT                   QKILETIKSNRDDFILIGQGAIEFGKNHNLNILQTFNDSNIKNLTTQLTKMIMILYTFD
FT                   NYKKVNFVINSNKNYDGHFTILPMNEFSFDKFINLEKCDSNIIDFQKVKIYPNLNEFIN
FT                   VQINVFLVNIINTLITESSFYKTKNGLVATNNILKELDDNLSKIQRKITRVKTELQIEE
FT                   INLLARQNMNEDDNDNDGGVYES"
FT   gene            66694..67173
FT                   /locus_tag="UUR10_0056"
FT   CDS_pept        66694..67173
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0056"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59790"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZAM9"
FT                   /protein_id="ACI59790.1"
FT                   /translation="MNHNYNIQITLLENKKFNIDNGLLYVNVNEENTWQKIENNTVLAY
FT                   ETILLKIVDDDYKKTFYLFLKNTHISVLNNIVKIQALNDLHFFIKDGLNKKNNHKKELV
FT                   DKYKNITNNILELEAKQQLGLTLSEFLDLDNLKQEQYITNMQIRLNLVEYKKDEK"
FT   gene            67163..69325
FT                   /locus_tag="UUR10_0057"
FT   CDS_pept        67163..69325
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0057"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60181"
FT                   /db_xref="GOA:B5ZAN0"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZAN0"
FT                   /protein_id="ACI60181.1"
FT                   /translation="MRNKLKIKLKFLASLATIPIVASPLIFSVAANEDGKQENNNGNNQ
FT                   DPNQQKKPKIPKNDPNFNIFKTVADKTVKDSLEKGINAAIVYVKSRQEEILENKEIEFK
FT                   KKIQQLIYLKNLQSYLEKNKENILKNSNDYGFYLNTPQILGTLKNYDIKDIEFNGEIYK
FT                   QIKVGKTDPLNYQKAIAPKGKISDVQSDQINDVEETKYKDTLKKYESEFLKEINKLIYD
FT                   ENDVPQINKDVELTRDEKGQFNTTLPKGYNDWNAYFISKIKDRVTAFDLKQNQQTNEDK
FT                   QEEQPNEQKDPDTPPPLPPPLVEGDHNEIDLPPAQANAIVSSLPLLLPYISPIYSNESL
FT                   SELKSKFDSLKPELKQTLFYFNNPINTRYLYSVLDFGVNGSSMINIKVKIIDQVNPKLQ
FT                   RTYIINKYDPILDLSFNSLKLNEVNAIKQIFVNLYKHLGLDEKIDYKKLRNFYIRNALF
FT                   TMIEAAQKLILRFNQIDKDNKVIGQKTFTTLQNEYLEKYKQKFVNNADNERLLNEFSNL
FT                   TKENFFRYLNNTLINNDYYWYQLVGAYKQVSLQFSEVLRLNKDKIKANIASIKGDENTI
FT                   ANLYKLNNQLIYQLSAIVAQRSFNSQQWYQSYLNVLQPIKENFDLMSILTNQTDIKTNK
FT                   DKAKDFKNAYDSALKSLERQKQVNKQIRRKIGIAFIVISLLVLIINLIIYGLIKKLKNK
FT                   KVILIINSVIMVLTIIVLIMGIILII"
FT   gene            69341..70876
FT                   /locus_tag="UUR10_0058"
FT   CDS_pept        69341..70876
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0058"
FT                   /product="ATP synthase F1, alpha subunit family protein"
FT                   /note="identified by match to protein family HMM PF00006"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59952"
FT                   /db_xref="GOA:B5ZAN1"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR000793"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZAN1"
FT                   /protein_id="ACI59952.1"
FT                   /translation="MQSTKANPRIKSIFNYIVTVSGIYDYQHHQIFVLKNDPTVKLFVI
FT                   SAKEDVAYLLISNEHANINIGDEIIETNREENVVTDLNYFGKIIDINNNFIWPKPLNNL
FT                   PSAKIAQTNPAFGLAHNLMTVKTLNEQLNTGIIAIDLLIPIGKGQRELIIGDRQTGKTH
FT                   IALNTIINQSRAGTKCIYVAIGQKRESLTTVYETLKAHDALKNTIIIDAPLTAYEQYLA
FT                   PYIGMAHAENLSYQHDVLIVFDDLTKHANIIREMALLTNKPVGKEAMPSDVFFSHSSLL
FT                   ERAGSFKNRKTITALPILQTVDGDITSLISSNIISITDGQIVTSTDLFAAGKVPAINID
FT                   LSVSRTGSSVQSRMITKVAGEINKIFRQYKRHLKLAMLDYEFNKETSLLLHKGKLIDKM
FT                   FLQKGFSLFSYRFIVLSTKLIAWGILKGVKDEQKAFMLLDYAINNYEDAQKAFNTISTT
FT                   QNYDDKIMKNYFAFILKQYSDYLNLNWEVELEHSFIPLQNEFLMNVAKFLGDK"
FT   gene            70876..72240
FT                   /locus_tag="UUR10_0059"
FT   CDS_pept        70876..72240
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0059"
FT                   /product="ATP synthase F1, beta subunit family protein"
FT                   /note="identified by match to protein family HMM PF00006;
FT                   match to protein family HMM TIGR01039"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60236"
FT                   /db_xref="GOA:B5ZAN2"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR024034"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036121"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZAN2"
FT                   /protein_id="ACI60236.1"
FT                   /translation="MNNGRVIKIWSDIVEVEFKNELPALNHLLTTHDGNTFLLVKRLVD
FT                   ATHARAIVVYASKELAINDVIVNTNKSFMVPVGNDAKNNIYNFWGNPLLKTDKKPQYVE
FT                   MNSTILNERYVDKSVEIVETGIKAIDFFMPILKGYKLGIFGGAGVGKTVLMKEIIFNLN
FT                   RHKQANSNIFIGSGERSREAIELYDELNASNLMPNSVMFISKMNEAPGARSSIVPIGIT
FT                   AAEYLRDQNKENVLLFIDNIYRFIQAENEVSTALGKKPSVGGYQSTLESDVTHVQNRLF
FT                   KNKNGSITSFQTIFLPMDDLSDPSAVAVFNHLDGKLVLSRAQAAKNIFPAFDPLASSTN
FT                   AIDPKIIGQRHYDAIIETKKVLKAYKDLEDVILILGFDELDAESKIIVKKALQLEMFFT
FT                   QNFFMTEHFTKAPGQFVPLKETVESVIRILEGKYLKQNPESFAYIGSNKDIPQDN"
FT   gene            72397..73635
FT                   /locus_tag="UUR10_0060"
FT   CDS_pept        72397..73635
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0060"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60154"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZAN3"
FT                   /protein_id="ACI60154.1"
FT                   /translation="MRKNKKLILKSLFLALATISVIIPIVTSCSRQTNIESNTKLKPLL
FT                   ASNGNIDQHYLSDFYFIDTYGMNTLDNSLLNKYKWTNLKINHQQSKPQLTKQIHDWTNY
FT                   AKQNDSQRQKIDQEIQNLNQYPNWFNATTSKTLSNFNIAKNEALSNFVFSTDKINYKNY
FT                   TPFSVDFQTGGGALLGIVNNDDTNPIFYVLTSNKNIVNHPFLENQDYLFKFMNQDQIYS
FT                   GVGKVKVYELAKQQKQILNGFSILAFSLNTKTLEPMNEHANTNPFNTSMLPYVNKLGLI
FT                   NHVNTKIDLKAMQNQDVIMYVNELSNSTISFANAPKNNDFVLTPSSVNTINNKGVGLYA
FT                   LFYETNLVNNQPTYVLTPILIGILEGNSTNQNDQINNLNLAINFSLLNNQYLIKLINHV
FT                   KQQDVNFAKLFNN"
FT   gene            73874..77278
FT                   /locus_tag="UUR10_0061"
FT   CDS_pept        73874..77278
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0061"
FT                   /product="endonuclease/exonuclease/phosphatase family
FT                   protein"
FT                   /note="identified by match to protein family HMM PF03372"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60358"
FT                   /db_xref="GOA:B5ZAN4"
FT                   /db_xref="InterPro:IPR006179"
FT                   /db_xref="InterPro:IPR008334"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="InterPro:IPR036907"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZAN4"
FT                   /protein_id="ACI60358.1"
FT                   /translation="MKKSKFKIIGFSVFGVILTSALIPFLITCSKQNDQKTKINSQKQK
FT                   TNTDLEAKSVNFDLKNNVFDKDISKFVLNFNTNKESNLQVVATFDVFDKNNKLLKTIKS
FT                   NKVNLVSKKFVFDNLDENVKYQLKQIDFYDPKDLNKVIYTKNDLAFNFETKIDDSVART
FT                   VELIIINGLNGFVDEQVIPDYSKRTSYLKAPGLIRILNEINKIKKERGANNVAVVMGGN
FT                   NYYENNKSSLTRAQYTAAALKFLNPIATSIANTDLNWGYDLVDEKTKHFKEYIKTLYNN
FT                   DGILSVNSYLKSGEQTIAMANNSKIINFNGFKLGLVGAMSNLVNFGSNINLTKDIKWFS
FT                   NEQTANLINAEAKNLKNQGVQNIVLLSSFLADKSKENNSLVSDQKSFYKEAARMSKLLD
FT                   SNINLMTASNPYKSFNIITNNKDNQPLTVVQSKPTSGFVRYMISLNPYNRILKTETKLV
FT                   DKLSTSGDEKGYNYTTHQDLLDPQKNPDFNDNLVALNNFINNYKDHEYEQLAQKILIKN
FT                   DKNVELYSSTYTLSSLGGFISDILAKYYQAPFYNKQTHAFEFKQTQAVILAPNAIRSLI
FT                   SAKPIKLENLNQILPFNDTLVSGEISVKDLKKFLINSHRTQHYNEPYQFSDTLKVEYEE
FT                   QVKTNKPKKKTTKKQKQTSDQKLDDVVLSNPKTIIKISLKNADGTYTELNDNQKITISV
FT                   MDSILKYNKGFKEAILNKTYADQTNIRDLLRAYLQKETQIDEKYNQKTFFKNNQRFINK
FT                   NQANPTSTPVYNHINESINNKQANHLRIGHWNVLHQTGLNDAKNYALAKTILFNKYDII
FT                   GLTEIWPAQGDNQEQNNLPVASIVKYMNQLSGSNDYDFVISDNLKGDENDKLATNNHTS
FT                   TERIGIIYNKKKANPIAFADNKIGHVYSNPLEDGKYEKQQTNYSRPPYAIKFASVGEIK
FT                   NDFTLVFAHLDSPGTYPSETKYQKKEHLLKRTELVKEKAISSNQMINKYEQGSREVDDA
FT                   ERLVKVMEEIKKIDNNKDDDYFFMGDTNIRLHNQQWVFRTFIQNGYSSVFADNDLFKSS
FT                   LSGNPGEFANSYDKIFSQVNGLTISNPSIYDLWNAYEDQIVDQVWLKKVRALNPHEFHD
FT                   KLFYIRNDISDHAPTYFDLGLNKDDSK"
FT   gene            77366..77590
FT                   /gene="secG"
FT                   /locus_tag="UUR10_0062"
FT   CDS_pept        77366..77590
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="secG"
FT                   /locus_tag="UUR10_0062"
FT                   /product="preprotein translocase, SecG subunit"
FT                   /note="identified by match to protein family HMM TIGR00810"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60278"
FT                   /db_xref="GOA:B5ZAN5"
FT                   /db_xref="InterPro:IPR004692"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZAN5"
FT                   /protein_id="ACI60278.1"
FT                   /translation="MALTIVLILFSVLALVIGLLLSRTSPSGGLSSLNGQDLEIFKKTK
FT                   DRGWIKGLQVLMFLLTIVMILIIIFYRVS"
FT   gene            77591..79756
FT                   /gene="rnr"
FT                   /locus_tag="UUR10_0063"
FT   CDS_pept        77591..79756
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="rnr"
FT                   /locus_tag="UUR10_0063"
FT                   /product="ribonuclease R"
FT                   /EC_number="3.1.-.-"
FT                   /note="identified by match to protein family HMM PF00575;
FT                   match to protein family HMM PF00773; match to protein
FT                   family HMM PF08206; match to protein family HMM TIGR00358;
FT                   match to protein family HMM TIGR02063"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59915"
FT                   /db_xref="GOA:B5ZAN6"
FT                   /db_xref="InterPro:IPR001900"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004476"
FT                   /db_xref="InterPro:IPR011805"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022966"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR040476"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZAN6"
FT                   /protein_id="ACI59915.1"
FT                   /translation="MSDLTKQTIIEIISKEERPIPAAILAKKVLEKTPTLNKTNIYKLI
FT                   DLLIEENTIKRLENNRLVLGYLDYEFDHEIKQGTITINSKGDGFIKEDGTEIEYYVNKK
FT                   YLNGALKKDLVKFVKLKKEPKNNLEDAAVIEVVEHAKDHYVGQFVTLPNGGYYIVVDDP
FT                   LFYLNISLKDTTGLVNGHKILFKIISQTTKDAVAELVHIIGHKNDVGSDILSIVYDNGI
FT                   DPIFNPDVVDLASKLEFHVDEHQSKIRRSIIDREIVSIDPVGSKDIDDAVYVKKLNDNR
FT                   YFLGVSIADVSFYVQPNTILDEDAFKRGTSTYLVDHVIPMLPHNISNNICSLNEGQFRM
FT                   CVTCDMIIDKNGKICWQDVYPAIMKNYRQMSYDEVNDFFEEKSRFESATLTMKEMLLEA
FT                   KELHHILRNKKIKDGYVDFDIKEPKIILNEQGVPVDIKIYERKTAQMMIEDFMIAANEA
FT                   VTMFAEQQMSQTLKEFNLEMPFIYRVHDKPSIINLQKFEVEAKKLSFNISHDFENIQPN
FT                   TISNWLKMNDNHANLPLISKLLLRSMAKASYEIINTGHFGLASENYTHFTSPIRRYPDL
FT                   IVHRLLWMFVFDPQSYTDKQRTELVNKLKLITEESNKNEVIAVKTERDVNAAKFAEYMN
FT                   LHIGKEFVGVVTTVSSFGLFVELENTIEGLIRIKNLKDDFYDFIPENMTLVGQKRNKVI
FT                   TVGNKVRVRVIEANKTTRKIDFELVAQ"
FT   gene            79768..80529
FT                   /locus_tag="UUR10_0064"
FT   CDS_pept        79768..80529
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0064"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59735"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZAN7"
FT                   /protein_id="ACI59735.1"
FT                   /translation="MSWNSTKDWFFKNINTTNSQTNLKVSGVYLLYINHKNLNNRIIPF
FT                   YVGKSNDIYQRFIQHKNALNKLINLYNADYDHRSFYLHYHQAKQSGKHLYSKLFYYLKE
FT                   NQLSINDLKVICLWHGEQALLVEKERYFIEQSKAYVYGFNQLPFISQSYAVLKFEEMYQ
FT                   KTNQVDLNQLLIDGISVLNHFETSWLDFGYGVFNIHEFIKFGLLQKQAFKQRQRIRNQH
FT                   FDLSLYNEFINKFDAFCDFWKQIKLKYSFEF"
FT   gene            80657..81082
FT                   /gene="smpB"
FT                   /locus_tag="UUR10_0065"
FT   CDS_pept        80657..81082
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="smpB"
FT                   /locus_tag="UUR10_0065"
FT                   /product="SsrA-binding protein"
FT                   /note="identified by match to protein family HMM PF01668;
FT                   match to protein family HMM TIGR00086"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59793"
FT                   /db_xref="GOA:B5ZAN8"
FT                   /db_xref="InterPro:IPR000037"
FT                   /db_xref="InterPro:IPR020081"
FT                   /db_xref="InterPro:IPR023620"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZAN8"
FT                   /protein_id="ACI59793.1"
FT                   /translation="MIVSNKHARRNYELLEFFECGIVLKGTEVKSISRANCSINEAYVQ
FT                   IVKNEALILNMHVASFFEGNNFNQDPYRNRKLLLHKKEIIKLQHLVQTQRMTIVPTKIY
FT                   WKNNKLKVEIALAKGKQLHDKREDLKKRDLARESRLF"
FT   gene            81102..82841
FT                   /locus_tag="UUR10_0066"
FT   CDS_pept        81102..82841
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0066"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59849"
FT                   /db_xref="GOA:B5ZAN9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZAN9"
FT                   /protein_id="ACI59849.1"
FT                   /translation="MKSAWKVLLGKHKLLFSFILLLNLIQVLLVIGSPLLLSILNNGTY
FT                   ASTTADAFIYGGILIAMAIGWAIFSIFTNYVSTIFQTIVESRLQMKIFEKTMFLTYADK
FT                   QKFSQSILLTTSVKDVEELSKTIIFLTRPVIMGIFYFIGAIALLFVISGNLWQVPLTVV
FT                   LMALSTIVVFIVVSKFNAKNWNKMRNANDELAKTSLENVNGVKVIRSFLLDAFFLTKLD
FT                   FKWKDNVSKSIIANRVSKVSIAIVIFIIYIITPVVLIIGICTNSMKATNILSIMQSTNL
FT                   LVLGIAMIGFGSEQYFRATVSIKRINDLIYYKNKITYKGTKEIVNNNIEFRNVSFRYEN
FT                   SKKWVLKNVSFSIKDTDRVGIIGTTGAGKSTLLKLLMHQLEPTSGGIFVDNIALKEIKK
FT                   TSLQHAFSVNEQVPSLFYGTIRENILFGLKNISDDQIDQAITIAQAKDFIETKEDKLES
FT                   MVAQRAQNLSGGQKQRLAMSRALLRDARTLILDDSTSALDMITEKKFLTALKQQTKFKN
FT                   SIIIAQRISNILDCDKIIVMDKGKIVGIGDNDTLLKTCAIYKDIYQQQINGGSKHESTV
FT                   SNN"
FT   gene            82816..84612
FT                   /locus_tag="UUR10_0067"
FT   CDS_pept        82816..84612
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0067"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005;
FT                   match to protein family HMM PF00664"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60325"
FT                   /db_xref="GOA:B5ZAP0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZAP0"
FT                   /protein_id="ACI60325.1"
FT                   /translation="MNQQSQTIKPVSKLHLIYYYFKDFKKSFIGLSIAIVLWLAATIAA
FT                   TFLLQETVDKYAVANGVVDTVVKMCGGLIGIYFLSFIFLLIMNEFAIRISFKIESHLSM
FT                   MVINRIRYLPMKYFDVNKSGEIFTKTLSDPTSVQDGIVNFYIELNKTFFGALGFGIALL
FT                   VTSPYIALIGIAIYTLVMLFNILIFKKSRQLMRKKRQDFGEMNGYIEEMIHGQNVVANF
FT                   DEQAYFVKKLDNMIKNLYKNWVKAQYSSQIIFPWSIFSMRLMNAVLIVSYLLISIKGIH
FT                   LPGIVSNIDPVTNMISFGGLVSISLFGNFFCDNFSQLSNAIPIFIIARTSLAKIDEIVK
FT                   TPNEIDWDEKLVIDDSQGIEVRFENVNFNYSKNKPTLKNINFVAKKNQKIAIIGPTGAG
FT                   KTTITNLINKFYDINSGHIYFNDVDITNKSRASVREHISIVLQDPFLFSESIYENIKKG
FT                   KMNATKEEIVEAAKKAQAHELILSFEKDYGTVISEKQSLSQGQKQLITIARAIVSDAKI
FT                   IILDEATSSVDTQTEHKLQLAINNLLKGRTSFVVAHRLSTIINSDLILVVKDGEIIAQG
FT                   NHDYLIKNSSFYQDLYYTNFAE"
FT   gene            84688..85482
FT                   /locus_tag="UUR10_0068"
FT   CDS_pept        84688..85482
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0068"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60285"
FT                   /db_xref="GOA:B5ZAP1"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZAP1"
FT                   /protein_id="ACI60285.1"
FT                   /translation="MTSLEITTLVISLLSLIATLSISFNIYFIELRKQRERKIERLQQE
FT                   AKQFIIHNLDEKDYIALCQFIYKLYKHDKHTRKIHREFVLLNEPVQKEVFKQLEITNIV
FT                   DFKDNEWINKKFNTLKEIVNDYQLGNWDDYKFYEHFNLAYSMFRDQKYDEILEELKQDQ
FT                   FGGKNLSFHEYLNEYTHRSKESNMLAPIDYFIEQNNLKEVFDRKKHATYKLYLLDLILN
FT                   ELCRSMINDHRINSEFKHFDCEVVYVEDLYLKVLYKLYFQLN"
FT   gene            85560..87041
FT                   /gene="lysS"
FT                   /locus_tag="UUR10_0069"
FT   CDS_pept        85560..87041
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="lysS"
FT                   /locus_tag="UUR10_0069"
FT                   /product="lysyl-tRNA synthetase"
FT                   /EC_number="6.1.1.6"
FT                   /note="identified by match to protein family HMM PF00152;
FT                   match to protein family HMM PF01336; match to protein
FT                   family HMM TIGR00499"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60069"
FT                   /db_xref="GOA:B5ZAP2"
FT                   /db_xref="InterPro:IPR002313"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018149"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5ZAP2"
FT                   /protein_id="ACI60069.1"
FT                   /translation="MERKFSDQELIRRNHLQELKDQNKNPFLATKVERSMSLKDFAEEY
FT                   KNFSKEELHNMDLKKVTLAGRLIGVRQTFGIIQDFSTKLQIYIDKKNVDPEVFSTFKSL
FT                   DIGDIVELQGVAMKTNSDEITLNVTNIKLVAKSLKVLPEKYHGLVDEEIKARQRYLDLI
FT                   VNDESKNTFIKRSLIIREMRNWLDSQGFFEVETPVLQDILSGAAARPFITHHNTLDKQY
FT                   YLRIATEIALKKCIVGGFEKVYEIGRIFRNEGMDSTHNPEFTSVELYVAYVDLWYIMQL
FT                   TEDLIRHIATKLKLLNPTFRGFSVDLNKPFKKAHMVDLINEHVGVNFFEVKSDEQALEL
FT                   AKKHHVKLLDHQKNFGHIVNAFFETFVEEKLIEPTFVYGHPVQVSPLTKKNQEDPRFVD
FT                   RFELFICQKEFANAYSEINDPIDQYERFVAQLEEAKLGNDEANELDMEFIEALEYGMPP
FT                   TGGLGIGVDRLVMLLTSNDSIRNVLLFPHMKDKAK"
FT   gene            complement(87121..87387)
FT                   /locus_tag="UUR10_0070"
FT   CDS_pept        complement(87121..87387)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0070"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60137"
FT                   /db_xref="GOA:B5ZAP3"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZAP3"
FT                   /protein_id="ACI60137.1"
FT                   /translation="MINEQKAKLIELKQKVNDFEFELDKYKEEFMRRIAIFVILFLFIP
FT                   PIGLVYLLIDLSKIKKLNQKRKSLESKIREFNYEINKIEISLL"
FT   gene            complement(87412..89238)
FT                   /gene="pepF_1"
FT                   /locus_tag="UUR10_0071"
FT   CDS_pept        complement(87412..89238)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="pepF_1"
FT                   /locus_tag="UUR10_0071"
FT                   /product="oligoendopeptidase F"
FT                   /EC_number="3.4.24.-"
FT                   /note="identified by match to protein family HMM PF01432;
FT                   match to protein family HMM PF08439; match to protein
FT                   family HMM TIGR00181"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59913"
FT                   /db_xref="GOA:B5ZAP4"
FT                   /db_xref="InterPro:IPR001567"
FT                   /db_xref="InterPro:IPR004438"
FT                   /db_xref="InterPro:IPR013647"
FT                   /db_xref="InterPro:IPR042088"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZAP4"
FT                   /protein_id="ACI59913.1"
FT                   /translation="MENKKYEWDLDDLLNNKSLDDLYAEFEAKKAERIKAFATFLDSKE
FT                   NFAQWQVLEEEFTIIANRFYNYVSNNLNTNVVDPKWNSWSQKLSASFYELETALSNYDS
FT                   VILANEAKIKEYLKDPQLSVYTRKYDEIFRYQPHTLNDEQSKLYSKLARADEGFSTIYS
FT                   TYTNNDMKFADAIDSKGKKHPINNEAEAFVHLKAKDRALRKSAYLSMYKAYYDSRESIT
FT                   KMLYYNYLSLNQQAKAKNFEDYIAKAAFDDVVDKSLITLIYDQVKLYKEANEDYKKARN
FT                   AYLKKLIKVSKIEPWDNALPLISKKIDISIEEAKQMSIDSLSILGDEYVSNIKRAFDEK
FT                   WVSWLPQKGKRGGAYSIGGTKGISKYYILMNYTNSLRDVQTIVHELGHSMHSLYSNRTQ
FT                   KIYSDYKIFYAEIASISNEVYLNYYLLEKYKDDLEMKLMILDEMISGFFATTTRQVIFS
FT                   NFEWIANELINSGAPFTADVVMKEYQKLEFEYTNKPIVEDLTSIYSLSSVTPLRIPHFY
FT                   VGNFYVYKYAVGQVAAIISGHRVFTKVEGAKQKVFDFLSSGGSKDPLDTIKLLGVDLTQ
FT                   PQSWQEALEIVKLWIKDYKQTIVLLNKKKSKK"
FT   gene            89342..90223
FT                   /locus_tag="UUR10_0072"
FT   CDS_pept        89342..90223
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0072"
FT                   /product="phosphotransacetylase"
FT                   /note="identified by match to protein family HMM PF01515"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60351"
FT                   /db_xref="GOA:B5ZAP5"
FT                   /db_xref="InterPro:IPR002505"
FT                   /db_xref="InterPro:IPR012147"
FT                   /db_xref="InterPro:IPR042112"
FT                   /db_xref="InterPro:IPR042113"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZAP5"
FT                   /protein_id="ACI60351.1"
FT                   /translation="MLNVVNKLKIKLENLTKKPLKVLFIEQSLEIDKAKQILSQNSLIN
FT                   IVDLASFKTPEIINECENIWYELRKSKGESQKDAQLAISNDLNFAVCLSYLKKIDILIV
FT                   GANLSSKTCFSSILKILKNPNGSIACSTMAMASEQELIFMSDCALNLTLNKDQMIDVAK
FT                   HSYTIAKKYFEVLNNHAAYISYLSQNDVLYQNNDFDFIGPMQFDAVVDLRVRNKKIINS
FT                   HQNHINHYVFDNISIANTIFKIYQTKLHYLTIGSYISNILTKVSVISRSASVDEIVATT
FT                   YLLCVAFLVDLF"
FT   gene            complement(90275..90889)
FT                   /locus_tag="UUR10_0073"
FT   CDS_pept        complement(90275..90889)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0073"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60072"
FT                   /db_xref="GOA:B5ZAP6"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZAP6"
FT                   /protein_id="ACI60072.1"
FT                   /translation="MDQYKINELIPSEYKLANYFNCGRITIHNAYEVLKVLGIVTTIKG
FT                   SGYYVYSSIDHFTNKAFANLYEIIDNIKYEQFIIDFEYHGNKFNSITKFSLIKNKKTVA
FT                   VSYYLTPNIMGLEQFDTNNINISKQLILSGFDDFFNVQTQINYENINLLKSILENENIK
FT                   FDTPMILNKLTSSSLKVELLVLTHISKEYFSYEETNKLIVN"
FT   gene            complement(90927..91583)
FT                   /locus_tag="UUR10_0074"
FT   CDS_pept        complement(90927..91583)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0074"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60087"
FT                   /db_xref="GOA:B5ZAP7"
FT                   /db_xref="InterPro:IPR027304"
FT                   /db_xref="InterPro:IPR037041"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZAP7"
FT                   /protein_id="ACI60087.1"
FT                   /translation="MNFKSTIINKKPIDWKHTIVLEELSVDPKALEMHKERINTVFAKQ
FT                   TEEQRAQQLHNIIVRENLFNKAMTYLADFYEIDVNEEDVKDLAPRIKQAFGVEDEKLAY
FT                   EISQKIIAKALIFQDLQKEFNIEIKDDELTKILESYYEETNLSIRDFKENKAQWEAAKS
FT                   TLLEEKTTAFIVDKFDRDLSILEANIRKKIAEQMELDKKIKEVQDNSKAKQNADK"
FT   gene            complement(91675..92550)
FT                   /locus_tag="UUR10_0075"
FT   CDS_pept        complement(91675..92550)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0075"
FT                   /product="iron(III) dicitrate transport ATP-binding protein
FT                   fecE"
FT                   /note="identified by similarity to SP:P15031; match to
FT                   protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60312"
FT                   /db_xref="GOA:B5ZAP8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZAP8"
FT                   /protein_id="ACI60312.1"
FT                   /translation="MFKIFSKYFCNHQLDRDRIIKESNDYALVVDNLSYKYHKKLPDVL
FT                   KNLTLDIKKNSFTTILGPNGCGKSTTAKAIVKLLKLKKGNIKVFDKNISELSFKQLAQL
FT                   ISYIPQSIEIPQGTRVIDFITFGRNPYLGISGILGKDDKAVIDLVINEMQLHDLKEKFM
FT                   QELSGGQRQKVVLALCLVQDTPIILLDEPTTYLDIKNQYELLESLKKLQILRQKTIIAI
FT                   LHDINQAIQYSDEVFVLKDGQIYANGNPNEIITKTLLKDVYNIDAQIDIVDDQKIVHNI
FT                   KVKDYLSNNK"
FT   gene            complement(92555..93625)
FT                   /locus_tag="UUR10_0076"
FT   CDS_pept        complement(92555..93625)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0076"
FT                   /product="hemin transport system permease"
FT                   /note="identified by match to protein family HMM PF00950;
FT                   match to protein family HMM PF01032"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60239"
FT                   /db_xref="GOA:B5ZAP9"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZAP9"
FT                   /protein_id="ACI60239.1"
FT                   /translation="MKINYKTKLKQHHFYLIKNLNYKQFAIIKMAGLIAIALCFIFLTL
FT                   AIYYDTTNGFDVSINQFNFNIRGPKTLMAFFSGGAIAVAGLLLQKVTRNHLADTSVLGI
FT                   GSLNIILMTFYFILIKDKTSSYLNPEMRILPLIMFLSSILGTSIVYTLSKLGKANNEKF
FT                   IIIGIALNFLFEAVSVVLINPANNSLFSNQDKNLMIAFENIKNYTLGIIPNSQYIDLSL
FT                   VISCSILITLTLIPIWFLRKKIDLYETSAALASTTGINVERLKISIYFLVALLAGLEIV
FT                   LVGYVALLGVIGASVARQLFGNKTGITMFAAFLIGAILVCFALLISVNFNTQVPVGFLS
FT                   TTIITPYFMYLIVRGK"
FT   gene            complement(93637..95607)
FT                   /locus_tag="UUR10_0077"
FT   CDS_pept        complement(93637..95607)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0077"
FT                   /product="putative ABC substrate-binding protein-iron"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59805"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZAQ0"
FT                   /protein_id="ACI59805.1"
FT                   /translation="MHKKTKIYLLGTFGLLSFGISVATIASSCTKTSSTNIQEQIKYDI
FT                   MPTYTSQADNLLALGITPDYYPQQMYWKKKAPYDYLNPQKSDYQKWFYEKDNFANQFKE
FT                   KLTSLEKDIKQYGTTWWSFSGNTYGEGVSEEYWNKNKGKLVYYDRYLIDNSHFERAKKS
FT                   LVAHDGPISNPNTIIPVDFKMSRDFYLTLNKDDILNFKNKPNSLLRKSLLLGLEYKDKE
FT                   KGELNELYNYSYIANKLQEDYFNGQTFDGINFNNSAFKKRVLEGNDIPIFYTEKNWNNP
FT                   KSLNSKIYEALKTVVLTKKVRESGLNHLNYNPFSPTIKQDDYITSILQHHPIYEQNMRW
FT                   DGGTQVYLGTMRDSLLYLYDIAYATTKYAYSEQAQIDFKDNLAKLEPLKKALFNANQIA
FT                   KNLIERLNKIRAYFQAVGVVDKNYNPDLKQFDNTNSKTLGLLTTSQNSGSSTLQTQSKY
FT                   GFLYYDLGFKAPKPILKKDEWTELLEDVNGKQLLCHRHGNGQIHCFGGGDSQDGVQVDK
FT                   NIVGSLFNMDDNGWWWNLGEGSLSASNFAKFNSQFDYLIKISYQNLEDFHSNNLTRPQK
FT                   ELIMSLIKPNYEDPANRVFDDNYELWNDGIKSPIGYNMILDSIIRIINKTIDPQVIKQN
FT                   EHLLREANNWGSYWDTFVNSK"
FT   gene            95843..97171
FT                   /locus_tag="UUR10_0078"
FT   CDS_pept        95843..97171
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0078"
FT                   /product="hemolysin"
FT                   /note="identified by match to protein family HMM PF00571;
FT                   match to protein family HMM PF01595"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60014"
FT                   /db_xref="GOA:B5ZAQ1"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR002550"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZAQ1"
FT                   /protein_id="ACI60014.1"
FT                   /translation="MIEDSQQIIDNQTTFSVGVLIILAIITIILICFSAFFSATETAVT
FT                   SVTTVKWKTESNKIKSKTIINVIYKMINNYTITLATILIGNTLVNTASSTIAGLFFAGI
FT                   VKSFSTASNAEAIGTGIATGIMTLIVLLFGEFIPKNFAKKNPIKILKLVAYPLNCFYVL
FT                   FWPLTWLLNRMFNKKSQSVITATEEELKSLVEVIRHEGTLDSQEALIINKAILFDDILI
FT                   NQKMVPWNQVVKISENKTVLESFEIFNSSGFSRLVVINKDDEVVGIIHLKKIIKYLLNE
FT                   PNTIIKDIMETPLLMNQKDTLYDGLRTMQFQRIHLGIVVDNITEKKPIGIITLENITEE
FT                   LTGNVYDETDNENEIKEIQVVNETTWRVNAKTNAKLFLHQYIDKNIEVDDDINMGKYIA
FT                   KINKNRAFKNRQLINTPNMYIETFKDVRTNQFAFLIEKKINKL"
FT   gene            complement(97198..98187)
FT                   /locus_tag="UUR10_0079"
FT   CDS_pept        complement(97198..98187)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0079"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF02650;
FT                   match to protein family HMM TIGR00647"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59796"
FT                   /db_xref="GOA:B5ZAQ2"
FT                   /db_xref="InterPro:IPR003802"
FT                   /db_xref="InterPro:IPR023054"
FT                   /db_xref="InterPro:IPR027434"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039518"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZAQ2"
FT                   /protein_id="ACI59796.1"
FT                   /translation="MQKSTLQEIIDKDLNKFTFSEFVKEDIYTNTDYSSTDYKVILYSF
FT                   FRNNLTIKIGQKLTWILKSQNLQIIEFILNGLEHFNNLNLEYEIIVEPDHLNKTRTNYS
FT                   LALWGDLDKLDEILKLFDNENDENFHKDRYCSNFLIGAMLSGGSIAHPLENYHLEIRCD
FT                   SNNYITLLTKALSRYGLEYKIVYRNKKTIIYFKKSETISDFLKAIRTQNSLFEFENIRI
FT                   QRDFNNQQQRLNNLDISNLSKSSKAGVLAKEMILEIKKNHEDFSKQSDKFLKYCELRIQ
FT                   NPDCSLNELAYLLKQTFNIEISKSGLNHFNSRIKQMYEELILKNERKN"
FT   gene            complement(98153..99082)
FT                   /gene="trxB"
FT                   /locus_tag="UUR10_0080"
FT   CDS_pept        complement(98153..99082)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="trxB"
FT                   /locus_tag="UUR10_0080"
FT                   /product="thioredoxin-disulfide reductase"
FT                   /EC_number="1.8.1.9"
FT                   /note="identified by match to protein family HMM PF00070;
FT                   match to protein family HMM PF01134; match to protein
FT                   family HMM PF03486; match to protein family HMM PF07992"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59926"
FT                   /db_xref="GOA:B5ZAQ3"
FT                   /db_xref="InterPro:IPR008255"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZAQ3"
FT                   /protein_id="ACI59926.1"
FT                   /translation="MNQQIYDLVIIGAGPAGLAAAVYAKRSGLNVIIVEKQFPGGKVAL
FT                   TANVENYLGINSISGPELAYKMYEQVLNLDILVIYELADEITLKEKYKEVKLATQTLIA
FT                   KTVIIATGTENRRLNIPGELTFENKGISYCAICDGPLYKNKVVSVIGSGNSAVEEAIYL
FT                   ATIAKEVHLIANKPEFKAERQMVEIVKNTSNIKIHYNKQTFEFFGEEFLQGLRFKDLVT
FT                   NEITTLNVEANFTFIGLLPSRINASNLNIFNETNGFITTNKNMETNVHGIFAAGDIVDK
FT                   SVRQIATAINDGVIAALYAKEYITRNNW"
FT   gene            complement(99100..100107)
FT                   /gene="lgt"
FT                   /locus_tag="UUR10_0081"
FT   CDS_pept        complement(99100..100107)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="lgt"
FT                   /locus_tag="UUR10_0081"
FT                   /product="prolipoprotein diacylglyceryl transferase"
FT                   /EC_number="2.4.99.-"
FT                   /note="identified by match to protein family HMM PF01790;
FT                   match to protein family HMM TIGR00544"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60011"
FT                   /db_xref="GOA:B5ZAQ4"
FT                   /db_xref="InterPro:IPR001640"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5ZAQ4"
FT                   /protein_id="ACI60011.1"
FT                   /translation="MQLEIINPESTLINDVVAHRIAFSIGSNFNIYWYGIIFVCGFLLA
FT                   ILTYSLRLKFHYKVPYDPGFYYIFLAIPMTIIGARLWSLAIGDAKDFFDFRNGGLAIQG
FT                   GVIAGVLSAAIYFPLILRMPKYHVRDLDADGNVIIRQPSMWIYADAIIPTILIGQALGR
FT                   WGNFINGEIFGAESTVNDLQWLKKAMPAVFEGMKHYFIEGDKTLFTIYQPLFLYESFFN
FT                   VIVFVFIYFGLSYIKQLKIGFVSMSYFFFYGVIRFSTESARAPQFSFAGTYVINSLLLI
FT                   FGVLGALYVQFIAPILRKRFLLDAIIELFYKKKQQAHKFGQLRNPEEFLYYCHK"
FT   gene            complement(100108..101034)
FT                   /gene="hprK"
FT                   /locus_tag="UUR10_0082"
FT   CDS_pept        complement(100108..101034)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="hprK"
FT                   /locus_tag="UUR10_0082"
FT                   /product="HPr(Ser) kinase/phosphatase"
FT                   /EC_number="2.7.1.-"
FT                   /note="identified by match to protein family HMM PF02603;
FT                   match to protein family HMM PF07475"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59770"
FT                   /db_xref="GOA:B5ZAQ5"
FT                   /db_xref="InterPro:IPR003755"
FT                   /db_xref="InterPro:IPR011104"
FT                   /db_xref="InterPro:IPR011126"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR028979"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZAQ5"
FT                   /protein_id="ACI59770.1"
FT                   /translation="MEIRGKLFVSQVVRKFNLNVVANSDYIDREISTTGITRVGFELAG
FT                   EILFKEIWNIVYFGSKESNYFSKFSETIISKKLGKILDLNPPLIIFGKNFKHAGILLKL
FT                   AERYKIPIVEVKYSFYELNFTINTYISQKLSHQSLVHGTLLSIYGIGVILMGESGVGKS
FT                   ELAIELVKKGHIFVGDDAILVNRIGGNLYGRAEDSTKDFIEIRGLGIMNFSRSFGIERM
FT                   IESTKIEIVIELIKAAKHEKIKFERFGREIQHKEFLETKIAYYYIPVIEGRSISDIIET
FT                   AITDYKLKTSGYNSAEEFILQIDKKGN"
FT   gene            complement(101034..102014)
FT                   /gene="tilS"
FT                   /locus_tag="UUR10_0083"
FT   CDS_pept        complement(101034..102014)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="tilS"
FT                   /locus_tag="UUR10_0083"
FT                   /product="tRNA(Ile)-lysidine synthetase"
FT                   /EC_number="6.3.4.-"
FT                   /note="identified by match to protein family HMM PF01171;
FT                   match to protein family HMM TIGR02432"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59858"
FT                   /db_xref="GOA:B5ZAQ6"
FT                   /db_xref="InterPro:IPR011063"
FT                   /db_xref="InterPro:IPR012094"
FT                   /db_xref="InterPro:IPR012795"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZAQ6"
FT                   /protein_id="ACI59858.1"
FT                   /translation="MTKLWTNLINKITNKKYLAAVSGGPDSMAMLNMYKRNISVVCHVN
FT                   YHKRESADRDQEIVVDFCKKNNLPIEILDVDEKVYEKYAHIDNFQAKARLIRYDFFKEI
FT                   GKKYNIQHLYIAHNFDDFLETAYMQRARQSKALFYGIKESNVVNGMIVKRPVLFIRKQT
FT                   LQRYCDENKIKYGIDETNELDIYERNRVRKTISNWSLNEVYDFKKAVLKYNKEHSSFAN
FT                   FVELSYIEFKKNKYRYDYFVRQDDGVQYYLIYYFLIDQKISNPNENKIISLIKFFGKQI
FT                   NKEKAYRVQENLYMHVNEDDLISLISYDKNDVIDDPNIIEKQAGN"
FT   gene            complement(101986..102546)
FT                   /gene="pth"
FT                   /locus_tag="UUR10_0084"
FT   CDS_pept        complement(101986..102546)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="pth"
FT                   /locus_tag="UUR10_0084"
FT                   /product="peptidyl-tRNA hydrolase"
FT                   /EC_number="3.1.1.29"
FT                   /note="identified by match to protein family HMM PF01195;
FT                   match to protein family HMM TIGR00447"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59843"
FT                   /db_xref="GOA:B5ZAQ7"
FT                   /db_xref="InterPro:IPR001328"
FT                   /db_xref="InterPro:IPR018171"
FT                   /db_xref="InterPro:IPR036416"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5ZAQ7"
FT                   /protein_id="ACI59843.1"
FT                   /translation="MEKYLIVGLGNPGSNYAKTRHNAGFMVINEICNKLNLFLDNSKFN
FT                   GMFAKTIYNNCVVFFCQPTTYMNLSGEFVSKMLKFYDIPIKNLIVIYDDVDTKLGVIKL
FT                   RKKGSSGGQNGIKNIINLLKTEEIKRIRVGIGKDPHAKLDQYVLSNFKIDELVIIKPAI
FT                   IKGALAALEAIGEDFDKVMNKFN"
FT   gene            102772..103911
FT                   /gene="dnaN"
FT                   /locus_tag="UUR10_0085"
FT   CDS_pept        102772..103911
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="dnaN"
FT                   /locus_tag="UUR10_0085"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="identified by match to protein family HMM PF00712;
FT                   match to protein family HMM PF02767; match to protein
FT                   family HMM PF02768; match to protein family HMM TIGR00663"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59794"
FT                   /db_xref="GOA:B5ZAQ8"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZAQ8"
FT                   /protein_id="ACI59794.1"
FT                   /translation="MEVFVSIKKLIEAMKFSTTIANTNNANALLLGVLIEVNENKITFK
FT                   TTNNQVSGYKEISDGFEYFSSGKILVTAKILLGLISKLKDKSVLLKQVDTNILLIKTEN
FT                   FETQINTMNIESFPSLNFSLEDYVKISLPHQIMQEINAKVLPNVLNSQGIEKIQPISGV
FT                   LIDTETLDNQLIAIGTDKIKASCLTKPYLGEKFKFIISYSTMKLIMEVLRNVEYSNNQI
FT                   VDFYVRNKSLVFKVNDAILQTRMIDGVYPNVYSIFNETNEEKNYVFDRRLLIEIIERGM
FT                   NIVMQEQNPKISIKIENNEAEISLTTFEIGNMKEKMPIINLSNANVEFIVNPSLLAHVL
FT                   KNFENNDVNFKVKDEILRPIIFIDAKDLGFKQILSRIKN"
FT   gene            104106..104276
FT                   /locus_tag="UUR10_0086"
FT   CDS_pept        104106..104276
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0086"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60033"
FT                   /db_xref="GOA:B5ZAQ9"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZAQ9"
FT                   /protein_id="ACI60033.1"
FT                   /translation="MAGLINNGGQAKFWLLENEVIVDKKKEDRRGRKLYDQMIVKIGNQ
FT                   LYQIVKTDESR"
FT   gene            104284..106236
FT                   /gene="gyrB"
FT                   /locus_tag="UUR10_0087"
FT   CDS_pept        104284..106236
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="gyrB"
FT                   /locus_tag="UUR10_0087"
FT                   /product="DNA gyrase, B subunit"
FT                   /EC_number="5.99.1.3"
FT                   /note="identified by match to protein family HMM PF00204;
FT                   match to protein family HMM PF00986; match to protein
FT                   family HMM PF01751; match to protein family HMM PF02518;
FT                   match to protein family HMM TIGR01059"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60160"
FT                   /db_xref="GOA:B5ZAR0"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZAR0"
FT                   /protein_id="ACI60160.1"
FT                   /translation="MNDSNKENKYTAESIKVLEGLEAVRKRPGMYIGSTQSEGLHHMIW
FT                   EIVDNSIDEAMGGFATVVKVIIKKDGVIRVEDDGRGIPVGIHEKTGLSGVETVLTVLHA
FT                   GGKFDNDSYKVSGGLHGVGASVVNALSKNFKVWVNKNYVQHYVEFINGGHAIEPLKIIN
FT                   DKDIKEKGTTIEFIPDFEIMEENEWDELKIMARLKQLAYLNKGVNIEFESEMTNRKEKW
FT                   HYEGGLKEYIADLNAEKEPLFDAIVYGEEEKEVKVPGHNDQTYNIKCEVAFQYNNSYNN
FT                   STHSFCNNINTTEGGTHEEGFKLAITRLLNKYAIDKKYLKDTDDKITKEDVSEGLTAII
FT                   SIKHPNPQYEGQTKKKLGNSEVRPYVNEITSIIFEKFLNENPEESKKIVAKVMQAAEAR
FT                   RRSHEAREATRRKSPFESNSLPGKLADCSNRDSSVTEIYIVEGDSAGGSAKTGREREFQ
FT                   AILPLRGKIINVEKAKIDKIFANEEIQNMITAFGAGIGPEFNIEKLRYSKIIIMTDADV
FT                   DGSHIRILLLTFFYRYMLPLIQNGNVYIAQPPLYKVSYGKTIKYAYSDQELEKIKSTLL
FT                   NTKYNIQRYKGLGEMNPDQLWETTMDPKNRLLLKVNIEDAAIADKTFSLLMGDDVTPRK
FT                   EFIEKNAKYVKNIDA"
FT   gene            106255..108789
FT                   /gene="gyrA"
FT                   /locus_tag="UUR10_0088"
FT   CDS_pept        106255..108789
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="gyrA"
FT                   /locus_tag="UUR10_0088"
FT                   /product="DNA gyrase, A subunit"
FT                   /EC_number="5.99.1.3"
FT                   /note="identified by match to protein family HMM PF00521;
FT                   match to protein family HMM PF03989; match to protein
FT                   family HMM TIGR01063"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60302"
FT                   /db_xref="GOA:B5ZAR1"
FT                   /db_xref="InterPro:IPR002205"
FT                   /db_xref="InterPro:IPR005743"
FT                   /db_xref="InterPro:IPR006691"
FT                   /db_xref="InterPro:IPR013757"
FT                   /db_xref="InterPro:IPR013758"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR035516"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZAR1"
FT                   /protein_id="ACI60302.1"
FT                   /translation="MALKKPKKSRLTTEEIKQQLEGSTIKEQSITKEVETSFLDYSMSV
FT                   IVARALPDVRDGFKPVHRRALFAAFENGMTHDKPYKKSARWVGDVIGKYHPHGDQAVYQ
FT                   TIVRMAQEFSMRYLLVDGHGNFGSIDGDSAAAMRYTEARLSKISYELLKYIDKETVDFV
FT                   PNYDASEQEPSVLPSGFPNLLTNGTTGIAVGMATNIPPHNLTEVCQAIKAYAKNHDISI
FT                   PEIMEHLKGPDFPTGAEIYGDSGIINYFNTGRGSVTIRSKYEIEDIGQGRVAIVVTEIP
FT                   YMVNKVNLIEKIVELVTNKQIEGISDLRDESSRDGIRIVIEVKRDVIPEVLLNKLFKTT
FT                   ALQTNFSVNNLALVNGVPMVLNIKEMIKYYFEHQIEVLVRRTKFDLRKAKERIHIVEGL
FT                   VIAVNNIDEVIKIIKASGDDDIASKALIARFGLTELQTKAILEMRLRALTGLNIDKLKK
FT                   EYEDLLLIIEDLEDILENYDRQVNIICENLDYLIEKFGDERRTEIMYGVSSHIDDEDLI
FT                   PVEDIVVTMSKRGYFKRLPIDTYKNQRRGGVGVQGLKTYEDDDVEKILVANTHTDLLFF
FT                   SDLGRVYRLRGHEVPLGSRQSKGIPAINFLPIEKSESILTILPIDNYEQGSLFFTTSKG
FT                   IIKRANLSDFESIRANGKIAITLKEGDKLFSVMQTLGNDEVFIGASNGNVIRFNENDAR
FT                   EMGRIATGVKGINLEDDEYVVGTGLSSHGEYVLAVGSKGLGKLTDINDYRLTKRGAKGV
FT                   NTLKVNDRTGNLVSIKVVNRDEEALIITTSGKVIRLSIQDISVIGRNTSGVKLISLENK
FT                   EEVKSIAIFKKEEIDDNDDEQKTSHGNEHNLE"
FT   gene            108899..109369
FT                   /locus_tag="UUR10_0089"
FT   CDS_pept        108899..109369
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0089"
FT                   /product="competence/damage-inducible protein CinA
FT                   C-domain"
FT                   /note="identified by match to protein family HMM PF02464;
FT                   match to protein family HMM TIGR00199"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60270"
FT                   /db_xref="InterPro:IPR008136"
FT                   /db_xref="InterPro:IPR036653"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZAR2"
FT                   /protein_id="ACI60270.1"
FT                   /translation="MNVALELINLLKEKRLKLSVCESASCGALSSSIGEVPGASSVFVG
FT                   GFISYSNEVKIQIVGVSEKTILKYGAVSEQTAKEMCLQTNQKFNTDIAISITGNAGPQG
FT                   SENKEVGLFYIGIAIKDFAIVKKVILNSSERTFNRFSIAWEAISYLIELIKK"
FT   gene            109410..110411
FT                   /gene="recA"
FT                   /locus_tag="UUR10_0090"
FT   CDS_pept        109410..110411
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="recA"
FT                   /locus_tag="UUR10_0090"
FT                   /product="protein RecA"
FT                   /note="identified by match to protein family HMM PF00154;
FT                   match to protein family HMM TIGR02012"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60122"
FT                   /db_xref="GOA:B5ZAR3"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013765"
FT                   /db_xref="InterPro:IPR020584"
FT                   /db_xref="InterPro:IPR020587"
FT                   /db_xref="InterPro:IPR020588"
FT                   /db_xref="InterPro:IPR023400"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5ZAR3"
FT                   /protein_id="ACI60122.1"
FT                   /translation="MKENDKLEKLDPIATLEAKFAKSTYFIADEIKNEKVSAISTGSIH
FT                   IDQITGINGIPVGKITEIYGNESSGKTTIALQTIAECQKKGGTAVLLDLEGSFDLNYAK
FT                   SLKVDLTKLIITQPQTGEQAFDMIETLIKTNSIDLIVVDSVAAMIPESEYQANMSEALM
FT                   GAHARLMSKGLRKIQPLMNKSQTAIIFINQLREKINTFFGNPEMTTGGKALKFYASLRI
FT                   ETRKADLIKEGINKIGIKTKVTTVKNKLAPPLQTCFIDVFFGHGFDYDNEIIDFAIQYG
FT                   ILKKNGSWFYFDDNKIGQGREQLKNTLLKNNELFTQVSEKTLAFVNNEKINQ"
FT   gene            110447..111868
FT                   /locus_tag="UUR10_0091"
FT   CDS_pept        110447..111868
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0091"
FT                   /product="hdod domain family"
FT                   /note="identified by match to protein family HMM PF01966;
FT                   match to protein family HMM PF08668; match to protein
FT                   family HMM TIGR00277"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59889"
FT                   /db_xref="GOA:B5ZAR4"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR006675"
FT                   /db_xref="InterPro:IPR017705"
FT                   /db_xref="InterPro:IPR036612"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZAR4"
FT                   /protein_id="ACI59889.1"
FT                   /translation="MGYLIAFIILLILFVLLITIVPVVMVVYLKKKQLKLALVPKSQTS
FT                   FKKAIQKSKDLEEECEDLNNKNNELKKTISDQNLQIDLLKKSNENFLLNATSLTAEQAK
FT                   KELFNLLKIKFKKELAQDYAKIKHEFNEAQEIYAQNILVETMEQIAEPLIVERSLFNID
FT                   IVDENLKGKIIGRDGRNKAVFENEGGVDLIVDRQQPIVGISTPNPIRREIARIVMQKLI
FT                   DSKNIDINRIELLFKEEREKFEKKAFEIGKNVAEQTLGFFDLPEGIYPYIGRMKFRNSY
FT                   GQNILSHSLEAAEYAERIAKLINIDPIKAKKAAFFHDIGKTIDFESNLDHVEAGLLIAK
FT                   KFNLDDYIYNAIESHHNKVIPTTIYGALVKIVDTLSAARPGARVNSYDEYYNRVKELEA
FT                   ICMRFDGVKSAYVIKSGRQLRVIVDSNLVSDEQLDLLSHEIKTAIEESDLLANYKIKIV
FT                   LIKEKRISIETNIIG"
FT   gene            complement(111943..112458)
FT                   /locus_tag="UUR10_0092"
FT   CDS_pept        complement(111943..112458)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0092"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59769"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZAR5"
FT                   /protein_id="ACI59769.1"
FT                   /translation="MINNKIISRETVDDYDDIYGWSIKIGEPTPKITGISLIYDNPKQP
FT                   KVNMTFSNNWPFYSLNKGFGFILFFKPNKNLNANYYVILTYVFNKEKNEDDVLKLNEET
FT                   KTYSFRPRIEFKCIPDGDNNQGGLAVPYGEEIKLIKTKEIRVDLVHDEMEPIAENPQNL
FT                   ITKLPSVE"
FT   gene            complement(112612..112731)
FT                   /locus_tag="UUR10_0093"
FT   CDS_pept        complement(112612..112731)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0093"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59999"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZAR6"
FT                   /protein_id="ACI59999.1"
FT                   /translation="MGFYDSNVAKNENPLSYKINLHNDNISGIDENIFSLNPT"
FT   gene            complement(113066..114028)
FT                   /locus_tag="UUR10_0094"
FT   CDS_pept        complement(113066..114028)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0094"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59880"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZAR7"
FT                   /protein_id="ACI59880.1"
FT                   /translation="MIKKHEAQVEIKLLNVPNTNAFNLENVDVQIELTNKKTNKIFKFQ
FT                   PLKDRFNWFDSNQNKKTIIKIVGQFKAGALNQLDDDEYFISKLIINDKNSEINEKVYKP
FT                   SGLQLDVSIDNQKPTHLLIPTTFSLLTSANIVDAQIISDDGVPKQLKLKYDGFVNEYNF
FT                   KENELIANIELISTKTKQSISLPSVKFDVNNKEIIFDVVNNKQLQDLILSDPVFKIKSL
FT                   TINNDLQVLKENIKQKELDLANKHILKIKKFTYDDSNIQNRLMKFELDSTAPIVKNVQS
FT                   TIGIPIDINYIFDKNFVFNSLNTNPLMMLILVMLFHNYV"
FT   gene            complement(114343..114525)
FT                   /locus_tag="UUR10_0095"
FT   CDS_pept        complement(114343..114525)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0095"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59991"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZAR8"
FT                   /protein_id="ACI59991.1"
FT                   /translation="MKIIKTNEMLIEFAHLELDEPKPNPIPPTPVPIPKPQPKPPVKKD
FT                   EAIVKSVAFKKDPTK"
FT   gene            complement(114661..114846)
FT                   /locus_tag="UUR10_0096"
FT   CDS_pept        complement(114661..114846)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0096"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60350"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZAR9"
FT                   /protein_id="ACI60350.1"
FT                   /translation="MMPTASLLFSCSQNKIKYKLEVLKHFFKTKNDDYYVCYQFDDLSI
FT                   DDKTKLEKVLFFNKYY"
FT   gene            complement(115168..115362)
FT                   /locus_tag="UUR10_0097"
FT   CDS_pept        complement(115168..115362)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0097"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60295"
FT                   /db_xref="GOA:B5ZAS0"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZAS0"
FT                   /protein_id="ACI60295.1"
FT                   /translation="MNKTNNNKSKIWLIVGIIFAIGLSFGIWGISKAVRDNKQTEQKCS
FT                   NKNSDNTKCIKEDDRKEGK"
FT   gene            complement(115346..116044)
FT                   /locus_tag="UUR10_0098"
FT   CDS_pept        complement(115346..116044)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0098"
FT                   /product="deoxyguanosine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60043"
FT                   /db_xref="GOA:B5ZAS1"
FT                   /db_xref="InterPro:IPR002624"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031314"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZAS1"
FT                   /protein_id="ACI60043.1"
FT                   /translation="MSDKKLDFLTPSFKKNRISNSIAIGGMIAFGKSTLAQALHEKYQP
FT                   SNVVYEMVEGDKLMDLLLAKMYERENNVLFGSLFQLYFVLNRFANYKNNCNRENLTIFD
FT                   RSIFEDWLFAHANIDKPSVFSYYDGLWQGVCKELIYEHGVPKLYVILDGDWELFKERIF
FT                   KRNRKVEIDNFSINETYFKRLLEMYKNYMVNVCKDFGIDYIVLDARNSVEHNVNEVTKR
FT                   LQELKNEQNK"
FT   gene            116241..118052
FT                   /locus_tag="UUR10_0099"
FT   CDS_pept        116241..118052
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0099"
FT                   /product="DNA polymerase III subunits gamma and tau"
FT                   /note="identified by match to protein family HMM PF00004;
FT                   match to protein family HMM TIGR02397"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59892"
FT                   /db_xref="GOA:B5ZAS2"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR012763"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZAS2"
FT                   /protein_id="ACI59892.1"
FT                   /translation="MSELTLYRKYRPHKFKDVIGQNLIKQALINANLNNKTTHAYIFSG
FT                   PRGIGKTSIARIFAASINCLKPNNGDCCEECSVCQSIINEQSVDLIELDAASNNGVDQM
FT                   RNITDNINYLPTLFKYKVYIIDEAHMLSTSAWNALLKTVEEPPQHVIFIFATTEYQKIP
FT                   LTIISRCQRYDFNRLNNSELQELIDLVAKKEDIKINENAINKLIQLADGAGRDCLSILD
FT                   QLVTNQKVIDIDLINKTFGLVDNSKVINLIELIQKNDLLELRKFIYELYDYGINLEAFC
FT                   AQIINILIDYLVYQKTNDETNLKKISIDELKKILSINFNANHLLNNFISLYSHLKNSVN
FT                   QVFEFEIYLYKIVNVNNDKLETKKTIPLIAIEKDKNTLPPSPPIAKTTSISKEVNKVNE
FT                   NKDVINFNNLYQTQIFHHKKNSDNNEQETNIKYEEKLIDEPTKINQPINKSDEVLDNYE
FT                   LAKQAFFNKDLKLSKEMSQKFKDFKNEAIVENSYIDIIKQADLVLWCSPNALVLGVEFL
FT                   GLINRINKVTRSFEFIKEFIKKFNSTKLVIAISKKQAANIVNISKQDLKTNIIKDVLID
FT                   DIKMLLKQEEQRKQEQIALLSEIEDEE"
FT   gene            118060..118359
FT                   /locus_tag="UUR10_0100"
FT   CDS_pept        118060..118359
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0100"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF02575;
FT                   match to protein family HMM TIGR00103"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60263"
FT                   /db_xref="GOA:B5ZAS3"
FT                   /db_xref="InterPro:IPR004401"
FT                   /db_xref="InterPro:IPR036894"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5ZAS3"
FT                   /protein_id="ACI60263.1"
FT                   /translation="MDFQKLAQELKKMQNTLSKKQKEFEEKVFDFDYKGYVLIKIKGNL
FT                   TIESIEVKTEIVDPEDKETLQDILRAAVNEAISKTCKERDAIMNSTIPKGTGFF"
FT   gene            118369..118974
FT                   /locus_tag="UUR10_0101"
FT   CDS_pept        118369..118974
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0101"
FT                   /product="recombination protein RecR"
FT                   /note="identified by match to protein family HMM PF01751;
FT                   match to protein family HMM PF02132"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60023"
FT                   /db_xref="GOA:B5ZAS4"
FT                   /db_xref="InterPro:IPR000093"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR023627"
FT                   /db_xref="InterPro:IPR023628"
FT                   /db_xref="InterPro:IPR034137"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5ZAS4"
FT                   /protein_id="ACI60023.1"
FT                   /translation="MSKPVEFEMLVDALKSLPGVGTKNAKKWAFFLLQQDQKYIDDFIK
FT                   RIKDAKTNIIKCKYCSNFGNKDECDICSNDYRDFTKLMIVTTNEDLERIESANIYNGLY
FT                   HITNGEVSLRKNVVIEHTNIKIIKERVLNGSFKEIIIATSYTHDGEVTADYIVKMLEDI
FT                   KDIQIYRIGFGIPLNSSIDYADDETLKQSIANKRKIRI"
FT   gene            complement(119776..120474)
FT                   /locus_tag="UUR10_0102"
FT   CDS_pept        complement(119776..120474)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0102"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to RF:XP_001579764.1"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60089"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZAS5"
FT                   /protein_id="ACI60089.1"
FT                   /translation="MKKSNKIITFLSVSLIGAGLVIALPIALSYKYKNKKEPKIENEIN
FT                   QNKVLPNNSVDELNKIVNELKQNDKNKNTKILEIEQKIAELDKKIDNNNKSIKEIQLQN
FT                   INLSKELTTQLQSQLKQIQNIEALTKTISEENKKQSSDIDKLKTSVKAVTQYFDKIIKQ
FT                   IGQQLNTVIQYLDKNVNPKIASFEQVERLVKEFNDSWSSKVGREDFNSLHKLLEELQSK
FT                   ITELEQKNSK"
FT   gene            120663..122009
FT                   /gene="ffh"
FT                   /locus_tag="UUR10_0103"
FT   CDS_pept        120663..122009
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="ffh"
FT                   /locus_tag="UUR10_0103"
FT                   /product="signal recognition particle protein"
FT                   /note="identified by match to protein family HMM PF00448;
FT                   match to protein family HMM PF02881; match to protein
FT                   family HMM PF02978; match to protein family HMM TIGR00959"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60330"
FT                   /db_xref="GOA:B5ZAS6"
FT                   /db_xref="InterPro:IPR000897"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004125"
FT                   /db_xref="InterPro:IPR004780"
FT                   /db_xref="InterPro:IPR013822"
FT                   /db_xref="InterPro:IPR022941"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036891"
FT                   /db_xref="InterPro:IPR042101"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZAS6"
FT                   /protein_id="ACI60330.1"
FT                   /translation="MFKAMIGNIVSKQMSKKLKNATIAEEDIKELLSEIRITLLDADVN
FT                   LLVVKKFIKNIKEKTIGLYVEQNQKPADVVLKVIKDELVEILGKENKPVNTAKSQLKIM
FT                   MVGLQGSGKTTTAGKLANYFRNKYNKKPLLVAADIYRPAAIDQLRTLAKQVRVDFWEEG
FT                   TQRPDLTVKNALHKADENENNLVIVDTAGRLQTNEELMQELVNVKKTLNPDEVFLVVDA
FT                   MAGQDIINVATEFNNWLKLTGIIVTKLDSDARAGAVLSLTSLLNVPIKFTGTGEKIGSI
FT                   DSFYPERMADRILGLGDIMTLAEKAADVIDEKQVRGSMQRMMAGKMDLEDLMRQMSQIS
FT                   KLGSFSGIAKMIPGLNSISENQIDDAENKMKIWTILLSSMTLKERRDPRVFKKEPSRRM
FT                   RVLKGSGRSPDELNKLLKQWEVSRDKMAELGKMLQKGKNPFSKSGGIFG"
FT   gene            122224..124014
FT                   /locus_tag="UUR10_0104"
FT   CDS_pept        122224..124014
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0104"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59775"
FT                   /db_xref="GOA:B5ZAS7"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZAS7"
FT                   /protein_id="ACI59775.1"
FT                   /translation="MNKKMNFNSSFAYVGFLTRHIIVKKTTYILPIITFLITLIVGIIV
FT                   GCVVNQKSQFLIISYVMIIFNLLMTTIFASLKALNVFKDFSEDGIDILVISKPISRKNI
FT                   VWSKIFFFILTGVVWSLISFLGLLIFYLISFNFAKDVNYYWLLSYISPFICYLVFGLLT
FT                   SLLALKLNAKISVLIPLVSFVPLLAVGIVSNIVSQLQSKAFLSSLKQKPTNNIEPFYLN
FT                   NNLDQYYLINTGFANHEFKQSQNLEVLDAYLKTRNLATFWQVSSWIFPIYQLVDAFNKS
FT                   DYEPFSDFIKNQENHKVLYANNLASKQFNYRLEKNSDSLPSFNINNDKGFLVPSLLKND
FT                   SQNLINNNLNQEVIYAIEDWKNQTIEYQKNSYTQLSADDIVGSIKWTIIKEVLNTKLFN
FT                   EYANNLFKTLDKKASKKQILDLISNSVQKFDFNKQIDENTELFKKDVNKLLIKSKTERQ
FT                   IYLAISLIYYLYFSSNYTDLLNTLLFDQKNHLQYQTQFKINLNNKNYLIGGFKNYLVNQ
FT                   ILPQETNDAIDQSKKDKKIRYKYSLEQGGNYLFDYVTQNYSIKREQQIVYKEVYCVIWL
FT                   VLIFSLLIGTYYGYKRKDYR"
FT   gene            124014..124724
FT                   /locus_tag="UUR10_0105"
FT   CDS_pept        124014..124724
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0105"
FT                   /product="ABC transporter"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60196"
FT                   /db_xref="GOA:B5ZAS8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZAS8"
FT                   /protein_id="ACI60196.1"
FT                   /translation="MNNQFILEVKNLTKIYKKSNQGVFDLSFNVKRGEIHAFIGENGSG
FT                   KTTTIKSIINAYTNYKGSILIAGFDNKTPKSHEKIGYVPEIALFPSELTTFQYLYSFAR
FT                   LSNLNKKQAIERIDYFLEKFHISDLKNKKPINFSSGQKKKVILIQALLHDPELIILDEP
FT                   TANLDPSARHEFNTILKELHEQNKTIFICSHILKEMDSYVDSLTLINKGKLVYSGHKYD
FT                   ELEKIYYENVLKNK"
FT   gene            124843..128007
FT                   /locus_tag="UUR10_0106"
FT   CDS_pept        124843..128007
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0106"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60298"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZAS9"
FT                   /protein_id="ACI60298.1"
FT                   /translation="MIKKWNSKRKWSLVCASLVIGSASVVTATACANTNNKVVNAGFIY
FT                   NGSTTNDAITGFDINDYIIKVPSSDVNLNQQILRNNNYEQKPILWEDYLKQYDSVKKQH
FT                   DQQTKSFYEYVWINKASKYKNLNKAIDINDPYFADWFLKLTPNTLKNDLYDFINDIRKD
FT                   NMKPSLVFSSSEPQVEVWKDLGNNQKQKIAPNQVIFEPLTQEDTKNNVTLFKKNKHLRV
FT                   NISFWYALTNQNSANVLINDPFYKKPSGIASNTSEKYFINIQNSPISLSFSHTDRLEHD
FT                   IYSAQTTSIKNTYKMRYYFDNIRVEKQVTKVKSNAKRGDQNAEENLAKEFYFANDNNEK
FT                   FSFGTRSYTLNNEITQASYEQDIFSLDQKIKNELKKLNQQQILKDIEYAFASGYDVAID
FT                   SISSIFNILKGVANDLDLKELFLQSTQDFKNLTYNITQHNNLTNLIALITSNQSLGVVI
FT                   DGFKPILKEIIYKNASIDQSVKNTIWSKIESMDFKNNLIAEIGQIKTLLDSISLAEIKT
FT                   YKPIINKLLELISLIEARSKKDPKNYGFIDGLDELFSFFLNLKQDDLPSNINFKISDQN
FT                   YGLYDLIVEVKKIVDNLVPHENQYDPKNQQIISTNYFLSKIKVLDLISLNKTNELDYRK
FT                   GVESIFSLLKKFQVAIPEIVYKIIDELLIQNTNWNKENIKKLLDAILYPKITSNDASIN
FT                   DLKSYFKYGISKPEITSKELEYDQNNLLIKKLNIKYRYKVLANAEFDIKPLFDLLPQKA
FT                   PSFINIGSLWDQIKKEFPYKVVLAKDDYVDHTISINEPQELTPLVFQDRSDHDKYKIGY
FT                   SFYPTHTVQTHMPNSMKAIIEEISSRNDRLLPNKYIAQLLSWLFYKKWVFTNPLAIYET
FT                   FEGDKKVANDKNVKYLIKDNLNKYLKHYDTNTYYEGFDFKHFSNNLENKVNNQTIRNLI
FT                   LAKIKTIKTDGQELYQDKLGRKVIATSAYDQINLTLQELIDYKLLEFGKKVDLKKDVYL
FT                   SAVAFNFGLNTNDSDQTNALNNNDEIKYNLNILKKVVITLHFTKPTLDLSDPNHPKLVN
FT                   SYTFVV"
FT   gene            complement(128071..128328)
FT                   /locus_tag="UUR10_0107"
FT   CDS_pept        complement(128071..128328)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0107"
FT                   /product="type I restriction modification DNA specificity
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59956"
FT                   /db_xref="GOA:B5ZAT0"
FT                   /db_xref="InterPro:IPR000055"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZAT0"
FT                   /protein_id="ACI59956.1"
FT                   /translation="MSFILRKTARKYVNQASGNPKLMSNVMQEIVVPIPPLAIQNKIVE
FT                   VLDKLEAYTENINVGLPLEIKQRKKQYEYYRNKLLDFKEY"
FT   gene            complement(128300..128839)
FT                   /pseudo
FT                   /locus_tag="UUR10_0108"
FT                   /note="type I restriction enzyme M protein, truncated; this
FT                   region contains one or more premature stops and/or
FT                   frameshifts"
FT   gene            complement(128977..129444)
FT                   /locus_tag="UUR10_0109"
FT   CDS_pept        complement(128977..129444)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0109"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59724"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZAT1"
FT                   /protein_id="ACI59724.1"
FT                   /translation="MAKYIKTGVSYINLDNARTINVLPEDIDSYLELGGDEAYQTSDLG
FT                   SELYINYADFESTNILFDLKKEELQAKIDAFLVSNDTILDLSEVFLDVHFSEDDDYEED
FT                   CCCEDECCGDEENEVCCNSETKSLEVEEECCGGTKDDCCGGHEHEHHHHQH"
FT   gene            129669..132500
FT                   /gene="uvrA"
FT                   /locus_tag="UUR10_0110"
FT   CDS_pept        129669..132500
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="uvrA"
FT                   /locus_tag="UUR10_0110"
FT                   /product="excinuclease ABC, A subunit"
FT                   /note="identified by match to protein family HMM PF00005;
FT                   match to protein family HMM TIGR00630"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60195"
FT                   /db_xref="GOA:B5ZAT2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR004602"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041102"
FT                   /db_xref="InterPro:IPR041552"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZAT2"
FT                   /protein_id="ACI60195.1"
FT                   /translation="MDKIIIKGAKENNLKNIDLEIPKNKLVVITGVSGSGKSSLAFDTI
FT                   FAEGKRRYFESLSSYARQFLGGNDKADVESIEGLSPTIAVDQKSTNQNPRSIVGTITEI
FT                   YDYLRVLFARVGTPFCPNGHGQIKSQTPKQIADFLFSLPPRSKVQILAPIEIKKGYKIN
FT                   EVLNNLRSQGYLRVLVNNEVYQLDENLPQFLDNKKTDIAIIVDRLVLNIDHQTKTRALD
FT                   AIEFALNYSGGEIAFKVDDNIHYFTQNDVCRVCGFKIKEIEPTLFSFNSPIGACEQCKG
FT                   LGYNYVPDERKMIPNPNLSINEGGLDYFKNTVNTTNLDWQRFNSIIKHYKIDKTKPLKE
FT                   LDRKEIDLLLYGSDEAIEIDITSANNKNYSSIDYVEGVLELVNRRYQETSSEMAREHYN
FT                   KYMSEKVCKSCKGKKLSPQALSILINEINIIDFIEKNINEGIDFLLHLQLSEAQAKIAN
FT                   PILKEVLDRLGFLKNVGLEYLTLARPASSLSGGEAQRIRLATQIGSKLTGILYVLDEPS
FT                   IGLHQRDNDKLIKTLKEMRDLGNTVIVVEHDEETMLAADYLIDIGPQAGVNGGYVIAAG
FT                   TPQEVMQNPNSLTGQYLSKQKDILVPKTRRSGNGHKIILKGAKHNNLKNVDLTIPLGKF
FT                   ICVTGVSGSGKSSLILETLVKAIEYTNFNPFVIPGEYKDLIGASNVDKIVVVNQDAIGR
FT                   TTRSNPATYVGVFDDIRTVFENTIEAKARGYTKSRFSFNIKGGRCERCWGDGTIRIEMH
FT                   FLPDVYISCEECHGKRYNDETLQVKFKGKSIYDVLKMPIDEALVFFENYPSIHRKLQLL
FT                   VDVGLGYLELGASSTSLSGGEAQRIKLAKFLQRKPTGKTLFVLDEPTTGLHIDDVAKLI
FT                   KILNKIVDGGDTVLVIEHNLDLIKVADYIIDVGPEGGNNGGKIIATGTPEQLLIKKDIS
FT                   YTAQYLEKYLKKN"
FT   gene            132505..134169
FT                   /locus_tag="UUR10_0111"
FT   CDS_pept        132505..134169
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0111"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59833"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZAT3"
FT                   /protein_id="ACI59833.1"
FT                   /translation="MKHKTKKLTLLMAGITLTSLCTVFAITACSKQKSQSNSQTKPNKV
FT                   IEKVDQAFFDEFKTKIEQKRTLPNIKITSTFKIPFEKNENTLKSPLFKIGDKSVYDLKQ
FT                   NEIPITWVQDLKDYFLSQKTILTYYALANLKLTSTDAKGAYFLQFIQYVQKMQQKGFLS
FT                   EDFYQQLWYLVSEISDYDMQNGILRSVYRIANPNLKIKDLYLDGSIYGFKKQKSKYMNF
FT                   TNLFQWPSNDEKVCFDIVFKNKNTNQTYTKNIELTYSKEKKYILDSLIDYSEFAPGEYE
FT                   LVSIKKHDDTNAKNLINPNNPNIARIFKVKVFKENEKFKPITLATINQQEADEYDRQNN
FT                   QIIYKNNSEIGILNDPNKIKELGTFLYFKKSLSEITIDDLDRYFKTYFINPEQDFNNFS
FT                   RQYKITKIDKEKQTVELSVLHINNKTNETYVSPINFKFHYQHVYDVNKNTDAKLELNFD
FT                   ESKKEQKQKLQALVNKLDFNKLTYNYLSELALVMFEDVDLENTKIHVEMIKNKDRSITL
FT                   KAYVDKAYKNGKLKISNKADILIKEFKVNYFMTNYFK"
FT   gene            134235..134816
FT                   /gene="hpt"
FT                   /locus_tag="UUR10_0112"
FT   CDS_pept        134235..134816
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="hpt"
FT                   /locus_tag="UUR10_0112"
FT                   /product="hypoxanthine phosphoribosyltransferase"
FT                   /EC_number="2.4.2.8"
FT                   /note="identified by match to protein family HMM PF00156;
FT                   match to protein family HMM TIGR01203"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59751"
FT                   /db_xref="GOA:B5ZAT4"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005904"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZAT4"
FT                   /protein_id="ACI59751.1"
FT                   /translation="MKDIDPRIKEVLITEEQIDQKITEAANWINKEYEGKEPIMIGILK
FT                   GCIPFIGKLLPKIKVDMKLDFLAISSFKGGTSAQTEPEIITDLKFEVKDQDLILVEDIV
FT                   DTGRTIKKVYDLLKIRGARSIKLVTLVDKKDGRLVDLQADFACCDIPLVFIVGFGLDYK
FT                   EIMRNLPYIGVLKEEVYQEDLNNKNEGDGE"
FT   gene            134821..136968
FT                   /locus_tag="UUR10_0113"
FT   CDS_pept        134821..136968
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0113"
FT                   /product="ATP-dependent zinc metallopeptidase-cell division
FT                   protein"
FT                   /note="identified by match to protein family HMM PF00004;
FT                   match to protein family HMM PF01434; match to protein
FT                   family HMM PF06480; match to protein family HMM PF07728;
FT                   match to protein family HMM TIGR01241"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59887"
FT                   /db_xref="GOA:B5ZAT5"
FT                   /db_xref="InterPro:IPR000642"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR005936"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037219"
FT                   /db_xref="InterPro:IPR041569"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZAT5"
FT                   /protein_id="ACI59887.1"
FT                   /translation="MHFFKKILNLFTSKIESEDNSVKKDDLTQPRKQSPEARKKRNRRI
FT                   IFWLIVLLIIGTIIGVIIYFSVRKEYDSVIVKSAQTEIVNDKRVLYLNTVRPNSNQITR
FT                   YTIDEDQLLAARVNILNNTNFQIISNASSLGLSRISFNIVREGVEKFKIGETSIYTPIS
FT                   GATNNQWNWLTSIIAQNAGIPSSGFNAQVIISPLISIIFFAIFLYIILRVSKAQSDSLL
FT                   GTNKGNAKLTKSSVRFSDVAGIAEVKEELIEIVDFLKEPKKYVAAGARIPKGVMLYGPP
FT                   GTGKTLIAKAVAGEANVPFFQTTGSSFEDTFVGVGARRVRELFEKARKSAPAIIFIDEI
FT                   DSVAKKRGNSLTAVQDQTINQLLSELDGFDTSSGVIVMAATNRLDTLDDAILRPGRFDR
FT                   QISVNLPDILEREQILRIHSRNKNLSAKVSLEDIARRTAGFSGAQLENVLNEAALLSVR
FT                   DKATSIHMNHLDEAIDRVIAGPSRPNKVISEREREQVSYHEAGHALIGLYSPGADVVQK
FT                   ITIVARGRAAGYTLQTPERNENILQNKTELISRVRTALGGRAAEELIYGPNEITTGAAN
FT                   DFYKITNIVRAMVASFGMTDVGLTQYIATEGVDNPYRNNYSEQTALAIDIEIEKIIQRE
FT                   YKIVKEMINEYREELELIVQTLLELETILKPQIDYIHQYKQLPPEVIANKNKREASQKQ
FT                   ANSSVEEAKVVDDKEKDQKSN"
FT   gene            137079..138335
FT                   /gene="serS"
FT                   /locus_tag="UUR10_0114"
FT   CDS_pept        137079..138335
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="serS"
FT                   /locus_tag="UUR10_0114"
FT                   /product="seryl-tRNA synthetase"
FT                   /EC_number="6.1.1.11"
FT                   /note="identified by match to protein family HMM PF00587;
FT                   match to protein family HMM PF02403; match to protein
FT                   family HMM TIGR00414"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60117"
FT                   /db_xref="GOA:B5ZAT6"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002317"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR015866"
FT                   /db_xref="InterPro:IPR033729"
FT                   /db_xref="InterPro:IPR042103"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5ZAT6"
FT                   /protein_id="ACI60117.1"
FT                   /translation="MFDINLIRKDIVVTKEKMLNKKVSSDLFDQIFGLDVLVRNLMQQE
FT                   QNLNAKKNQLSKEIGILAKNKDPKLQQTLDLVNSIKSELQDISLTLSNKQDELNKLLLV
FT                   IPNMPDDSVPIGNDENDNVEIKKVFEPRKFDFSPLAHWDLAAKNKLIDFDKSTKITGSR
FT                   FIIYTNFGARLYRALQQFCLDMNVKAGFNEIWAPVIVNQESLIGSGNLPKFVDDLFKLE
FT                   NSNYYLSPTAEVQLTNLHRNEILKASDLPLYYTALTPCFRSEAGSAGRDVRGVIRQHQF
FT                   HKVELVKLCKPEDSFKELESMTRQAESILEALELPYRRIALCTGDLGFSSAKTYDLEVW
FT                   LPSYNAYKEISSCSNCTNFQARRAKIRYKETVDAPTELVHTLNGSSLAIDRLWAAVVEN
FT                   YQQEDGSITIPKALEKYIY"
FT   gene            138574..139728
FT                   /locus_tag="UUR10_0115"
FT   CDS_pept        138574..139728
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0115"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59741"
FT                   /db_xref="GOA:B5ZAT7"
FT                   /db_xref="InterPro:IPR000200"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZAT7"
FT                   /protein_id="ACI59741.1"
FT                   /translation="MKFKKIILLSSAISLIPIASLAFSMNSIHDKNFEIALEKSNELLN
FT                   RLYNEKQKYKFYTYIKDEEGNKYIYIQFEKRFIIYDLNLKKIIQITQSYHKKDIINKSI
FT                   YVFGEDIKDPNLQDKESFKIDLNKDTFESIPNISNVIKNAWWWASRNTIEKIGYIQTRD
FT                   FRPGESVGMCEYIALSNLLLYNELFTSSTIFTDEEFNKYFELSKGESDIFESSPVFRNY
FT                   GLKNPKESLPYKLWKLNNEKLNLWEISSYYLPVTRFMVGKMGSFIFESDYKIGAYYWKT
FT                   IEHIKNNNPVIVTTTKTMHSFVVYGYDEKSEMLLINWLWGGRRSITLLNYWKLSESASP
FT                   LKLFYTLKTKPKNFPTNFRKVFHYNNEYFTGNEMTKIYENQRKI"
FT   gene            139805..140596
FT                   /locus_tag="UUR10_0116"
FT   CDS_pept        139805..140596
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0116"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59995"
FT                   /db_xref="GOA:B5ZAT8"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZAT8"
FT                   /protein_id="ACI59995.1"
FT                   /translation="MAIITRINNDASVWHATCLANAFCWRFSIINHLLLITISLIAIWN
FT                   IYWFRKSINQFQHYDQYLENKKSIIASIISMIIAMLLITLIINISIVYANQNYYHFDRR
FT                   TEELIIDQITSMQMGEFAYIYCLRMTFYLLLTIFVAHFINNKKTAIIILISYLAISLAL
FT                   VLIGMAITLIGNLTALFWVTLITGSIFPELINANFQWLGDFKGLEIWELIYNVDFINYI
FT                   PYFISFVTLTILLSKIKWFPIDNKNFNKTKPQLKLLFNLNN"
FT   gene            140840..142399
FT                   /locus_tag="UUR10_0117"
FT   CDS_pept        140840..142399
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0117"
FT                   /product="spermidine/putrescine import ATP-binding protein
FT                   PotA"
FT                   /EC_number="3.6.3.31"
FT                   /note="identified by match to protein family HMM PF00005;
FT                   match to protein family HMM PF08402"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60238"
FT                   /db_xref="GOA:B5ZAT9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017879"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZAT9"
FT                   /protein_id="ACI60238.1"
FT                   /translation="MEKTLLHLRDITKIYDDGFAAVNKFDLKIKKGEFVTLLGPSGCGK
FT                   TTMLKIIAGFEQPTNGKILYNGIDIKDMPIRLRPTSTVFQDYALFPNMTVKQNIKYGLK
FT                   LMRKPKDNVDQSIYLQADKVYNSALKKANEKIKELKKQRRGLLAEIKKMDLKYQKNKNI
FT                   FEIKEMRKNQYLGTLDELYQKQGINKNGKSDFLNYFKNWFSREKLNLNDPIDKEIYNLK
FT                   KAYKEKSGLDKRYDKITYKYNDLDYWESYWATYPQLKKEQFENKNITRLLTKEEVEKEA
FT                   NRVIDLVGLSARKDSYPSDLSGGMQQRVALARSLVIQPEIILLDEPLSALDAKVRKQLQ
FT                   DELKKLHKNLGITFILVTHDQEEALSLSDKVVVMSNGQIEQVGKPSDIYDSPSSLWVAN
FT                   FIGKTNIFEGHYIAKGEVEFDGIASKTDVIDGFDENEACYIMIRPEDFDVVKKDEGSIN
FT                   ARVESVLYKGLMWDIKCKYNDMIINVEGVNKVNEGDEIGLDWDDIDVHVIKKDCLSNEQ
FT                   AI"
FT   gene            142383..143390
FT                   /locus_tag="UUR10_0118"
FT   CDS_pept        142383..143390
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0118"
FT                   /product="ABC transporter, permease protein"
FT                   /note="identified by match to protein family HMM PF00528"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59834"
FT                   /db_xref="GOA:B5ZAU0"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZAU0"
FT                   /protein_id="ACI59834.1"
FT                   /translation="MNKQFNFHFQSSKPLNINKTNEITISSKETKTIKKNNRKHYKQTF
FT                   FDKLKMNKALSLAIPYFLVTIFLLVIPLVSIIVKSFVNNTDSTGATTNIVDNWSVITPT
FT                   IGMKIFNSLWIAAVATIFCLIIGYPFAYFLSIGKSKFLKAIAIALITSPIWMSMLVKLI
FT                   GIKTFFDVVNGEINSTHGHIFTILGLVYINLPLMILPIYTSLSTMPKNLVNASYDLGRG
FT                   FFYTFFHIVIPYTKNALISGVWIVYLAAFTSVVVSNFLNNDNAGGLIGGEIFSQGQDGI
FT                   SSGVQLSRSSTITLVISLILLGIYLIIVVVPKIVQLIFYKRKNSKKGVKNDEQY"
FT   gene            143377..144231
FT                   /locus_tag="UUR10_0119"
FT   CDS_pept        143377..144231
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0119"
FT                   /product="ABC transporter, permease protein"
FT                   /note="identified by match to protein family HMM PF00528"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60123"
FT                   /db_xref="GOA:B5ZAU1"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZAU1"
FT                   /protein_id="ACI60123.1"
FT                   /translation="MNNINWLSWLRNSYIWIVLAIIYIPLIIIVLLSFTTPSIKGNITS
FT                   AFDWNDGLNYLTLTTNQFTDALVNTIIVSIIAVPISTIIATMTCFGVWHAKAFYKKLMT
FT                   ASAQTNMMIPDVISGISLALLFAATFIPIGFSFGFSTIILAHISYCTPYAIMIIYPRML
FT                   KMKKNLILASYDLGYTKIATFFKIILPYLLPSIISATIIVFAMSFDDFIITKLVGGKVN
FT                   TIGTEMYSMAKGIKAWAVCFGALMVLLTILIAALISANKIIKLKLINKQTNTRKLKIWN
FT                   KQV"
FT   gene            144235..146271
FT                   /locus_tag="UUR10_0120"
FT   CDS_pept        144235..146271
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0120"
FT                   /product="putative lipoprotein"
FT                   /note="identified by match to protein family HMM PF02030"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59908"
FT                   /db_xref="GOA:B5ZAU2"
FT                   /db_xref="InterPro:IPR000044"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZAU2"
FT                   /protein_id="ACI59908.1"
FT                   /translation="MKINKKLAKIFAGATSLLVFIPIITACSQKSKLVVGNFDSYMDPD
FT                   VANEQAKRFRKNNLSYSFYDNNEILGSLIKSKILDVQVASAYEVAKLAKNKLIKKINWS
FT                   KFDLKDENNQTITSIDGLQKIFTKEVWAISNAYSSYLGDIDNDGKNDQLLEYMIPYFYQ
FT                   DLIFAYRGKKIPSLDDSKKDVYWSDIFKELTRKDGTPNRFLYEQEADLGVGADEKTPIS
FT                   IGKNKTKIVAIDDARTIYDLAKIMELEGDNKNEVIKAINHEIVGINNSINRILKILNDP
FT                   NIDQEIKEEDAKELKRLQKQLADKQKELKTNVFLPDSSSVRYIENKLNNISNMFKNTHP
FT                   NSMHLKANSNDVLNDLAMASVAGAIAYSGDIAFAANGGEYTTEADSKYANMKPTSENFH
FT                   VVRPKNTMSVLDGFTINSTITNENEQAAYEYLHELCFAGLNKKNSDGESKILDYGLNIH
FT                   RNKTPKAIADYENSTEDQNEVGNVLEDSGYLYTPMRNFDYVQYSPTIKPIANYVLEPNE
FT                   GLYGKTGFESDLLQEKMIEIFEIDPKYKTKKERQRKHKYIALLNEIINYIYNTYQENNR
FT                   FVFKDTIINDLYQQKPIKDLIYEYLKNLDLKVDQRNFVHYLLLKFEAIFANINEEVQER
FT                   AALNQILRKIFDVQLNTDTLEFPTNDLSISNLKLAYLAFREKI"
FT   gene            146390..146992
FT                   /locus_tag="UUR10_0121"
FT   CDS_pept        146390..146992
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0121"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59810"
FT                   /db_xref="InterPro:IPR020941"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZAU3"
FT                   /protein_id="ACI59810.1"
FT                   /translation="MNYKYTAKEKQIIYNYILREYGQVDHIIFLSDEHIRVPIEYDILV
FT                   IKKDDLQILMTFGLGAFKSHNHIEKTQERAEIFLELPIDWDFSKYENMWPVHFLINIVK
FT                   YSYSNHLTLKWLQTFVNPSYFNKSNKIAGFLDLSWYSENSLECKINDDFFVSFYQILII
FT                   DDEELFYAKTNGIRALSKFFDDGKSRIVDLNRKSFVK"
FT   gene            147057..148187
FT                   /locus_tag="UUR10_0122"
FT   CDS_pept        147057..148187
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0122"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60292"
FT                   /db_xref="GOA:B5ZAU4"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZAU4"
FT                   /protein_id="ACI60292.1"
FT                   /translation="MRTYDSISEISEDKDLVFVDIEATDNKGDQRIIQFSGYRLNIKKN
FT                   KIRRFNKKFNPDQEINSRIKTLLNFNKNFNNIEQMPKLDQKWAKEIYNFVKNAIVVTFT
FT                   DFDIKKMHQLFSHYEFDLEKIIYFDIYKFFEKKLHTNAVPSLFSLGILSGIKIDFFKLH
FT                   NALYDAFILKEIFLHIRYKTNEELYEMYSYYQFLPKIINSSYFITNEQEKNKGIIKKEV
FT                   KYVMYIKEFDFTDKFDLNFVVYKKNHHFYSKPIYDSSLELQTISSAIDEHSSPKVQLAN
FT                   TFFEYLSKSAVFSMKKLGIKQSEKFLKFYKTHTNKRKIIKVLSLNLKKEIKPENFVIKA
FT                   QVICETLSKNEAIHPFVQEYLKAFSDISSQENENNN"
FT   gene            148209..149156
FT                   /locus_tag="UUR10_0123"
FT   CDS_pept        148209..149156
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0123"
FT                   /product="pseudouridine synthase"
FT                   /note="identified by match to protein family HMM PF00849;
FT                   match to protein family HMM PF01479"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60287"
FT                   /db_xref="GOA:B5ZAU5"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR006224"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZAU5"
FT                   /protein_id="ACI60287.1"
FT                   /translation="MNLKEIKIKINDANQRLDRFLLKNFPNLSRIAIYKLIRTKDIKVN
FT                   HKKAEHNYLLKENDVVSIYAKENFLEKKIDLDFAKAKDELEIIYEDSNILVVHKPIGLI
FT                   VHEDDNHKNDTLQNRIKKYLVKKNEYHPFDESAFVPSLCHRLDLNTSGLIVAAKTANAL
FT                   RIIAEMFKNNDVNRVYKCLTYNRLPKNNDIVYNYMYKANDNTMIVQNFKTKVNKTAITK
FT                   YQYIGNYKKYFVYDIELLTGRTHQIRAVLNFLHAPIVGEQKYITKDIDKNQNYEYQCLV
FT                   SYKIKFINVRKYQCEELNYLENKEFKLDRVWFLK"
FT   gene            149403..150929
FT                   /gene="rrs"
FT                   /locus_tag="UUR10_0124"
FT   rRNA            149403..150929
FT                   /gene="rrs"
FT                   /locus_tag="UUR10_0124"
FT                   /product="16S ribosomal RNA"
FT   gene            151224..154125
FT                   /gene="rrl"
FT                   /locus_tag="UUR10_0125"
FT   rRNA            151224..154125
FT                   /gene="rrl"
FT                   /locus_tag="UUR10_0125"
FT                   /product="23S ribosomal RNA"
FT   gene            154194..154297
FT                   /gene="rrf"
FT                   /locus_tag="UUR10_0126"
FT   rRNA            154194..154297
FT                   /gene="rrf"
FT                   /locus_tag="UUR10_0126"
FT                   /product="5S ribosomal RNA"
FT   gene            154442..154912
FT                   /gene="folA"
FT                   /locus_tag="UUR10_0127"
FT   CDS_pept        154442..154912
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="folA"
FT                   /locus_tag="UUR10_0127"
FT                   /product="dihydrofolate reductase"
FT                   /EC_number="1.5.1.3"
FT                   /note="identified by match to protein family HMM PF00186"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60192"
FT                   /db_xref="GOA:B5ZAU6"
FT                   /db_xref="InterPro:IPR001796"
FT                   /db_xref="InterPro:IPR012259"
FT                   /db_xref="InterPro:IPR024072"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZAU6"
FT                   /protein_id="ACI60192.1"
FT                   /translation="MLKLIWCQTLNGGISKNNKLPWYVKEELEHFYKTTKNHKIVMGKS
FT                   TFDSLEQKPLSNRTNIIFSSIMQTPEDQSYFVTNDFQQLLNDAKKEDIFIIGGKELFDI
FT                   FLNHADALIVSVLNDYYDCNLYMKVDYNNFNLDKKDVYDNFVVNYYSSKKDK"
FT   gene            154921..155598
FT                   /locus_tag="UUR10_0128"
FT   CDS_pept        154921..155598
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0128"
FT                   /product="phosphoglycolate phosphatase"
FT                   /note="identified by match to protein family HMM PF00702;
FT                   match to protein family HMM TIGR01549"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60109"
FT                   /db_xref="GOA:B5ZAU7"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZAU7"
FT                   /protein_id="ACI60109.1"
FT                   /translation="MTKKLIVFDFDGTIMHTHTTMSLSIIGVLEFYNHHVPSLKEMNDL
FT                   LGNLSMANIFRKYAKHDLLDIEIETMIAKYYEIYESSLFMIHSYFFDGILELIKKIRSI
FT                   DNVKLAILSNKKSTLLTTMVDYYNLHHYFDYIYGAEDVDQMKPHPSGLLRLMNNCNVDH
FT                   KNTLLIGDSLADLKAALNVKCHFLLVNWEPEYQKHKETIANLKPLVVQTIDELETEISQ
FT                   FLR"
FT   gene            155657..155730
FT                   /locus_tag="UUR10_0129"
FT   tRNA            155657..155730
FT                   /locus_tag="UUR10_0129"
FT                   /product="tRNA-Gly"
FT   gene            complement(155792..156415)
FT                   /gene="upp"
FT                   /locus_tag="UUR10_0130"
FT   CDS_pept        complement(155792..156415)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="upp"
FT                   /locus_tag="UUR10_0130"
FT                   /product="uracil phosphoribosyltransferase"
FT                   /EC_number="2.4.2.9"
FT                   /note="identified by match to protein family HMM PF00156;
FT                   match to protein family HMM TIGR01091"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60045"
FT                   /db_xref="GOA:B5ZAU8"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005765"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR034332"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5ZAU8"
FT                   /protein_id="ACI60045.1"
FT                   /translation="MHKIINHPLIKDKLTRMRKVSTVSTVFRTNLEELTQLMVYEATKD
FT                   LELNEIEIETPVVKNAKGYKLKNKICLIPILRAGIGMVDGVKSLIPTATIGHIGLYRNE
FT                   ETLKPVEYFKKFPKNISESDVIILDPMLATGGSVVEAVNIIKKYNPKSIKFVCIVAAPE
FT                   GLEYVQKIHPDVDVYIAALDDKLNENGYITPGLGDAGDRIFGTK"
FT   gene            complement(156536..156640)
FT                   /gene="srpB"
FT                   /locus_tag="UUR10_0131"
FT   ncRNA           complement(156536..156640)
FT                   /gene="srpB"
FT                   /locus_tag="UUR10_0131"
FT                   /product="Bacterial signal recognition particle RNA"
FT                   /ncRNA_class="SRP_RNA"
FT   gene            complement(156662..157909)
FT                   /gene="tyrS"
FT                   /locus_tag="UUR10_0132"
FT   CDS_pept        complement(156662..157909)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="tyrS"
FT                   /locus_tag="UUR10_0132"
FT                   /product="tyrosyl-tRNA synthetase"
FT                   /EC_number="6.1.1.1"
FT                   /note="identified by match to protein family HMM PF00579;
FT                   match to protein family HMM PF01479; match to protein
FT                   family HMM TIGR00234"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59824"
FT                   /db_xref="GOA:B5ZAU9"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002305"
FT                   /db_xref="InterPro:IPR002307"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR024088"
FT                   /db_xref="InterPro:IPR024107"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5ZAU9"
FT                   /protein_id="ACI59824.1"
FT                   /translation="MHNLIKDLKARNLINNITNEEKLKKALAENKGIYVGFDPSADSLH
FT                   LGNYIMIMLLKRFRLHNIKTFALVGGATGMIGDPSGKSAERNLLDKTILEHNITKIKYQ
FT                   LEKFTNSQVINNYDFYKNMTFLDFLRDVGKLININYLLEKEIISSRLDVGISYTEFSYN
FT                   LLQGYDFLQLYKNDNIAIQAGGSDQWGNITTGIEIIRKSLGDDNIACGLTINLLTNSEG
FT                   KKFGKSEKGAIYLDENKSSVYEMYQFLINQTDADVEKLLNFLTLIDVDEINKIMQAHKE
FT                   NPALRIAQKALAQAVVVDVHGQQKYEQALHISQVLFNGNINELNQEEFNIAIKSLPTTK
FT                   LDKDEIKIIDLLNLANISSSNRVARDFLSTGSILVNDIKVNDENFLVKKQDAINQEFSI
FT                   IKKGKRNYFLIVWNKD"
FT   gene            158041..158943
FT                   /locus_tag="UUR10_0133"
FT   CDS_pept        158041..158943
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0133"
FT                   /product="ABC Transporter"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59721"
FT                   /db_xref="GOA:B5ZAV0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZAV0"
FT                   /protein_id="ACI59721.1"
FT                   /translation="MKIKKEKDNDINSVSNENENKKINIKDLSKDERKELKKRIKEVEK
FT                   LNKNHKGDIDMPSRDPNNIIELRDVKKIFTNGYLINETLKGVNLDIRKGEFVIILGPSG
FT                   SGKTTLMNIMSGLDRATDGDVRVCGKQLINMSQNKLTDFRKEYIGFVFQQYGLLPTLSV
FT                   EENVEIGADLQVDKKRRIKPQDALKAVGMLEYAKKFPHELSGGQQQRVSIARALAKNPI
FT                   ILFGDEPTGAVDETMSKIILKEFVKVNQELKTTVIIVTHNPIFAELGTLVIKVKDGNIN
FT                   ELIRNDHPKSVDELKWDEQ"
FT   gene            158960..161482
FT                   /gene="secA"
FT                   /locus_tag="UUR10_0134"
FT   CDS_pept        158960..161482
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="secA"
FT                   /locus_tag="UUR10_0134"
FT                   /product="preprotein translocase, SecA subunit"
FT                   /note="identified by match to protein family HMM PF00271;
FT                   match to protein family HMM PF01043; match to protein
FT                   family HMM PF07516; match to protein family HMM PF07517;
FT                   match to protein family HMM TIGR00963"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60284"
FT                   /db_xref="GOA:B5ZAV1"
FT                   /db_xref="InterPro:IPR000185"
FT                   /db_xref="InterPro:IPR011115"
FT                   /db_xref="InterPro:IPR011116"
FT                   /db_xref="InterPro:IPR011130"
FT                   /db_xref="InterPro:IPR014018"
FT                   /db_xref="InterPro:IPR020937"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036266"
FT                   /db_xref="InterPro:IPR036670"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZAV1"
FT                   /protein_id="ACI60284.1"
FT                   /translation="MNLISKISPQNRILNHARLIAEEVLKKEDEYTHFSDQELINKSDD
FT                   IIEYLANNNPLDDRLVESLCIIREVIYRVHNKRAFKVQLIGAIIVYFGDFAEMMTGEGK
FT                   TLTLVLVAYLNALYKKGVHMVTVNEYLVKVGAEFATPALNFLNMSVGQITANMNEYEKR
FT                   NNYDCDITYTTNSELGFDYLRDNMVTNYNSKVQRGLWFAIVDEGDSVLIDEARTPLIIS
FT                   GEPQEEIGNYVKADRFVKTLYPQDFTLDPESQSVALTESGVEKAQKFFNTKNYYNFENS
FT                   DIIHKVTNALRANFTFFNGREYIVKKDDEGEDVIALVDQSTGRIMEGRSYSAGLQQAIQ
FT                   AKEQIKIEPENLTVATITYQSLFRLYKKLAAVSGTAITEVEEFLNIYNMVVVTIPTNKP
FT                   IRRIDHPDYVFDNKRTKWKYVIADVIRRHENGQPILIGTASVEDSEILHQLLERVNIPH
FT                   EVLNAKNHAREAEIVARAGEYKAVTIATNMAGRGTDIKLSPESLEAGGLCVIGTERSDS
FT                   RRIDNQLRGRAGRQGDIGESRFFISMEDTLFSRFATDNLAKADDKLSEDVISTKFFTRL
FT                   LNNTQKKVESLNYDTRKNLIDYDHVLSNQRELIYKQRDKILVSSDNKDILYRMLDSVID
FT                   DIIYQSHNEPNEDIIDVKKLIDLATQNIFYDNYLNHDEYYGLDLDEIKTKLKNDCISFF
FT                   EQKEQLMTPGIFNQILSEIMISNIDEEWTKHLDVTSKIREGVNLRAYEQKAPLNIYVED
FT                   SDKLFEKLKHDVAWKTVCSIGKINYVHQEYDKVNNEFIINDNEIIDNDNVIDFENTDHS
FT                   LISEQEIEDSLVNIDELNDQNTKNENND"
FT   gene            161485..163485
FT                   /gene="uvrB"
FT                   /locus_tag="UUR10_0135"
FT   CDS_pept        161485..163485
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="uvrB"
FT                   /locus_tag="UUR10_0135"
FT                   /product="excinuclease ABC, B subunit"
FT                   /note="identified by match to protein family HMM PF00271;
FT                   match to protein family HMM PF02151; match to protein
FT                   family HMM TIGR00631"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59890"
FT                   /db_xref="GOA:B5ZAV2"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR004807"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR024759"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036876"
FT                   /db_xref="InterPro:IPR041471"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZAV2"
FT                   /protein_id="ACI59890.1"
FT                   /translation="MDDFKKLELVSSYKPAGDQQKAIDEMVNNINQGINRQVLLGATGT
FT                   GKTFSVANVIAKTQLKTLVLAHNKTLAAQLFAELKEMFPHNKVEYFVSYFDYYQPEAYK
FT                   PITDTYIEKDSVTNAEIEMMRLSTINSLATRNDVIVVASVACIYASVSPVEFTKKNLYL
FT                   HVGESIDFEQIKYKLVQLGYERKDHDLLPGTFRIRGDLIEIMPGYSDKFKIRVSMFGNE
FT                   VEAIDLCDPITNNVISKEQRFILRSASEYIFDDSRLSIAIDNIKKELDERVKFFLKNNQ
FT                   LIEAQRIEQRTKQDIEGIVEFGFCSGVENYYRHLEHREPFQTPWTIFDFFGYNNQDWLL
FT                   IVDESHISLPQVKGMYNTDRSRKQTLVEYGFRLPSALDNRPLNYDEFNEKISKVIYVSA
FT                   TPNDEEIALSNNHIVSQIVRPTGLLDPIVEIRKTEHQIDDLINELMLLKNNNQRAFITV
FT                   MTIRMAEDLTNYLNNTKVKAAYLHNELKTLERSSIINKLRKGIYDCIVGINLLREGLDV
FT                   PEVARVFIFDADKPGFFRSDKSLIQIIGRAARNADGKVIMYADTITQAMQVAIDETKRR
FT                   REIQLDFNLKHNIVPKTIIKPIHEDLSGHDYKQNAELYAAKASKNEYDQKIKELKKKME
FT                   EAAKKREYEIAAQYRDMIVELEAIKQSIKSK"
FT   gene            163579..165600
FT                   /gene="ligA"
FT                   /locus_tag="UUR10_0136"
FT   CDS_pept        163579..165600
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="ligA"
FT                   /locus_tag="UUR10_0136"
FT                   /product="DNA ligase, NAD-dependent"
FT                   /EC_number="6.5.1.2"
FT                   /note="identified by match to protein family HMM PF00533;
FT                   match to protein family HMM PF01653; match to protein
FT                   family HMM PF03119; match to protein family HMM PF03120;
FT                   match to protein family HMM TIGR00575"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59935"
FT                   /db_xref="GOA:B5ZAV3"
FT                   /db_xref="InterPro:IPR001357"
FT                   /db_xref="InterPro:IPR001679"
FT                   /db_xref="InterPro:IPR004149"
FT                   /db_xref="InterPro:IPR004150"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013839"
FT                   /db_xref="InterPro:IPR013840"
FT                   /db_xref="InterPro:IPR036420"
FT                   /db_xref="InterPro:IPR041663"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5ZAV3"
FT                   /protein_id="ACI59935.1"
FT                   /translation="MDRIKAKINELKQKLDQWNYEYYVLDDPSVPDHVYDQAMRELIEL
FT                   ENAYPQFKTNNSPSVRVGGFVSEKFNKVKHKRPMLSLSNAFDANDLRKFDQDNQNASVD
FT                   LKGYVVEPKIDGLSISIIYKNAKLHQAITRGDGVNGEDVTSNILTIKDIPHYIDQKYKD
FT                   YEIEVRGEVYMAFHDFYEMNDNLEESDKKFANPRNAAAGTLRSLDNSIVAERKLSAFMY
FT                   YLVNAQELGIKTHYESIQFLKDNKFKVSDLIVKVDTIDEVINQIDRYTKVRNDLSYMID
FT                   GIVIKINNLEVYDEIGYTSKFPKWAIAYKFPANVVSSQLLEIINDVGRTGKISYVAKIK
FT                   PILLDGSIVEYATLHNFDFIKEKDIRINDEIKIYKAGDVIPYVDGVDLSKRLANSVPYE
FT                   SITNCPSCQSVLVRENDEVDQRCLNIYGCKKINIEKIVYFVSRNCMNIEGMSDAIINKF
FT                   YDANLIKNVADLYYLQKHKEFILASDFKIKDKSFSNLINSINNSKTRSLEFLLTAFGIR
FT                   HVGPNLAKKLAKQFKTMTTLMHANFGELTNVDACGEKAALSLINWFNDDHNVSLVNQLQ
FT                   QVGVNMEYIDDFIYDDNINIIDEYKNKTFVITGSFSISRDEIKTILEKYYHAKVKNSVS
FT                   KKTDYVLAGIEAGTKLEKAKLLGVKIIENEFWKKDNNF"
FT   gene            165837..166532
FT                   /locus_tag="UUR10_0137"
FT   CDS_pept        165837..166532
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0137"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60068"
FT                   /db_xref="GOA:B5ZAV4"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZAV4"
FT                   /protein_id="ACI60068.1"
FT                   /translation="MKINITKGKTIFKRNYKKKHSIYYSTSKIIKDYTLSAVMLGLGIL
FT                   IAYLSHFIRFNFLAFDFSLFTLVYLIYKVKYRFVYLVTILLSLANLLHGSPSWIGTMVL
FT                   SLNNLFFVSMVILFKKLFIPKRPKFYLNLWVLVLSSFLTTVFNVIMNGILYTPLYWYTF
FT                   KITPTLNFLEVQKIYEKHPTLFLLNIKSYWLGIIALYTSFNLIKNIIISFISLTILKIF
FT                   ADKKTIITY"
FT   gene            166546..167856
FT                   /gene="cysS"
FT                   /locus_tag="UUR10_0138"
FT   CDS_pept        166546..167856
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="cysS"
FT                   /locus_tag="UUR10_0138"
FT                   /product="cysteinyl-tRNA synthetase"
FT                   /EC_number="6.1.1.16"
FT                   /note="identified by match to protein family HMM PF01406;
FT                   match to protein family HMM PF09334; match to protein
FT                   family HMM TIGR00435"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60053"
FT                   /db_xref="GOA:B5ZAV5"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015803"
FT                   /db_xref="InterPro:IPR024909"
FT                   /db_xref="InterPro:IPR032678"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZAV5"
FT                   /protein_id="ACI60053.1"
FT                   /translation="MKLYDSYSNQLVEINDELISIYNCGPTVYNHIHIGNARPLITMDV
FT                   LYRFLKKHNIKTKYVLNITDIDDKIINYALANNLKELEVSEYYFNEYLKIKKALNTLEM
FT                   INPKVSTHMDKIIDYIQKLIDKQAGYFIGDDVYFDTKKALNYGQLSKRDLENDIVGMRI
FT                   ESAANKHNPNDFILWKKTNKGIMWNTPWGIGRPGWHSECSCLINTYIGEQVSIHGGGID
FT                   LKFPHHENENAQNQVLYNKNLAKVWMHFGLVNINNEKMSKSLNNFILVKDLLAEYDYQV
FT                   VRWFFYQADYKQPIKFSHEIMKQNEKEILKIKNAIYNAKNYLYFNHQLKSLTQIDHFGF
FT                   FDERINDDLDFVGIVDLIHISVKKINILIKKNKDMNELKLNLTQLLYMLDILGINFVDL
FT                   HNDENLALLNTWKNYVDKKDYVKADELRKQLINIGIL"
FT   gene            167858..168577
FT                   /locus_tag="UUR10_0139"
FT   CDS_pept        167858..168577
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0139"
FT                   /product="RNA methyltransferase, TrmH family, group 3"
FT                   /note="identified by match to protein family HMM PF00588;
FT                   match to protein family HMM PF08032; match to protein
FT                   family HMM TIGR00186"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60296"
FT                   /db_xref="GOA:B5ZAV6"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR004441"
FT                   /db_xref="InterPro:IPR013123"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZAV6"
FT                   /protein_id="ACI60296.1"
FT                   /translation="MNYNFGKKALLDAIGNKQSISKVYLLSKNYELINLINKNKITYEI
FT                   VNEAWFKQFDHSLNHQNIAFKLVKKNFQKTGLESFLKLIKDKKNALVLILDEIEDPRNF
FT                   GAIIRTANAFGVDAIIYKKHHQASINDLVIKTSMGAINYIYMIEVNNLSNTIKNLQDEG
FT                   FWVYATSLLKSQPYEKVDYANKTVFIVGNENKGVSPLILKNADQSIRIDMFGDVQSLNV
FT                   GVATGIILAHYRTKIKP"
FT   gene            complement(168585..169769)
FT                   /locus_tag="UUR10_0140"
FT   CDS_pept        complement(168585..169769)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0140"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60251"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZAV7"
FT                   /protein_id="ACI60251.1"
FT                   /translation="MKKNKYKLLIKSLVITSFLVTTSSVIVACTNKEKEQHLTKLKNLS
FT                   QHAKQIYNEIKTNKLFKNEAFILNDQINKVLKINEQNNLDVITKNYNDLKKLLDEIQEK
FT                   ISKEKEEEKQQNANLNKVINIKLENLNQIVNHNLLKENKESFFNQIIDFTPVITEIQTI
FT                   INQNQNLLDLKNEELELKLKNLNLFIKELDHKFKNIMDQLFNIEDSYINKFLKFINDQN
FT                   FINDKEYQKRKKFNPQEYLELTKSIESSFNKLKNITVNSDLDQYLNSLNLMLLSLTNEA
FT                   KTFFTKFEDQIKEYFKWIVYGKDDTLTKTFNRIVEEQKRNEFMEQTAKALLTFPTEINQ
FT                   KFKMFVDFFTLKNDKDETEYQKIWKLKHNEVNKVWFGIAECFGSGKCTDKSKPS"
FT   gene            complement(169781..173056)
FT                   /locus_tag="UUR10_0141"
FT   CDS_pept        complement(169781..173056)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0141"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59867"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZAV8"
FT                   /protein_id="ACI59867.1"
FT                   /translation="MQKKILKNLSIGIASTIILGSITISLSNCSHSNKQKTFSSSTITN
FT                   QDTKNLDIVAKNIKFKYDIFENEDEQTIKINKIKIVGDLGETKIIIKKVIIEQKSNIFL
FT                   VQYQLSLHNQTKEYTQKLEINKKQSVIETKYINDQLNSKYQANNDYRPFALKELLTSPQ
FT                   NIKKTSNLSLITMQKNNQEFNNYFSFIQNEHNFKQSPFNQVTLLTKQNQLTDHSTNFKF
FT                   EKIEIDKENQIATVSFSHDSDSQTIQKILNATNKLLLIKNFDWTNPFSKIISYEKFNNN
FT                   QLRFSLKDFPKSLTKFIITHIQYDDVVESLGRDLKNLFLYNQIEEELKLKKLNFYLQEN
FT                   EVYGSAFFDFNEQTLELYKNKIFLFEFTLDENYSEARKNQSLIAKYTPPIQYVRVPFKS
FT                   LWKFKIPHLYNGYLYKLNKISIRDNNSLAPFAFVKIKELNTSTFFAKNITYNDRKIIDL
FT                   YYNNDQLFSTKYQTLKNKNLTLNDLYKLWASDQNNLYLDYSLRNFISLVQYENTYLFYK
FT                   NKTNEGFYDFITKKANFMLVNNNEIKNLHKTTLKDSPDLIFKKDKDNYFQLTKKINKIK
FT                   NLNLINEENLVFNITFGLDSNLIKETNLWKNLMLRSQISLAVPYKILKNKKVIEDAEFV
FT                   LNYGIGNQEYEYELYKKIKQDFRFQISYINDELKIKIISKNNVSVFNNIWEHNSSIDSS
FT                   YFLTKANFNIYYLNNTTVDIMEDNESNNQYTTRIYKNNEQNFLPIKNARDRVISLSLIQ
FT                   DGTWNVLGKVKPNDDNDYRYYLISCAHVLNSTQAFKSINKTGNKDLFESGNSSNGDFDP
FT                   LVPQIIHENETLNDKKNPYYNALEKNGKLEANPNQFQFLNFPEKISIESIINFDHQVKN
FT                   KLSPHVNALGFFNPNASLDFSLITINLKPFFQKYGQLENSTAFNNLTKEQQSVIRHIIN
FT                   FKNLKPLKLSNQTKYFDDNQNVKWYLSTFPRTETINEFNAGKLPRYREYEINKYDKIQE
FT                   NIVTTNNYLSTVGTTKISDQYFDVGSGSSGSVVYDENGDLVGMISFGAHENAKFTAGGM
FT                   IVFDSLISGFFGDKNNFANRTSLIQQIKQLAYLYPEKYEDIYK"
FT   gene            complement(173181..173486)
FT                   /locus_tag="UUR10_0142"
FT   CDS_pept        complement(173181..173486)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0142"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59816"
FT                   /db_xref="GOA:B5ZAV9"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZAV9"
FT                   /protein_id="ACI59816.1"
FT                   /translation="MKIIGSAFLGIVFCILLAFAIIFGIEIDYYHQGDYLKYLNFLDKL
FT                   HQYNKIDNLFEYSNHYESALIGVIVLTIICFLIFITPIIIIAIAKVKKKKVINKNI"
FT   gene            complement(173630..174040)
FT                   /gene="atpC"
FT                   /locus_tag="UUR10_0143"
FT   CDS_pept        complement(173630..174040)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="atpC"
FT                   /locus_tag="UUR10_0143"
FT                   /product="ATP synthase F1, epsilon subunit"
FT                   /EC_number="3.6.3.14"
FT                   /note="identified by match to protein family HMM PF02823;
FT                   match to protein family HMM TIGR01216"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59747"
FT                   /db_xref="GOA:B5ZAW0"
FT                   /db_xref="InterPro:IPR001469"
FT                   /db_xref="InterPro:IPR020546"
FT                   /db_xref="InterPro:IPR036771"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5ZAW0"
FT                   /protein_id="ACI59747.1"
FT                   /translation="MANLTKLKIVTPYAQNLEKDVYSVELKTSEGRIAVLPDHNPLMSI
FT                   IENHVAYIRELPNAPRKPLLLLDGIVYVEEHQVRVFSDYFKFLDEIKIDEINSLLNKLK
FT                   NDLANEEDDKKKLQLKSKIKLNESILIAYKDR"
FT   gene            complement(174040..175434)
FT                   /gene="atpD"
FT                   /locus_tag="UUR10_0144"
FT   CDS_pept        complement(174040..175434)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="atpD"
FT                   /locus_tag="UUR10_0144"
FT                   /product="ATP synthase F1, beta subunit"
FT                   /EC_number="3.6.3.14"
FT                   /note="identified by match to protein family HMM PF00006;
FT                   match to protein family HMM PF00306; match to protein
FT                   family HMM PF02874; match to protein family HMM TIGR01039"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60141"
FT                   /db_xref="GOA:B5ZAW1"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005722"
FT                   /db_xref="InterPro:IPR024034"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036121"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5ZAW1"
FT                   /protein_id="ACI60141.1"
FT                   /translation="MTEVKKGKINQILGPVVDVRFPSEWLPEINTALELNNHGSKLVLE
FT                   VSQLVGDNIARCIAMDTTDGLVRGQEVINTEKPIMMPVGKQVLGRMFNVTGDPIDEQPA
FT                   PTGKRMPIHRPAPSFAEQAEAIEILETGIKVVDLLVPFAKGGKIGLFGGAGVGKTVLMQ
FT                   ELIHNIAKNHGGLSVFAGVGERTREGNDLYYEMAESDVLDKTALVFGQMNEPPGARMRV
FT                   ALSGLTMAEEFRDAFGQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLAFEMGQ
FT                   LQERITSTKKGSITSVQAVYVPADDLTDPAPATTFSHLDAKVVLDRAIASLGLYPAISP
FT                   LQSTSRLLDPLVVGVKHYSVARRVIEILQRFMELQDIIAILGMDELSEEDRQLVMRARK
FT                   VRNYLSQPSHVAEKFSGQPGLSVKLEDTIEGFRKILDGECDDIHEQHFLYVGKIDDVFE
FT                   KVAKSK"
FT   gene            complement(175458..176318)
FT                   /gene="atpG"
FT                   /locus_tag="UUR10_0145"
FT   CDS_pept        complement(175458..176318)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="atpG"
FT                   /locus_tag="UUR10_0145"
FT                   /product="ATP synthase F1, gamma subunit"
FT                   /EC_number="3.6.3.14"
FT                   /note="identified by match to protein family HMM PF00231;
FT                   match to protein family HMM TIGR01146"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60000"
FT                   /db_xref="GOA:B5ZAW2"
FT                   /db_xref="InterPro:IPR000131"
FT                   /db_xref="InterPro:IPR035968"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5ZAW2"
FT                   /protein_id="ACI60000.1"
FT                   /translation="MSLDAIKRKISSVQTTAKITNAMKLVATAKLKRQRDRLAAIKEYC
FT                   HDYYDVIGLLLSVVNDIEFLKIPNAKNRTLYITINSTMGLAGSYNYNVNKLVSKIINED
FT                   DITFTIGKKGHDFMRLSNRLHQVNTYLNLNDNDLTFDMSLQIAREALELYSNGEVNKIC
FT                   IIYTKFINAITFEVNNIDVLPFDKTVLTKDNLAETIELAKDNIIFQPNKVELVKKILPT
FT                   YIATVLYGSLIESKISENASRRNAMDAATKNAKALAEDYKLIYNTLRQGKITREITEIV
FT                   AGSDD"
FT   gene            complement(176320..177111)
FT                   /locus_tag="UUR10_0146"
FT   CDS_pept        complement(176320..177111)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0146"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59795"
FT                   /db_xref="GOA:B5ZAW3"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZAW3"
FT                   /protein_id="ACI59795.1"
FT                   /translation="MNKSFEEFSKLPKVKQIFTPWFIVALVVFIVGLVIAFTMVGLLNE
FT                   GFENARALVNDQGQIVGKVADVNGNDHSLMSWLGYDQHANYQELYKIINNRLIDGQTME
FT                   SLMNNTDKKVDPKLYEALHYHAHSKLINHNGTWGFTTKVLSDWENSWFYKYNQLFSQLA
FT                   DSKDSILAAQGAKSLKKLSTIIQYQNPNYIVYNWVFIVFMMPQMITFVIIVVKLATVLS
FT                   PKKSAEEKQAYKLAKLEAKKQKKAKNLNNSLQQTNLNLEAN"
FT   gene            complement(177126..179519)
FT                   /gene="atpA"
FT                   /locus_tag="UUR10_0147"
FT   CDS_pept        complement(177126..179519)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="atpA"
FT                   /locus_tag="UUR10_0147"
FT                   /product="ATP synthase F1, alpha subunit"
FT                   /EC_number="3.6.3.14"
FT                   /note="identified by match to protein family HMM PF00006;
FT                   match to protein family HMM PF00306; match to protein
FT                   family HMM PF02874; match to protein family HMM PF09378;
FT                   match to protein family HMM TIGR00962"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59847"
FT                   /db_xref="GOA:B5ZAW4"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR000793"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005294"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR023366"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033732"
FT                   /db_xref="InterPro:IPR036121"
FT                   /db_xref="InterPro:IPR038376"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZAW4"
FT                   /protein_id="ACI59847.1"
FT                   /translation="MTDNKNHSLISDIKSQIKKFSEKALTLEVGNVISLGDGIVLVDGL
FT                   DNVMLNEIVRFENGVEGMALNLEEDAVGVVLLGDYSNIKEGDRVYRTKKIVEVPVGDIM
FT                   LGRVVDALGKAVDNKGNIVANKFSVIEKIAPGVMDRKSVHQPLETGILSIDAMFPIGKG
FT                   QRELIIGDRQTGKTTIAIDAIINQKGRNVNCVYVAIGQKNSTIANVVRDLEAHGAMEYT
FT                   TVVTANASELPALQYIAPFTGVTIAEEWMHQGKDVLIVYDDLSKHAIAYRTLSLLLRRP
FT                   PGREAYPGDVFYLHSRLLERACKLKDELGAGSITALPIIETQAGDISAYIPTNVISITD
FT                   GQIFMMTSLFNAGQRPAIDAGQSVSRVGSAAQIKSVKQTGASLKLELANYRELEAFSQF
FT                   GSDLDDETKRILKLGKAVMAVIKQEPNKPYNQTDEAIILFTVKEKLIPQVPVERIQDFK
FT                   EYLLNYFKGTKLRADLEEKKAFDKENTPAFKCAIQKAINNFLNNSQDFKPCDELEQTAY
FT                   DKFFNENEPIVVVNENEFFDEQINSLPTFESIHPVQIEEKVQELAEPREVFEVNKIEKE
FT                   HLFEEVEPEKIICEHHQFEITEDQEEVDGQEVLEDENHEYAIYEVVEQNDTIENCKEAN
FT                   DEAEIQVPVAEVVQDEEILNERENRNWVFSDSAVSEVEKQTIMISISPNESEQLFDNGR
FT                   SVVFFKVAPKYPVEKVLVYVTSPIQKVIGEFDLLKIDVNSVNSSWNKYRSSSVISSRKE
FT                   YLEYFSSHKEAHALLASKVYKYRRPKDLASFNMKKGPSGFTYLK"
FT   gene            complement(179522..179821)
FT                   /locus_tag="UUR10_0148"
FT   CDS_pept        complement(179522..179821)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0148"
FT                   /product="ATP synthase delta subunit domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59748"
FT                   /db_xref="GOA:B5ZAW5"
FT                   /db_xref="InterPro:IPR000711"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZAW5"
FT                   /protein_id="ACI59748.1"
FT                   /translation="MQSNTKLVKYSKIIANRLKAYSNQTRFIEIKTAFELNNEQKQRIK
FT                   KTIINRFGDERPIKFIVDPSLIGGVSLKINLEIIDSSLKTKLNQIINIKEKEGA"
FT   gene            complement(179831..180370)
FT                   /gene="atpH"
FT                   /locus_tag="UUR10_0149"
FT   CDS_pept        complement(179831..180370)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="atpH"
FT                   /locus_tag="UUR10_0149"
FT                   /product="ATP synthase F1, delta subunit"
FT                   /EC_number="3.6.3.14"
FT                   /note="identified by match to protein family HMM PF00213;
FT                   match to protein family HMM TIGR01145"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59949"
FT                   /db_xref="GOA:B5ZAW6"
FT                   /db_xref="InterPro:IPR000711"
FT                   /db_xref="InterPro:IPR026015"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5ZAW6"
FT                   /protein_id="ACI59949.1"
FT                   /translation="MKSSLKPVEKYAYSIFEIAKEEKKLDLYKHNLETINSIIEEVPAF
FT                   FEAVGDPARDRNERKQIVIKNLEGEIDIYLISLIDLLIDVKSIKLLKKIVLKALDFVNE
FT                   ALSVKKVLITTAYELTKNQIDRLVQSLKKKYACEKIEPIVVVDKSIIGGLSINFESQVL
FT                   DNSLKTKLFNVVKKTN"
FT   gene            complement(180374..180766)
FT                   /locus_tag="UUR10_0150"
FT   CDS_pept        complement(180374..180766)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0150"
FT                   /product="ATP synthase F0, B subunit"
FT                   /note="identified by match to protein family HMM PF00430"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60230"
FT                   /db_xref="GOA:B5ZAW7"
FT                   /db_xref="InterPro:IPR002146"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZAW7"
FT                   /protein_id="ACI60230.1"
FT                   /translation="MLDKRREYIAKEITDAENAKQEALQYLENAKSEHLAAQAETAEII
FT                   AKAKSESLTLRELLEKEAREAADKIISSAKISIANERRENLERLQTEAREAAYIAAEAL
FT                   MKKELSREDNDKLVDQFIKELETNEK"
FT   gene            180741..181007
FT                   /locus_tag="UUR10_0151"
FT   CDS_pept        180741..181007
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0151"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59764"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZAW8"
FT                   /protein_id="ACI59764.1"
FT                   /translation="MYSRLLSNILFVGFHTNHNTNEKTTHIAITWAINTHTFGKSVLMI
FT                   SAGFNSGISPVHEANIGMNITDKERTDSVATKCFLFNFITLLP"
FT   gene            complement(181059..181388)
FT                   /locus_tag="UUR10_0152"
FT   CDS_pept        complement(181059..181388)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0152"
FT                   /product="ATP synthase, C subunit"
FT                   /EC_number="3.6.3.14"
FT                   /note="identified by match to protein family HMM PF00137"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60063"
FT                   /db_xref="GOA:B5ZAW9"
FT                   /db_xref="InterPro:IPR000454"
FT                   /db_xref="InterPro:IPR002379"
FT                   /db_xref="InterPro:IPR020537"
FT                   /db_xref="InterPro:IPR035921"
FT                   /db_xref="InterPro:IPR038662"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5ZAW9"
FT                   /protein_id="ACI60063.1"
FT                   /translation="MSSFIDITNVISSHVEANLPAVSAENVQSLANGAGIAYLGKYIGT
FT                   GITMLAAGAVGLMQGFSTANAVQAVARNPEAQPKILSTMIVGLALAEAVAIYALIVSIL
FT                   IIFVA"
FT   gene            complement(181451..182278)
FT                   /gene="atpB"
FT                   /locus_tag="UUR10_0153"
FT   CDS_pept        complement(181451..182278)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="atpB"
FT                   /locus_tag="UUR10_0153"
FT                   /product="ATP synthase F0, A subunit"
FT                   /EC_number="3.6.3.14"
FT                   /note="identified by match to protein family HMM PF00119;
FT                   match to protein family HMM TIGR01131"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60249"
FT                   /db_xref="GOA:B5ZAX0"
FT                   /db_xref="InterPro:IPR000568"
FT                   /db_xref="InterPro:IPR023011"
FT                   /db_xref="InterPro:IPR035908"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZAX0"
FT                   /protein_id="ACI60249.1"
FT                   /translation="MENYNPLDIMIALPHIAAIIIVTLIIATISLIYFSMIRKLTVHDV
FT                   PNRFVIIIGMIVDYFRGLVVDTMGAKHVKLAPYVLFTFCYIFTANLVSLFGFKEATTAS
FT                   SVPLAMALATVVGGQIVALKYQKASFFLKFTFKIKGFPIMVNPLEIVSKLTPIISLTFR
FT                   LWGNISAAAILLNITYWAFAGFTNVVPWVGVSLIAAVIILPILIGYFTCFAGTIQAFVF
FT                   TLLTSINWGLEIKEGEEHYAHLAHKKAEKLAAKKLAELDAQNQAQNNEVQVVL"
FT   gene            complement(182319..182744)
FT                   /locus_tag="UUR10_0154"
FT   CDS_pept        complement(182319..182744)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0154"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59916"
FT                   /db_xref="GOA:B5ZAX1"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZAX1"
FT                   /protein_id="ACI59916.1"
FT                   /translation="MVDGYLIIFLPFLSISFMVFVFLGILLEKGWSFFYTYLLVIPFGF
FT                   GITLLRIFIISKLLNKRLKMNNLGINPKKYRRLPANFFAFGTIYILFNFLILVPLVIGN
FT                   LVNLYQPIFEVISLFILTFFMFFIQMGMQIYLGAKKR"
FT   gene            182980..183690
FT                   /locus_tag="UUR10_0155"
FT   CDS_pept        182980..183690
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0155"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60276"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZAX2"
FT                   /protein_id="ACI60276.1"
FT                   /translation="MNYQIFIHLLENKQKNLKSSITLPIILEFKDDIFKILPSILEKYK
FT                   ETKIINNTINNIVLKINNKTILISKSITNEPYEYNIVNVNKKNDIYSEDNNLVLFNLVN
FT                   YIIEKIQGLIKYVNFWTIQMSAINWVYFVTYNFNKSYLTDYNWKKYVFKIKEDETKGII
FT                   QTNLLRNYGFVDFIVQSKSQNFLKAQEIQNKILKCVLNLDDHLNDEYLKELYKKYETYK
FT                   IFDKDHKYLVINIE"
FT   gene            183759..186704
FT                   /locus_tag="UUR10_0156"
FT   CDS_pept        183759..186704
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0156"
FT                   /product="p115 protein"
FT                   /note="identified by match to protein family HMM PF02463;
FT                   match to protein family HMM PF06470"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59826"
FT                   /db_xref="GOA:B5ZAX3"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR010935"
FT                   /db_xref="InterPro:IPR011890"
FT                   /db_xref="InterPro:IPR024704"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036277"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZAX3"
FT                   /protein_id="ACI59826.1"
FT                   /translation="MIFLKKIEAQGFKSFGEPIVAEFKHPMTGIVGANGTGKSNIVDAL
FT                   KWVIGDQSLKSMRAHKNELLFSGGRYAPKAHIARVNLYFNNVNNVLYTEHKEIKISRVL
FT                   NTKTNENTYYINDEIVRLKDITDMFLDSGLSKGSLGIISQGAVSWFAEAKPIERRKMFE
FT                   EASGIGRYSKRKQEALSSLERANENLDRLNDIVVNLKKELTKLEKQAQRFNEYKQIKDE
FT                   LTKLELVILVRDIVHWQKNLEQITNELKESKNNYNMQAPLIETKKAEILNLRKIANDYV
FT                   EELTDLEFRHKKILEKIKNLNEQLLLTKSSLENKAFNSTNTEERIEAFAKLINTSKKEL
FT                   ENNKSIINKKIDEFNKVVEQKRELEKIKEEQENKINTIVSKISTKNLEKESLENEFNRQ
FT                   TQNERGVKSIISAQKSLPGVYGTISQNIKTKIEHEVAISIALAKGINNIIVKNNQAAEN
FT                   CVDFLKKNNAGVATFLPIENLQAKSIKPEFYDVLKELDGFVGIANELVKIDTNYKISID
FT                   YLLGNTIIADNLKNAIILSEYTYKNYKVVSLDGDVVFGGGAISGGSNSKKNIILNLDEK
FT                   IKQLDEKIQVLKKEEIDLRNLNIKTKSKWQECYNDEQSLNSIINSLRAKNDGISDNLAN
FT                   YNNQYQALNAMKLDDNKIELKINDLNNGYYESNNELIDLEQKISSLKKNLSDANINKNN
FT                   KEIEYGKELDIFNDLKIKLNKFEVSIDNLNFSISNAQNRLVENYKLTIENAIETYQDQE
FT                   IEMSESDARFRIENLKIDIQKYGDINLNALTDYEEKKAEYDANFAEYENCRKAVDEISS
FT                   SIHELDKKAKADFMKVIRETNKLMPEIFEYLFGGGSCAINLDDPNNILESGVEIVANPP
FT                   GKRDVPLSALSGGEKTMVVLAVLFALLKIAKFPLIILDEAEAALDASNVAKFATIIDKY
FT                   SDETQFLVITHREGTMKSCGYLLGTTMMNNGVTTLLEVNLNDPKIKYESEL"
FT   gene            186707..187762
FT                   /gene="ftsY"
FT                   /locus_tag="UUR10_0157"
FT   CDS_pept        186707..187762
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="ftsY"
FT                   /locus_tag="UUR10_0157"
FT                   /product="signal recognition particle-docking protein FtsY"
FT                   /note="identified by match to protein family HMM PF00448;
FT                   match to protein family HMM PF02881; match to protein
FT                   family HMM TIGR00064"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59776"
FT                   /db_xref="GOA:B5ZAX4"
FT                   /db_xref="InterPro:IPR000897"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004390"
FT                   /db_xref="InterPro:IPR013822"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036225"
FT                   /db_xref="InterPro:IPR042101"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZAX4"
FT                   /protein_id="ACI59776.1"
FT                   /translation="MGFFKKIFNKILGKKDTGQVSEEISQKNEENRILKLEDNSINKFN
FT                   EGLRKSSSALTNAINELATKYIDINEEWYEHLEEVLIGYDVGYVATNKIIESIRNEMIY
FT                   QKVNDPELIKSIIIDKIFIYYIQDTEINTEINLKQNQTNVVLVVGVNGVGKTTSIAKIT
FT                   KKFINENKKVLLVAGDTFRAGAVEQLKVWAQRLNVDIELPIKEGQDPASVIYAGVKKGY
FT                   EQKYDLVICDTSGRLQNKINLMNELKKIHDVIHKFDEHAPHETLLVLDATQGQSGINQA
FT                   KAFNEVTKISGIILTKMDSTSRGGIVLAIKDAFNIPVKLIGLGEKLDDLSVFDLEMYVD
FT                   SIVLGMKLDVK"
FT   gene            187752..188051
FT                   /locus_tag="UUR10_0158"
FT   CDS_pept        187752..188051
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0158"
FT                   /product="YlxM family protein"
FT                   /note="identified by match to protein family HMM PF04297"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60064"
FT                   /db_xref="InterPro:IPR007394"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5ZAX5"
FT                   /protein_id="ACI60064.1"
FT                   /translation="MLNKNKRWYLIALYDIYQGLLTTKQCEYFNLHYFKDLSFSEIAEL
FT                   KEVSKSAISDCLNKVCDQLLKYEQALLIYEKNKKRNDLYTLINDSELVKKLKDI"
FT   gene            complement(188155..191952)
FT                   /locus_tag="UUR10_0159"
FT   CDS_pept        complement(188155..191952)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0159"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60281"
FT                   /db_xref="InterPro:IPR009849"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZAX6"
FT                   /protein_id="ACI60281.1"
FT                   /translation="MKRIKNKKWWKFGGVLFLLPLASFLIMCKNQEAPKTNKENVLDVF
FT                   DENIINIENISKPKFINQNKTIINLKLKKFNFKSPNTTITLTYKDNNGHKFTSDPLNIN
FT                   DEQNYDFIFSNLTPNRKYQIQNLTFNNQKRTDVYLKTNLNNAIFSIKPIPIKINNFKIK
FT                   VFNQNALISFSIPKNSDVRVNEKIALEFENLSNNLVPNNEIISKIDNDFNVEFNLNNLN
FT                   LNNKYRIVSLRFLDTNPPNINPNVFEKLSNHESIFTILDIKTNTHNHKDLNTNDKKYID
FT                   SPYNTKIELNDKNNFNDKVLPDAFEQQNINIQEVENLNQDILNQNELELQKYFSFVSDQ
FT                   TNFKAKNFQNYSFNDINKNSKQEFKFKIKHISIDNNNKKAIIELDSSNSNDNTKLLEAN
FT                   NKQLLIKSYDYNNPWSKILSYEKKDNNKMIFDLHDFPKDLKTFIITHIRFDDNITSLGK
FT                   IKENSFEYYQNDKEYLLKSLKYYFDIKENQLYGSACFNFNNNDFEILKNKTFIFKYEID
FT                   TKNNVLNKYIPLNKYISVDFKNLAQFKIVNVFDGLNYKLESIKIVNKNSLLPYNDHVKI
FT                   QNANNTNFSVWHKVYPKQNIINNFLDDSSIKGELNLSKIDFNHLWKNNTDQKNIPYSLR
FT                   NLISLTLYEREYAIYKHNATNGFYLYNTITSNKDFNLIKNNKESYHLNSLIAHLAIKEE
FT                   GLKKDATAGFFLEKDLHDFGNLNNFKDEDIVFNVDLELDPNLIYESQLADKNMRRSHVM
FT                   IPISYKVIKKQHILEDVEFGLNYALGSETYENHIYQQIKSQLKFNVFLNGSKIKVEVKP
FT                   RNDNIKLYDYVWKHNNSNQPSYFIGRYDFIVNWLTNNNEVIIDKKLEEFKKKSYTTRIL
FT                   KDNENEMSKAAIKQVRERTITFSLTSDGTWNFLGKVKPNDPNDYRYYMLTDHHVIGSGG
FT                   SWYNPQINWAGKVEYESINLNKKTIYDDDGNEKYTYSNFADYTVVIPQVISQNDLNKDK
FT                   YQPYYNYNNVNDQDTPGKNQLQYFAFPFKLKFEKVMDFCLQKNNIYKHYNALGRYDDKI
FT                   SELDWSVVSIDLKPIFEAFKNQDLNKPFIYNNKTLSPEETSVIKYFLSLKNIKPLEVSP
FT                   QTRYVRSNQDVDWYIGTFPRYTNTNQNSMGVGELRYREYNIQKIDSVNTNFVTGGKGVL
FT                   YKSDIPYTTISTDYIDAAGGSSGTSLYDEQGRFVGSIATGRTPSKNGHPTWETIGWSLI
FT                   DSQISGFFGDRENRANNSSIIQQIKQLAYLYPEKYEDIYK"
FT   gene            192139..192217
FT                   /locus_tag="UUR10_0160"
FT   tRNA            192139..192217
FT                   /locus_tag="UUR10_0160"
FT                   /product="tRNA-Ile"
FT   gene            192219..192296
FT                   /locus_tag="UUR10_0161"
FT   tRNA            192219..192296
FT                   /locus_tag="UUR10_0161"
FT                   /product="tRNA-Ala"
FT   gene            complement(192392..194146)
FT                   /locus_tag="UUR10_0162"
FT   CDS_pept        complement(192392..194146)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0162"
FT                   /product="multiple banded antigen"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60016"
FT                   /db_xref="InterPro:IPR009849"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZAX7"
FT                   /protein_id="ACI60016.1"
FT                   /translation="MKLLKNKKFWAMSLGAIAISTSIVAFAASCSNSNIKSKLSKQLAQ
FT                   TKDGKNYFAVYEIENYTKLTDEEKKSLENLEFGVSVLDKDGKNPVNIKVKGVQKDGKVY
FT                   VKLPRKPEVNEKLLVVPTKNILKTEALVLNNDNLNYQTVAFEQVPSQKSTSTPENPSTP
FT                   ASTKKDEVVANKITINKIQNGTAIIEVAFSKFELADPNKKDFVLEVKDSVNDGASAISA
FT                   TELVFDANKKILTGKLNGLVSNINYKISKFTLNNNKIKFDLKQEDQQELLNQYIKQAKL
FT                   NTIINKANKKINIKLQDFSILNSFQDNQPVLTFDIEIKKDSSLQVVHKSLTKNQLLNPN
FT                   GLEIDLKDKMNKDNVNYDVKLTNVKIANVALNNDNVNNIEQNHISFRHLSTNDIKNSSD
FT                   KVEAKFSVGLGFDISEKLKNIAFKKLDTNTNKLIDISDPTILRLTFYEYSKDQKVENNL
FT                   AAPTDKTKISVVEIKKSQLINSSVVSFVKELNKNAKYHMANIAFNQQLLPYLNKQFNVN
FT                   ADFPIDLEKNPIDFNDNKQAGDEKIKKTKESAIKVATAIAKQIVGIDYKGRDIIKNFIE
FT                   LDNVVNKK"
FT   gene            194416..195504
FT                   /locus_tag="UUR10_0163"
FT   CDS_pept        194416..195504
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0163"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59953"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZAX8"
FT                   /protein_id="ACI59953.1"
FT                   /translation="MNYQTVAFEQVPSQKSEPKEEKQTKAVDYEKAIKDEDYVKQITLS
FT                   NLEKYISNEYQYLNPNNKTLDYKNHNFVQKFLDEIDVLAQKLESNDLNLEDKQIYEKII
FT                   LGLRWLLAEDNNETKNKALALFKDYFTTIMKATKVNDKVHYDPSFINEFYGSMSNLFEE
FT                   YNLEPSVEIESNKIRIIKEDKDVIKDKTVTATFNLYNGFDWPTLLKDVVFKEYKKDSEG
FT                   KVELKDGKPVETDKIIEDPVVMRLQIAEYPKDWKTSEKDPQNYSYVDFKKSEVLKSPKL
FT                   VFTKVFNLDKEQKYHVKNVMFSHKLIPNLLKAFNIENKGNNTQNELSAKIKSNLTLVDE
FT                   KTQTNLNTNYIPLSLTETNNKK"
FT   gene            complement(195558..197630)
FT                   /locus_tag="UUR10_0164"
FT   CDS_pept        complement(195558..197630)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0164"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59727"
FT                   /db_xref="InterPro:IPR021301"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZAX9"
FT                   /protein_id="ACI59727.1"
FT                   /translation="MRTSKYITKYDYIGYYTKQKAMWFFTNAEIKAKLDLMLKDVSSYD
FT                   FEDLDDEEDHDIEIDAYEIYKEQTDFILQLEINKNIDKDNPKIAEGIILDQASQEDIKK
FT                   TYPNITKIINFEADALYKNKSLEELADLTLELLDKNGEIILFQPVFINNQLITKPDCFI
FT                   KENEEFIVIETKGTSSIKKHHLLDIFYQAQVISKHPYFVNKCVSYKMCIVDYVKLKKNQ
FT                   VSFTISPFYNYQKSVVLTLPPTAANEFNKFEINELKRKRKRGEAIYLKKDENKKYYEDI
FT                   DAYEICKGILLDDLIDGTYSSIDDYKEAKKIYDYKTEDLKDDVRFNKTMDEVVKSVEKL
FT                   HNDFDDVINELLAHKQTLLNLPIEQRIPTNFIPSYNDKGDYKDNDFWLELRNLYAYMGY
FT                   DVIKYSGKILTIKKFGLNNVTKDILGIDILKTYANQTFFNLYKNNQIKIYQAAVDLFAK
FT                   LKSKKVYFDFESINSAIRAVDNSFPFTQTVTQNSIIIDDGSCDIKNLKCTNMIIDPREI
FT                   NNEWFKAIIDKIHHGLEYSYIVYNKSFEASRLKEMAEFINEEIYELKVSEIIKNMYDLA
FT                   DFFIVSMRKQLIVIPELKGFYSIKKVLPIIEKEFPQIYHDVNCLNYKELSVGNGLVCQT
FT                   KTTKRFFNTITDLEWEQFVHDARIYCENDVRAMIAVEYFIKKLIDEAKMKNLILG"
FT   gene            complement(197718..198599)
FT                   /locus_tag="UUR10_0165"
FT   CDS_pept        complement(197718..198599)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0165"
FT                   /product="HAD hydrolase, IIB family"
FT                   /note="identified by match to protein family HMM PF00702;
FT                   match to protein family HMM PF08282; match to protein
FT                   family HMM TIGR00099; match to protein family HMM
FT                   TIGR01484"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59972"
FT                   /db_xref="GOA:B5ZAY0"
FT                   /db_xref="InterPro:IPR000150"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZAY0"
FT                   /protein_id="ACI59972.1"
FT                   /translation="MGKNDKYLIACDLDGTLLNNESDISQKTIDGIKKIIDQGHIFCIV
FT                   TGRPLRGSIHIYEKLGLNTLMANYNGSYISNPSDKKFTPVNMTFSKNIVSAILKNRFIA
FT                   KNIVNAVVEADNVATVLNSNMDLNIWKSFIDIFHVPIRDMNEKNNILNQTNNDINNLIK
FT                   DANALLLNVNDKALFDSMVYHIKQIAPTLAVRSWSARIDDKFEVIEVNSSFADKAMAMK
FT                   YLSSYYGIPLERCIAFGDGENDLTMLNNAGYGFAMKNGTRPAKLLARHITKHTNVENGV
FT                   VWELEYVLNEKK"
FT   gene            complement(198625..199626)
FT                   /gene="trpS"
FT                   /locus_tag="UUR10_0166"
FT   CDS_pept        complement(198625..199626)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="trpS"
FT                   /locus_tag="UUR10_0166"
FT                   /product="tryptophanyl-tRNA synthetase"
FT                   /EC_number="6.1.1.2"
FT                   /note="identified by match to protein family HMM PF00579;
FT                   match to protein family HMM TIGR00233"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60354"
FT                   /db_xref="GOA:B5ZAY1"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002305"
FT                   /db_xref="InterPro:IPR002306"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR024109"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZAY1"
FT                   /protein_id="ACI60354.1"
FT                   /translation="MKRLISGIQPTNNLTLGNYLGAIKNFVDLQNDYEVFLFVADLHSL
FT                   TPNIFDNTNFFATKRQIIATYLAAGIDPKKTCLFYQSDILAIPLLSHILLCSTSIGELT
FT                   RMTQFKDKSAKATKMANNTEMIPSGLLTYPALMAADILAFNADVVPVGQDQKQHLELTR
FT                   TLADRFNKRYGQTFKLPQVYIPKIGAKIMDLLDPSVKMSKSSKNPKGVIFLNDSREQII
FT                   KKIKGALTDNLNQVKYDVEQQPSVSNLITIYACLTNLTFAEIETKYNQQNYGVFKNDLA
FT                   NIVADFLENLQQKISYWLNSPELDIMIDNSCERANDVANQNVQLVLKQMQLK"
FT   gene            199752..200141
FT                   /locus_tag="UUR10_0167"
FT   CDS_pept        199752..200141
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0167"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF03960;
FT                   match to protein family HMM TIGR01617"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60224"
FT                   /db_xref="InterPro:IPR006504"
FT                   /db_xref="InterPro:IPR006660"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZAY2"
FT                   /protein_id="ACI60224.1"
FT                   /translation="MIYVLYSPNCAVCKKVVRFFRNNQIEITKIIIGEDKIERSMLIDI
FT                   LSLCEDGFGTIISFKTESSKRLNITSKTFLDLSTKELLNLIQEDLNLIRRPLIYQTKNN
FT                   KPYRLQIGYDSEEIEIFKRVVHEGR"
FT   gene            200128..200940
FT                   /locus_tag="UUR10_0168"
FT   CDS_pept        200128..200940
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0168"
FT                   /product="NAD(+)/NADH kinase family protein"
FT                   /EC_number="2.7.1.-"
FT                   /note="identified by match to protein family HMM PF01513"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60129"
FT                   /db_xref="GOA:B5ZAY3"
FT                   /db_xref="InterPro:IPR002504"
FT                   /db_xref="InterPro:IPR016064"
FT                   /db_xref="InterPro:IPR017437"
FT                   /db_xref="InterPro:IPR017438"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZAY3"
FT                   /protein_id="ACI60129.1"
FT                   /translation="MKDVKPVYFYDIYCFNPNKCTEDKGVLLLETKLKEYQKVTFLRSE
FT                   QKPQIVFLLGGDGSFINFVNQQWKQNWKIVGINYGQLGFYSSYDGINTINIDEIVDESM
FT                   YANAFLIEVNINNENKFYCLNELSIFSNELASCDISINNTFYEKFRGSGLLFATPSGST
FT                   GKNKVAHGPIIFNNQPCFSMLEIFPVNHLKYSSLNAPVVFGKDYQISLTNIKFKRTLNL
FT                   VVDGNNINFNNKIDFIEVKLIQASLQIHGLNNYKKYIERLRRSFIKEE"
FT   gene            200948..201328
FT                   /locus_tag="UUR10_0169"
FT   CDS_pept        200948..201328
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0169"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:BAC44251.1"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60100"
FT                   /db_xref="GOA:B5ZAY4"
FT                   /db_xref="InterPro:IPR001996"
FT                   /db_xref="InterPro:IPR025328"
FT                   /db_xref="InterPro:IPR036878"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZAY4"
FT                   /protein_id="ACI60100.1"
FT                   /translation="MKNLNTKQKSLIIFLSIITLGIFAIYFFSKAKKTSQIKNTHLTTS
FT                   SKIPFSLTAFYDCVGSKDNLANVDATINTLKIELKEASLLNNEELKHLGAKGIMRNQTK
FT                   ISIIFGDFCLELKELIKKDLLS"
FT   gene            201423..201644
FT                   /locus_tag="UUR10_0170"
FT   CDS_pept        201423..201644
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0170"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60005"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZAY5"
FT                   /protein_id="ACI60005.1"
FT                   /translation="MLIKPAKRSEKIYTIISIKDSVVTLKNDYQDEKEIEIYEFDLQNI
FT                   IPEIGKFINLIKYDQQGCSVFEEYDQNA"
FT   gene            complement(201646..202125)
FT                   /locus_tag="UUR10_0171"
FT   CDS_pept        complement(201646..202125)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0171"
FT                   /product="conserved hypothetical protein TIGR00246"
FT                   /note="identified by similarity to SP:Q9PQW3; match to
FT                   protein family HMM PF02590"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59898"
FT                   /db_xref="GOA:B5ZAY6"
FT                   /db_xref="InterPro:IPR003742"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5ZAY6"
FT                   /protein_id="ACI59898.1"
FT                   /translation="MIIKIISVGKLKQTGFVNLVNDYLKRINYYLKCQEIVVNDEPEPT
FT                   QISTKLLEQIKDKEANRILKNINQNDFVIALIIEGKIISSEMLAENLQNWLNASYPNIC
FT                   FVIGGSNGLHEKIYERANYHLSLSKMTFAHGLAKVMVCEQIYRALSILNNGKYHK"
FT   gene            202180..202905
FT                   /gene="tpiA"
FT                   /locus_tag="UUR10_0172"
FT   CDS_pept        202180..202905
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="tpiA"
FT                   /locus_tag="UUR10_0172"
FT                   /product="triosephosphate isomerase"
FT                   /EC_number="5.3.1.1"
FT                   /note="identified by match to protein family HMM PF00121"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59792"
FT                   /db_xref="GOA:B5ZAY7"
FT                   /db_xref="InterPro:IPR000652"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR020861"
FT                   /db_xref="InterPro:IPR022896"
FT                   /db_xref="InterPro:IPR035990"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZAY7"
FT                   /protein_id="ACI59792.1"
FT                   /translation="MVKMKYIIANFKMNATEELINHFLNNLISFDEQKLTIGLAPGDLY
FT                   LKTFVDLSQTKKVKLYAQNPSAYSKGPYTGQISCLQLLDSNIKNTLVGHSEIRIDCSQS
FT                   IIDQKTKICMDLLDQVIICIGEPLDVYEQKKSLSFVLSQLANVINYKGLKKIIIAYEPI
FT                   WAIGTNLTLDLKHINHMIEGIKTYLYNCTGLNIPILYGGSVNANNIKELCTQKLIDGFL
FT                   IGNASLDVNNFNQIINACK"
FT   gene            202936..204444
FT                   /gene="gpmI"
FT                   /locus_tag="UUR10_0173"
FT   CDS_pept        202936..204444
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="gpmI"
FT                   /locus_tag="UUR10_0173"
FT                   /product="2,3-bisphosphoglycerate-independent
FT                   phosphoglycerate mutase"
FT                   /EC_number="5.4.2.-"
FT                   /note="identified by match to protein family HMM PF01676;
FT                   match to protein family HMM PF06415; match to protein
FT                   family HMM TIGR01307"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60305"
FT                   /db_xref="GOA:B5ZAY8"
FT                   /db_xref="InterPro:IPR005995"
FT                   /db_xref="InterPro:IPR006124"
FT                   /db_xref="InterPro:IPR011258"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR036646"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5ZAY8"
FT                   /protein_id="ACI60305.1"
FT                   /translation="MSLNKKLALIIIDGLGIGKKDDTNAVYLANPKTLNYLIKNYPTLE
FT                   ISAAQQPIGLLENQAGNSEIGHLTIGAGRIILNDNANINSYTKRLDYESLVLNDINNEI
FT                   VHVVGMYSNGLVHSNYEHIHWIIKELVKNNNQVVLHLISDGRDDYPYGFAQFIEQINAL
FT                   KTQYNVIIKSLSGRYFAMDRDQRWERTQKAFNTMFIKQDKICEQSLLEVAQSIANHYES
FT                   DEFVEPIVFNNDEKYNLKPYQKVILTNYRSDRMRQLAHLLKPNRKFNYHNPFLIKDIHL
FT                   ITLVPFPDVDAITLFEKQNLNNTLGDVLNDHHIKQARVAETEKYGHISFFFDGGINKHY
FT                   ASKTQYLIPSQKVATYDLCPQMSASLITKTIIDHYFDHDVFIVNYANPDMVGHSGNMKQ
FT                   TIQAILSVDSEIQKLYDFFKKNNGVLMITGDHGNAETMIDANGQIITSHSINDVWFIIT
FT                   DNNIVFDQTQKFSLANIAPTILEYLNIKKPIEMAASSMIKKIHK"
FT   gene            204487..205362
FT                   /locus_tag="UUR10_0174"
FT   CDS_pept        204487..205362
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0174"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60245"
FT                   /db_xref="GOA:B5ZAY9"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZAY9"
FT                   /protein_id="ACI60245.1"
FT                   /translation="MEKKAKIYTCSHILLIIFSLVCLHWFFILAITTPHQIGFLINKVD
FT                   QWTNASSTYIYKIDSQSLLYLNQTLNFNVTLNASGISSIVLFICYLFTFTFNLSMIGVM
FT                   RAWKLSLLHLIVAWLILFVVLYLFIIIMITPNFNQIINNSYYAWLKASVLNNQTLNPTQ
FT                   KVKILNTYINYYHLPVINDPQVSLLDISKHQINNENLTFNPSYNYNSDLYFTKAKLIYF
FT                   TYTIAGIIFIISFVYYLSEVIKLCLTVNDNWKIKPRQRKDGLNIRKRKTKQEIVAPDPS
FT                   LEEIFKELDL"
FT   gene            205481..206803
FT                   /gene="eno"
FT                   /locus_tag="UUR10_0175"
FT   CDS_pept        205481..206803
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="eno"
FT                   /locus_tag="UUR10_0175"
FT                   /product="phosphopyruvate hydratase"
FT                   /EC_number="4.2.1.11"
FT                   /note="identified by match to protein family HMM PF00113;
FT                   match to protein family HMM PF03952; match to protein
FT                   family HMM TIGR01060"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60071"
FT                   /db_xref="GOA:B5ZAZ0"
FT                   /db_xref="InterPro:IPR000941"
FT                   /db_xref="InterPro:IPR020809"
FT                   /db_xref="InterPro:IPR020810"
FT                   /db_xref="InterPro:IPR020811"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5ZAZ0"
FT                   /protein_id="ACI60071.1"
FT                   /translation="MKIVDLLAYQVLDSRGQPTVAVKLFLENDQSVVAMVPSGASTGTK
FT                   EALELRDGDANYFFSKSVKLAIQNVNNIIRPHLLNKNVLNFFELDNLLINLDGTENKTK
FT                   LGANALLGVSIVIVKGGAVAASKPLYQYIKEDLMHNYDEHYYAPIPLMNFINGGAHADN
FT                   NLDIQEFMIVPLNAISFSQAIQTGSEIFHELAKILKANHLNTAKGDEGGFAPMLNDNYA
FT                   ALELLVRAIKKAHYFPSKKQGVCLALDVASSELYENEKYVFKKALSHNTNLEQTSFSSD
FT                   EWAKYWSDLASQFPIISIEDCFDENDWNGFSLFLKNNPHIQSVGDDLYCTNLKYLQKGI
FT                   NFKATNAILIKPNQIGTISETLDVIKYAQENNINTIISHRSGETEDTFIADFAIGVGAG
FT                   QIKTGSLSRSERIAKYNRILEIEQELKDKLVYEPNKFFKFN"
FT   gene            206772..207737
FT                   /locus_tag="UUR10_0176"
FT   CDS_pept        206772..207737
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0176"
FT                   /product="phosphofructokinase family protein"
FT                   /EC_number="2.7.1.11"
FT                   /note="identified by match to protein family HMM PF00365"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60029"
FT                   /db_xref="GOA:B5ZAZ1"
FT                   /db_xref="InterPro:IPR000023"
FT                   /db_xref="InterPro:IPR012003"
FT                   /db_xref="InterPro:IPR022953"
FT                   /db_xref="InterPro:IPR035966"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZAZ1"
FT                   /protein_id="ACI60029.1"
FT                   /translation="MSQTSFLNSTKNILIITSGGDAPGMNASLVSLIHELMDSNFNVFV
FT                   GIEGLLGLYNNLIEPIKNKHIFDVYFKEQGTIIKTSRFIKLNVNDEKTQVIKKNLLEHN
FT                   IHKIIILGGQGSMQAGLVLTDLGFEVYGILHTIDNDFNQTQMCIGASSAAHFNQQLLTC
FT                   LNYTAKAHNAFSLVEIMGHQCPWLVNNSIGQLKPILTLTNQDPKYSVDQVIDLVKTKIT
FT                   LAKEYDPLIIVQELIYDQQWYEALKKAFAQKLHQTLRVTILNYLQRGAPVIDFDLQLAK
FT                   DSASVLVDFIINKNEIENTSNMYVVVNKNDIKPQVIKFND"
FT   gene            207749..209173
FT                   /gene="pyk"
FT                   /locus_tag="UUR10_0177"
FT   CDS_pept        207749..209173
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="pyk"
FT                   /locus_tag="UUR10_0177"
FT                   /product="pyruvate kinase"
FT                   /EC_number="2.7.1.40"
FT                   /note="identified by match to protein family HMM PF00224;
FT                   match to protein family HMM TIGR01064"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59836"
FT                   /db_xref="GOA:B5ZAZ2"
FT                   /db_xref="InterPro:IPR001697"
FT                   /db_xref="InterPro:IPR011037"
FT                   /db_xref="InterPro:IPR015793"
FT                   /db_xref="InterPro:IPR015806"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZAZ2"
FT                   /protein_id="ACI59836.1"
FT                   /translation="MFSKTRIIATVGPATTKSFSNWAEFNDLKNQNEAQQVNSHIKNLI
FT                   LNGVNIFRMNLSHGEQEIHIFRSQLIKEIAHDLKIKVEILFDTKGPEIRVCQMSEDNFI
FT                   AKDSEVIIHCQKQIIGKRNEFSVIDASKKYNMINDVKANDRILVDDGKLILVVKKIDSS
FT                   KNIIYTIAKNNHVLKTNKRLNLPDSNYSLPFLSKKDIDDINLAANLKIPYLALSFVSNV
FT                   KQINEVKALLKDQSFTPKLIAKIETQEAIDNLEEIIKNTNGVMVARGDLGLEVPFYKIP
FT                   IYQNKIVELCHKYNKYCIIATQMLDSLERNLLPTRAEVTDVYYAVNQKVNATMLSGETA
FT                   AGIDPINAVSVMQSIILETENNDIKQEIEFASVKLLIPNEIKSKILDFHNLKTNLHKLL
FT                   VVNLVDKNYEQTIYDLLKCNFNFSILFVVNEDRNHDLLLKNTNFIVSQNKISNQKELLE
FT                   FLDFDFKKYELLFVFI"
FT   gene            209295..213599
FT                   /gene="rpoB"
FT                   /locus_tag="UUR10_0178"
FT   CDS_pept        209295..213599
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="rpoB"
FT                   /locus_tag="UUR10_0178"
FT                   /product="DNA-directed RNA polymerase, beta subunit"
FT                   /EC_number="2.7.7.6"
FT                   /note="identified by match to protein family HMM PF00562;
FT                   match to protein family HMM PF04560; match to protein
FT                   family HMM PF04563; match to protein family HMM PF04565;
FT                   match to protein family HMM TIGR02013"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59846"
FT                   /db_xref="GOA:B5ZAZ3"
FT                   /db_xref="InterPro:IPR007120"
FT                   /db_xref="InterPro:IPR007121"
FT                   /db_xref="InterPro:IPR007641"
FT                   /db_xref="InterPro:IPR007642"
FT                   /db_xref="InterPro:IPR007644"
FT                   /db_xref="InterPro:IPR007645"
FT                   /db_xref="InterPro:IPR010243"
FT                   /db_xref="InterPro:IPR014724"
FT                   /db_xref="InterPro:IPR015712"
FT                   /db_xref="InterPro:IPR019462"
FT                   /db_xref="InterPro:IPR037033"
FT                   /db_xref="InterPro:IPR037034"
FT                   /db_xref="InterPro:IPR042107"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5ZAZ3"
FT                   /protein_id="ACI59846.1"
FT                   /translation="MQNNKNYTEKFITDKVTRRDYSKIKSNFEGPNLLEIQVESFKRFM
FT                   EKDLKEVISGIFPLKSPQGKYTLAFKGLKIKQPTKDESACRDEGKTFETPIYIDLELTD
FT                   NYTGEVKRAQRNAKTGEDGIYLGAIPKMTEKGTFVINGIEKFVISQIVRSPGIYVLGKS
FT                   SIKLNGSRKRLFEGKICEIYPSKGTLMLGYIPKDRHNIQIVARDSSGDNAQTFSITTLL
FT                   KAFGLTSAEILKIFNNEKEIRESLEVEKYSPEYIFENSQENEIIFKIYSDAHDIHEKAD
FT                   RRESNNKLREEYIEQGSPLLSKLKELIFDYVEKSDEIDALLHENKDVEDANFIKNNKKL
FT                   YDEREEIINCIISEKAAKDIVELLGINIKNVETLRHLGKASYQLALQQHFFNKRLYDIS
FT                   SAGRYKFEKKLLLSERLYQKVIARDIIDKKNNILIPKDTLITKEHIELIKKESRDKNIK
FT                   WTRKINLLPIALETEIEQFLEYESIAVYKDNDLRDETTEIVGLAPGCKLQTLTVADLVA
FT                   TTSYIYNLNYEIGEFDDIDHLGNKRLKLIHELLRARIATSMARIEKFINEKLAISDGSS
FT                   NNITNVNDKGIDTELDREVEESDMSDEEKKKAISVKSIINTKQFQSLVKDFFNSHQLIQ
FT                   FIDQQNPLAELTNKRRISAMGPGGISREDPNLDIRDVHHSHYSRICPIETPEGMNIGLI
FT                   MSLASLAKVDENGFIVAPYYVVEDGVVKEECKYLTAHEDDNYIIAESSVQLDENKRILD
FT                   EQVVARYRGSTGLFSPHEVDFIDIVPKQVVSIAASAIPFIENDDGARALMGSNMQRQAT
FT                   PLIKPYAPIVGTGTEFKIAHDSGMAVVAKNDGVVEFVDSQKIVIKNDNDKLDEYKLIKY
FT                   RKSNQDTCNNQIPIVKIGQKVHKSETIGDGPAMQNGELALGRNILVGYTTWRGYNFEDA
FT                   IIISERLVDQDVFTSIHIDEHTIQCMKTKNGDEEITRDMPNVSDTAKRFLDNQGIVLVG
FT                   AEVHEGDVLVGKTTPRGNVETAPEDRLLQTIFGDKSKTVKDSSLKVKHGQEGIVAAVKR
FT                   IKSTDENGSELPDDVIEIIKVYIVQKRKIQVGDKMAGRHGNKGIVSKVVPIQDMPFLKD
FT                   GTPLDIMLNPLGVPSRMNIGQILELHLGYAAAEIGKKQLIQIAIDQLGYEKYISLFGIN
FT                   EIIAKKLYEKITNLIKHKQAKQPKDIDLIDITIVLKELGLSYDDIGIKISTPVFDGANH
FT                   DDIVDIMNEANIDIENNKGKQVLYDGRTGEAFDGLISVGLTYMLKLDHMVDDKIHSRSV
FT                   GPYSKITQQPLGGKSQNGGQRFGEMEVWALEAYGAAYNLLEILTIKSDDVQGRNQAYNA
FT                   IIKGHDVVADGMPESFKLLTKQMQGLGLCITVETKDDRMIDINEYTLNQNRLNNDDDEV
FT                   IFDESIKEINENNQQVFNTDFNDNDYDDEENF"
FT   gene            213621..217538
FT                   /gene="rpoC"
FT                   /locus_tag="UUR10_0179"
FT   CDS_pept        213621..217538
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="rpoC"
FT                   /locus_tag="UUR10_0179"
FT                   /product="DNA-directed RNA polymerase, beta' subunit"
FT                   /EC_number="2.7.7.6"
FT                   /note="identified by match to protein family HMM PF00623;
FT                   match to protein family HMM PF04983; match to protein
FT                   family HMM PF04997; match to protein family HMM PF04998;
FT                   match to protein family HMM PF05000; match to protein
FT                   family HMM TIGR02386"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59983"
FT                   /db_xref="GOA:B5ZAZ4"
FT                   /db_xref="InterPro:IPR000722"
FT                   /db_xref="InterPro:IPR006592"
FT                   /db_xref="InterPro:IPR007066"
FT                   /db_xref="InterPro:IPR007080"
FT                   /db_xref="InterPro:IPR007081"
FT                   /db_xref="InterPro:IPR007083"
FT                   /db_xref="InterPro:IPR012754"
FT                   /db_xref="InterPro:IPR038120"
FT                   /db_xref="InterPro:IPR042102"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5ZAZ4"
FT                   /protein_id="ACI59983.1"
FT                   /translation="MSQKGIKSLTISIASPEQILSWSKGEITKPETINYKSLKPEPNGL
FT                   FDESIFGPSKDYECYCGKYRKVKHKGKVCERCHVEITESIVRRERMGHIELAAPVAHIW
FT                   FTKELPSPSKISLLLDITYKEVDQVVYFVNYIVLDEGNNEYDGKSIFNKKEVLDLTSPK
FT                   NSIRSRNKLRRTLRNIQERIEEELNHEREALIQDFDYRLAVTYDQMLKDSNIPFSVKDV
FT                   MAFIEKHTGVRFGIGAEAIHELLEKLNLEEEHEKIKQAIQNSPNAYDQKTKRLLRRLEC
FT                   VRWIKDSGSKPEWMVMTRIPVTPSETRPIISLDGGRFTTSDTNNFYRKIIIRNERLKQM
FT                   QATDAPEILLDNEKRLLQEAVDSLFDNNSRKKPVVGKDKRPLKSLSNHLKGKQGLFRQN
FT                   LLGKRVDYSGRSVIVVGPELKMYEVGIPALMILKLFRPYIISELIRKRDEFGNEIQPIC
FT                   ANIKLAEQKILAQDDEIWPVVEKVIKQRPVILNRAPTLHRLGIQAFEPKMVDGKAIRLH
FT                   PLVTTAFNADFDGDQMAVHIPLSKEAVAEARSILLASWHILGPKDGKPIITPTQDMILG
FT                   IYYLTKEKFPQPIEEMILKDPVQARIEFINHFHIFATQDEAIRAYKLKTIRINDVIGIT
FT                   TKAFDNKSFSKEGILVTTVGKIIFNQAFPTNFPYINDVKNLYGDNQFEIIGMHESILDY
FT                   LKAYNLKEPLTKKTLSTVIDYLYKVSEIEVVPQTMDKIKALGFKYSMISATSISAFDIP
FT                   SYDQKYEYFKETDELVAKLREFYLDGKLTDDERYTKVVQAWSQTKDKVTHDIEKLINSD
FT                   EYKDNPIVIMAKSGARGNTSNFTQLAGMRGLMSKSYNYDQKNNSGVIKDTIEIPIKHSF
FT                   IEGLSVSEYFNSSFGARKGMTDTAMKTAKSGYMTRKLVDSTQAVVIKGNDCGTKEGIIV
FT                   REIRNTKDNTSIESLKDRIVGRFSINPIYDTKNKLIIEGDKLITNEIANMIQNSGIREV
FT                   EVRSPLHCSSLYGVCQKCFGLDLSTNKLIETGTAIGVIAAQSIGEPGTQLTMRTFHTGG
FT                   VAGDTNITQGFERIKQLFDCIQPQENEKAIISQVKGTVDRIEKDSNTNGYNVVIKYNKD
FT                   NFVSYPTRPNAVLRIKTGDNVVAGQKITEGSIDVNDLLKYAGIENVRHYIIKEVQKVYR
FT                   MQGIEISDKYIEVIISQLTNKVTITNPGDSGLFVGETISINEFTEVAQSMLVNKKKPPS
FT                   AINQVFGLDHAPSKSGSFLSAASFQDTKKILTDAAARSQKDMLIGLKENVILGNLIPAG
FT                   TGLKDVEEVIAYGEEMYKKQY"
FT   gene            217678..218568
FT                   /locus_tag="UUR10_0180"
FT   CDS_pept        217678..218568
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0180"
FT                   /product="multiple banded antigen"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59882"
FT                   /db_xref="InterPro:IPR009849"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZAZ5"
FT                   /protein_id="ACI59882.1"
FT                   /translation="MKILKNKKFWALTIGSALIGVSVIASVASCYGSNVQSKLSDKLVE
FT                   DENNNYYVAYEITNYDKLKDSEKAQLEKISFATSITPVDKTKNSQVFNAKVNDGIIFNK
FT                   QTKTFYIKLVRKPELGESIIILPSDSILKTHGFVVVNENLKFVKINKKGEVQTTPSKPA
FT                   VEKKDNLLVKTVVFSKVVDAKSTLSFELSTLELADEAKVEISVELSTKKVDASDTKYVI
FT                   APTLAKAVLDKTTKKINVEISNLAQGQKYTVAKLTLNGKEIALSDEQKQVALSVTKEDN
FT                   KENPTPLPPVPKANK"
FT   gene            complement(218666..219520)
FT                   /locus_tag="UUR10_0181"
FT   CDS_pept        complement(218666..219520)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0181"
FT                   /product="EDD domain protein, DegV family"
FT                   /note="identified by match to protein family HMM PF02645;
FT                   match to protein family HMM TIGR00762"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60155"
FT                   /db_xref="GOA:B5ZAZ6"
FT                   /db_xref="InterPro:IPR003797"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZAZ6"
FT                   /protein_id="ACI60155.1"
FT                   /translation="MKTAILIDTGANVLDIKDDNVYFVPIQLIVKEHQVEQQLKDVIDV
FT                   SQEQLKQILINKTSIHTSLPSPGFVMNKLDELFTKYDRVVILTLSSGLSSYFESLSIIK
FT                   EDYKDKHLVCIDSRSVSIGILWLVDEINSLLKNNPSDEELIALVKERSQKIIGGVIVNN
FT                   LDQLIAGGRVKKTKGIIAKALRLKLIVRWNGQLDFMDKTPNLSIAIDKLLDIINDQNQW
FT                   RTNGIKNIVILTDLENESQINSLKTSLQEKIQQDVEIKVSYLPGCIYAHVGLNNFAILI
FT                   EAN"
FT   gene            219666..220262
FT                   /locus_tag="UUR10_0182"
FT   CDS_pept        219666..220262
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0182"
FT                   /product="putative tRNA binding domain protein"
FT                   /note="identified by match to protein family HMM PF01588"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60054"
FT                   /db_xref="GOA:B5ZAZ7"
FT                   /db_xref="InterPro:IPR002547"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR033714"
FT                   /db_xref="InterPro:IPR037154"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZAZ7"
FT                   /protein_id="ACI60054.1"
FT                   /translation="MYIYYNRTSLNDTLIFLKNNEQYDHQVFLNDDLLLFYRNKELIGF
FT                   NLWNASKYLENLSEGYLYPSLELMQKLSNLTKTKLVPNDDFKGFIVGVILEANLIPNTH
FT                   LHVCLVDIGNQQVQIVCGAQNARVGLKTVVATPNLLMPNGNEIKKSKLMNYDSFGMLCS
FT                   QKELNIEGFNSQGIVELNEQYQVGQLFTKVYSNLK"
FT   gene            220287..221282
FT                   /gene="prs"
FT                   /locus_tag="UUR10_0183"
FT   CDS_pept        220287..221282
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="prs"
FT                   /locus_tag="UUR10_0183"
FT                   /product="ribose-phosphate pyrophosphokinase"
FT                   /EC_number="2.7.6.1"
FT                   /note="identified by match to protein family HMM PF00156;
FT                   match to protein family HMM TIGR01251"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60294"
FT                   /db_xref="GOA:B5ZAZ8"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR000842"
FT                   /db_xref="InterPro:IPR005946"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR029099"
FT                   /db_xref="InterPro:IPR037515"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZAZ8"
FT                   /protein_id="ACI60294.1"
FT                   /translation="MPKNHDILLFSLSNSRQLANKIANLLKIELSPIRIDKFADGEFIV
FT                   APQVPVRGRRVIIIQSTSKPVNDSLMELLIAIDSIKRASAKAISVVIPYYGYARQDRKA
FT                   KPREPITARLVAKMIESAGATSVLTWDIHSLQTQGFFDIPFDSLEAVWVLMKHYFDAYK
FT                   DSSNITIVSPDYGGVKRAREISIATGATLAIVDKRRSGKNQVEINNVLGDVQGRDCVIV
FT                   DDMIDTGGTILGAAKIVREKGAKSITIIATHGLFNNNARERFEQAIKDKIINKVCIADT
FT                   IENEPFEGLEIVSIAPAIAKCIEIYSKGAGSMSFVHDENSKFLFTKKNNK"
FT   gene            221286..221825
FT                   /locus_tag="UUR10_0184"
FT   CDS_pept        221286..221825
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0184"
FT                   /product="primase homolog"
FT                   /note="identified by match to protein family HMM PF01751;
FT                   match to protein family HMM TIGR00334"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60268"
FT                   /db_xref="GOA:B5ZAZ9"
FT                   /db_xref="InterPro:IPR004466"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR025156"
FT                   /db_xref="InterPro:IPR034141"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZAZ9"
FT                   /protein_id="ACI60268.1"
FT                   /translation="MNKPIIQEVIVVEGKTDAQKIDQLVNAQIITTNGSEISKKTLALI
FT                   KQAQLSKGVILFLDPDYQGEKIRKTITNYLKYGITKQCFISKDSMLDNAKKIGIAEANN
FT                   DALLKALKSQATFIINPIESISWLEYLTLNLNNKKMRLMLCDYLNISYCNHKQLFKRLN
FT                   MMQKTLEQIKAIIKEF"
FT   gene            221829..222668
FT                   /locus_tag="UUR10_0185"
FT   CDS_pept        221829..222668
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0185"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF00590;
FT                   match to protein family HMM TIGR00096"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59813"
FT                   /db_xref="GOA:B5ZB00"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR008189"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR018063"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZB00"
FT                   /protein_id="ACI59813.1"
FT                   /translation="MKLCDKEYILSIIATPIGNLEEASERVIKSLNEAYVILCEDTRMT
FT                   SKLLHLLNIYDYKKLVSFHNFNEVEKLNEAINYIKKYPTALVSDAGYPTISDPGYKLIN
FT                   ECHRQNIGVQVINGPSSLMHALVASGMCSQDFMFLGFLGKTQKQRVEKLKQYKNLQTTF
FT                   VIYEAVHRLQTTLMDVYETWGDVLVFIGRELTKKNESHYYGYLSQLPPITEKGEFVIVI
FT                   DNKTNFDVIKNNDINECLNEIRTLIKQNFKLKDACKEVSKTSGFDSKELYKLMVNQK"
FT   gene            222670..223896
FT                   /locus_tag="UUR10_0186"
FT   CDS_pept        222670..223896
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0186"
FT                   /product="ATPase, AAA family"
FT                   /note="identified by match to protein family HMM PF00004;
FT                   match to protein family HMM PF07728"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59785"
FT                   /db_xref="GOA:B5ZB01"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008824"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR021886"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032423"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZB01"
FT                   /protein_id="ACI59785.1"
FT                   /translation="MLDKLIKTLKNPHSIDDIVGQKDLLDEIGIIRKMVNHHQVFNLIF
FT                   YGPPGVGKSSLAKVLAQDLKVPFAFFNPVVDSKKQLMQIIEQALDLNNFIIIIDEIHRL
FT                   NKDKQDILLPIIEANKIKLFATTTENPFFVINPALRSRCQLLSLKPLTSSQISERIKTL
FT                   INVEEVFEPQAFNLLITKTNGDLRAVINTLEIIHLLYKEHKVDYVLLKRIMQESYALGV
FT                   SDGDEIHDLKSAFHKSMRGSDCDAALYYLARLIIIGDFEAIYRRISVCVHEDIGLANPN
FT                   LCLRVDQGINSCRFLGYPENQVILANLVLQICLSNKSNSVYLAYHKAFEDAANGKQYSI
FT                   PNHIRDAHYASAVKLGVHGYKYPHDFKNNYVNQQYLPRELANKKYYVPQNNEQEFKLNQ
FT                   NQQKFKNNN"
FT   gene            223916..225481
FT                   /gene="metG"
FT                   /locus_tag="UUR10_0187"
FT   CDS_pept        223916..225481
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="metG"
FT                   /locus_tag="UUR10_0187"
FT                   /product="methionyl-tRNA synthetase"
FT                   /EC_number="6.1.1.10"
FT                   /note="identified by match to protein family HMM PF09334;
FT                   match to protein family HMM TIGR00398"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59768"
FT                   /db_xref="GOA:B5ZB02"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014758"
FT                   /db_xref="InterPro:IPR015413"
FT                   /db_xref="InterPro:IPR023457"
FT                   /db_xref="InterPro:IPR033911"
FT                   /db_xref="InterPro:IPR041872"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZB02"
FT                   /protein_id="ACI59768.1"
FT                   /translation="MLKQKKFFISTPIYYSSGNPHIGHAYTTIIADVLARYKRLFGYDV
FT                   FFLTGMDEHGQKIQQKAFEENISPKALVDRNSIIFLNLWKRLHISFSKFIRTTQMDHEE
FT                   SVQKVFSYLYKQGKIYLGQWTGYYCVSCEENYNPAEIIKSQDNIMLCRMGHKLETKSEE
FT                   SYFYKMSDQAPFLKTYYQNHPNFIIPNERANEMVNNFLNNLEDLSISRTTFDWGIPIAE
FT                   NPKHVIYVWLDALMNYLTATGYLSNNEELFQKYWCDNETEIVHLLSKEIARFHCIYWPI
FT                   FLNDLQIRFPSTILSHGWIITKEGKMSKSLGNVIDPNVLIDTYGVDALRYYLMADLSLF
FT                   RDAIFSEDNLIETYNTQLANSYGNMISRTLGMLKKYRNNIVPKYVGCVLKNDEKLENLI
FT                   NKNIELVQENINKYSIDKALNCIQEILVEANKYVEDNKPWELAKNQQKQELDSLLVHLV
FT                   KVIQVTTTLLSPILIEGSKKAVEQLNFDESFLTLASLASYDIFNYHKVNDSKPIFARII
FT                   VEKQ"
FT   gene            225569..226741
FT                   /locus_tag="UUR10_0188"
FT   CDS_pept        225569..226741
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0188"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60058"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZB03"
FT                   /protein_id="ACI60058.1"
FT                   /translation="MRLRYKILCASLGVVGVAGVIAAISIDYKQIPIVYANGSSSVLPL
FT                   IQALSEKHHKQDIISNAGGSSLGIIEAVEQRTNIGVSSRSPNIDFEQQSVEKSHVVYDK
FT                   WKQNQLKTYTIAWDGIGIIYKLNKTNHELVLTKDNIIKLFKAFTGNEQVSYYDLDPQLP
FT                   KTPILAYSRTGGANASGTAEAFLTSNPLISKKEFKKKYHDIYKVIEAGTYGKLIRSTEE
FT                   SNTQAWTNISKDNVDGSITYLSTGFILKNYDQIIAKGYKIAYLQNKDLKNYLPFEINEN
FT                   KQEIVNVAKTYGWYRPFNLVFSLNMQGIKNTKEFVWWLLTNKKVEKIIQESGFIPLTFE
FT                   QKNSMFLKPYKDEQSFQEAINNQSAKNNFFVSDFELIESNRINILGAKSA"
FT   gene            226741..228936
FT                   /locus_tag="UUR10_0189"
FT   CDS_pept        226741..228936
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0189"
FT                   /product="phosphate transport system permease"
FT                   /note="identified by match to protein family HMM PF00528;
FT                   match to protein family HMM TIGR00974"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59989"
FT                   /db_xref="GOA:B5ZB04"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR005672"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZB04"
FT                   /protein_id="ACI59989.1"
FT                   /translation="MSILNLNSQQTKKIIFNKKIKDKLAKTLVISFAWLFSICFIGLVV
FT                   FIIIRSIPGFEAYGLKNIFWSKNFNLADYAAGSSVWFPLAITLLVSFGAIIIAAPIGIK
FT                   TATFIKFRIKNKRLQKFFRVTILALAGIPSVIFGLFAIQSLGPAISFVFHIDTVQNITT
FT                   SMFMLAFIIIPTIISLTLSTYDGIDMRLIENGIGMGSSYTRSIYKIFKKEARGGIIIAI
FT                   IIALGRAIGETMAISMILSDQGYQNIFGTGFLQIMHSALRPLGAVISANMFAENGGEGL
FT                   RGLLYVYGIVLFVAIMILNGLVTYLTRKRSKKTYAWFIKLEKSLAYIVCFIPDQLKILY
FT                   EKITHRSQYKLHVNNLDNLNNYITDRIQNRKLKRLYTIHKLFFESLAFMVAFAFLAWIS
FT                   LDILVNGIKAINLPTSTVVAYTKNTTGQATINTLIIIIVAILIGLPFSLFVAIYINEYA
FT                   KNKWPKKVLLFFIDSFGSTPSIIFGMFGLVIFIEIFGFTSMGNIGKSLLAGALTITLVV
FT                   LPTFTRSIQQSLKAVPMSIRENAYGLGCSKWETIVKLVLPQAKKGIISAIVLTIGRIVA
FT                   ETAPLYLTAGLSSAQSITILNPGQTLTTRIYAQLYENNTNIAHNVMYESAFITLWLVIA
FT                   LIIIAHVIVPYFEFIKHDIKKWFKILKNYLRAPYMRDIKVFKPQIYQKHLYLTHNQAKI
FT                   MGYNESVNKVAKIGLKLYEIRYVDDEQIQKELLKVRG"
FT   gene            228941..229930
FT                   /gene="pstB"
FT                   /locus_tag="UUR10_0190"
FT   CDS_pept        228941..229930
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="pstB"
FT                   /locus_tag="UUR10_0190"
FT                   /product="phosphate ABC transporter, ATP-binding protein"
FT                   /EC_number="3.6.3.27"
FT                   /note="identified by match to protein family HMM PF00005;
FT                   match to protein family HMM TIGR00972"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59863"
FT                   /db_xref="GOA:B5ZB05"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005670"
FT                   /db_xref="InterPro:IPR015850"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZB05"
FT                   /protein_id="ACI59863.1"
FT                   /translation="MNDQKDNKEIQTIVPLNQKTNLNELDAKAIYDEFQKLNKYQRAFA
FT                   WLKLPKQKKAELKQFLNKKKTQVDLLKEDFNDANVFEIRNFNFWYMNRTKHVLHDLNLD
FT                   IKRNKVTAFIGPSGCGKSTFLRNLNQLNDLIEGTSHEGEIYFLGTNTRSKKISSLELRT
FT                   RIGMVFQKPTPFEMSIFDNIAYGPRNNGINDRKILEKIVEKSLKSAALWDEVKDDLDKA
FT                   GNALSGGQQQRLCIARAIALEPEVLLMDEPTSALDPIATAKIEELILELKKKYSIIIVT
FT                   HSMAQAQRISDETVFFYQGWIEEAGETKTIFIHPKNKRTKDYISGKIG"
FT   gene            229954..230610
FT                   /locus_tag="UUR10_0191"
FT   CDS_pept        229954..230610
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0191"
FT                   /product="PhoU family"
FT                   /note="identified by match to protein family HMM PF01895"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59854"
FT                   /db_xref="InterPro:IPR026022"
FT                   /db_xref="InterPro:IPR038078"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZB06"
FT                   /protein_id="ACI59854.1"
FT                   /translation="MATNYFLMKESQCDLLNDFKNFFQMVIDNQKLICDLLKNDQSSYK
FT                   ETYEKACFLEKKVNTTYADMLEEIMWIIQRDQPRASYLRFFIAGINSIKDLERISDHSE
FT                   IICEYFLETEFDEEQKNIFLTSFEISNQILSDLYDFFDKNEFSVNTIEHIKDLRSKSIM
FT                   KINKNLIQSLHDQSKLLDENSNYIKLILMYRHIERNIEHGINIVQNFGNVHITSR"
FT   gene            230770..230994
FT                   /locus_tag="UUR10_0192"
FT   CDS_pept        230770..230994
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0192"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59987"
FT                   /db_xref="GOA:B5ZB07"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZB07"
FT                   /protein_id="ACI59987.1"
FT                   /translation="MTYMLLTSSDLHCGSCSSNLYNVLEKIGAQNISVNILNSEFAFEF
FT                   EENKIADQDVIKEINKNGFKTNILEKYTY"
FT   gene            230998..233127
FT                   /locus_tag="UUR10_0193"
FT   CDS_pept        230998..233127
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0193"
FT                   /product="copper-transporting P-type ATPase"
FT                   /note="identified by match to protein family HMM PF00122;
FT                   match to protein family HMM PF00702; match to protein
FT                   family HMM TIGR01494; match to protein family HMM
FT                   TIGR01525"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59903"
FT                   /db_xref="GOA:B5ZB08"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZB08"
FT                   /protein_id="ACI59903.1"
FT                   /translation="MLKNNLIKKFQLLPINKRRYLISLTKTSIALLISIPLMVFEMLFM
FT                   FKSNLILGLDGYFIYGWIVFVLSIFIVFGLGFSFFKGAFFEVFKWKKPGMSLLVVISTC
FT                   VAFIYSTYSLISNTIIYKPKLHGFFETACMIIATMSVGQLVSDRIKLKANQDLQSLNDL
FT                   QVKKYNSYDLNTKQVSEKVVFQAEINEYALVKKGEIVPLDGVLYSQIAEVDESSLTGEA
FT                   RPILKTINNDIIAGSINVGDNFIFKITKLYNDSTIKKIINGVNQIASSKPKIQVVADKI
FT                   SLWFTPFILLMAILAFLLQAFVPSIQELPIAFLNLHGSNNDSNLYEKAAYVAVSVLVIS
FT                   CPCAFGIAVPLAVLIGAGHGAKSGITFNNSNIFEKIKKVNAIAFDKTGTLTYGKLQLKQ
FT                   VIGNDQFLDLIYQMESISLHPLAKSFVTYAIINNISMSTKLIDIKEVAGVGIIAKDIDG
FT                   NVYELTSEHYANENQFDFSLINQKSSTSTNLLASNIIFSINKKVQSILVFEDEIRADAY
FT                   ETIKVLHENNIETYMITGDNTKVAQKIANELGIKHFYAQVKPEEKANIIKEIQNQQKTV
FT                   MYVGDGINDLLALKQANVSISIGETNKATNAVADISLIKPDILNIYKVIKLTKTTKMFI
FT                   VSSLLWAFGYNLIFIPLALIGIIPPFISVLIMTTSDIAVVLNSLIFRLLKMRLVNRKQA
FT                   HKLDLKIIDKAMLHK"
FT   gene            complement(233593..235746)
FT                   /locus_tag="UUR10_0194"
FT   CDS_pept        complement(233593..235746)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0194"
FT                   /product="multiple banded antigen"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60127"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZB09"
FT                   /protein_id="ACI60127.1"
FT                   /translation="MSALTGCKKEINLNDKIIVENVALVDQDVQAKKAKIKLTFAQPIV
FT                   LENKAQASLKLTLNKKGTQQTKVVDLVLSDDKLKATTENLVEFATDVYNVTKLSLNNTE
FT                   ANVNSIKSSDLKIDVVSSVALVDQDVQAKKAKIKLTFAQPIVLENKAQASLKLTLNKKG
FT                   TQQTKVVDLVLSDDKLKATTENLVEFATDVYNVTKLSLNNTEANVNSIKSSDLKIKSSL
FT                   EEEINSLIIKKDIIDGIKNPDFITLDDIRYYLNHSFRYLRLSGLKNKLENSINDNYSSG
FT                   RYISKLDDFIGTIDKNEEEHVLKLKFNHLISYILILIEDKDKDEKLMEKDLDLLKQYCI
FT                   LINSKHINKDKIKSFVIQLKDAIYDYCAKHNIFTKKIIENKIAFKYIDFKNTNNNEPNS
FT                   FIGEFELEMGYNIKNGFREIKYQEYYDDGSKSIDYNDPIVLKLIFTNLDKSKISLDQYK
FT                   NNLEEIRNNIEIIEIRKSQLEKSPQLYLNQRFKDKNYYLMTVAFNYRFMYFFDKLLNIN
FT                   SGIQLNDAIYPFNYSKVKKIQENKLQNKELKLSKEEEQLLEKYKILKQQITKISSEIVK
FT                   SINIKNENGNNDKIEYLDLDEEFNMIPKPDEAIVSNIEFIEVNTKAKTGKIKLTFNAPV
FT                   KLTNEDRKDLVLDLLRSEPHGNYHSESINLVLSKDKMSATANLSELREEIYEVVSLKLN
FT                   GWDINLNNDIRNKKLKVETNPMR"
FT   gene            complement(236094..236363)
FT                   /gene="rpsO"
FT                   /locus_tag="UUR10_0195"
FT   CDS_pept        complement(236094..236363)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="rpsO"
FT                   /locus_tag="UUR10_0195"
FT                   /product="ribosomal protein S15"
FT                   /note="identified by match to protein family HMM PF00312;
FT                   match to protein family HMM TIGR00952"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60094"
FT                   /db_xref="GOA:B5ZB10"
FT                   /db_xref="InterPro:IPR000589"
FT                   /db_xref="InterPro:IPR005290"
FT                   /db_xref="InterPro:IPR009068"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5ZB10"
FT                   /protein_id="ACI60094.1"
FT                   /translation="MAVSKQQKHDLTVKFGGSASNTGKTEVQVAILSAEIDSLTTHMIE
FT                   NKKDKASKRGLYKKVAQRKKLLSYLQRVDIERYRALIKELNLRG"
FT   gene            complement(236474..237184)
FT                   /gene="rnc"
FT                   /locus_tag="UUR10_0196"
FT   CDS_pept        complement(236474..237184)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="rnc"
FT                   /locus_tag="UUR10_0196"
FT                   /product="ribonuclease III"
FT                   /EC_number="3.1.26.3"
FT                   /note="identified by match to protein family HMM PF00035;
FT                   match to protein family HMM PF00636; match to protein
FT                   family HMM TIGR02191"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60364"
FT                   /db_xref="GOA:B5ZB11"
FT                   /db_xref="InterPro:IPR000999"
FT                   /db_xref="InterPro:IPR011907"
FT                   /db_xref="InterPro:IPR014720"
FT                   /db_xref="InterPro:IPR036389"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZB11"
FT                   /protein_id="ACI60364.1"
FT                   /translation="MDNKKFLDFLKQNRIEPKNLSIYLEALTHKSYANEHKLTKNYQRL
FT                   EFLGDACVEWVISNFIFNYKIKDNEKMRSLDEGEMTRARSNMVRSEILSYAAKDLGLTD
FT                   FLMIGVGLEQDQSARMEKIYEDIFEAFIGAVAQDQGIKKVSLILEKTLIKYFREGQINY
FT                   QKDYKTIFQEQAQRINKKPIMYKLVRNEGDKKEVHLVWNDLIYGIGIASTRKEAEILAA
FT                   KNAILKLDDYTKKA"
FT   gene            complement(237174..238169)
FT                   /gene="plsX"
FT                   /locus_tag="UUR10_0197"
FT   CDS_pept        complement(237174..238169)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="plsX"
FT                   /locus_tag="UUR10_0197"
FT                   /product="fatty acid/phospholipid synthesis protein PlsX"
FT                   /note="identified by match to protein family HMM PF02504;
FT                   match to protein family HMM TIGR00182"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59823"
FT                   /db_xref="GOA:B5ZB12"
FT                   /db_xref="InterPro:IPR003664"
FT                   /db_xref="InterPro:IPR012281"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5ZB12"
FT                   /protein_id="ACI59823.1"
FT                   /translation="MKKIKILLDTMGYENTLEHVIKAAKDFYYQHEDDLEIILVGNEQL
FT                   IKPLLDNDWRLFPIVHTEVSIEQNDTILSARKKQNSSMHLALRYLKDKQANGMLTAGNS
FT                   AVFVYNAYATIGLLEHIKKPAFMPFVPTIDGGVTNLLDVGASIDLDGRDLFNFAIMANT
FT                   IAKMRTPNPRVGVLNIGTEDHKGLPYHQEANELLKTSNLNYVGFVEPKTILEREVDVLV
FT                   ADGFSGNIALKTMEGVGKTISNFLKNEYKKPKNLFAALLSKPIFKKMKKAFDYKEHAGA
FT                   FVLGLDGILVKTHGSADYQQFMSALKILYETIKADVLNEIKKDLNNYYGQ"
FT   gene            complement(238174..239868)
FT                   /locus_tag="UUR10_0198"
FT   CDS_pept        complement(238174..239868)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0198"
FT                   /product="DAK2 domain protein"
FT                   /note="identified by match to protein family HMM PF02734;
FT                   match to protein family HMM TIGR03599"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60197"
FT                   /db_xref="GOA:B5ZB13"
FT                   /db_xref="InterPro:IPR004007"
FT                   /db_xref="InterPro:IPR019986"
FT                   /db_xref="InterPro:IPR033470"
FT                   /db_xref="InterPro:IPR036117"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZB13"
FT                   /protein_id="ACI60197.1"
FT                   /translation="MKTIKLDLFQKMLYAGAKILEIECQYINDLNVFPVPDGDTGSNMK
FT                   TTTAGAIVAIKEAEITNFSQLAKIFSRGLLMNARGNSGVILSQIFRGFMDALNNDSDEV
FT                   NIDQLKQAFNSAKDKAYASVSTPIEGTILTVIRVVKERINEYDNFDSVEDLFAFATKEA
FT                   EIILEKTPEMLPSLKEANVVDSGGYGLVSFLKGMYQSLTNIFDEKLIIKNEEENIKSKT
FT                   KPLDLEVVHKEKEEGFGYCSEIILSLKKKIVPNSANKSFFELEKYKAELAKIGDSIVAI
FT                   QDEDLVKVHLHTLTPYKFLQISQKYGEFDKVKIDNMTNQFYENLERKGLSTKKENKATL
FT                   NMEQKIIATVPSEKFKKMFIEEHGIENVIVTETEGAPSIQRFVDEINTTNAAQVFIVTD
FT                   DSNIVLAAEQASKIAAENNVLVSVIGAYNVFEALLAISHFEQQNDYRTNFKTMNKIVKK
FT                   ARSGVISTSIKDVKYPHITVNKDDYIGIINKKIVASKKTAYEALLTTIEMLIESLKKPE
FT                   ICYIYYGINASQTDVHQIEKYISEKYGIICDLRYTGQSLYHYYIGIQ"
FT   gene            complement(239883..240149)
FT                   /locus_tag="UUR10_0199"
FT   CDS_pept        complement(239883..240149)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0199"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59974"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZB14"
FT                   /protein_id="ACI59974.1"
FT                   /translation="MLKKTKFDSQLVKSLITSSILKVPGIFSVDISDKLSDFNQNRFVI
FT                   KISLHEDVVNVLSVANEARNLVYYELSKQLNDDSVVINIIINC"
FT   gene            complement(240252..240869)
FT                   /locus_tag="UUR10_0200"
FT   CDS_pept        complement(240252..240869)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0200"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60018"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZB15"
FT                   /protein_id="ACI60018.1"
FT                   /translation="MYKEILIKNSSANYIVSDPFENMIDAFPIILFENNNYVYYLAGQN
FT                   AYLPSQMRRWKNWDEILVNKNDLSKEDFLYKDIYINLFQIYITKKTNLTKYTNNQLNFV
FT                   LTKNDFKKELWDKLIYIPIKKLINTQKPQILLFEIFKKQDQKYHSTLLFANKNVLKKFY
FT                   LNSATRVNHEDVINLAFEKLETLQKLSKTTKVKKHLTNLKKY"
FT   gene            241005..241199
FT                   /gene="rpmB"
FT                   /locus_tag="UUR10_0201"
FT   CDS_pept        241005..241199
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="rpmB"
FT                   /locus_tag="UUR10_0201"
FT                   /product="ribosomal protein L28"
FT                   /note="identified by match to protein family HMM PF00830;
FT                   match to protein family HMM TIGR00009"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59763"
FT                   /db_xref="GOA:B5ZB16"
FT                   /db_xref="InterPro:IPR001383"
FT                   /db_xref="InterPro:IPR026569"
FT                   /db_xref="InterPro:IPR034704"
FT                   /db_xref="InterPro:IPR037147"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5ZB16"
FT                   /protein_id="ACI59763.1"
FT                   /translation="MARRDQLTGKGPLSGNTRSHAMNHSKRRWNVNLQKATIKTENGSQ
FT                   RVLVSAKTLKTLKKHNLLA"
FT   gene            complement(241443..242135)
FT                   /locus_tag="UUR10_0202"
FT   CDS_pept        complement(241443..242135)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0202"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60067"
FT                   /db_xref="GOA:B5ZB17"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZB17"
FT                   /protein_id="ACI60067.1"
FT                   /translation="MKQEYKHLKYFFSRQGWKVSNHGQWITPLIAIFFIAFALWMFALT
FT                   IDVPKYNAALIVNSNFYEQKLFGGFYYLVGGTPYTSSADTISVSNIHITKQAIAATTLT
FT                   LLFYTLLLINTLIGQFKAKKIVVIPWIIMLCATILLVSELTVGFGYKLDNQQFDLLRRN
FT                   PFVLNDQISVFYKIAFLKDLKYANTNLTQFAKPLIGLYAFVNILSALAYFVLVFINIPN
FT                   AIIQQRVW"
FT   gene            complement(242246..242548)
FT                   /gene="rpmA"
FT                   /locus_tag="UUR10_0203"
FT   CDS_pept        complement(242246..242548)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="rpmA"
FT                   /locus_tag="UUR10_0203"
FT                   /product="ribosomal protein L27"
FT                   /note="identified by match to protein family HMM PF01016;
FT                   match to protein family HMM TIGR00062"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59937"
FT                   /db_xref="GOA:B5ZB18"
FT                   /db_xref="InterPro:IPR001684"
FT                   /db_xref="InterPro:IPR018261"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5ZB18"
FT                   /protein_id="ACI59937.1"
FT                   /translation="MNKLYWLTDLQLFASKKGVDSSKNGRDSNPKYLGAKLGDGQSTKA
FT                   GQIIYRQRGNKIYPGLNVGQGKDHTLFAKTAGVVKYTKFMGDKTKVSVLPKEDNK"
FT   gene            complement(242554..242862)
FT                   /locus_tag="UUR10_0204"
FT   CDS_pept        complement(242554..242862)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0204"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF04327"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60250"
FT                   /db_xref="InterPro:IPR007422"
FT                   /db_xref="InterPro:IPR036764"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZB19"
FT                   /protein_id="ACI60250.1"
FT                   /translation="MIKINHYPNALLVKGHANFDEHGKDIVCAGVSAIIMGALNWFDQQ
FT                   KTTIKVEQGFILIIIDDNNQLYRQYLELIIIQLKAIYFKYQSYIELHEYKQQYKRGL"
FT   gene            complement(242868..243170)
FT                   /gene="rplU"
FT                   /locus_tag="UUR10_0205"
FT   CDS_pept        complement(242868..243170)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="rplU"
FT                   /locus_tag="UUR10_0205"
FT                   /product="ribosomal protein L21"
FT                   /note="identified by match to protein family HMM PF00829;
FT                   match to protein family HMM TIGR00061"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60348"
FT                   /db_xref="GOA:B5ZB20"
FT                   /db_xref="InterPro:IPR001787"
FT                   /db_xref="InterPro:IPR018258"
FT                   /db_xref="InterPro:IPR028909"
FT                   /db_xref="InterPro:IPR036164"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5ZB20"
FT                   /protein_id="ACI60348.1"
FT                   /translation="MFAIFQTGGKQYKVQQGEKIYVEKLDLEVGSKISFDQVIMVEGSV
FT                   GTPFVKNAVVNATVLKQGKQKKINIIKFKSKKHHLKRQGHRQPYTQLVIDSISVK"
FT   misc_feature    complement(243198..243276)
FT                   /note="Ribosomal protein L21 leader"
FT   gene            243477..244049
FT                   /gene="gmk"
FT                   /locus_tag="UUR10_0207"
FT   CDS_pept        243477..244049
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="gmk"
FT                   /locus_tag="UUR10_0207"
FT                   /product="guanylate kinase"
FT                   /EC_number="2.7.4.8"
FT                   /note="identified by match to protein family HMM PF00625;
FT                   match to protein family HMM TIGR03263"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59784"
FT                   /db_xref="GOA:B5ZB21"
FT                   /db_xref="InterPro:IPR008144"
FT                   /db_xref="InterPro:IPR008145"
FT                   /db_xref="InterPro:IPR017665"
FT                   /db_xref="InterPro:IPR020590"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZB21"
FT                   /protein_id="ACI59784.1"
FT                   /translation="MKRGKLIVFSGPSGVGKHTILSKIIDRKELNLAYSVSMTTRKKRE
FT                   GEINGVDYYFVNDEEFKKAISNNELIEWAEFVGNKYGTPRFVVEKLRNEGKNVILEIEV
FT                   VGALQVLELFKNDDLISIFLLPPSLDELKNRLLKRNTETLETIEKRIQKASHELSIKDH
FT                   YKYNIINDNPDHAANQLAEIILDEIKR"
FT   gene            244033..245040
FT                   /locus_tag="UUR10_0208"
FT   CDS_pept        244033..245040
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0208"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59929"
FT                   /db_xref="GOA:B5ZB22"
FT                   /db_xref="InterPro:IPR004383"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR040072"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZB22"
FT                   /protein_id="ACI59929.1"
FT                   /translation="MKLNDNSLKQIYSLSLNELKEELLKLNLKPFISKQIYSWIYQKRI
FT                   FDFDKFSNISKSNQSILKENFDNNLLTINEYQSNSDGSIKFKLLTTINLIINCMIIKFE
FT                   NGFLIKINPFGINDKKEIINLSTNELVLQTLLVQQFLDQHKLGKITNVIVKGSQDSLLN
FT                   MEAVSNFINIINDENGLNIGKRKIVVWTSGVDVDLIKWGQLQNQIELIISLNASNSQVY
FT                   KKLMLNKTNQNWSFIKLIEQIKTYTEMTNNRVVLEYLLIDKINDNLDYANELVELLKNI
FT                   LCYVLLIPYNLNHKTSDNLEEFFNILSINKIRISKRVRKSNDLDISFTQLKIKE"
FT   gene            245044..245787
FT                   /locus_tag="UUR10_0209"
FT   CDS_pept        245044..245787
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0209"
FT                   /product="protein phosphatase"
FT                   /note="identified by match to protein family HMM PF00481"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60175"
FT                   /db_xref="GOA:B5ZB23"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR015655"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZB23"
FT                   /protein_id="ACI60175.1"
FT                   /translation="MNFGFISDIGSQRKHNDDCALVIQNEHQQTLLIVCDGLGGYKGGA
FT                   AASHITLETIKDNFLATNFNEYDEQQIRKWYIKVIKLAQIEIDRAVLLDKDVYNMGTTV
FT                   VASIIINDFVYTLNIGDSRAYLLSNNQSSQISRDHNLLQVLHERKVGPEVYEKHEKNLF
FT                   SLTQFVGRTSNVVLSYDLFVTKLHHNEIIVLTSDGFHNYFELNDLYDKLIVTNQQTNNQ
FT                   ILQQLINQAIDNGSNDNLSLAFLIF"
FT   gene            245792..246952
FT                   /locus_tag="UUR10_0210"
FT   CDS_pept        245792..246952
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0210"
FT                   /product="serine/threonine kinase"
FT                   /note="identified by match to protein family HMM PF00069"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60093"
FT                   /db_xref="GOA:B5ZB24"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZB24"
FT                   /protein_id="ACI60093.1"
FT                   /translation="MREQIQTNSILNHKYKVVKHLADGGFSKVYLCCFLSDETKFIVVK
FT                   VLDISDEKQQMVVYDELRISNLIKNSNSDKRSYIMEYYEYFESGSLETDDKRIYIVFEY
FT                   IDGLTLREYLDEFKTVTYVKAVEIIRQVALGVSFFHSCNPQIIHRDLKPENCMINKTLS
FT                   KIKIIDYGAASVFYNREDLTKDQEIKCTIIYASPKLLSLGQKVKEQASKGLNKNALSLI
FT                   NDALGVNYDIHSLGVMLYELITGTNPFSEHTIKDDRDYLEKWTTYDVEPLSSINKTIPK
FT                   GIDNILIRCFAWKKEDNKLLYKDIYTLIDDLNNVMDPESSLNQDYIKPLNKLRIYRKNV
FT                   AGLYEIKGKDRKWYLQKWFIILVGCLSIILIILLIIILSFKKSGAI"
FT   gene            246955..247860
FT                   /gene="rsgA"
FT                   /locus_tag="UUR10_0211"
FT   CDS_pept        246955..247860
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="rsgA"
FT                   /locus_tag="UUR10_0211"
FT                   /product="ribosome small subunit-dependent GTPase A"
FT                   /note="identified by match to protein family HMM PF03193;
FT                   match to protein family HMM TIGR00157"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60223"
FT                   /db_xref="GOA:B5ZB25"
FT                   /db_xref="InterPro:IPR004881"
FT                   /db_xref="InterPro:IPR010914"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030378"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5ZB25"
FT                   /protein_id="ACI60223.1"
FT                   /translation="MRAKITSVIVNNFYVYIYDLKIETKAIPKGIFKHDSHELKPMVGD
FT                   DIEVELVDGVYLIVKIYDRYNQLIRPKVANVDIVLVVASIVQPDLNTLTLNKYLAFYEA
FT                   RNVKNVAIGLSKYDLASDSLKQKVDQLILDYQRNNYKVFVLTNEHDISLLKKFIKKHTL
FT                   CLAGNSGVGKSTLINKLDPSIKQRTQEISQFLNRGKHTTTSTKLISFANGFLVDTPGFG
FT                   NLEVNLTKNEMANAFSDFANYARFCKFSNCLHIDEPHCAIKKAVNDDQIVNWRYDDYLK
FT                   IMKKLPNDVLEIKTRNQNKK"
FT   gene            248058..249581
FT                   /locus_tag="UUR10_0212"
FT   CDS_pept        248058..249581
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0212"
FT                   /product="ammonium transporter"
FT                   /note="identified by match to protein family HMM PF00909"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60207"
FT                   /db_xref="GOA:B5ZB26"
FT                   /db_xref="InterPro:IPR018047"
FT                   /db_xref="InterPro:IPR024041"
FT                   /db_xref="InterPro:IPR029020"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZB26"
FT                   /protein_id="ACI60207.1"
FT                   /translation="MSTITTTSWGIDPNIYFSKHELTWVPATADANTLALAHFNPTSTL
FT                   LVALAIAFVLLMTPGLALFYGGLTRRKSTLTIINQCVASLGVTTLIWIFGGFSLAFGPS
FT                   VGKGIIGDISTYFAFRNLLFADGWSGDAGIVFANFTNGVPLILFFAYQLAFAIITPPLM
FT                   VGAFADRMKFKNYLVFLVLWQYLIYIPFAHWIWGQGFLAAAGVIDFAGGIVIHTSAGFG
FT                   ALAASLVLGKRVLLKNDKSRPNNIPMTILGATLLFFGWFGFNVGGSGFVSGGNAAVWSL
FT                   ATSAWISTIIALAIGMIGWAILETIFNKNHKPTGVGLVTGAIAGLATITPAAGYVPIWA
FT                   SVPIGVAAVLVCYASAKTLHHFHKIDDTLEVWGVHGMGGVTGSLLIGAFASKSVNPSIM
FT                   YEAIGPETTGILFGVQLGAMLLAAVYAFVFTILLVYITRPRLSARQQLGHIDYINHGED
FT                   AYAFDIEIPSEKEMEQYELADSSWHSSTGVKHPLVKKANLQAGESTSSH"
FT   gene            249754..251316
FT                   /locus_tag="UUR10_0213"
FT   CDS_pept        249754..251316
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0213"
FT                   /product="ammonium transporter"
FT                   /note="identified by match to protein family HMM PF00909"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59804"
FT                   /db_xref="GOA:B5ZB27"
FT                   /db_xref="InterPro:IPR018047"
FT                   /db_xref="InterPro:IPR024041"
FT                   /db_xref="InterPro:IPR029020"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZB27"
FT                   /protein_id="ACI59804.1"
FT                   /translation="MSTWGLNKDIYFSTHELTWVPADASQSTLDAIGFNPTNTLLVALA
FT                   IAFVLLMTPGLALFYGGLVRRKSTLTIINQCVASLGITTLIWIFGGFSLAFGPSVGKGI
FT                   IGDISTYFAFRNLLFADGWSGGAVLVFANFTNGVPLILFFAYQLAFAIITPPLMVGAFA
FT                   DRMKFKNYLVFLVLWQYLIYIPFAHWIWGQGFLAAAGVIDYAGGIVIHTTAGFGALAAS
FT                   FMLGKRTMLVTDKNRANNLPMVVLGATLLFFGWFGFNVGGAGFVKDSSNHISQAISSWL
FT                   NTIIALAIGMVGWITLETIVNKNHKPTTVGLVTGAIAGLATITPTAGFVPIWASVPIAI
FT                   MGVLVCYSIAKLLHHFHFDDSLEVLPVHGMGGVVGSLLIGAFATDTVANGIKYNAVGLD
FT                   SSGNPVYGLLFGLQLGAVALAIVWAFAFTCLIIYISKPRLSAREQLGHIDYINHGEDAY
FT                   KFDFLIPSEDEMASYEGFDQVWEQKVSGCKKADLASKLVPVFMEHESDCTWQSKSRECT
FT                   KSK"
FT   gene            251433..252749
FT                   /locus_tag="UUR10_0214"
FT   CDS_pept        251433..252749
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0214"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59736"
FT                   /db_xref="GOA:B5ZB28"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZB28"
FT                   /protein_id="ACI59736.1"
FT                   /translation="MPRINTQVFNENDDKNTIKNNNDKTIDQNKIRADIEHARLLETKE
FT                   YNANFYPSNDPQYTLIKKQDDCAKLKPTLNFDDGDQLITIAPTQNYANLKLRDVEVDQK
FT                   NSIIYEPKKELINQNLIQEDLNNPHLSVSQKPNGFIQKTKSFIPQNISEFIYHNEDIAD
FT                   QNQYENNLTFSQLEQKVNQKNTPDFYLKEIHAIRNKIIVWTMLLAIGMGLLFYLVYEVV
FT                   VNHFNPWIFLPVSVYCVLMIFFLALSCSNFANFKKEMHYQQNNFDRTKATNFIVGIYRK
FT                   LVVMHINVNWIASYLYLTSLFMILGVFVVSYFMNLYYNAAIGSRFGDLIVKIPAIVSEQ
FT                   FTQKASINKNPLWAIIGLGVILGLTFIIHLWLIFNAHHRVNHIQSYYVNEIISGEEIIQ
FT                   LKKQANRRGLVIFLVLSIILGLIFYLMYTILKRKYSIKK"
FT   gene            252763..254328
FT                   /gene="fhs"
FT                   /locus_tag="UUR10_0215"
FT   CDS_pept        252763..254328
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="fhs"
FT                   /locus_tag="UUR10_0215"
FT                   /product="formate--tetrahydrofolate ligase"
FT                   /EC_number="6.3.4.3"
FT                   /note="identified by match to protein family HMM PF01268"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59985"
FT                   /db_xref="GOA:B5ZB29"
FT                   /db_xref="InterPro:IPR000559"
FT                   /db_xref="InterPro:IPR020628"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZB29"
FT                   /protein_id="ACI59985.1"
FT                   /translation="MPKIIEEVINKKGLLIDDYELYGNEIAKVKSIKKTNKNDPKLIVI
FT                   TAMNPNPAGEGKTTTTIGLVDALNKHGYKAIGALREPSMGPVFGMKGTGSGGGLSFLKP
FT                   FDKINLHFSGDFHAITAANNLIVAVIENEIHNKSSMQIDPQKILIKRCLDVNDRSLRNI
FT                   EYNLNHYQTRTGFNITAASDLMALFCLAKDHKDFENKLAETIIAYNIVNQPIRICDLEL
FT                   TKAIMTILDDALYANLVRTNEDNPVFVHGGPFANIAHGCNSIIATKNALALGDYVVTEC
FT                   GFGSDLGLEKFMNIKMASLDLKPDLIGLVISLKSIAYHAQTNEKDYIKQGFANVLCHIN
FT                   HIKKYNVPFIVYINVNTNTDSEEDLLALEKLLDENQIEHARSYAYSYGSKKSEEITKKT
FT                   VALTNQVNDHQLKLIYDIKDHLSYKLKKICENVYGADGYELSYEAKEQLNRYEHLDFYL
FT                   CIAKTPYSISDDAKLLNNPKNFKIHIERFEINYAAKLIIAITTTIYRMPGLNKEPAAKN
FT                   FVMK"
FT   gene            254459..255211
FT                   /locus_tag="UUR10_0216"
FT   CDS_pept        254459..255211
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0216"
FT                   /product="tyrosine recombinase XerC"
FT                   /note="identified by match to protein family HMM PF00589"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60177"
FT                   /db_xref="GOA:B5ZB30"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZB30"
FT                   /protein_id="ACI60177.1"
FT                   /translation="MKDFIRYTKKRNLSLNTIRTYESVLKHYEPVLDSWIKIRNKIINS
FT                   NFKPRTIHLHKNVLLSFFEFKKLKRYLQNLKLLKLPQIEMKYFDVISKNNLYKKTDILD
FT                   DDSLEIKKYKTIIRFLFETGIRAHELFFLEPVNNRLYVLGKGNKKRQIFFVKQTFEQLQ
FT                   KFYENLKGFETTKTLRLYIKKIIGKNFTPHSLRRSFATFMLIKGANPKTVMLQMGHANI
FT                   QTTFSYLNLNEQTNRRIYNKIMYQNDAE"
FT   gene            255425..257773
FT                   /locus_tag="UUR10_0217"
FT   CDS_pept        255425..257773
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0217"
FT                   /product="amino acid antiporter"
FT                   /note="identified by match to protein family HMM PF00324"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60107"
FT                   /db_xref="GOA:B5ZB31"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZB31"
FT                   /protein_id="ACI60107.1"
FT                   /translation="MINNKIKEVKIKKKLEKNKKVSLMGFVLLTASAIIAFYTFPSLST
FT                   AGWIAIIFAFITAMCWFIPIGIAAAEMATIKGWTEGGIFTWVRNLLGPRNGFIVTWLQF
FT                   QVTFGFVAMILFVLSSFSFAFAGADGYNYFNTLKLGTTLNQATSVNFSKNFNNGALYGI
FT                   GIVVVAGLIFMSLLGQKRTHQFGQVALIIGILLPFFIILGFQIYTVATMPDPLYFIGKH
FT                   FQKEPHLDPSVTGTSYELNKTFMSSVVMASFMAFSFSLHGVEVSAIAANRMDNPSKKYP
FT                   QAMMFVVISALVCIIIGSVMISMTVPTSTLSFNGGLVQTIMFNLSVGGIDVKLPDGTVA
FT                   HYKTLAHAYSVVETQYGTAAANQVMYQFVYGHPINTGSDLARSDLLTLTSEVNDPLKNP
FT                   SLFISVMNVETNKMAMQGLQAITFFIGIGVFVEVAVWMSNLSTGLNYAMRKAHFPVWVT
FT                   YRLKNGSALTVAILWIALLMCIFAIYMFGYNSLMQYKGQTISDVLANEIRIDQNQKEPM
FT                   ALLSNQNLDEIKLMARSIYEHSHAPGAQANVLHFDFNKHANSEVNAIYEKIKDYIGINA
FT                   VASGTPASITNISFISNVVSQISMYYIGYNIFLIGYLRYVFKANWLRREFRVKWPWLQI
FT                   SLALLAMGVNTFAVVATYLPAAPELYPGQEAYYVFISIALPMFVCTLLLGLFIYLINYA
FT                   WNKKRGINLSEHSNLTNVDQNVLDVINNWHLYKNQKEFAKFERHVQLLQQKQVIVRTTK
FT                   DKVQRELVANEMQYLAAEIATRFAPEEEH"
FT   gene            257948..259096
FT                   /locus_tag="UUR10_0218"
FT   CDS_pept        257948..259096
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0218"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59841"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZB32"
FT                   /protein_id="ACI59841.1"
FT                   /translation="MKKNHKKWLLMTTPVLLIGGLSTLALTSCKDEKKSNPKPDKQSTI
FT                   EEYKLSLSSVETGFNEAKLIFDNNDSFKSLDNFKVILKNIQNTNEVVEANNLSATIENQ
FT                   KLVLKLNNLQDGQTYKIDKILYQTNKEVILSNNQVFTTKTKPKIEYEVQEKILKLDDKT
FT                   YYVVLKVKDPQNLNEPTKEILKSVTFTSKISNVANLKNAILENQRPYVKEDYSEIQIKL
FT                   PRVPVISEKIEITANNSLFKSFTITVGEKHIENVEKIIDITKKVFGNQELKSISITKQN
FT                   SSSANITLSLKLNGNSIIAGANKLINKKDKAIKFSFFVKNKATNTIKEFNFNEKSKPIG
FT                   SYQFTLNGLDANSDFVIEDIRYDDKSIKITEELLASLSFSTK"
FT   gene            259153..259470
FT                   /locus_tag="UUR10_0219"
FT   CDS_pept        259153..259470
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0219"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60025"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZB33"
FT                   /protein_id="ACI60025.1"
FT                   /translation="MKKWQKILTIALPTSLLVAIPIVAASCSTKSEAQKEFEKTYKEYL
FT                   SWLDKLASKMPVLKEAFSTLKEEINKQINKSEKLSDEAYKALTASLKVSIDGMKKTLGQ
FT                   N"
FT   gene            259480..259923
FT                   /locus_tag="UUR10_0220"
FT   CDS_pept        259480..259923
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0220"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59773"
FT                   /db_xref="GOA:B5ZB34"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZB34"
FT                   /protein_id="ACI59773.1"
FT                   /translation="MNQNKIVNKKDLDIALANLILSIGVVVFIIIGAILVHLGIYYMVY
FT                   SYYGSPYLTQDIATTNVVNAWAMYNAGVAFLVIFALIEIASFALFVTTTVNVGLNLKRQ
FT                   ENFVLPFVFGILGCLGIIPIIGSIIIYVQLNKFYKQQNEPSLI"
FT   gene            260097..261650
FT                   /locus_tag="UUR10_0221"
FT   CDS_pept        260097..261650
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0221"
FT                   /product="putative membrane protein"
FT                   /note="identified by match to protein family HMM PF02608"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60148"
FT                   /db_xref="GOA:B5ZB35"
FT                   /db_xref="InterPro:IPR003760"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZB35"
FT                   /protein_id="ACI60148.1"
FT                   /translation="MRKIKLNKKIILASVIGTLGVALVPTALVACSQNKTKSDSKNLTL
FT                   NNFYGRPSSDGDDAYQAIYESKIQDGARMLGLISFRHKNPISKYFNSPKDNQQVSAILI
FT                   DEIYDLQTGKDRIASITYRADQAAFLAGIAAAYYLNSNQNVFGKDNKLTWGGFVGIHLP
FT                   STTRFIQGFKFGIQWANEKLKNKKVKQTENNEEKEWINVEQVFATDYQSGDFSPTSDKA
FT                   KTIVNQLVSNNVDLILPVAGLQIDYATTTAAESSKPIVVVGVDTEQELDDNTNKARISE
FT                   NNKTLANGKTIIFSIVKRLDLAFKGALLKASEGAQLTNDINKDAYKLGTHTEASFNKNT
FT                   YVDNTALVELSKAGHQYLIDAIKLSGLKEVNDYKTIVEKIQEDPLFKLLSQTGTKKLDE
FT                   VATKSQQGDWVLKSEYQNLSFIQLQKMLGGLVYVDQKNELYPYELSNSFYLEKDPNKRQ
FT                   ASKAFYNYWNAKDANQINLVKIFLGQSVDVLKDKSFSESIYKGLEEFYKSKNIIIPKLY
FT                   "
FT   gene            261848..262411
FT                   /gene="infC"
FT                   /locus_tag="UUR10_0222"
FT   CDS_pept        261848..262411
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="infC"
FT                   /locus_tag="UUR10_0222"
FT                   /product="translation initiation factor IF-3"
FT                   /note="identified by match to protein family HMM PF00707;
FT                   match to protein family HMM PF05198; match to protein
FT                   family HMM TIGR00168"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60110"
FT                   /db_xref="GOA:B5ZB36"
FT                   /db_xref="InterPro:IPR001288"
FT                   /db_xref="InterPro:IPR019813"
FT                   /db_xref="InterPro:IPR019814"
FT                   /db_xref="InterPro:IPR019815"
FT                   /db_xref="InterPro:IPR036787"
FT                   /db_xref="InterPro:IPR036788"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZB36"
FT                   /protein_id="ACI60110.1"
FT                   /translation="MNTPNNQRHMSSNNDARKNQPLINDQIRFRTMVVIDDHGNNLGEM
FT                   NRIDALNLATSKNLDLVVIAKKGNIPVTKILDYGKYKYEQKRRQKESRKNQTIIKVKEI
FT                   KIKPMIGEHDLKVRAENAKRWLEDKDNVKFVIEARGRMCTKDEFILQAYEKFIDLIKDY
FT                   GTVVQANKKVSNYRYETIIEPIKK"
FT   gene            262426..262620
FT                   /gene="rpmI"
FT                   /locus_tag="UUR10_0223"
FT   CDS_pept        262426..262620
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="rpmI"
FT                   /locus_tag="UUR10_0223"
FT                   /product="ribosomal protein L35"
FT                   /note="identified by match to protein family HMM PF01632;
FT                   match to protein family HMM TIGR00001"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60288"
FT                   /db_xref="GOA:B5ZB37"
FT                   /db_xref="InterPro:IPR001706"
FT                   /db_xref="InterPro:IPR018265"
FT                   /db_xref="InterPro:IPR021137"
FT                   /db_xref="InterPro:IPR037229"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5ZB37"
FT                   /protein_id="ACI60288.1"
FT                   /translation="MAKIRQKTKRAAAKRFSITKNGKLKRKHAYRSHLALGRSTKAKRH
FT                   LRKDAIMSTSDTKRYTQCL"
FT   gene            262675..263037
FT                   /gene="rplT"
FT                   /locus_tag="UUR10_0224"
FT   CDS_pept        262675..263037
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="rplT"
FT                   /locus_tag="UUR10_0224"
FT                   /product="ribosomal protein L20"
FT                   /note="identified by match to protein family HMM PF00453;
FT                   match to protein family HMM TIGR01032"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60204"
FT                   /db_xref="GOA:B5ZB38"
FT                   /db_xref="InterPro:IPR005813"
FT                   /db_xref="InterPro:IPR035566"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5ZB38"
FT                   /protein_id="ACI60204.1"
FT                   /translation="MRVKGGSVTRQRRKRWLEKAEGSWGTRNTSYRIARQTVIRAAEYA
FT                   YRDRRNKKRDFRKLWISRINAAVRELGYTYSQFMNALVKANVVTKDGQGLNRKMLSELA
FT                   INNPEAFNQLVNKVMK"
FT   gene            263257..263562
FT                   /gene="rpsJ"
FT                   /locus_tag="UUR10_0225"
FT   CDS_pept        263257..263562
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="rpsJ"
FT                   /locus_tag="UUR10_0225"
FT                   /product="ribosomal protein S10"
FT                   /note="identified by match to protein family HMM PF00338;
FT                   match to protein family HMM TIGR01049"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59807"
FT                   /db_xref="GOA:B5ZB39"
FT                   /db_xref="InterPro:IPR001848"
FT                   /db_xref="InterPro:IPR027486"
FT                   /db_xref="InterPro:IPR036838"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5ZB39"
FT                   /protein_id="ACI59807.1"
FT                   /translation="MNQELRIRLESYDHRLLDDTVKTIVDISNSTGSKLRGPIPLPTKK
FT                   EIFTILRSPHVNKSSREQFERRTHKRLIILENPQPKTMEALKRLSVPFGVEVTFKI"
FT   gene            263585..264286
FT                   /gene="rplC"
FT                   /locus_tag="UUR10_0226"
FT   CDS_pept        263585..264286
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="rplC"
FT                   /locus_tag="UUR10_0226"
FT                   /product="50S ribosomal protein L3"
FT                   /note="identified by match to protein family HMM PF00297;
FT                   match to protein family HMM TIGR03625"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59722"
FT                   /db_xref="GOA:B5ZB40"
FT                   /db_xref="InterPro:IPR000597"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR019926"
FT                   /db_xref="InterPro:IPR019927"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5ZB40"
FT                   /protein_id="ACI59722.1"
FT                   /translation="MKSLLGTKVGMTQVFTETGKAVAATVIYVEPNKVLAVKTNEKDGY
FT                   NAIQIGYETVKEKALNKPLLGQFKKANSDPKRHIKEFRDVVAEVGAELTVSEFEPGQLV
FT                   NAQAYTKGHGFTGSIKRHNFSMGPMGHGAGYPHRYVGSIAKGRGGSQAQRVFKGTKLPG
FT                   HYGHELVTTKNLLVLDVKANENLILIKGAIPGPKGSIVLLKSAKKVGHIVSDPQVVNYL
FT                   ANKASSSEANK"
FT   gene            264297..264932
FT                   /gene="rplD"
FT                   /locus_tag="UUR10_0227"
FT   CDS_pept        264297..264932
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="rplD"
FT                   /locus_tag="UUR10_0227"
FT                   /product="ribosomal protein L4/L1 family"
FT                   /note="identified by match to protein family HMM PF00573"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59811"
FT                   /db_xref="GOA:B5ZB41"
FT                   /db_xref="InterPro:IPR002136"
FT                   /db_xref="InterPro:IPR013005"
FT                   /db_xref="InterPro:IPR023574"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5ZB41"
FT                   /protein_id="ACI59811.1"
FT                   /translation="MAKIKLLSIDGNFAKELEVTSDLFVEVPHKQAMFDSVLAENAAER
FT                   QGTHSTLTKGEVRGGGKKPWRQKHTGKARTGSTRNPHWTGGGVVFGPKPNRNYNLKVNA
FT                   KVRLLAFKSALTIKLNEGKMLGLVANSDLETPSTKKMVNFINNANLENQKVLLVIADHF
FT                   SNIKKSTNNLQKVTTKLWYQVSVRDLMHANVVVVAEEAFTNYARKVSK"
FT   gene            264935..265252
FT                   /gene="rplW"
FT                   /locus_tag="UUR10_0228"
FT   CDS_pept        264935..265252
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="rplW"
FT                   /locus_tag="UUR10_0228"
FT                   /product="ribosomal protein L23"
FT                   /note="identified by match to protein family HMM PF00276"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59965"
FT                   /db_xref="GOA:B5ZB42"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR012678"
FT                   /db_xref="InterPro:IPR013025"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5ZB42"
FT                   /protein_id="ACI59965.1"
FT                   /translation="MELTRVILHPYTTEKTYSIRNKSEHETLTFIVDKNANKYQIREAF
FT                   IAIFGLKPLKIRTTNRGPAKIRTSTARPGYTKAKKIAYIVMPIGVKVAVSKEEVEAANA
FT                   K"
FT   gene            265306..266145
FT                   /gene="rplB"
FT                   /locus_tag="UUR10_0229"
FT   CDS_pept        265306..266145
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="rplB"
FT                   /locus_tag="UUR10_0229"
FT                   /product="ribosomal protein L2"
FT                   /note="identified by match to protein family HMM PF00181;
FT                   match to protein family HMM PF03947; match to protein
FT                   family HMM TIGR01171"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59899"
FT                   /db_xref="GOA:B5ZB43"
FT                   /db_xref="InterPro:IPR002171"
FT                   /db_xref="InterPro:IPR005880"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR014726"
FT                   /db_xref="InterPro:IPR022666"
FT                   /db_xref="InterPro:IPR022669"
FT                   /db_xref="InterPro:IPR022671"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5ZB43"
FT                   /protein_id="ACI59899.1"
FT                   /translation="MAVKRIKNHSSGKRQTVVVDYKSILTTSKPEKSLLVTLPKKAGRN
FT                   NQGKITIRHHGGGHKRKYRIIDFKRNKDNIYGTIKSIEYDPNRTSFISLVVYADGEKRY
FT                   IIAPKGIKVGDKIISGNENIDILLGNSLPLEFIPEDTLVHNIELSPNAGGQITRSAGAS
FT                   AQILGFDETKKYILVKLNSGEVRKFRKECRATIGTVSNDEHILENLGKAGKSRHLGVRP
FT                   TVRGSAMNPNDHPHGGGEGRSPVGMDAPRTPWGKRHMGVKTRNNKKSSTSMIVRRRK"
FT   gene            266166..266432
FT                   /gene="rpsS"
FT                   /locus_tag="UUR10_0230"
FT   CDS_pept        266166..266432
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="rpsS"
FT                   /locus_tag="UUR10_0230"
FT                   /product="ribosomal protein S19"
FT                   /note="identified by match to protein family HMM PF00203;
FT                   match to protein family HMM TIGR01050"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59862"
FT                   /db_xref="GOA:B5ZB44"
FT                   /db_xref="InterPro:IPR002222"
FT                   /db_xref="InterPro:IPR005732"
FT                   /db_xref="InterPro:IPR020934"
FT                   /db_xref="InterPro:IPR023575"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5ZB44"
FT                   /protein_id="ACI59862.1"
FT                   /translation="MSRSLKKGAYADPSLLKKVEAANASVSKKPIKTWSRRSQIFPNFV
FT                   GLTFEVHNGKTFLKVYVTEDMIGHKLGEFAPTRNFKNHTEAKR"
FT   gene            266454..267389
FT                   /locus_tag="UUR10_0231"
FT   CDS_pept        266454..267389
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0231"
FT                   /product="ribosomal protein L22"
FT                   /note="identified by match to protein family HMM PF00237;
FT                   match to protein family HMM TIGR01044"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59859"
FT                   /db_xref="GOA:B5ZB45"
FT                   /db_xref="InterPro:IPR001063"
FT                   /db_xref="InterPro:IPR005727"
FT                   /db_xref="InterPro:IPR018260"
FT                   /db_xref="InterPro:IPR036394"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZB45"
FT                   /protein_id="ACI59859.1"
FT                   /translation="MTNKVIQRNIHISHRKASLVIDLVRNKPVHEAIRILSNTPKKFAP
FT                   IVLKLLNSAISNVQHNSKDMDPSKLYIYKIVANQGPTMKRTLPRAKGSADQLFKRTTHL
FT                   EIVLSDDVNEREKELAAIKAKKSKKPLVVEPVAKVETKKVAKPSKVETKPVEKDENVDP
FT                   ELLKREQQVLKVVEKTASQKEEETTETIMISTSPKNAQVLFDDLEKNVIFYKTTPVNKV
FT                   LRVLVYVTSPTKKVVGEFDLESVEIGAISSIWRKYNKQSVISKKEYDAYYEGKDKAHAL
FT                   VSKKAYKYRNPKDLSEYNMTKGPSGFQYLK"
FT   gene            267409..268182
FT                   /gene="rpsC"
FT                   /locus_tag="UUR10_0232"
FT   CDS_pept        267409..268182
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="rpsC"
FT                   /locus_tag="UUR10_0232"
FT                   /product="ribosomal protein S3"
FT                   /note="identified by match to protein family HMM PF00189;
FT                   match to protein family HMM PF00417; match to protein
FT                   family HMM PF07650; match to protein family HMM TIGR01009"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59930"
FT                   /db_xref="GOA:B5ZB46"
FT                   /db_xref="InterPro:IPR001351"
FT                   /db_xref="InterPro:IPR004044"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR005704"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR018280"
FT                   /db_xref="InterPro:IPR036419"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5ZB46"
FT                   /protein_id="ACI59930.1"
FT                   /translation="MGQKVNPNGLRFGINKQWLSRWVPTDQLQMAKWLVEDDKIRKYLS
FT                   TKYKNAGIDHVEIERDQQRVNVYVYAVQSGLLIGTEASEKKLIELAINKIVGRKQLVSL
FT                   KVVEVQIPELQASLMAREIADAIENRVSFRIAQKMVIKKVLKAGARGIKTHVSGRLGGV
FT                   EMAREEGYTQGVMTLHTLRADIDYSMQEAHTTYGIIGVKVWINRGELFGNKLVNSVAHA
FT                   ANKEFSRSSKPKKGSFNRSSRSKNTKPAPKQAVSE"
FT   gene            268197..268613
FT                   /gene="rplP"
FT                   /locus_tag="UUR10_0233"
FT   CDS_pept        268197..268613
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="rplP"
FT                   /locus_tag="UUR10_0233"
FT                   /product="ribosomal protein L16"
FT                   /note="identified by match to protein family HMM PF00252;
FT                   match to protein family HMM TIGR01164"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60020"
FT                   /db_xref="GOA:B5ZB47"
FT                   /db_xref="InterPro:IPR000114"
FT                   /db_xref="InterPro:IPR016180"
FT                   /db_xref="InterPro:IPR020798"
FT                   /db_xref="InterPro:IPR036920"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5ZB47"
FT                   /protein_id="ACI60020.1"
FT                   /translation="MLQPKRTKFRKPHKVSYEGKAKGNKQVDFGEFGLMALEGAWIDAR
FT                   QIESARIAISKRLLKTGKMWIRIFPHMSLTKKPLEVRMGSGKGSPEKWVAVVKAGTVMF
FT                   EIANVSEELMREALRAAGNKLPIKVKIVKKGEAN"
FT   gene            268613..268840
FT                   /gene="rpmC"
FT                   /locus_tag="UUR10_0234"
FT   CDS_pept        268613..268840
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="rpmC"
FT                   /locus_tag="UUR10_0234"
FT                   /product="ribosomal protein L29"
FT                   /note="identified by match to protein family HMM PF00831;
FT                   match to protein family HMM TIGR00012"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60082"
FT                   /db_xref="GOA:B5ZB48"
FT                   /db_xref="InterPro:IPR001854"
FT                   /db_xref="InterPro:IPR018254"
FT                   /db_xref="InterPro:IPR036049"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5ZB48"
FT                   /protein_id="ACI60082.1"
FT                   /translation="MSSIAQDLRKKDSLELEKIVIELKAKLLELRFAAANGEAEKLHTA
FT                   KEIRKTIARALTILNERELAEKLNNKEANK"
FT   gene            268840..269094
FT                   /gene="rpsQ"
FT                   /locus_tag="UUR10_0235"
FT   CDS_pept        268840..269094
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="rpsQ"
FT                   /locus_tag="UUR10_0235"
FT                   /product="30S ribosomal protein S17"
FT                   /note="identified by match to protein family HMM PF00366;
FT                   match to protein family HMM TIGR03635"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60057"
FT                   /db_xref="GOA:B5ZB49"
FT                   /db_xref="InterPro:IPR000266"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019979"
FT                   /db_xref="InterPro:IPR019984"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5ZB49"
FT                   /protein_id="ACI60057.1"
FT                   /translation="MERSRRKVLEGLVVSDKMQKTVVVSVETKSKHPIYRKLVISHKKY
FT                   HAHNDNDDAKVGDLVEITETRPLSATKNWRVSKILERAR"
FT   gene            269114..269482
FT                   /gene="rplN"
FT                   /locus_tag="UUR10_0236"
FT   CDS_pept        269114..269482
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="rplN"
FT                   /locus_tag="UUR10_0236"
FT                   /product="ribosomal protein L14"
FT                   /note="identified by match to protein family HMM PF00238;
FT                   match to protein family HMM TIGR01067"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60191"
FT                   /db_xref="GOA:B5ZB50"
FT                   /db_xref="InterPro:IPR000218"
FT                   /db_xref="InterPro:IPR005745"
FT                   /db_xref="InterPro:IPR019972"
FT                   /db_xref="InterPro:IPR036853"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5ZB50"
FT                   /protein_id="ACI60191.1"
FT                   /translation="MIQHMTRLKVADNTGAKEVGVIKVLGGSKKRYASVGDIVVVSVKK
FT                   ATPAGLIAKGQMAKAVIVRTKKSIRRESGLLIRFDENACVLIKEDKTPRGSRIFGPVAR
FT                   EIRDRGYTKIASLAPEVL"
FT   gene            269497..269829
FT                   /gene="rplX"
FT                   /locus_tag="UUR10_0237"
FT   CDS_pept        269497..269829
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="rplX"
FT                   /locus_tag="UUR10_0237"
FT                   /product="ribosomal protein L24"
FT                   /note="identified by match to protein family HMM PF00467;
FT                   match to protein family HMM TIGR01079"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60272"
FT                   /db_xref="GOA:B5ZB51"
FT                   /db_xref="InterPro:IPR003256"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR005825"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR041988"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5ZB51"
FT                   /protein_id="ACI60272.1"
FT                   /translation="MNRIKKGDTVVVISGKNKNKSGVVIQVNPKEQTALVEGVNKIKRH
FT                   QKKDQTHEQSGIIEKEAPIRLCKLALVDPKGKDKGKATKVKYLLKDNKKVRVARKSGSE
FT                   LDANKK"
FT   gene            269846..270400
FT                   /locus_tag="UUR10_0238"
FT   CDS_pept        269846..270400
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0238"
FT                   /product="50S ribosomal protein L5"
FT                   /note="identified by match to protein family HMM PF00281;
FT                   match to protein family HMM PF00673"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60337"
FT                   /db_xref="GOA:B5ZB52"
FT                   /db_xref="InterPro:IPR002132"
FT                   /db_xref="InterPro:IPR020929"
FT                   /db_xref="InterPro:IPR020930"
FT                   /db_xref="InterPro:IPR022803"
FT                   /db_xref="InterPro:IPR031309"
FT                   /db_xref="InterPro:IPR031310"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5ZB52"
FT                   /protein_id="ACI60337.1"
FT                   /translation="MAFLKDLYKNKVAKDLQKEFAYSSVMQIPKIEKVVINAGIGNAVA
FT                   DKKHLEAAISELTLITGQRPVETKAKKSIATFKLRAGQSIGAKVTLRGDRMWAFIETLF
FT                   NIALPRVRDFKGISNNSFDDQGNYTLGIKEQIIFPQVVYDDVKSVRGFDVTFVTTAKTA
FT                   QEAKALLVGLGAPFQKVRGDK"
FT   gene            270404..270589
FT                   /gene="rpsN"
FT                   /locus_tag="UUR10_0239"
FT   CDS_pept        270404..270589
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="rpsN"
FT                   /locus_tag="UUR10_0239"
FT                   /product="ribosomal protein S14p/S29e"
FT                   /note="identified by match to protein family HMM PF00253"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59720"
FT                   /db_xref="GOA:B5ZB53"
FT                   /db_xref="InterPro:IPR001209"
FT                   /db_xref="InterPro:IPR018271"
FT                   /db_xref="InterPro:IPR023053"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5ZB53"
FT                   /protein_id="ACI59720.1"
FT                   /translation="MAKKSLIAKQKKHQKFAVREYTRCVRCGRPHAVNRKFGVCRLCFR
FT                   DLAYAGAIPGIKKASW"
FT   gene            270600..270998
FT                   /gene="rpsH"
FT                   /locus_tag="UUR10_0240"
FT   CDS_pept        270600..270998
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="rpsH"
FT                   /locus_tag="UUR10_0240"
FT                   /product="ribosomal protein S8"
FT                   /note="identified by match to protein family HMM PF00410"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60356"
FT                   /db_xref="GOA:B5ZB54"
FT                   /db_xref="InterPro:IPR000630"
FT                   /db_xref="InterPro:IPR035987"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5ZB54"
FT                   /protein_id="ACI60356.1"
FT                   /translation="MYLDPIAELITKINNGRKAHKAEVSFATSKLKTAILELLVKEGYI
FT                   KSYDIRPTENNKSETVVKLKYKNQTTSSINGFKQISKPGLRIYSTHLNLPKVLNGLGIA
FT                   IITTSKGVMSDKQARKENVGGEVIAYVW"
FT   gene            271007..271555
FT                   /gene="rplF"
FT                   /locus_tag="UUR10_0241"
FT   CDS_pept        271007..271555
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="rplF"
FT                   /locus_tag="UUR10_0241"
FT                   /product="ribosomal protein L6"
FT                   /note="identified by match to protein family HMM PF00347;
FT                   match to protein family HMM TIGR03654"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59994"
FT                   /db_xref="GOA:B5ZB55"
FT                   /db_xref="InterPro:IPR000702"
FT                   /db_xref="InterPro:IPR002358"
FT                   /db_xref="InterPro:IPR019906"
FT                   /db_xref="InterPro:IPR020040"
FT                   /db_xref="InterPro:IPR036789"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZB55"
FT                   /protein_id="ACI59994.1"
FT                   /translation="MSRIGNRKLTIPANVNVSVESGKVHIVSQTAKLSVDFPVNLISVD
FT                   VVDNTIKVSRANDEKQTKMFHGTVNANIANALVGVTTGWKKELEVKGVGFRAKVEGSKL
FT                   NLGLGFSHPLLIQIPTGLKIETPSATEISISGSDKATVGAFAAVVRAYRKPEPYKGKGV
FT                   MYKGERIVRKAGKTADKKK"
FT   gene            271574..271939
FT                   /gene="rplR"
FT                   /locus_tag="UUR10_0242"
FT   CDS_pept        271574..271939
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="rplR"
FT                   /locus_tag="UUR10_0242"
FT                   /product="ribosomal protein L18"
FT                   /note="identified by match to protein family HMM PF00861;
FT                   match to protein family HMM TIGR00060"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59817"
FT                   /db_xref="GOA:B5ZB56"
FT                   /db_xref="InterPro:IPR004389"
FT                   /db_xref="InterPro:IPR005484"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5ZB56"
FT                   /protein_id="ACI59817.1"
FT                   /translation="MKRINFSRAKQRALRAKRLHVKIRNLQLAANKPVLVITKTNAHIW
FT                   AQLICYNKNITLASSSSVQLDLQNGNKDNARLVGADIAKKALAQGFKQVIFNKNGAKYH
FT                   GRIKALADAAREAGLEF"
FT   gene            271957..272568
FT                   /gene="rpsE"
FT                   /locus_tag="UUR10_0243"
FT   CDS_pept        271957..272568
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="rpsE"
FT                   /locus_tag="UUR10_0243"
FT                   /product="ribosomal protein S5"
FT                   /note="identified by match to protein family HMM PF00333;
FT                   match to protein family HMM PF03719; match to protein
FT                   family HMM TIGR01021"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59998"
FT                   /db_xref="GOA:B5ZB57"
FT                   /db_xref="InterPro:IPR000851"
FT                   /db_xref="InterPro:IPR005324"
FT                   /db_xref="InterPro:IPR005712"
FT                   /db_xref="InterPro:IPR013810"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018192"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5ZB57"
FT                   /protein_id="ACI59998.1"
FT                   /translation="MENNVKKETIVDSEKVEKQQPVTAPVVNKKENTQPKAKTFKRETT
FT                   TSNFEERVVKIKRISKTTKGGRMMRFSALVVIGDKNGTVGFGMGKSIEVPDAIKKAIKN
FT                   ANNNLIKVKQTKKGSIYHDVNGRHGAAKVMLLPAPEGTGIIAGGPVRAVVELAGFTDIY
FT                   TKSRGANAPMNVIRATINGLLQQLTPQEIARLRDKSLKEL"
FT   gene            272585..273031
FT                   /gene="rplO"
FT                   /locus_tag="UUR10_0244"
FT   CDS_pept        272585..273031
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="rplO"
FT                   /locus_tag="UUR10_0244"
FT                   /product="ribosomal protein L15"
FT                   /note="identified by match to protein family HMM PF01305;
FT                   match to protein family HMM TIGR01071"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59893"
FT                   /db_xref="GOA:B5ZB58"
FT                   /db_xref="InterPro:IPR005749"
FT                   /db_xref="InterPro:IPR021131"
FT                   /db_xref="InterPro:IPR030878"
FT                   /db_xref="InterPro:IPR036227"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5ZB58"
FT                   /protein_id="ACI59893.1"
FT                   /translation="MQLHNLEYKKGSRNHKEKRVGRGHGSGLGKTSGRGQDGQKARKSG
FT                   MVRLAFEGGQTPLYRRVPKVGFNNDRFANKYNVVTLISLVKYETKELTAEFMYVNKIAK
FT                   NEDLPIKVIGNAVLPSGTVVSAHKFSKGALESISNSKAKAQILE"
FT   gene            273084..274499
FT                   /gene="secY"
FT                   /locus_tag="UUR10_0245"
FT   CDS_pept        273084..274499
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="secY"
FT                   /locus_tag="UUR10_0245"
FT                   /product="preprotein translocase, SecY subunit"
FT                   /note="identified by match to protein family HMM PF00344;
FT                   match to protein family HMM TIGR00967"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60173"
FT                   /db_xref="GOA:B5ZB59"
FT                   /db_xref="InterPro:IPR002208"
FT                   /db_xref="InterPro:IPR023201"
FT                   /db_xref="InterPro:IPR026593"
FT                   /db_xref="InterPro:IPR030659"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZB59"
FT                   /protein_id="ACI60173.1"
FT                   /translation="MTNKQKKKNAFRQLLMIFKNKKVLVALIVTLSILILFRIGSVIPM
FT                   PYIKLNGNFGNQGSFFSIINLLGGGGLSQFSLFAIGIGPYITAQIIMQLLSSELVPPLA
FT                   KLSKSGERGRKKIEVITRIITLPLAVMQAVIIINLMTRANGFISIVPNAPFAIGSPLFY
FT                   VTYIFLMVGGTYISLFLADLISKKGVGNGITLLILTGIVASLFNHFIAIFSNLGSLTSS
FT                   KVSQIIGFILYILFYIMILIGVVFVNNSTRKIPIQQTGQALILDHEKLPFLPIKIMTAG
FT                   VMPVIFASSVLAIPAQVAEFLDKQSMGYYVIHNYFIVDSWTGLAIYVVLILLFTFFFSY
FT                   VQLNPPKMAEDIKKAGRFIPGVQVGMDTEKHITKVIYRVNWIGAPILAFLACLPHLVAL
FT                   VAKTINHGIPVIQPSTIFGGTSIIIMVTATLELWNAIKSTSTSTSYAYQRKELETAITI
FT                   SVESDKSSKSQIW"
FT   gene            274509..275150
FT                   /locus_tag="UUR10_0246"
FT   CDS_pept        274509..275150
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0246"
FT                   /product="adenylate kinase"
FT                   /EC_number="2.7.4.3"
FT                   /note="identified by match to protein family HMM PF00406;
FT                   match to protein family HMM PF05191; match to protein
FT                   family HMM TIGR01351"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60120"
FT                   /db_xref="GOA:B5ZB60"
FT                   /db_xref="InterPro:IPR000850"
FT                   /db_xref="InterPro:IPR006259"
FT                   /db_xref="InterPro:IPR007862"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033690"
FT                   /db_xref="InterPro:IPR036193"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5ZB60"
FT                   /protein_id="ACI60120.1"
FT                   /translation="MKILLIGPPGSGKGSVSELLTKNNALKHVSTGNLFRAILKEDSEL
FT                   ARKIKEINVSGGKLVPDEITNQVAKSAIDELIKNQQSFILDGYPRTINQALALEQYCDL
FT                   DYIFYLDINHQELMKRLTGRWMCPKCAGIYNIHFKKPQVDGVCDNDQATLYQRADDHED
FT                   AVSIRLDEYDKLTLPLIKHYKTNPRFIKINANQPIKDVYEDINNYLKQNK"
FT   gene            275174..275923
FT                   /gene="map"
FT                   /locus_tag="UUR10_0247"
FT   CDS_pept        275174..275923
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="map"
FT                   /locus_tag="UUR10_0247"
FT                   /product="methionine aminopeptidase, type I"
FT                   /EC_number="3.4.11.18"
FT                   /note="identified by match to protein family HMM PF00557;
FT                   match to protein family HMM TIGR00500"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60357"
FT                   /db_xref="GOA:B5ZB61"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001714"
FT                   /db_xref="InterPro:IPR002467"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZB61"
FT                   /protein_id="ACI60357.1"
FT                   /translation="MVIVKTEKDITAIKEAVRIWKIAREAIYEQVKAGVSLKELDLLAK
FT                   EVIEANGGIAAFHNYLGFKGHICISVNECVIHGVPTDYILKDGDKVTFDVGVKYDNHYC
FT                   DAAFTIIINNSNVEALKMSDICKKSIDEAVAIIKPKVTTHAISNVIQKFIEKNGYFILR
FT                   DFAGHGCGNEIHEDPLIPNYRSLLYRNVTLEENMVICIEPMILSGSNAYYIDPNDQWSV
FT                   KSKNHQMTCHWEHMILITKDGCEVLTA"
FT   gene            275951..276175
FT                   /gene="infA"
FT                   /locus_tag="UUR10_0248"
FT   CDS_pept        275951..276175
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="infA"
FT                   /locus_tag="UUR10_0248"
FT                   /product="translation initiation factor IF-1"
FT                   /note="identified by match to protein family HMM PF00575;
FT                   match to protein family HMM PF01176; match to protein
FT                   family HMM TIGR00008"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60119"
FT                   /db_xref="GOA:B5ZB62"
FT                   /db_xref="InterPro:IPR004368"
FT                   /db_xref="InterPro:IPR006196"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZB62"
FT                   /protein_id="ACI60119.1"
FT                   /translation="MADTEKLKMLGKIVEILQGGNFRVQLENGITIMSHVSGKMRVNKI
FT                   NILPGDTVDVELSPYDLTRGRITYRHRDS"
FT   gene            276199..276312
FT                   /gene="rpmJ"
FT                   /locus_tag="UUR10_0249"
FT   CDS_pept        276199..276312
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="rpmJ"
FT                   /locus_tag="UUR10_0249"
FT                   /product="ribosomal protein L36"
FT                   /note="identified by match to protein family HMM PF00444;
FT                   match to protein family HMM TIGR01022"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60323"
FT                   /db_xref="GOA:B5ZB63"
FT                   /db_xref="InterPro:IPR000473"
FT                   /db_xref="InterPro:IPR035977"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5ZB63"
FT                   /protein_id="ACI60323.1"
FT                   /translation="MKVRASVKAICKDCKIVKRSGVVRVICANPKHKQRQG"
FT   gene            276342..276740
FT                   /gene="rpsM"
FT                   /locus_tag="UUR10_0250"
FT   CDS_pept        276342..276740
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="rpsM"
FT                   /locus_tag="UUR10_0250"
FT                   /product="30S ribosomal protein S13"
FT                   /note="identified by match to protein family HMM PF00416;
FT                   match to protein family HMM TIGR03631"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60052"
FT                   /db_xref="GOA:B5ZB64"
FT                   /db_xref="InterPro:IPR001892"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR018269"
FT                   /db_xref="InterPro:IPR019980"
FT                   /db_xref="InterPro:IPR027437"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5ZB64"
FT                   /protein_id="ACI60052.1"
FT                   /translation="MARILGVDIPNDKRVVISLTYIFGIGKSTSQKILKLANIDENIRV
FT                   NDLADEQIAEIRRVALNFVKANGEKLQLEGDLRRTVAMDIKRLMEIGSYRGIRHRRGLP
FT                   VRGQRTKTNARTRKGPRKTVANKKIETR"
FT   gene            276762..277127
FT                   /gene="rpsK"
FT                   /locus_tag="UUR10_0251"
FT   CDS_pept        276762..277127
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="rpsK"
FT                   /locus_tag="UUR10_0251"
FT                   /product="30S ribosomal protein S11"
FT                   /note="identified by match to protein family HMM PF00411;
FT                   match to protein family HMM TIGR03632"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59780"
FT                   /db_xref="GOA:B5ZB65"
FT                   /db_xref="InterPro:IPR001971"
FT                   /db_xref="InterPro:IPR018102"
FT                   /db_xref="InterPro:IPR019981"
FT                   /db_xref="InterPro:IPR036967"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5ZB65"
FT                   /protein_id="ACI59780.1"
FT                   /translation="MAKKKKLSFTNGIAYIHATKNNTIITLADEQGSVLSWASSGSIGY
FT                   KGTKKKTPYSAGIAAEAAAKAVIDMGLKSVEVHVNGTGASRDTAIRSLQAAGLEVTKIK
FT                   DVTPIPHNGCRPPKKPR"
FT   gene            277164..278147
FT                   /gene="rpoA"
FT                   /locus_tag="UUR10_0252"
FT   CDS_pept        277164..278147
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="rpoA"
FT                   /locus_tag="UUR10_0252"
FT                   /product="DNA-directed RNA polymerase, alpha subunit"
FT                   /EC_number="2.7.7.6"
FT                   /note="identified by match to protein family HMM PF01000;
FT                   match to protein family HMM PF01193; match to protein
FT                   family HMM PF03118; match to protein family HMM TIGR02027"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59865"
FT                   /db_xref="GOA:B5ZB66"
FT                   /db_xref="InterPro:IPR011260"
FT                   /db_xref="InterPro:IPR011262"
FT                   /db_xref="InterPro:IPR011263"
FT                   /db_xref="InterPro:IPR011773"
FT                   /db_xref="InterPro:IPR036603"
FT                   /db_xref="InterPro:IPR036643"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZB66"
FT                   /protein_id="ACI59865.1"
FT                   /translation="MRKFLKYQLDVPSINSEDKNRTVVKIAPLEIGFGDTLGNALRRIC
FT                   LSSIPGASMFAVKFGGYSHEFQPYEGVKEDITHIILNLKNLAIKIDELIYSEDYFNNLL
FT                   IDKWPKMKINFKGPGVITAKDIVCPVGFEIVNQDLYIAEVTKPIDVEIEIFAKTGRGRV
FT                   DFNTNKDFVSTLHIIATDSNYSPVLHYAYNVEMIKDSKSSMSEILTIDIATNGTISGSE
FT                   AIAIAAKIMQAHLEPIMNIDKTINEMIIMREREEEEKRQNASISIDDLDLTVRAYNALK
FT                   QSGINTTAELIELTKSQLEKIKNLGRKSVTEIIQKLTERSLELKKD"
FT   gene            278175..278534
FT                   /gene="rplQ"
FT                   /locus_tag="UUR10_0253"
FT   CDS_pept        278175..278534
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="rplQ"
FT                   /locus_tag="UUR10_0253"
FT                   /product="ribosomal protein L17"
FT                   /note="identified by match to protein family HMM PF01196;
FT                   match to protein family HMM TIGR00059"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59957"
FT                   /db_xref="GOA:B5ZB67"
FT                   /db_xref="InterPro:IPR000456"
FT                   /db_xref="InterPro:IPR036373"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5ZB67"
FT                   /protein_id="ACI59957.1"
FT                   /translation="MSYINKPGKTRAWRKMVSRQQVSDVISHGSIVTTKTKAKESQRHV
FT                   DHLITLAKKNTLASRRAAAAILLGTNQHSADDLLRKLFNELGPKYANRAGGYTRVIKLG
FT                   NRPGDNTEEAVLQLV"
FT   gene            278636..278941
FT                   /locus_tag="UUR10_0254"
FT   CDS_pept        278636..278941
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0254"
FT                   /product="merozoite capping protein-1"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59980"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZB68"
FT                   /protein_id="ACI59980.1"
FT                   /translation="MNEDKKNKIYYNNPVKVKDNTKLKKEIKHDKKFSDKTNYNNEQKT
FT                   INNKKSGFKAGYQGFLKQQNMLENNEIKNDFKNQKPSKHKSFKNTKNYKYKKVIIK"
FT   gene            279085..280953
FT                   /locus_tag="UUR10_0255"
FT   CDS_pept        279085..280953
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0255"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60162"
FT                   /db_xref="InterPro:IPR027593"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZB69"
FT                   /protein_id="ACI60162.1"
FT                   /translation="MKKQKRKILISSLLSVFLITSLTVGLGTGLSLVSKNQSKITSKIY
FT                   QETNFFVNDLSKQLFLDVFNQNKAQLNTYIYDQNNVSDQQLLDLKFALTLLNPNRLDIS
FT                   DDDAISIMKNIAKRTIFESLANNWYWFFTNLNALKFAYTPYKPDFYAPYKNEKQDFSGS
FT                   LILNKVIDINKPLVNYVKVKQKTFDQEVYHSVDVYYLQFGDHLVLRLLKFNKKNHFDVR
FT                   FDTDLFQFDQKINDLKSIATQMQTNIDQQREKSFEKDVANYKNYYEENLDENQQFDQAT
FT                   YQQGLDRIKQKYNETNNFNFLNVKKSFFQKFSYEMFLELKDQLGFKRYVLRNVNQKEVG
FT                   ARDFIQKEYHQENKINSKPNQQELNHFQKYIDHNLDINIHKISKEAYVTQKIIKNLLLD
FT                   AFNNDDAQITNYLTQQNNKEYQTKLIKQLIEFSNYFKSQKMAKDSLEYKQKLKDYEQLF
FT                   SQNWYFILMNLNHFELSFNNWFTLPKQTNPITKEIVEPSKEYLQRLTNLEPYEDYYFIN
FT                   NYLDKKQEGDTSILIGSFKDLYITKNKSIFNIKIDFANNKNRLNLNPLVYFFPKTKNKL
FT                   SIDLITSIFHQAIFHQSKEYYKLFETDMIDKYEYGIPAQMLLLWKE"
FT   gene            280956..282263
FT                   /locus_tag="UUR10_0256"
FT   CDS_pept        280956..282263
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0256"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59905"
FT                   /db_xref="InterPro:IPR027593"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZB70"
FT                   /protein_id="ACI59905.1"
FT                   /translation="MSKFFKKQHLWKWSLFCLPLVIIPFIISACNNSSLQKQQKLVRNQ
FT                   ISFISDGFKNYYVNLAFDQSLKNNKKMIFNVSLIDEKNQKNDLLVKDYIIKDKQILIKL
FT                   PRLIKWNDRLVITSNNPLFKPINIRIFLDDVIKLDNSIITTKTSVDSQNNWTTFLNNKV
FT                   IHNLLLSIYPDQKEREEYIKSQQNIKPDYTQEIANWLNYYNTVQNDANKGPVYDKNPKK
FT                   NKPKKNPFGGGSVSNPFAYQQARKAHNKLFNENWLWFLFNLTKQIFMLYPDDNLFQESS
FT                   EETVQNLKDSKVNNHSSFYRASSNEFIDGLYVIESSNLDKKPEELDEYTDFSKTAKFAL
FT                   LNKEGFIFTIFIEENYDKTKKLVSRQVSLVPWIKTLPKLMFNDHTIKHDFNLANYTENS
FT                   YDYNAINFHSPLEIKVYGDQFGGKAIRFSFVDIDSN"
FT   gene            282346..282753
FT                   /locus_tag="UUR10_0257"
FT   CDS_pept        282346..282753
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0257"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60314"
FT                   /db_xref="GOA:B5ZB71"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZB71"
FT                   /protein_id="ACI60314.1"
FT                   /translation="MNNYTQQVIDYINQNNSKNKPYFIKKYAFAFLSSLIIFIFLLIFG
FT                   LANYFDPLISLMGVGLILGVLIVFCIHVKIVNNYSINLLKWLRNQKVLSYKNIINILKF
FT                   ILNKQLHLHLTIVELEQVCIDLEEFKKVHVI"
FT   gene            282743..283330
FT                   /locus_tag="UUR10_0258"
FT   CDS_pept        282743..283330
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0258"
FT                   /product="proline dipeptidase"
FT                   /note="identified by match to protein family HMM PF01205"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59815"
FT                   /db_xref="InterPro:IPR001498"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR023582"
FT                   /db_xref="InterPro:IPR036956"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZB72"
FT                   /protein_id="ACI59815.1"
FT                   /translation="MSFKTIKNDQNSLVIIKKSKFYISINKVNAKKEVSMLLKKYQDEY
FT                   SDATHICYAYIIGPQSNYMKTQDDGEPNGTAGLPILNMIKTKALTNVIIFVIRYFGGIK
FT                   LGAGGLIRAYTQCAKEIIELCEIINLQKYFYYKVTYKLKDTKFASQILASIDYEKLSEN
FT                   YDSNSVVLEIRSLIKIDIYTSHIQFVFVKNDY"
FT   gene            complement(283384..285162)
FT                   /locus_tag="UUR10_0259"
FT   CDS_pept        complement(283384..285162)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0259"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59782"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZB73"
FT                   /protein_id="ACI59782.1"
FT                   /translation="MKTRFKRNILLAFLSAIVTPVPVILACVLTKTNNENNSQWFKIFS
FT                   EIKNEANTKISYVFANNHKLNYLIDKAKQIDNFIKILNLNENSGNNWLIYGFSKIWKLI
FT                   QEFDFILKQKTQEYNNWLTKVDDVIKLLKDKKIELLKFKNKNNVNDANLNLIQKRIDEI
FT                   LDNYTKAPNDENIDDIKIRYQKIVESCNYNYQKSIKEETNKTKKIKEEIKNLKKDYFNK
FT                   IENGKEYYKLYDEEIAKLLYEANQLNDNIHSILDHILNRKSLENKFNDLKKEVEEHKKI
FT                   SKYIKENANKNNENFWGTWRENILGKYFVYQNFMDNTNVAIWYGLALKIENLSKQNFIN
FT                   NKVNELKQLLEKWKLYGQALIRDTFDAIGISGLFFTVNTKVRMLENYSPLIDPNRPSKK
FT                   GEYYILIEKLKNLLNEIQERSRKASKNLQNIYDQVVKDDVEKILEYVKANGYGFSPQEA
FT                   FNELMTWSNYYLNQMPEIFQHYKEKIIKPVLDQIKTKGNSASDVVKLEELYNYKYNYTN
FT                   FYEPYNFERDSFYWEKDYKNNDKNEKIKDDEGRYILKKQIPHHLKNEYDTARLFLKIER
FT                   TIDEVCKKYSITNPLN"
FT   gene            complement(285340..288324)
FT                   /locus_tag="UUR10_0260"
FT   CDS_pept        complement(285340..288324)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0260"
FT                   /product="calcium-translocating P-type ATPase, PMCA-type"
FT                   /note="identified by match to protein family HMM PF00122;
FT                   match to protein family HMM PF00689; match to protein
FT                   family HMM PF00690; match to protein family HMM PF00702;
FT                   match to protein family HMM TIGR01494"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59734"
FT                   /db_xref="GOA:B5ZB74"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR004014"
FT                   /db_xref="InterPro:IPR006068"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZB74"
FT                   /protein_id="ACI59734.1"
FT                   /translation="MKKNNEDQTDSFVSFDPQNTDPLTGLNDEQVLKSRQIYGFNEIKK
FT                   KKKSNILTKFFKQFLDFMVILLVIAGIITLILAIVKPPHDITELIVQYVEVGVIGFILF
FT                   LNAIFGTIQEVKAEKNTEALSKLTSPQAKVLRNNQILIIDSREVVIGDILILEAGDWIP
FT                   ADALLINSSSLEVDEAVLTGESLPVQKDAKAIVKQGAGIGDRLNQIFSGTSITNGTAKA
FT                   IVTNIGMNTEIGKIAKLINDQKVQLTPLQQKINKLSKIIGAFASVLCIAVFIIYIYLVG
FT                   GGNWEINWHPALVMAISLSIAAIPEGIVAIVTIILSFGVKQMAKKNALIKRLPAVETLG
FT                   SANVICSDKTGTLTQNKMTVTKVFTNILKTTDLINEKDVYELIKWASIANNGSRNFNDK
FT                   KQEYEFIGDPTETSIIEAALKLNIDKSELDKEFVRIHEFPFDSTRKLMSVIVRNNDNYY
FT                   LVTKGAIDAIEKIVVEPITNDVYKANDFLGKQALRVLGVGIKKLAFLPTNFNQDELERE
FT                   LEFIGLVGMIDPPRPEAQEAVEIAIKAGIRPVMITGDHINTASAIAKQIGILNEGQEVL
FT                   SGHELSSMSDEELINNVERYSVYARVSPTDKIRIVKAWQSHDKVVSMTGDGVNDAPALK
FT                   AADIGCAMGITGTDVSKASSDMILTDDNFATIINAVSLGRSIMDNIKRIIVLLLITNLA
FT                   GLISLIFGIIILGINPMSSLQILWINVIAETLPGIALGVHLADANLMRHKPLKKSAPIV
FT                   NKKMWMTIFINGFFIGLISILLFYLGASSHFDFDFIAMRNEFKELANLEAIYQNVWNWL
FT                   GENHEITNIVHEKIIAIKTPIMAGSSLTFIFMGMSLAFNALSLRSNHSIFINFWKNSKY
FT                   IVYSIIISVIMIIVITYTPHLNEVFNMNPYNMNGYEWFNVFPFVLFTIPLGIFEVIKYV
FT                   KYLKLRRSFDYKNKTYASLNQEIKSLNLKINNTKINYEKEYYKALLNNLIVKRKILINK
FT                   CHKEI"
FT   gene            288491..288820
FT                   /locus_tag="UUR10_0261"
FT   CDS_pept        288491..288820
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0261"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF03672"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60151"
FT                   /db_xref="GOA:B5ZB75"
FT                   /db_xref="InterPro:IPR005359"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZB75"
FT                   /protein_id="ACI60151.1"
FT                   /translation="MSFSNFLFKVSEVFSSIIHEATDIVTQADLDNANAHAHSLAVGLG
FT                   IGIVLFLIAGLVIGYFVSMKIMKRQLKKNPPISKDTIRMIYQQVGRKPSESQINEIYNR
FT                   AVKQK"
FT   gene            288825..289451
FT                   /gene="ysxC"
FT                   /locus_tag="UUR10_0262"
FT   CDS_pept        288825..289451
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="ysxC"
FT                   /locus_tag="UUR10_0262"
FT                   /product="ribosome biogenesis GTP-binding protein YsxC"
FT                   /note="identified by match to protein family HMM PF01926;
FT                   match to protein family HMM TIGR00231; match to protein
FT                   family HMM TIGR03598"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60039"
FT                   /db_xref="GOA:B5ZB76"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR019987"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030393"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5ZB76"
FT                   /protein_id="ACI60039.1"
FT                   /translation="MAKFIKSAQYFDQYPVDKQFEICVIGRSNVGKSSLINALANEKIA
FT                   RTSNTPGRTQLVNFFDFNSFRLVDLPGYGFARVSKDKQLDLATIIDQYLGYRQNLCAVF
FT                   QICDINVLTNDDVEMSRYFENQNYAHFVVLNKVDKVNKSHFDNNKQKIAKFLNISVDRL
FT                   LCVSAQKNTNVATLFALMKKVVIETRQKQLLLKKEEKKSSEEEIK"
FT   gene            289432..292056
FT                   /gene="valS"
FT                   /locus_tag="UUR10_0263"
FT   CDS_pept        289432..292056
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="valS"
FT                   /locus_tag="UUR10_0263"
FT                   /product="valyl-tRNA synthetase"
FT                   /EC_number="6.1.1.9"
FT                   /note="identified by match to protein family HMM PF00133;
FT                   match to protein family HMM PF08264; match to protein
FT                   family HMM PF09334; match to protein family HMM TIGR00422"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60085"
FT                   /db_xref="GOA:B5ZB77"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002303"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR019499"
FT                   /db_xref="InterPro:IPR033705"
FT                   /db_xref="InterPro:IPR037118"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZB77"
FT                   /protein_id="ACI60085.1"
FT                   /translation="MKKKLNKNYLFKEVESNKLLFWQENNLFKAQANSTKPPFAIVLPP
FT                   PNVTGHLHIGHAYDFTLPDILMRYKKLQGYDAFIVPGTDHAGIATQTKFEKILKTNEQV
FT                   DRFVLGRKAFLEKLKIWKDEQTYYIHKQWNALGLGLDYNNYLFTLDEPVVQTVREVFVK
FT                   MFNENIIYRAKKLVNWDIQLKTAISNIEVIHKEIEQKLYYIKYSSEDQKDFVIVATSRP
FT                   ETMFGDKHLIMNPNDQRYVHLHNKIFINPINNAKMSVILDDYIDIEFGTGVMKCTPAHD
FT                   FNDYELAKKHNLELINIMNEDGTLNEKCAEFKGLDRLQARALIVDKLQKSNHLVKIENY
FT                   QSNVGFSERTNEIVEPYLSYQWFIKMDNLVKNTIKMQNDFNDKVDFYPNRFNKTLLTWL
FT                   ENTEDWCISRQLWWGHQIPVWYHKKTNEIYCNTTPPKDLENWIQDEDVLDTWFSSGMWP
FT                   LLTTKWNSNDQFFKRYFPTALMVTGMDILFFWVSRMMNFSQYLVQKRPFKDVLIHGLIR
FT                   DAQGKKMSKSLGNGIDPFDIINEYGLDTMRLFFASSTTVGEDLNFSTERLGANWNYLNK
FT                   IWNIAKYIENLDEINESFSIQDVHEFCDVNKWIIAELSKLSVEMNKNMDKYNLVVATKD
FT                   LYDFIWNTFASNYLEYTKVLLQDTTFKNETIKTIRYVFNQILIMLHPFAPNISEEIWLN
FT                   LNQTNESILLQKYPMVNFEFESIIINKIAKIILEIRKLRLQENINNKTNLCFELVSAND
FT                   EFYNSNIKLINLLLVLVNAKVSEIKKSSVNSCTYELVIDDFILKTWYEKSIDYDTQIKK
FT                   VSEQLKYLENEIKRATNLLNNQGFVNKAPTELIAKEKDKLNNLEKEQANLLKIFADLKQ
FT                   KVN"
FT   gene            292060..292578
FT                   /locus_tag="UUR10_0264"
FT   CDS_pept        292060..292578
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0264"
FT                   /product="RNA methyltransferase, TrmH family"
FT                   /note="identified by match to protein family HMM PF00588"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60128"
FT                   /db_xref="GOA:B5ZB78"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR016914"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZB78"
FT                   /protein_id="ACI60128.1"
FT                   /translation="MLHIVLFEPEIILNTGNIARMCVGFNANLHLIRPYGFILDKARFD
FT                   KDFVRASANHLDELKLFEYDDFYEFIAKNNIIENQIYFFTRYGTKAPCDYKYANLNKED
FT                   VYLVFGKESTGIDHDILRKYPQNWIRIPTSINLRSLNIANSVAMGIYEVLRQNDFSDLL
FT                   KYEPHKKFE"
FT   gene            292584..293258
FT                   /gene="trmB"
FT                   /locus_tag="UUR10_0265"
FT   CDS_pept        292584..293258
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="trmB"
FT                   /locus_tag="UUR10_0265"
FT                   /product="tRNA (guanine-N(7)-)-methyltransferase"
FT                   /EC_number="2.1.1.33"
FT                   /note="identified by match to protein family HMM PF02390;
FT                   match to protein family HMM TIGR00091"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60254"
FT                   /db_xref="GOA:B5ZB79"
FT                   /db_xref="InterPro:IPR003358"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5ZB79"
FT                   /protein_id="ACI60254.1"
FT                   /translation="MRLRNNANAPLYLKSQEQYIVNDQQLLKNDLAKVFKNPHLPLHIE
FT                   IGMGKGDFIVENALHNPQINYLGIEKFPTVIVKAHKKALKHKLDNLAMICFDANAILDL
FT                   LNSKSIDKIYLNFSDPWPKKRHAKKRLTNPYFLEKFAALLKDDGLIEFKTDNESLFHYT
FT                   IYDVLLNDLTKYEILFLTYNLYALVNNVELLKNIPTEYEKKFVMQGQRIKKVSFRFLKK
FT                   ND"
FT   gene            293295..293375
FT                   /locus_tag="UUR10_0266"
FT   tRNA            293295..293375
FT                   /locus_tag="UUR10_0266"
FT                   /product="tRNA-His"
FT   gene            293531..294202
FT                   /locus_tag="UUR10_0267"
FT   CDS_pept        293531..294202
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0267"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59831"
FT                   /db_xref="GOA:B5ZB80"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZB80"
FT                   /protein_id="ACI59831.1"
FT                   /translation="MINQNKRFCFQYFKKQSNQPISIKESLKKYFDFKNQSVKSIIYNL
FT                   VLAAFFLALFLIGRFLTKNLDFLNGFSWQLQMGIFVLAIVCIPNFYYKLMYYIIAPLVM
FT                   LAIGFSAEPFFGYLMPHYGFGLILFIDVILIITKKWNQTIKKQIFWTYLLVFSFSIIGY
FT                   FIVWMGYSIQGTLFYNTPFAPSMIYNSLVTFGSMAINFGLYIIAIPVIAALKNKYSTKL
FT                   I"
FT   gene            294249..295598
FT                   /locus_tag="UUR10_0268"
FT   CDS_pept        294249..295598
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0268"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59967"
FT                   /db_xref="GOA:B5ZB81"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZB81"
FT                   /protein_id="ACI59967.1"
FT                   /translation="MFNQILKRRKRHLNFEIFIFFFILFLIAFLALWIISGNIQTITDF
FT                   IKTKIYDASPQLKYLTSVKIEPFNNLEEVLDFIIKNKTLIKELQNQPEILDAIKNNPQI
FT                   LKTISDNQEILKQISEYKAFIEVAGKQPEILKFAQNNKELIKQIQAKPELLDLIKNHSN
FT                   LIDHLKANEKYMDIIKQNPQMLKDLYHIDDYLFNIIKTSLENEKENNILALAVKNATLI
FT                   NSFTKNLNLQEIKHAIEFYKTVDLNKLQVDDKLIDIIKNNYEIFEVFLKNPDYIKNLND
FT                   NQNIINAIQQNPDLIDNFKNFDFDVLVQKKDLVRALIKIIEYKPHPQIQKFNEKVFLKF
FT                   FKDNRELANILNIVSLIGSALFIILYMIFMFASFIAHVSMLKQIKNFNKIFKEAKLKKA
FT                   YLVFSLLLQFFFFVVLFVINFIVLIILVVDYNKLKAIVQDNDDGEREEAY"
FT   gene            295598..296056
FT                   /locus_tag="UUR10_0269"
FT   CDS_pept        295598..296056
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0269"
FT                   /product="histidine triad protein HIT"
FT                   /note="identified by match to protein family HMM PF01230"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59762"
FT                   /db_xref="GOA:B5ZB82"
FT                   /db_xref="InterPro:IPR001310"
FT                   /db_xref="InterPro:IPR011146"
FT                   /db_xref="InterPro:IPR019808"
FT                   /db_xref="InterPro:IPR036265"
FT                   /db_xref="InterPro:IPR039384"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZB82"
FT                   /protein_id="ACI59762.1"
FT                   /translation="MQDCIFCKILKGEIISKIIDENEFAIAILDIQPASDGHILIIPKK
FT                   HYRNFSLTDPIYLDGMMRLAKNMTFVLEEVFPNVLGFNYLMNSNSGAGQVVMHTHMHII
FT                   PKQNNDRGFVFKAIKEEGDISDIDEIYKKIATKTQKLKKSRLSKHYMV"
FT   gene            296070..296822
FT                   /locus_tag="UUR10_0271"
FT   CDS_pept        296070..296822
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0271"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60146"
FT                   /db_xref="GOA:B5ZB83"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZB83"
FT                   /protein_id="ACI60146.1"
FT                   /translation="MEQIKNLINLQIKLKPIQKTFYDIWSKTFINGIDNNGEIHQQNKQ
FT                   IILEIYTTLKTFLNQNQNVISKLPLNEVKKIANDILKKEINLEQPLVDYYYQSSSYFIL
FT                   IPYLIQILYQSYDANKPAYKAMAKFIIKNNLGLFKEWDLIERQTLEIVKLKTNLIEDQR
FT                   KVINLFSCEQREAQHNRFVKLFNNFILVYWTKEEVKYIEMIRFLMYFAWIPIIFIILLV
FT                   LILGLYFGLTNSSSSSTTQLLLNLINLY"
FT   gene            complement(296819..297883)
FT                   /locus_tag="UUR10_0270"
FT   CDS_pept        complement(296819..297883)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0270"
FT                   /product="coproporphyrinogen III oxidase"
FT                   /note="identified by match to protein family HMM PF04055;
FT                   match to protein family HMM PF06969"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60206"
FT                   /db_xref="GOA:B5ZB84"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR034505"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZB84"
FT                   /protein_id="ACI60206.1"
FT                   /translation="MIFSQNTKHLYIHIPFCNHICTYSDFKRILKTVQSKDIFKDFLKD
FT                   VQMRIKNFKTKQFETIYLGGGVPNCLSNCELKQLLQTIFPYVSNNCEYTIECNPELINQ
FT                   TQINLFKKYKINRISLNAQSLNNNILKKMNYIHTNQDIKNAIDLFYKNKIFNISCDFLY
FT                   CLTMLTLKDLDDIFDFIVQNKINHVSFYGLEIKDESILKKLNISINEDQDAEQMSYVNN
FT                   KFASLNFKHYEVSNWVSDLKYVAKHNLAYWQTKDWAAIGWGAHGFENNIEYFFDAPVQK
FT                   PVLIKKMLTKYDIYQQILMMGLRLKEGLNLNEKINNDAYLYFKDKLKYISINKKNHLVV
FT                   DDLNLLNSSILDIF"
FT   gene            complement(297896..298105)
FT                   /locus_tag="UUR10_0272"
FT   CDS_pept        complement(297896..298105)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0272"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60185"
FT                   /db_xref="GOA:B5ZB85"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZB85"
FT                   /protein_id="ACI60185.1"
FT                   /translation="MSTKAFNPKERVTKTVVLSDLDQHQNYSKKHKKMDFKKRVVLSIF
FT                   LILLTCGAIILLVFVITELFRLSA"
FT   gene            298282..298827
FT                   /locus_tag="UUR10_0273"
FT   CDS_pept        298282..298827
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0273"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60101"
FT                   /db_xref="GOA:B5ZB86"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZB86"
FT                   /protein_id="ACI60101.1"
FT                   /translation="MGSNKTKKNRSTIQFLFGTIKKRKIANYLIIAFAFLTFALAIIGS
FT                   FDAIASKYAIGIGSGLSLFITIGFSIWRVLMIHLGKEWNKSEIIWQSVMGAILVLSIIF
FT                   WIWATATTSVQYSALKEYFQLLKQKDQRASFIVLTQATTDQFGTALKGGLWAWVVTSCV
FT                   YIFTNTFHNMFMKEKSPK"
FT   gene            298831..299922
FT                   /locus_tag="UUR10_0274"
FT   CDS_pept        298831..299922
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0274"
FT                   /product="nicotinate phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60044"
FT                   /db_xref="GOA:B5ZB87"
FT                   /db_xref="InterPro:IPR007229"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR035809"
FT                   /db_xref="InterPro:IPR036068"
FT                   /db_xref="InterPro:IPR037128"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZB87"
FT                   /protein_id="ACI60044.1"
FT                   /translation="MGPVIPNTRLIDFKFDRDLLNKAYTSHYFIKTCKIIELHAPSHSV
FT                   IMQFTHFSKTPIMVCGTSEVLALLEFCLSRKELKQLKIYYVPDGHVIKPKEALFAIEGP
FT                   YEIFGWLENIIDSILARRSSVATNCYNVLNVINDEQKVIYMSDRSDDYSLQPYDGYAAA
FT                   VGGMQYFVTQKQVEFLKDINYECKVMGSMPHALIQQNNGRVDLACEMFAQTFPNDPLIA
FT                   VIDYNNNVLNDLEQLRYMFDRLYAVRIDTAKDLIDNSLLSTFDNVRNHDLHGCNPYLID
FT                   LVREYLDNNGGEHIKIIASSAIDLNSIKNFNKHNSAIDFYGIGTYLTHLSIHITADLVC
FT                   LDNVYGAKVGRKIAKNFAEMTLY"
FT   gene            299998..300165
FT                   /gene="rpsU"
FT                   /locus_tag="UUR10_0275"
FT   CDS_pept        299998..300165
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="rpsU"
FT                   /locus_tag="UUR10_0275"
FT                   /product="ribosomal protein S21"
FT                   /note="identified by match to protein family HMM TIGR00030"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59885"
FT                   /db_xref="GOA:B5ZB88"
FT                   /db_xref="InterPro:IPR001911"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZB88"
FT                   /protein_id="ACI59885.1"
FT                   /translation="MSRGVNVEGDLEKALKKFKRISNETKKDSKRHEYYLSPRIRRKEK
FT                   IKEANKYRSF"
FT   gene            300285..301931
FT                   /gene="argS"
FT                   /locus_tag="UUR10_0276"
FT   CDS_pept        300285..301931
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="argS"
FT                   /locus_tag="UUR10_0276"
FT                   /product="arginyl-tRNA synthetase"
FT                   /EC_number="6.1.1.19"
FT                   /note="identified by match to protein family HMM PF00750;
FT                   match to protein family HMM PF03485; match to protein
FT                   family HMM PF05746; match to protein family HMM TIGR00456"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59798"
FT                   /db_xref="GOA:B5ZB89"
FT                   /db_xref="InterPro:IPR001278"
FT                   /db_xref="InterPro:IPR005148"
FT                   /db_xref="InterPro:IPR008909"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR035684"
FT                   /db_xref="InterPro:IPR036695"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZB89"
FT                   /protein_id="ACI59798.1"
FT                   /translation="MMITQKISEQLSKALEKMGIFETKVLVDKTKNIKFGDFYTNVAMT
FT                   LSKRVNQSPLVVAKEIINNLDQDLFFKVNLQPPGFLNFTLKAKDHEDLLTQIYDQKDLF
FT                   GQFAKKNITYNVEYVSANPTGYLHIAHAANAIYGDILANLLKIYGYDVKTEYWINDAGN
FT                   QIDKLAMSVLVRYLQLQNINIELPTDAYHGQEIYLVAQALYEIYKDQFINVRLNEKEEI
FT                   DDVIVNEQIKKFAVSYLLDEIKKDLASINTYIDTYTSENWIRSSGRILEVLSKIKQHTY
FT                   TLDGALWLRTTAFGDDKDRVLIKSDGSYTYFTPDIAYHDYKFSKDNTTKLIDVWGTDHL
FT                   GYIARLKAAMSALGYDPNNLEIVCAQVMKLVKNNEEFKLSKRSGQSLTIKDLVEIIGKD
FT                   ALRWFLGSSSMNSHVVIDVDIALSKNNNNPLYYVQYAHARANQVLNKQVYEFDFKTDLL
FT                   IETRERELLNQLHFYKQTIANAANNREPHRISNYLYDLAQIFHNYYANIKINDENNKAL
FT                   SAQRYTLVWCVKQVLANGLAIMKITPYDQMY"
FT   gene            301934..303202
FT                   /gene="pgk"
FT                   /locus_tag="UUR10_0277"
FT   CDS_pept        301934..303202
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="pgk"
FT                   /locus_tag="UUR10_0277"
FT                   /product="phosphoglycerate kinase"
FT                   /EC_number="2.7.2.3"
FT                   /note="identified by match to protein family HMM PF00162"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59837"
FT                   /db_xref="GOA:B5ZB90"
FT                   /db_xref="InterPro:IPR001576"
FT                   /db_xref="InterPro:IPR015824"
FT                   /db_xref="InterPro:IPR036043"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZB90"
FT                   /protein_id="ACI59837.1"
FT                   /translation="MNSLNKKSIKDLDVNGKTVVLHLDLNVVLDYENKRILNDRKLRAS
FT                   LPTINYLINHNAKIVILSHLGRIKTLADKQSGKYSLEIIVDELRERVSKNVNRVVFSPL
FT                   NYGETVVQMVNDLEERDILILENTRYCDISDEGEYVGLEWDGSEILGQFWGMLGDIFID
FT                   DAYGVAHRQLSSNYQTAKFAKKSALGFLIVNEVNHLDIALEVPKRPYLALIGGNHVADK
FT                   IEAIEVLCERADQVIIGGGLVYTFLYAQGYNVGLNLVERNMIDDCNNILEKYGKKILIC
FT                   FDFLCNNDFSDTRPIYRKIDEGLEGLYGLDIGKRSLKFIKHEIYRSKTILLNGPFGVIE
FT                   NIKYYAQGTTEICKSMAKQTTRGAYTIICDIDTSSHAEYLGLDKYMNFISTGGGASLSY
FT                   IEEGVLDGLETIDNVPLNVLKKE"
FT   gene            303206..304297
FT                   /locus_tag="UUR10_0278"
FT   CDS_pept        303206..304297
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0278"
FT                   /product="endo-1,4-beta-glucanase"
FT                   /note="identified by match to protein family HMM PF05343"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59922"
FT                   /db_xref="GOA:B5ZB91"
FT                   /db_xref="InterPro:IPR008007"
FT                   /db_xref="InterPro:IPR023367"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZB91"
FT                   /protein_id="ACI59922.1"
FT                   /translation="MSKFSEKEIRQKAIEYMEIYGMSRHEERVATKLKTSLKDVGVSYE
FT                   RDNLGSIIFKKTNSNKGPKILIATHMDEVGFVVQQILDNGQLLLSMVGGVWPNIVIGSV
FT                   AKVYVDEQRQYTGVFGHTSIHILEPEARSKAVPVKELFVDCGFSSKQQALDLGVEIGTE
FT                   VYMEGPSLNFHDENYIVGKAVDNRVSVAVLDLLVHSLKDKVIPNQTYFAATVQEEVGLR
FT                   GAKTVVSKVKPDIGIVIDTTTSHDTYKCPEGDTKLNDGVCIRMKDGGTLVNPALVKYFE
FT                   ALAKKHNIPLYKYVARGGGTDAEELQYGPDGGVLTIGLSIPQRYLHAPIGVATVKDMKA
FT                   AFDLVREFLEVFDENEFEKVKFK"
FT   gene            304372..305091
FT                   /gene="deoD"
FT                   /locus_tag="UUR10_0279"
FT   CDS_pept        304372..305091
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="deoD"
FT                   /locus_tag="UUR10_0279"
FT                   /product="purine nucleoside phosphorylase"
FT                   /EC_number="2.4.2.1"
FT                   /note="identified by match to protein family HMM PF01048;
FT                   match to protein family HMM TIGR00107"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59969"
FT                   /db_xref="GOA:B5ZB92"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR004402"
FT                   /db_xref="InterPro:IPR018016"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZB92"
FT                   /protein_id="ACI59969.1"
FT                   /translation="MTAHNQAKLGEIAKVVLMPGDPMRAKWIAETFLENAILVNEVRGM
FT                   LCYTGTYKGKKISIMGHGMGIPSIGIYSYELYKFYEVQTIIRIGSTGSYKKELNVNDVV
FT                   LVQKSYSDSTFASLIGAKVCDDKVLLPTKEVNELIEQTAKDLNLKLSLATCHASDVFYN
FT                   NDFESLDEIIDRTKSDCVDMESFGLFANAQILNKNAATLLTVSDSLITGDALSPTERAN
FT                   TFKKMVTLALESAIKLL"
FT   gene            305201..305596
FT                   /locus_tag="UUR10_0280"
FT   CDS_pept        305201..305596
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0280"
FT                   /product="DNA-binding protein HU"
FT                   /note="identified by match to protein family HMM PF00216"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60035"
FT                   /db_xref="GOA:B5ZB93"
FT                   /db_xref="InterPro:IPR000119"
FT                   /db_xref="InterPro:IPR010992"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZB93"
FT                   /protein_id="ACI60035.1"
FT                   /translation="MSEKIKAKTRVQMIDELSKMLNIDKKQTKTFMDTYEAFLILELSR
FT                   AKEVRFGNIGKFKVTVRAERKGINPKTGETVIIPEKTIPKFTFTKGIKEIINAGISVED
FT                   ETVFLDDNDYEDDGDEFVEEYIAPESN"
FT   gene            305736..307892
FT                   /locus_tag="UUR10_0281"
FT   CDS_pept        305736..307892
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0281"
FT                   /product="ppGpp 3'-pyrophosphohydrolase"
FT                   /note="identified by match to protein family HMM PF01966;
FT                   match to protein family HMM PF04607; match to protein
FT                   family HMM TIGR00691"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60149"
FT                   /db_xref="GOA:B5ZB94"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR004811"
FT                   /db_xref="InterPro:IPR007685"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZB94"
FT                   /protein_id="ACI60149.1"
FT                   /translation="MSELVKQKLDDLYDFLRQKKYSTQTIELVQKSFDFANYYHGDQTR
FT                   KSGEPYIIHPIATVRILASWDMDESTLVAGMLHDVLEDTNCPEEVMEKTFGKEVTQLVC
FT                   FVTKVSLYSKNRRNKVSHTNLEEKYSIQVFMSMTQDIRAMIIKIADRYHNMQTIQYLRL
FT                   EKAKRIATETLEIYANISGRLGMYRVKTELLDMSFKILDPQNYQLVNDSINKLVESNQK
FT                   KWNEILARLKNILLANNIKAEFEWRLKGIYSTYKKMTSGYEVKDIHDIYAIRVILDDVY
FT                   LCYQTLGLVHMNYTYIINTFKDYISTPKWNLYQSIHTTISYEGTLVEIQIRTTKMNLFA
FT                   NNGLAAHWKYKEQKDNKTEILLTVNNVLLRDFLSSTEKGIKTIKDVTTGTIFDVLILNS
FT                   NKWITVSNGSTLLDVAYKYDINNFFNILAIYRNGERSHFDTHVETGDTIKISYSNGIET
FT                   IRPNWITLANNDVVKLHISNHLKKYELNKQITKEQFLANAEFFLEGKIMSEEHAIKRLE
FT                   KEFQVNSINTFLDNIANTDIDLQTKYKVFSENKQVSREAINTIKNQAWKWLADSSYFSG
FT                   LENLYFTDFEISPCCSKIPGINCVAKVVRNKVEIHRSDCPKVKNSRSKTIVIEWSKEKL
FT                   ENRPRYFKVNLILKGNWSESVGNVLCNTLIRMKANISKVDIAKNKAARTHDTFLKIYVK
FT                   NLDHLQKIILELQAKNVINEWRLM"
FT   gene            307892..309505
FT                   /gene="pyrG"
FT                   /locus_tag="UUR10_0282"
FT   CDS_pept        307892..309505
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="pyrG"
FT                   /locus_tag="UUR10_0282"
FT                   /product="CTP synthase"
FT                   /EC_number="6.3.4.2"
FT                   /note="identified by match to protein family HMM PF06418;
FT                   match to protein family HMM TIGR00337"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60261"
FT                   /db_xref="GOA:B5ZB95"
FT                   /db_xref="InterPro:IPR004468"
FT                   /db_xref="InterPro:IPR017456"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR033828"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZB95"
FT                   /protein_id="ACI60261.1"
FT                   /translation="MKHKQKTKFIFVTGGVYSSLGKGVSASSIGRILVELGYSVAMQKL
FT                   DPYLNIDPTYLSPLQHGEVFVTKDGKEADLDLGTYERFINADLNKYSSVTSGKIYYEIL
FT                   TKERENGFGGKTVQTIPHITSAVIDYIEKIKDSLKTDFVIVEIGGTIGDIESLPFIEAI
FT                   SQFKTIYGANNVMFIHCSPLIYIEKVGELKTKPTQHSVKILRSLGISLDLLLLRTDQKL
FT                   DEVTIKKLAWSCGLDVDMIFAAYDVESVYLLPNILFEQGIHKAILEFFDLPLKNDNINS
FT                   WISFTNKIIIPKKHELIIGLVGKYVELPDAYKSVLASLELAAIELNIDLKIKYIQPINL
FT                   NENNVDDELKTLNGIVIPSIAGSIKGWPGALLAATYARKNNIPFLAIGTGVNIGVGEFV
FT                   KNQLQLPIEFINLGNGDFSFLKYAFIKNEIENYRIGEYCSNIQVNTITSKIYCEQKQLN
FT                   ERHRHHFEFNSEYINDHFLKHGWKIGAISTNNDYIDVLEYTKNHFYVLTIFNAEYTSKP
FT                   SKPNPYFINLLKTSLKIKES"
FT   gene            309509..310774
FT                   /gene="hisS"
FT                   /locus_tag="UUR10_0283"
FT   CDS_pept        309509..310774
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="hisS"
FT                   /locus_tag="UUR10_0283"
FT                   /product="histidyl-tRNA synthetase"
FT                   /EC_number="6.1.1.21"
FT                   /note="identified by match to protein family HMM PF00587;
FT                   match to protein family HMM TIGR00442"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60309"
FT                   /db_xref="GOA:B5ZB96"
FT                   /db_xref="InterPro:IPR004516"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR015807"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="InterPro:IPR041715"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5ZB96"
FT                   /protein_id="ACI60309.1"
FT                   /translation="MSNYTKPRGTVDLYNEAMNEFKSLENFLLTTTKKYGFQQIKTPIF
FT                   EFAELFMKSAGESSDLVSKEMYLFKDKSDRWLALRPEGTAGVIRAVVENKLLLNNPLPL
FT                   KLMYFEPCFRYERPQAGRQRQFHQFGVEVLGTKNIYYDFELIALANNILKKLAISDYVL
FT                   EINYISTAHNRSLWVKSLQEYFNLYRDELTPLSQERITTNPLRILDDKLESQKLVVQQA
FT                   PKITNFLSNEEKEEFALIKKMLDEHDIKYRVNEGLVRGLDYYSGLVFEFISTSPRLLGQ
FT                   STIIGGGRYGQLIKQTGGPDYEGIGFGIGIERLLIALLDSNKQILNNFEDKYLIAYFDK
FT                   ELENEAIKLTQSLRINNQLNVDIILDTIKADKIFRLAQRLNAKKLIILAKKEWLNKQVI
FT                   LKDLLSFEQKTLNLDEIKKIKE"
FT   gene            310778..312514
FT                   /gene="aspS"
FT                   /locus_tag="UUR10_0284"
FT   CDS_pept        310778..312514
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="aspS"
FT                   /locus_tag="UUR10_0284"
FT                   /product="aspartyl-tRNA synthetase"
FT                   /EC_number="6.1.1.12"
FT                   /note="identified by match to protein family HMM PF00152;
FT                   match to protein family HMM PF01336; match to protein
FT                   family HMM PF02938; match to protein family HMM TIGR00459"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60293"
FT                   /db_xref="GOA:B5ZB97"
FT                   /db_xref="InterPro:IPR002312"
FT                   /db_xref="InterPro:IPR004115"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR004524"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR029351"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZB97"
FT                   /protein_id="ACI60293.1"
FT                   /translation="MRVYCGRIGKEHLEKNVILNGWVKKVRKMGNLVFVDLKDRFGIVQ
FT                   IFATKQDEVFDELTQLSREDVINVEGLVLLRKSPNHELKTGEFEVHAQKLLIYSKAKTP
FT                   PLIIEDETDANEEIRFKYRYLDLRRDVNLRTFELRSKVYQTFRNYLHSEEFIETETPIL
FT                   AKPTPEGARDFYVPTRTKKFYALPQSPQTFKQLLMVAGFQKYFQIAKCFRDEDLRSDRQ
FT                   PEFTQVDIELSFADELEIQTLIENLFKHVFKQTINVDLTTPFVRMSYEQAINDYGSDKP
FT                   DLRFDLKLKTLDTYFKTSKSQIFQKALSNNQSIRAILVPNVNLNKKQIQSLEKFAKDKG
FT                   AKGLAWISIENEKVIDGSLSSIKEDHVIYQTIFKDYHLSTGTILLIADEFDIASQSLGL
FT                   VRVNLASMLNLKKPNDFKFVWIIDWPLYEYDDENQRFVAAHHPFTMPTLETLDTFDIDQ
FT                   KNAKGRSYDIVLNGYEVGGGSVRIINQQIQRRMFKSINMSDEEANLKFGFLLNAFEYGV
FT                   PPHCGIALGLDRLIMILINSEYIRDVVAFPKNNNGVDMMLDAPASMNDEDLKELGLIIK
FT                   ND"
FT   gene            312507..313343
FT                   /locus_tag="UUR10_0285"
FT   CDS_pept        312507..313343
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0285"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60279"
FT                   /db_xref="InterPro:IPR009677"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZB98"
FT                   /protein_id="ACI60279.1"
FT                   /translation="MINKKKIINPNIAYFEQNIPNYQEHLVVWNDLYDKLILLTDKIIV
FT                   DKNNKSIYQQTDKQTLDFSLCLSGLLSKTLGLNHKSSSLYLTSDDELAHRFKIKVLHNY
FT                   FNLYNIEEFYAFMDNQIRLENAKNIARLSLIYDLKKHENILKNTTDTDLENIDLEFAFI
FT                   NFLRAKISINFAYAYDICETILLLRTGHDLRFLENEHFSNLIPVFGLQVIKYFSNWKEF
FT                   LINYVMAVAYHNLDINNPQNVFLATQKFIDHLDELIVDYGLNKRDQWIKKIIPYEE"
FT   gene            313396..313893
FT                   /gene="msrA"
FT                   /locus_tag="UUR10_0286"
FT   CDS_pept        313396..313893
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="msrA"
FT                   /locus_tag="UUR10_0286"
FT                   /product="peptide-methionine (S)-S-oxide reductase"
FT                   /EC_number="1.8.4.11"
FT                   /note="identified by match to protein family HMM PF01625;
FT                   match to protein family HMM TIGR00401"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59911"
FT                   /db_xref="GOA:B5ZB99"
FT                   /db_xref="InterPro:IPR002569"
FT                   /db_xref="InterPro:IPR028427"
FT                   /db_xref="InterPro:IPR036509"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5ZB99"
FT                   /protein_id="ACI59911.1"
FT                   /translation="MVKSIWVAGGCFWGIQKYFDSIKGVRHTIVGYSQGNVINPSYEQV
FT                   CTQTTNHTETVQVDYDDRFVSLTSILEHLYQIIDPFSLNKQGEDIGNQYRSGIYYVDHE
FT                   DALIIKNFLLQKQNQTSKKIMIEVHKLHNFNIAEEYHQKYLDKNPNGYCHVNLSLSKKR
FT                   FN"
FT   gene            complement(313921..314520)
FT                   /locus_tag="UUR10_0287"
FT   CDS_pept        complement(313921..314520)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0287"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59761"
FT                   /db_xref="GOA:B5ZBA0"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZBA0"
FT                   /protein_id="ACI59761.1"
FT                   /translation="MSTRTLKISKVKLKIVDALFNLLKTNAFDKIKISEIIEVANISRP
FT                   SYYRNFDNKISIITYFIKNIYNWNVKNKLINAKVNKKFDEHGFIKFYEASLQTSLEFKD
FT                   YFLILDKNNFSGLIVDLTTENGFYAIGNMSNNSIDKYIINHLTGFFCNIRMQWLKNGAK
FT                   ESVHDMAMFLVSILKDNVIEKLKKYNCHHDNDDEEW"
FT   gene            complement(314528..315001)
FT                   /locus_tag="UUR10_0288"
FT   CDS_pept        complement(314528..315001)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0288"
FT                   /product="glutathione peroxidase"
FT                   /note="identified by match to protein family HMM PF00255"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59963"
FT                   /db_xref="GOA:B5ZBA1"
FT                   /db_xref="InterPro:IPR000889"
FT                   /db_xref="InterPro:IPR029759"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZBA1"
FT                   /protein_id="ACI59963.1"
FT                   /translation="MKLSDYPVLDIDKKLFDWSKIKNKLVLIVNVASKCGYAKQYEQLE
FT                   YLYQKYKNKGFVIIAFPCRQFMFQEFDDNNKIKEFCTTKYNVSFPIMYLTNVIGSNISP
FT                   LYKQLITEYPWSPKAKAVKWNFEKFFVKNDEVIGRFESKCEPNDLEEFIKNNL"
FT   gene            315250..325248
FT                   /locus_tag="UUR10_0289"
FT   CDS_pept        315250..325248
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0289"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF00657"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60264"
FT                   /db_xref="GOA:B5ZBA2"
FT                   /db_xref="InterPro:IPR013830"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZBA2"
FT                   /protein_id="ACI60264.1"
FT                   /translation="MDKKNKKILGISMASIIATIAIIAPATYFGLQKSDQLKKDPKLDY
FT                   NQAKLKGLDDNIIVDPNPSNNENYLPPLDFSKVCIKPQTKINYLAIGDSITAGFNSELG
FT                   WEAPGRYDLATNKISGLSFPSFIAQYINKVEPNRLASYENLGLTGSRAIDWLYLLGVAD
FT                   ANYFKDQQYKFFDFSKKMDNQENNPFKHRLKKFFNDFGYRNDKKLTNNEQVLKSDFTEF
FT                   YNSLRSANLMTISLGANDFLAYLDINKLIDLANSTQNDLVNKANEYKNYLKTIAQKIQN
FT                   DLKKLISAIKKVNPNISISLIGYPTPLLRLNDVLNQLFKLPNNQSLVNDVMDILNNAIK
FT                   NVADLKNNVNYIDPFDENDWKANSDKFTRAIFDIHPTELGYKRMAQDIFLKMSLGQNYA
FT                   QNKTPLIANAIYEAWDEDYFNKDSDSFKQQIGFANNTNQDLVNKVLGTSKGALFWVKTT
FT                   LENDKQLRDQFLNFKNTSTIVKDWLFANKRSFNSFVNFISQNLVNLGLDKNGAIAQFLA
FT                   NIDENGLNNLYKLAQAFVQTTYLDRVISGIQNDFDNLDLDKNNIKGTQKISTTLLLDVF
FT                   KKHVINDQNLFELLNGLFKSDFFVDNQLEIKKIVKALLSDLIGSQKLLDMVFGNNASNN
FT                   LNGDTEFLKNILIIQQKLVKTKSLEKIIDVFVDALFDSNQNYLSQGPLSNVLAKIVSAN
FT                   KNVLSERLTTLFDDLLKDETTLSAVYSLTTQILNEQIPDFAKTENGAQIIKKIISYGSN
FT                   VSLINLIKNNTIDLLTNPKTFLGIFDQNKPSILSIMQQSIDVNSKPFLNNVIDLLTSNK
FT                   INIDDWKLLMQAILNSPSITNILNNGLAGISDLNQKISSKVDFIKLIKNLAFVLDEKNL
FT                   DDTHKQQIKNTLKTIVDELFENPNLKNLLDSFEDFLANKIGDLLISSKSQIISTKGEQI
FT                   WKVIKTLINKTINGEQIKNLLITFINNFIDQPKQYQDFNTFTELLSVILKTNDQQIQTS
FT                   IDAIVKSVFADESTNSLISELIVDLMQQYLFKNNVSANDSQKLTTFIKNVLPSIADLTL
FT                   YKQVRRSLFTFLKENLVTIINDPNKWQTFVNKGINKILVDSLPQLLTIVELIENDQIKD
FT                   QDVIDVIKILIDNLDFNKLLTNSNNQSTTLEIDAKYLIFKLIKNFANSRIFKVENPKLE
FT                   VYKTKLKTILETSINNVFSNTNLNEFFNDGLAKLLSSLDIFAQLNLTDEQRNNFAKTII
FT                   KTFKENSTFKTLLISITKNLVDNVDEYVNANDLESIISLVIKQNQQQLKKVFDEILLVV
FT                   LKDEQWQDLILRLLVKVINPSKNYEDISSSSINKLKTFMTKFADGFSKLDIYKQIKDAL
FT                   FNVLSDPQKTKKLLSNDQQELKSIILEAFNINTPQNALKLIKIFDIDSISSRDYADVIE
FT                   IILFEIGIQTNIKNNNTTSSNNQSHNNDFIFQVIKLALNDGIDQKHLTKLKEIINFVLN
FT                   DIEKIYESDNFIRTQLNKFANSLVNSIIKLLPKTQSLENEYNEFFTTILNDRIFLNSVK
FT                   DLLSIIINKVIDHKDQYKNANSLGELVQLFAQNKESDLKTKFKVLLESVLKNETIVNKF
FT                   GSLLIKSFKLELNVPITNDQNEQNSISFIAKLLKNLTNLSIYNKLVDNFFVFVKSNIKN
FT                   LIDAKSFDSSKVSNELINFTSPKAKDYATLIELFGIEEISADEWKAFIGFIIDYTPFNQ
FT                   LFNSKPTTPFQSSSTNTSFDSSKITTEVFEFIKAFVSSKVINDSTNTTKAQTNANKFKD
FT                   VIEFLFDKLLTSNNTKNFIINLVIKQDAISSFLKSINIDEQKAIKISHAIINAIGEDKN
FT                   LQTIFNALIEPLVLQPQKFANTTNLAELIAKLIQESESNLKPAVISIIKNLLKNNEIQE
FT                   FVLQVVIPKINQNKTYNDLSQQAISSFKNLLTKLANHLDNVSVFNDLLTNLFTKLKHQN
FT                   SINQLLTTNLDAMLNLVKELFNLNENTLAKVIDILEIDDISAQEFVDVINAFVNQIEIS
FT                   FEKNQTTTNTNSESINRYWKYASALIKHNWSSKAKTKFKSIISLFIEQNLNSNQESFWT
FT                   KLVQTIGTKVSNIIVEKISNLSSQKTSYETLIKNLLNNANFKNAIKNFIVEGSSKIIDN
FT                   LDQLKDATSFGDLVQKLITTNDTWLKSEIKKVLSVILKEANLTNELAQVLINSYTSYFE
FT                   ITNLGEEQQSKLKNVLTKVITNVSDLKFVDNLTTQLIKFLKENAKALIDNPLNNQQALN
FT                   KFINENIANEDALINLLEIFDNTNISVEEWNEFTQILIDYLPLNKILDITKRINQQNNQ
FT                   TALSVNQQITNVFVFIKKLLNSTHLNNVKNKFDDVIKNAISNLLKNNNFKNFIATQLTN
FT                   TLFSNTNLINTLGIVDTKTTLIDPIINQLISSEELSNIIQTLITSIFEQKDQLKTLDSS
FT                   NEFFTKLISLNTEKLKPNLKKIIQNTLKQDNVQELLVRVIFKQITPNKIYVSIKEESKH
FT                   NLKSLISKFANRLEEFSSYNEIVNNLFTSLSNKDNWTKLFSNNNNDLIAFAKTIFDYTN
FT                   PQKIINLIDVLKITSINDTDYIQAFKTLLDEVDFSYFINKKHQTNESNANSQNKLNIND
FT                   YYKYVKALFNHELDETSKIKLKNIIKELTTKVLSDQGTGFINNLANALSEKISNLITKA
FT                   IPQLQSHQDAYKNLVKKIFTNQTLFNEVKELIVWVFNDFIDQKNTYKSIKTFGALFEKF
FT                   IQTHEQEIQNKLIATFKKIFSEKNNLIDEISTTFIDSVKTYFNITNLTNGDNDKIKQFI
FT                   KFVFNNIFELEYVKNSVNKLITTLKDNVKNLVDNNSDINTIMQTNVVSFISSPTEVAKL
FT                   FQIIKLDTNNTILNFLKVILEKLPTTAYQKMFGTKIVLQDQTATVTTNKQEHQAIEYIK
FT                   AILNSSYLNDNAVLTKTKTIIKDLLTSFSKSTELTSYLSELIANSFAQKLSDVTKINLE
FT                   NSKKFLVGSYKFIVNDTKFVEIINNLIDNLLTQKSQYLDKLISSPLDVINELIKTNIAT
FT                   QKNEFVPFIKRFLKTDSTSEFIAQFIIGTLKLENTNNNDINTIKKFINELVDNMHNLDF
FT                   LNVFIDSMFNLMSKKGLDIFIKPNEIAEFKKSMETFGLTDPMNLLKIAKQVNNNQIKGE
FT                   TIGDLINLMFEKSPLTSYDKLNANDHPLYYGLKNLKEESLTSVIFGNGNKKEYKGIERI
FT                   NELDAIQHLINQLWDAQKKYSDQHKNSMTYEQDNPYMRSLIHLGIVLQWYVHETYFRNT
FT                   TGGFWWWGAASNSWSGEGEVFLLLKADKNFSEAKVNQMIMGNRSPWLWSAPSYWSYTKN
FT                   DFLFMITYWKKHKTSRHTKKPMVDDIFESLKRGYGQQIAIKK"
FT   gene            325507..335637
FT                   /locus_tag="UUR10_0290"
FT   CDS_pept        325507..335637
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0290"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF00657"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59895"
FT                   /db_xref="GOA:B5ZBA3"
FT                   /db_xref="InterPro:IPR001087"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZBA3"
FT                   /protein_id="ACI59895.1"
FT                   /translation="MDKKSKKILGLSVASIIAAIAIIAPATYFGLQKQEENKKDINLDN
FT                   ITRRIPGEGKDIIKVEDLNNNEQNAGLKLDFSKVSIKPQTKINYLAIGDSITAGFNSEL
FT                   GWEAPGRYDPVTNKISGLSFPSFIAQYINKVEPNRLASYENLGITGSRITDWLYMLGAG
FT                   SDAYFKDQEYKFFDFSKQMDQQNKNPFKNRLSKFFKDFGYNSQLLPKNNQEVNASDFNA
FT                   LKEQIKKANLMTISLGANDFLRYLDITKLVNLTNLKGKELETKVKELENTLKKLASEIT
FT                   NDLKKLISLIRNLNPNVSITLISYPLPLLRLQDVIDSSFKLSNKRSLSDEIMSILNNAI
FT                   KDAHDLNNNVNYIDTFDENDWKENSFTFAKAIFDIHPTELGYKRMAQDIFLKMSLGQNY
FT                   AQQKTASIANAIYDAWDSEYFNKDKDSFKQQIGFANNTNQDLVGKILGSSKGAAFWAKT
FT                   ALENDQELRKAFSNFKNTSSLVRDWLTSNKRRFGSFVNLITTNLTSLGLDKNGAISQFL
FT                   SKKDENDTNNLYKLASTLASTPYIDMVVSGIQNDLDNLDFDHNNIIGTQNISKKILYDV
FT                   FRKNIVNDKNLYELIKGMFNSQLFSENKSQIKGLVKALLSDLVSSHKLLEIIFGEFAND
FT                   NLKNNNEFLKNLLTIQNKLVQTKSLDNIINVFVDALFDNDNQYLSQGPLSNVLEKIVSA
FT                   NKTLLTTRIDSLFNDLFKDQTMLDATYDILMQVLDQKVPDFIKTPQASKLIKKILSKGT
FT                   DLKLINTLKLNIVNLLTNSETYAGIFDPSKASIISLVQKSIDFSSKSFISDLLDLLTSD
FT                   SINLNEWKEFIKGILDSSTITNILNYGIVGLISSNTTSLTTNNFDFNVLLKNLISVLAE
FT                   KHWTVEQKTKLKSILRASVDELLTNSHTQNFINSIEDFIANKLGDLLLGMNSELLKNNM
FT                   SDIWKLIKEVVHDLIHSFQSYDLVFTIINNFIDQPENYTKLNSINDLLPLILKSTNKEL
FT                   QSKIDALFKKLVDNQKTTSLIGTLTSNLIVNNLFSKQLSVEYNQKISNFITNILPTIPN
FT                   LTLYKEVRQQIFEFLTNNVAKILVNPKNSLSILNDGVNQLLSNVLPKLLTIVELVDNDK
FT                   IQDQDFIDVIKIFIDNLDFNKLFKNNTTNQSTFKINLNLEPKKLIFDLIKNLLNSPVLK
FT                   VNENQNNKAKIESNKAKIKSILTTSVTNIFENSNIINLFNDQLSQLFSSIDFFKDLNLS
FT                   VQQRSKFGKAIVEILNKEKLLSNLINKLITNLIDHTNEYAQATSLAEILSLIVKYNEIE
FT                   LKDAFDKLLTNILKNEDLQDLILRILVKLINPNKTYDSISTASISKLKSFITNFATGIG
FT                   QLDFYQQLKNSIFIVFADKSKMQQLLSNDQSAINEILLEAFNINTPDKVLKISSLLDIK
FT                   EISARDYADIIEIILVEIGINTNTNVQTNESNNSQESNPNNKSNNFVFQIFKKALNNGI
FT                   SDSQLQKIKDVINYLLDDIVKIHDSSSFLRIQLNQLAHILVDKITTSLPQSVSIKHWYE
FT                   EIFSSILNNQDFLQKAKVLLSSVLNEIIEHKDKYKNVDSFGQLITTFITNKASDLKAQL
FT                   KDLLNTVLKNQTLITNIGQVIIESFKLENKIDVLDENLEQNTISFINKIFAHITELPIY
FT                   NNLVDNFFNFFTQNTNTFDKKPFDFNKFKDSLFNAIIPKMNDFASLLDLFKYNEISEQE
FT                   WRDAITFFIDYLPLNSLINSKSSSTNSLALTRNASVSNSEVNSNKIKNIIFDLIKALAQ
FT                   KAKTFDSNVATKTKNIIEFTFDKLLTSNNIRSFAKNLLLDLAPIKSFLNSLNIQDEKQP
FT                   EVIEHIINALLKDKQLQTIFNALIESILSNSNNFDNTTTLSEIINQIVNTSKEKIKPAI
FT                   TKIIQNLLVDDEIQTLLLCYAIPQINATKTYDNISESSINKIKNLITKLANNLNQFSIY
FT                   NNVLDNLFTKLGDKTSVDKLLTGDLSSILNILKEVLNLNQPSELIKVIDIFNIEAISAQ
FT                   DYVDVLNVIVNDIGFNNQPTTNNNQNQKNDINVYFNYLKALVEHNFSESSKTKLKEIVK
FT                   LFVTDVMNDNHEDHFWKTTSSFVSEKLSDLLIKKVQALSTQKNEYRQLINNLLSGNDFK
FT                   QVVQNLVIEGFAKIINHQEQLKNAQDFGDLIQKIINIDDSWIKNQLKQLLNAIVKNVNL
FT                   TKATSTAIINSYLNYFEIKNLSEENKNTLINIFDKILKQVPNLSYLQNIVDQSVDFLKT
FT                   NIQALINNQSLKDDVWNDFINKNVTDISALSNLLEIFKTNEITSSEWNQLITILVDHAP
FT                   ISKIEQIITSLASSSTISNKVQKQSIKVQIDKIYTLIKKVLQSQALNKNHANTSVVKIN
FT                   EVIKTLIDRLFANEEIQILITNKLSNWIFSSNLANTLNIDSNQKDSLIKPIIEFIANSN
FT                   ELKDILKSITNSFVSHASDLANTNSFEELIAKLISLEQANLKNNLKNFVQKLFENEKVD
FT                   ELFARVIFKQVSPQKTYDQIQKAHKDKLIAFIKKIANNLTKFDLYNKLFDNLFNSITKH
FT                   ENLTKLLSEQQDSLISFIKTIFDFSDPKQIVSLIDVLKVSEITSNDYIDVIKLILDEID
FT                   FNHFFNQTVENNSSNPSNFQQNSNSSKLDINKYYIYVKTLFAHEMDSTTKEKLKTIINE
FT                   LTKQIVQNTNQGLLNNLGTGLGQKLSNLIINGIPGLTSLKQEYKTLVQKVFTNQNLFEQ
FT                   IQNLIIYAINSLVDHKDEYKNHETFGQLLSAYINKNQTEIISKLKDAINKVISGSSSLI
FT                   DDIATSFANTIKTYFKLENLSTDDTNKLKGFVDFVIKNIFNLEYVNDGLNKLITALSTN
FT                   AVKIIDENADFATIMQSDVVSYLTSPQQIAKLFEIVKLDTNDAILNFLKVIFNHLPQDA
FT                   YANLFGNKINISSNASSNQNTNKSTTPQHNVLDYIKAILNSSYLKEQTTIAKIKHIFKE
FT                   LLTTISKSSQLNNYIGQLISNSFAQKLSDFTNVDKQYSEAFLKGSYQFIIGDEKLIKII
FT                   DEVVNDLVDHKDEYLKQIETNNQPSINIILNMLIKRNVDKQKGDFVPFIKRLLTIDSST
FT                   QFMAQYIFRTLKLENTNAQDIKVIQTFVKELVSQVDQLDFVNLFIDKIFTLLKENGLDL
FT                   FTNEEGIKKVNEAMKTFGLTETTNLLKIAKLVEPNKIRAETIGDLINLVFEKSPLAEDF
FT                   ESITQEKNPLYYGLKNLKEDSLSGVLFASGKKKTGEAAKVSEINMLDAIQHLVNKLWTA
FT                   RAEYAKKHPNLEYEQDNPYMRALVHLGIVMQWYVHETYFRNVSGGLWWTGSDSLSGEGR
FT                   VYLLLKADMGAESEKRVRSMIMGNRGAMLWNTPKEWNYGKNDFLYMITYWKWRTNSRFN
FT                   DPKEKNKATFVFKALKRGYGQKVKTMK"
FT   gene            335791..336630
FT                   /locus_tag="UUR10_0291"
FT   CDS_pept        335791..336630
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0291"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60002"
FT                   /db_xref="GOA:B5ZBA4"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZBA4"
FT                   /protein_id="ACI60002.1"
FT                   /translation="MQINKKKLLIKLGLFLGLGTIPIFVSSCSIIIPDSIPLKSNVSLI
FT                   TNDISKLANNYIDNQHEIIESVDKNKKINLTNEMIQKAKFYAEYVGRLRFIQKLKNEIE
FT                   KWKVSTNEIIKTITDSDISSLYDFNDNNLTIYTKTFYFRDPKIVNTNKNDYFISKKPIQ
FT                   TITMENLLDMGLTWTIIYKDQTKTHIKPTDFMTKNFIDYKKLENKIDTRLKILYDMIVK
FT                   NESLNINHSEYESLLVNNDWKKYHENVINIFIHQRYNEGIKIDIDFLSHFLLKETLK"
FT   gene            336644..337354
FT                   /locus_tag="UUR10_0292"
FT   CDS_pept        336644..337354
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0292"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF01709;
FT                   match to protein family HMM TIGR01033"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59844"
FT                   /db_xref="GOA:B5ZBA5"
FT                   /db_xref="InterPro:IPR002876"
FT                   /db_xref="InterPro:IPR017856"
FT                   /db_xref="InterPro:IPR026564"
FT                   /db_xref="InterPro:IPR029072"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5ZBA5"
FT                   /protein_id="ACI59844.1"
FT                   /translation="MPRKHLIASGINKKQQQQAKIWMKCAKEIKAAAKMGGPNPEANPR
FT                   LKVAIERALNNNLSRDSIERNINGASKDADNLKELTYEGYGPNGLAIIVRALTDNEQRT
FT                   ISAVRGYFSKLQGQIAKPNSVSMLFNEYGQLLIDKKTKTLDEWFELLVDQDIVDINEDD
FT                   EIIEILVQPKDFSATKLILENNNANIQSAEIKLIPTDFISLDDHARERLVRFVNACEND
FT                   DDISWVITNYEEEL"
FT   gene            337354..338061
FT                   /locus_tag="UUR10_0294"
FT   CDS_pept        337354..338061
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0294"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60009"
FT                   /db_xref="GOA:B5ZBA6"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZBA6"
FT                   /protein_id="ACI60009.1"
FT                   /translation="MSNIDSKTNFWKLNKKNKKILFRVLGYSSLLTIILTPIIYKVSYN
FT                   KQYEFISQSVRELKAIDNNLVSSYSNFYISQKSSASNGLYNYNLITNFKDFQQLMIDDL
FT                   NFDKYSSALIHEEIKNELLKKYDENFFKNNDLLYVSYNSLDSKYFLTSILTYDHNNLSL
FT                   PFLNTKTIFNEEFNNENFYTNSALGNTKTEVKFFSVSKKYNIKREQVRIYGLKTAKDLF
FT                   LYKNYVQKNNKPV"
FT   gene            complement(338058..338571)
FT                   /pseudo
FT                   /locus_tag="UUR10_0293"
FT                   /note="recombination protein U; this gene contains a frame
FT                   shift which is not the result of sequencing error;
FT                   identified by match to protein family HMM PF03838"
FT   gene            338714..339280
FT                   /gene="efp"
FT                   /locus_tag="UUR10_0295"
FT   CDS_pept        338714..339280
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="efp"
FT                   /locus_tag="UUR10_0295"
FT                   /product="translation elongation factor P"
FT                   /note="identified by match to protein family HMM PF01132;
FT                   match to protein family HMM PF08207; match to protein
FT                   family HMM PF09285; match to protein family HMM TIGR00038"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60111"
FT                   /db_xref="GOA:B5ZBA7"
FT                   /db_xref="InterPro:IPR001059"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR011768"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013185"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR015365"
FT                   /db_xref="InterPro:IPR020599"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5ZBA7"
FT                   /protein_id="ACI60111.1"
FT                   /translation="MATIIQAKDLRAGHTFLYKGSIYQVIENSFNKTAMREGIVKCKVK
FT                   NLRTGAITVEVLTGEKVEQAIIEKSKMTFSYDDGSGYVFMDNETYEQISIPYNQLSWEK
FT                   NFIEEGTEVSVMRYDGELMGVSLPDQLVVTIVEAEEAVQGNSVQNATKRAWLASKWEFQ
FT                   VPQFIKSGEKVIINPSNGQYVGRAK"
FT   gene            339283..339585
FT                   /locus_tag="UUR10_0296"
FT   CDS_pept        339283..339585
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0296"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60171"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZBA8"
FT                   /protein_id="ACI60171.1"
FT                   /translation="MQYITINNAKTGKILISKPNIKKFIEQKFNLIVNKKFVIKSIDIT
FT                   QYDESLVDISIIIALFDEHRKVDLDEVRDVQNHLASFIYSNLGVDTKSVNIGIDL"
FT   gene            339588..339971
FT                   /gene="nusB"
FT                   /locus_tag="UUR10_0297"
FT   CDS_pept        339588..339971
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="nusB"
FT                   /locus_tag="UUR10_0297"
FT                   /product="transcription antitermination factor NusB"
FT                   /note="identified by match to protein family HMM TIGR01951"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60241"
FT                   /db_xref="GOA:B5ZBA9"
FT                   /db_xref="InterPro:IPR006027"
FT                   /db_xref="InterPro:IPR035926"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZBA9"
FT                   /protein_id="ACI60241.1"
FT                   /translation="MKTQWAKRVKLFQFVYHWLITKKNKTIALKSALVDFELDVSWLSV
FT                   SEYILDNCEQLIKMIKPFINKDWTFERLSYVEQALLLSAYGEYLVLKTPKKIIIDQTLI
FT                   TTHNYSNDESYKFINAILDQLLN"
FT   gene            339979..340683
FT                   /locus_tag="UUR10_0298"
FT   CDS_pept        339979..340683
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0298"
FT                   /product="RNA methyltransferase, RsmE family"
FT                   /EC_number="2.1.1.-"
FT                   /note="identified by match to protein family HMM PF04452;
FT                   match to protein family HMM TIGR00046"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59888"
FT                   /db_xref="GOA:B5ZBB0"
FT                   /db_xref="InterPro:IPR006700"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZBB0"
FT                   /protein_id="ACI59888.1"
FT                   /translation="MQRYFVSKIKDKKVYFYDSDVHHIKNVMRMRLHDEIIVINETQAF
FT                   IAEIINLEPLHATIIKPYFNDCELSTKIDLFQASIKPNNFEWIVQKACELGINSIYQTI
FT                   FKRTYNSTLIKNNRISTIIKEACEQARRNYLVNYYEQFSFSELLKVLLNYDLILVAYEN
FT                   EKQIFLNDIFKENSTYQKIALVIGPEGGFEQEEIALLKKINNVVCISLTKTILRSETAS
FT                   LYLLANLINKLI"
FT   gene            340706..341665
FT                   /locus_tag="UUR10_0299"
FT   CDS_pept        340706..341665
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0299"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59832"
FT                   /db_xref="GOA:B5ZBB1"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZBB1"
FT                   /protein_id="ACI59832.1"
FT                   /translation="MKQRLINYIIVLIGILCIVSLVVGFAVWFSPNKNFYSLTSVNTTG
FT                   LDGLSAKKIYNPNDGIFLEQLQGFSKHNIAGYVVPIIFAILSFGLLFLYYYLNKKSRAK
FT                   ADFPISEKFYYHTSITTLYLVGSLIVVSWILSYIAIGINFRPNNFSITLNDNDYASLSS
FT                   EPFLTYWKELKQSFDAKKSVYIAFLVITIAFAVSIIGFVNYFSLKIALEQTQKATLAVQ
FT                   KQEEEQKNQLSNGTYFDQDLNLLNDYDKLVLYQKNNLSSAIFLAINDQEQILMQQDQVV
FT                   ISSLSIEQKVKYREQATRIVFEKQDSHHDDHLATSGNF"
FT   gene            341923..343449
FT                   /gene="rrs"
FT                   /locus_tag="UUR10_0300"
FT   rRNA            341923..343449
FT                   /gene="rrs"
FT                   /locus_tag="UUR10_0300"
FT                   /product="16S ribosomal RNA"
FT   gene            343745..346646
FT                   /gene="rrl"
FT                   /locus_tag="UUR10_0301"
FT   rRNA            343745..346646
FT                   /gene="rrl"
FT                   /locus_tag="UUR10_0301"
FT                   /product="23S ribosomal RNA"
FT   gene            346715..346818
FT                   /gene="rrf"
FT                   /locus_tag="UUR10_0302"
FT   rRNA            346715..346818
FT                   /gene="rrf"
FT                   /locus_tag="UUR10_0302"
FT                   /product="5S ribosomal RNA"
FT   gene            346933..347403
FT                   /gene="greA"
FT                   /locus_tag="UUR10_0303"
FT   CDS_pept        346933..347403
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="greA"
FT                   /locus_tag="UUR10_0303"
FT                   /product="transcription elongation factor GreA"
FT                   /note="identified by match to protein family HMM PF01272;
FT                   match to protein family HMM PF03449; match to protein
FT                   family HMM TIGR01462"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59753"
FT                   /db_xref="GOA:B5ZBB2"
FT                   /db_xref="InterPro:IPR001437"
FT                   /db_xref="InterPro:IPR006359"
FT                   /db_xref="InterPro:IPR018151"
FT                   /db_xref="InterPro:IPR022691"
FT                   /db_xref="InterPro:IPR023459"
FT                   /db_xref="InterPro:IPR028624"
FT                   /db_xref="InterPro:IPR036805"
FT                   /db_xref="InterPro:IPR036953"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5ZBB2"
FT                   /protein_id="ACI59753.1"
FT                   /translation="MAKYTISKHRLEELQLELREILDVKWPAITKQLQDAREQGDLSEN
FT                   ADYDAAKNEQAALKKRKDEIEEILENYELIEDVMRSTDEVSIGSTIEIYNYQKDHKEVI
FT                   TLVGSMDSDPFANKISMDTPLGKAVVKQKEGSEVTVHTLALPYKVKIIKIID"
FT   gene            347483..347568
FT                   /locus_tag="UUR10_0304"
FT   tRNA            347483..347568
FT                   /locus_tag="UUR10_0304"
FT                   /product="tRNA-Tyr"
FT   gene            347572..347648
FT                   /locus_tag="UUR10_0305"
FT   tRNA            347572..347648
FT                   /locus_tag="UUR10_0305"
FT                   /product="tRNA-Gln"
FT   gene            347713..347789
FT                   /locus_tag="UUR10_0306"
FT   tRNA            347713..347789
FT                   /locus_tag="UUR10_0306"
FT                   /product="tRNA-Lys"
FT   gene            347851..347938
FT                   /locus_tag="UUR10_0307"
FT   tRNA            347851..347938
FT                   /locus_tag="UUR10_0307"
FT                   /product="tRNA-Leu"
FT   gene            347943..348016
FT                   /locus_tag="UUR10_0308"
FT   tRNA            347943..348016
FT                   /locus_tag="UUR10_0308"
FT                   /product="tRNA-Gly"
FT   gene            348079..348867
FT                   /locus_tag="UUR10_0309"
FT   CDS_pept        348079..348867
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0309"
FT                   /product="DNA methylase"
FT                   /note="identified by match to protein family HMM PF05175"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60102"
FT                   /db_xref="GOA:B5ZBB3"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR007848"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZBB3"
FT                   /protein_id="ACI60102.1"
FT                   /translation="MQKKYIKNTLGFDTNLFVYQDKQMFNYSVDTVLLANFISLSSKTK
FT                   KVLEIGTNNAALSIFLASRKEDMNIDAIEIQSEAIDLALLNVKENHLEKQINIIHADFN
FT                   EYWKTFDKIENNKYDAIICNPPFYKQDKIIPSTKKPLKTLALYEIALNFEQIMQGCAKI
FT                   IKQKANLAMVIPTTRLVDLLEMMRKYQFEPKRIKMIYPRIYEQSNLVLVEARYKTGWGT
FT                   HFEPNLYLHYEDKQNHEYTKEVLKWYKPIKFKKSNEGEAK"
FT   gene            348869..349783
FT                   /locus_tag="UUR10_0310"
FT   CDS_pept        348869..349783
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0310"
FT                   /product="endonuclease IV"
FT                   /note="identified by match to protein family HMM PF01261;
FT                   match to protein family HMM TIGR00587"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59878"
FT                   /db_xref="GOA:B5ZBB4"
FT                   /db_xref="InterPro:IPR001719"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR018246"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5ZBB4"
FT                   /protein_id="ACI59878.1"
FT                   /translation="MDKYNLIIGSHVSLKANDFFYGSVKEALSYGANTLMVYTGAPQNT
FT                   RRQPIELFKINEAHNLLKEHNIDLNNLIVHAPYIINPCSSKKYVRELAKEFLIQEIERT
FT                   QFMGITKIVLHPGSCLDQDEDIALKQVYTMLNEIFATINTNVVVCLETMSGKGSEIGIN
FT                   LKQLKTIIDNVDSKKNIGVCLDTCHMSDSGIALDHDSFNQYLKEFDAQIGIDYIKVLHI
FT                   NDSKNPRGANKDRHENLGYGTIGFDNLINIIYHPLLNNIPKILETPWFDFHDQSISLYE
FT                   YEIKMIRDRKWFDIKYKLLVGNK"
FT   gene            complement(350085..351050)
FT                   /locus_tag="UUR10_0311"
FT   CDS_pept        complement(350085..351050)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0311"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60269"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZBB5"
FT                   /protein_id="ACI60269.1"
FT                   /translation="MNNNEIEDELDLENFNYQKALEVPNLKAINLTEDEFNLHFWDIVG
FT                   VYRSYLNNLKEPNDSGYIYELNRNEYNHLCLVVIKKESKVDKVKKNYILNTIKNMDYDI
FT                   SLTDDSQIFSKKSEILDNDLLVERNKLINFFLEEARKNKKQSANKEDNITTNDQQLKSA
FT                   FIYGDFGVGKSIITQAYTNTISLKYNLKIAYITLNELFKNVIQFFNYKDISDSVVNELI
FT                   NELSNIDVLVIDDFSSGNLNYWSISTILMPIIENRLKSMKQTIFISNFSIEQLNNSTKN
FT                   IANIEEQKAKLRLFNRIECLTYGNVFKIKGPSIFKVTNNL"
FT   gene            complement(351053..352198)
FT                   /locus_tag="UUR10_0312"
FT   CDS_pept        complement(351053..352198)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0312"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60061"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZBB6"
FT                   /protein_id="ACI60061.1"
FT                   /translation="MDIVIKKNCNFIKNENYLYSFYTPLIGIQATAMYSWFVNRENIFN
FT                   KKGIINLTREYLLNELNISINTYNNLITKLVNVDLIKIYCIENNQQQIIEVFRPLNFNE
FT                   FSNIEKFNEELKNNVSNDHYKILNLLNKENSINNNRLIDLSTQFKTNYSNSFENKLDKI
FT                   KKIILDEYQLSLQINESVKLSILNFFKKYKFSVNEMANLIKNNLINNIDFLTIDLNKLE
FT                   LSIISNQQVENNKTKLQYQNIERDSSIFNENADLNLFKNVINHYNYFEPSDFLKHIRKE
FT                   KLSVEDKEAIILLTYDKTLNNAIVNVILDFVLFKNLGRLNIKYLKCIKETVLGINIKNE
FT                   YEMIKFFQNKKMNQKQLVFNNDDNTNTFKNTDFVEVKFGDL"
FT   gene            352546..353106
FT                   /locus_tag="UUR10_0313"
FT   CDS_pept        352546..353106
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0313"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59786"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZBB7"
FT                   /protein_id="ACI59786.1"
FT                   /translation="MFEQIFFLASINDKKIIRWLYERYHKIFLKYINEQLHFKFYTLDI
FT                   EANDLKTVIYEIFLKIFQVSKIKNLNQFIGFVKRQIYFYLVYLLRKALSNKNLVNQLNS
FT                   NNFENREAISENLDDVSIELNNKFLIHELLEIIYKENLLLYHFTILIIKGYTTNEINKI
FT                   LKINSTKTYYFKSILKKYIKNLL"
FT   gene            complement(353172..353426)
FT                   /gene="rpsT"
FT                   /locus_tag="UUR10_0314"
FT   CDS_pept        complement(353172..353426)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="rpsT"
FT                   /locus_tag="UUR10_0314"
FT                   /product="ribosomal protein S20"
FT                   /note="identified by match to protein family HMM PF01649;
FT                   match to protein family HMM TIGR00029"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60228"
FT                   /db_xref="GOA:B5ZBB8"
FT                   /db_xref="InterPro:IPR002583"
FT                   /db_xref="InterPro:IPR036510"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5ZBB8"
FT                   /protein_id="ACI60228.1"
FT                   /translation="MANIVSNEKTYRHTQKVRKENHAKMSKLRTIVKKTRSSNEQAQLN
FT                   EAYKVIDTTASKGVIHKNKANRLKSRTAKAFKANLQVVA"
FT   gene            353625..353992
FT                   /locus_tag="UUR10_0315"
FT   ncRNA           353625..353992
FT                   /locus_tag="UUR10_0315"
FT                   /product="Bacterial RNase P class B"
FT                   /ncRNA_class="RNase_P_RNA"
FT   gene            complement(354032..354472)
FT                   /locus_tag="UUR10_0316"
FT   CDS_pept        complement(354032..354472)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0316"
FT                   /product="ribosomal protein-alanine-acetyltransferase"
FT                   /note="identified by match to protein family HMM PF00583"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59932"
FT                   /db_xref="GOA:B5ZBB9"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZBB9"
FT                   /protein_id="ACI59932.1"
FT                   /translation="MLKNLLVKSANQNDLNDIAIFENKFFLNDAYSIASLYQMFNDANY
FT                   EIVIVEYEQKNIGYLIYMKTIDFNEILKIGVDENYRNLKVGSVLIDLLKQKKQNILLEV
FT                   SSINENALNFYLKRGFIKQSIRKKYYADNSDAILMIWKYNTQ"
FT   gene            complement(354450..355025)
FT                   /locus_tag="UUR10_0317"
FT   CDS_pept        complement(354450..355025)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0317"
FT                   /product="glycoprotease family"
FT                   /note="identified by match to protein family HMM PF00814"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60095"
FT                   /db_xref="GOA:B5ZBC0"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR022496"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZBC0"
FT                   /protein_id="ACI60095.1"
FT                   /translation="MNSLYQLFIDVTSKKCVLAIYKNFKILANIIVETNNNLTDIIVEH
FT                   IIALLKAVHLKYQDLDAIYLDIGPGSFTGVRVGAIVAKTICTTHNQIKLFINDSLNIIA
FT                   NNKNNVFVHLDAKGNKSYTISIINNIQSDYRIITNEQLQIELKNTSLTIIDANQVDYHN
FT                   LIYNLKFDNFKLTNILDFDLNYVKKPLS"
FT   gene            complement(355018..355917)
FT                   /gene="rluA"
FT                   /locus_tag="UUR10_0318"
FT   CDS_pept        complement(355018..355917)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="rluA"
FT                   /locus_tag="UUR10_0318"
FT                   /product="RluA"
FT                   /note="identified by match to protein family HMM PF00849;
FT                   match to protein family HMM PF01479; match to protein
FT                   family HMM TIGR00005"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60097"
FT                   /db_xref="GOA:B5ZBC1"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR006225"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZBC1"
FT                   /protein_id="ACI60097.1"
FT                   /translation="MKILYSLTSPKRIDKFLVEVTDYSRTSIKKMLEQNLVLVNDNIIT
FT                   KQSYLLQKNDSVEIKNEQCVIDSQKELLPFACPLEIVFEDQDLLVINKPSGMLVHPTSF
FT                   QEQNTLANALKHYLKTDDFYITHRLDKNTSGLIVICKNQKALCCLQQQFMQKTVKKSYY
FT                   AIVHNRFDMHHLHFMINEPIGHSYQDKLRMKTGDAKNVKEAISIVKVIEQYQNTALVEV
FT                   SIITGRTHQIRVHMRHINHPIYNDPLYGISKHTTPYEQYLHSFYISFIHPSTNEIVEFK
FT                   TLMPNEFINLIKEWKTNE"
FT   gene            complement(355920..356711)
FT                   /locus_tag="UUR10_0319"
FT   CDS_pept        complement(355920..356711)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0319"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59976"
FT                   /db_xref="GOA:B5ZBC2"
FT                   /db_xref="InterPro:IPR001872"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZBC2"
FT                   /protein_id="ACI59976.1"
FT                   /translation="MFEKITNSNFYITIKKFNESLRKINFFKKIILKIDNKGVRDYFLS
FT                   ITTLDVIFYKIINFIIIALIVLLSGFLVREWAINLVINTKEIYHGPIFHFTLNNGIALG
FT                   RINNNSGIVYALQSIPIILGFLSFIFLKKSYHYAPLLFLLFGGLGNIIDRSIPELELYK
FT                   ALPDIFHNSFINPNSVGGGNDVINGVVDYWKFVNSIINLFDVYIVVGVCVLVVILIIGF
FT                   IIKWKSDNDTKDTTKKAADENDLEINEVSNKPFGYDDLEKP"
FT   gene            complement(356711..357256)
FT                   /gene="ppa"
FT                   /locus_tag="UUR10_0320"
FT   CDS_pept        complement(356711..357256)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="ppa"
FT                   /locus_tag="UUR10_0320"
FT                   /product="inorganic diphosphatase"
FT                   /EC_number="3.6.1.1"
FT                   /note="identified by match to protein family HMM PF00719"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59939"
FT                   /db_xref="GOA:B5ZBC3"
FT                   /db_xref="InterPro:IPR008162"
FT                   /db_xref="InterPro:IPR036649"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZBC3"
FT                   /protein_id="ACI59939.1"
FT                   /translation="MKLNVTIEIPKNSNIKYEYDRATKEITVDRILYGSMVYPHNYGFL
FT                   KEALDYDGDELDVLVFADQAFQPGIKVPARILGAMKMIDGGETDTKLLAVIDVDPRYKH
FT                   INTFKDIPLHWLAEVQDFFENYKNLQNKKVEILGFEDEVWAQKEYEECVALMQEHGHLK
FT                   KDEFVSKMMKQRPEKYSQ"
FT   gene            357416..357820
FT                   /locus_tag="UUR10_0321"
FT   CDS_pept        357416..357820
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0321"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59852"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZBC4"
FT                   /protein_id="ACI59852.1"
FT                   /translation="MKEFSKNKTYNNFKNHKSPLRVVEGIVREIKNNELQIDFVDSYKK
FT                   GICKFINLTDYNWNTISSRFLINSKHLFLISKFDPTRRVYWLNYKIIHPIEIKNKRRSY
FT                   PTLSHDRNLRIFLTNLLENEDKEHNNHEIN"
FT   gene            357848..358411
FT                   /locus_tag="UUR10_0322"
FT   CDS_pept        357848..358411
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0322"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59808"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZBC5"
FT                   /protein_id="ACI59808.1"
FT                   /translation="MNKMVGIIVPQYANDYELATFNLFLKKAGFYVTLISLTKQLIIQM
FT                   QSMNKIVCNELIEKCNLSKFNFLILISSQNLTLQKIIKTSFILTQSQKIPKLNKFLNDF
FT                   FNLKEDNKYLIAINDAPLYLNELNLLKDFKFTCNNTLNKKLGKNCLCDKNIVQDCCLIT
FT                   ANDSICALKIVEIITNTMCENKQK"
FT   gene            358494..363221
FT                   /locus_tag="UUR10_0323"
FT   CDS_pept        358494..363221
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0323"
FT                   /product="efflux ABC transporter, permease protein"
FT                   /note="identified by match to protein family HMM PF02687"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60332"
FT                   /db_xref="GOA:B5ZBC6"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZBC6"
FT                   /protein_id="ACI60332.1"
FT                   /translation="MFKNLIKNVYRYLLKSKASFIGLCLLLFVSIFSFSMLTNLSKTLT
FT                   RSYTNLVNKQKLHDITVNESYIEDQKSVKQAQFNKLLGELKLFYALQGLNFDWTRSNSL
FT                   IVNSTKDDITYKIVEYSTNKQINTFDEQTIKRLVANSFFDVDLYSILNNAKADVIDLIK
FT                   TKNFNTNLIVNNLKELEDNPKINLVKLNKVDNYDVSNSQQARLYLLKNIVYGAWPSKTN
FT                   SLYTSFKKAYEYSLEDKNYDPLVGNVKLNNKTNFDALEAKKISTQFILMLYPSKKGISL
FT                   NGNVNTVVKGHRITFSFEPAGIPIPVYFDVKSAYTLVGLGAFLSSHNKQKYPMDLWQKA
FT                   LVEHQDQKSFEKWFNSLDEKYIVHIDNTPYLILDSGITPDFMYPIISFTSVIPNPKKEG
FT                   LVYANLNGYARIHDAFRSNPAEKNLQIRITNQKHEAVDINTLKKITKDLNDRIKKESIM
FT                   NWPTSLDAAYLKDDTNNHITPSPLRLVFIDKITSTIQTFSILITLFILVLAVFVVVIII
FT                   NRFLAQNKINIGISIANGVARWKIILSFGFIGLIPCVVGGLCGYLVAYFTQNLAVSIFS
FT                   GYWLIPTALEGFDFGALITVIVFPFLLFFALIAILGYWSVRKPPINLMRGTETFKISKI
FT                   VHVIKLPFKYMSGFNKYLITLSFSSITRIIIFSIMIALSFGSIMFLTGTRGKIKQTTDA
FT                   TLQTKKYRYGIDLITPTDQGGQYISLSTNQIGSTLSDENNHELTQKYESSDYKDFINSP
FT                   LFKNLQNLKLIGAKDDQRRTYDINYIANAFQVKQFLDFNFGFGDINSGSSSNPWSITKS
FT                   LIPENNLQILNETYKKWGSKLINDHSIFSKQLIKKGVNELAYDNLNIRNSYDPNEYFNP
FT                   FEFKDIINTHLKQFDKSLLDQHVSYEILVRVHNNLFNYKNIYGKLVFRKNEWIIYFENS
FT                   NFSIGDQNFISGIYYKKSNEQDYDLDHHIFKNVDLIYDEIYFERNRKQNYQKLIYQTFS
FT                   SYFRTRFLKYDPEGNFNYLLPLKYLNATIVRKELLQNAINNEIIFKNEQNKITKKISFK
FT                   NDNDLVITKINDATYEIKNVVNNQIYIYYPRQIKRSYKIDPAKATNAIKTGLSVKLDND
FT                   FINLVLLTHPSINPSYTDVWSGITFNMIGFDYLTKNNKTQLNEFDEPYIWIDAQINKIN
FT                   KQKYEEAKNPKIIGIIKNSKLVHLLSNKKQINHLLFNENDEQVAIINRVAAKYYNLKIG
FT                   DHFSFVANNQTNRYTKDYVKKQITLKVVGIIDTYQEIEIYTGIKNAAQILGMHSSPYAD
FT                   KSLYEGYDGAFNGIFTNKSDPAMLTRIISIYSPSGLYPVSEIWKKDAATIDLIKNILSD
FT                   KYSMYELNNKSDPKSLVLSSRLSLTKALGYKDFNTLKLDARNIYDENHNYLGLRNEQAQ
FT                   AEWVIDKLISIYGRDTYSSTLKNVEVVDVLFAVLETASKTIQTVEIVVILLILFIIILV
FT                   LVLMSINSLSDILKVAKLLKNMGYNDLKNAQLFLMAFLPPLIIGSIISIPLVVLVMQAF
FT                   SEMIFNSLNVLLTTGFIWWHFLIILLIVAIIFLIMWAIAIRILRTSNIADASKRG"
FT   gene            363336..364712
FT                   /gene="nusA"
FT                   /locus_tag="UUR10_0324"
FT   CDS_pept        363336..364712
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="nusA"
FT                   /locus_tag="UUR10_0324"
FT                   /product="transcription termination factor NusA"
FT                   /note="identified by match to protein family HMM PF08529;
FT                   match to protein family HMM TIGR01953"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60229"
FT                   /db_xref="GOA:B5ZBC7"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR010213"
FT                   /db_xref="InterPro:IPR013735"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR025249"
FT                   /db_xref="InterPro:IPR030842"
FT                   /db_xref="InterPro:IPR036555"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZBC7"
FT                   /protein_id="ACI60229.1"
FT                   /translation="MSNSFKSKEFIEYFKDTAKQNEIELEVLSSIIKEAFEKTYLRTHP
FT                   GENFETNINLKEGTINCFRNLVVVENEKAHNEDLETCLDDAVEILLDDARKINANAQIG
FT                   DTIKQYISIDDFKSIEVGQIGSLLRQKITEIHNKRVADFWKPSLMKMIRAKVAEINYNK
FT                   QRNEITGVKVELDDQWKTLGYLSRKDRIGDEKFKVGETYDFIIKEVKEQSRLWPVLLSR
FT                   TEPELVEEILKREVVDIKNGNIEIKKIARIAGFKTKVAVSTNLLNIEPVAVVVGNKGLT
FT                   ITSISKQLNNERIDVIRYADDKRIFIANAIGLDKLKGLLVQENESDQRSAIAIVSKEDL
FT                   PSVIGRGGANIRLIAKITEWNIDVKTIEQAFEENVVYEKFDEKIYRSWNIESINKKNVT
FT                   NDEMLALIDNMQDEKVEKTEQVKDQLKQQEKQTIVSNNDDSENDDEQLEYLEGFEDFKF
FT                   "
FT   gene            364724..364975
FT                   /locus_tag="UUR10_0325"
FT   CDS_pept        364724..364975
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0325"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF04296"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60152"
FT                   /db_xref="InterPro:IPR007393"
FT                   /db_xref="InterPro:IPR035931"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZBC8"
FT                   /protein_id="ACI60152.1"
FT                   /translation="MAMKVNQRTCIFSKKKYPKNELVRFVIINDELIFDLNHYRGYYLK
FT                   IQKNMNLEKLYQFLKKRFMIKNEEQVYQILKQLIQSLI"
FT   gene            365014..366858
FT                   /gene="infB"
FT                   /locus_tag="UUR10_0326"
FT   CDS_pept        365014..366858
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="infB"
FT                   /locus_tag="UUR10_0326"
FT                   /product="translation initiation factor IF-2"
FT                   /note="identified by match to protein family HMM PF00009;
FT                   match to protein family HMM PF01926; match to protein
FT                   family HMM PF03144; match to protein family HMM PF04760;
FT                   match to protein family HMM TIGR00231; match to protein
FT                   family HMM TIGR00487"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60166"
FT                   /db_xref="GOA:B5ZBC9"
FT                   /db_xref="InterPro:IPR000178"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006847"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR015760"
FT                   /db_xref="InterPro:IPR023115"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036925"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5ZBC9"
FT                   /protein_id="ACI60166.1"
FT                   /translation="MAKKNIKQKKDNRIAIDVKKHIKKVDVGVFGGTFVFTSPLSIAEL
FT                   APKLNKSTNEIIMRYFKKGVVYNLNTILDEEQIGELCLEYDLDFKIEKNVNTENLLENI
FT                   AFDDLEADLVARAPIVTIMGHVDHGKTTLLDTIRKSSVTASEAGGITQHIGAYQILKGD
FT                   KPITFIDTPGHEAFTEMRARGANLTDIVILVVAADDGIKMQTEEAIDHAKAANVPIIVF
FT                   VNKMDKYEANPDKVLNQLSAKEIVAEELGGDIVFVKGSALKNEGIFELLDSILLIAELN
FT                   DYKANPNRLAYGTTIEANLDKGHGPLATLLVQNGTLRKGDYLVVGSTYGKIRNMFDEYD
FT                   NEIEMALPSKPVKVSGFEEVPTAGDKFLALADEKQARAIANDVKQKKIRLERSMLQSSD
FT                   IRAKIANGELKNINLIIKADVQGSLEALKGIFNSINIEGVTTTLVRSAIGTISESDVRL
FT                   AQTSDAIIIGFNVRANRIIKDLADSVGVQIMNYDIIYKFKEDLEAWMKGTLDPIIVEEV
FT                   IGEAKVLKLFKHSQVGTICGCRVINGKIKRNALVRVLRDGIVIYNSKIATLQHNKDSVN
FT                   EVIADKECGLTIANFNDVKENDIIEVYVKVEKNHDEVK"
FT   gene            366866..367216
FT                   /gene="rbfA"
FT                   /locus_tag="UUR10_0327"
FT   CDS_pept        366866..367216
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="rbfA"
FT                   /locus_tag="UUR10_0327"
FT                   /product="ribosome-binding factor A"
FT                   /note="identified by match to protein family HMM PF02033;
FT                   match to protein family HMM TIGR00082"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60318"
FT                   /db_xref="GOA:B5ZBD0"
FT                   /db_xref="InterPro:IPR000238"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR023799"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5ZBD0"
FT                   /protein_id="ACI60318.1"
FT                   /translation="MANEVRVARLESLIKDVINNALANEINDKIAKLARVTAVRLSNDL
FT                   SVAKIFLDAHKRESMPKVLENVNKVSGLLRSKLAAEWTSYKVPELRFVIDETIDYANHI
FT                   DELFKKIKQQEN"
FT   gene            367223..367633
FT                   /locus_tag="UUR10_0328"
FT   CDS_pept        367223..367633
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0328"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60303"
FT                   /db_xref="GOA:B5ZBD1"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZBD1"
FT                   /protein_id="ACI60303.1"
FT                   /translation="MLKKQNKNKEQYWLEKHLRQKKGLIVSWSIIFSILVLLSISFGLI
FT                   LHFFDSTNLSIQLSFIVNVNKYLVDVTKILVYIGFGLIYLPIVFLLGCWITGINGVHES
FT                   LYYHVFIWAFYFISVILLIITICLSIATHIYY"
FT   gene            complement(367682..368764)
FT                   /locus_tag="UUR10_0329"
FT   CDS_pept        complement(367682..368764)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0329"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60212"
FT                   /db_xref="GOA:B5ZBD2"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZBD2"
FT                   /protein_id="ACI60212.1"
FT                   /translation="MFKQKNKKIYALFGFGIVGILSVSILSSCQKANKNNHNSKQELVQ
FT                   SNYKKQPNNKKDENLITKPEDKKDSGKEKNDNPSSSKIVQTSKPDSKKSPEITNHLKNN
FT                   QIKNNHKLTTPTITKPFLFKIKNQDVGAPKNKQLIELDISKVDLNQYGFISFANNSEIK
FT                   LKLEFDVKLKNQETKQEPTIFEMPLYEEEVREKKINLKLEALEKDATYKLKKASIIDAK
FT                   NQEHEINRNDLSDLEFSTKNDELSLNSIDYLIQSSGHSIKLIFSKFDLFDRENNPSIII
FT                   KLRKKDDSKNIITICSNHQKDNLTVIHGEKTIVLAAKQLENDAEYEIVSIMVNDIDLTN
FT                   QLTNKKLLTKEMGPPNEPII"
FT   gene            complement(368842..369537)
FT                   /locus_tag="UUR10_0330"
FT   CDS_pept        complement(368842..369537)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0330"
FT                   /product="hypothetical protein"
FT                   /note="identified by match to protein family HMM PF01863"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59771"
FT                   /db_xref="InterPro:IPR002725"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZBD3"
FT                   /protein_id="ACI59771.1"
FT                   /translation="MLNFVKDLNFEINQKKIIVKVCLQPKIKYIKIKIINHEIVCLINN
FT                   LTLVDIAQDFVINNKLKILKLYENDLKRIKYDEHYLNWITLLGIKFSTIKLVNDTFHCE
FT                   FNLQKQIIYIYDQSQNLANSKLIYQKILKYLAEIIFPQIIKNAENITNLAVKEYEFGFY
FT                   KSRWGVYDKLKHIIKLSYFLVHYDQEIIQYVVIHELTHIKYQHHQNSFWDFVLKYCKNA
FT                   KIYNKQLKS"
FT   gene            complement(369550..371349)
FT                   /gene="lepA"
FT                   /locus_tag="UUR10_0331"
FT   CDS_pept        complement(369550..371349)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="lepA"
FT                   /locus_tag="UUR10_0331"
FT                   /product="GTP-binding protein LepA"
FT                   /note="identified by match to protein family HMM PF00009;
FT                   match to protein family HMM PF00679; match to protein
FT                   family HMM PF03144; match to protein family HMM PF06421;
FT                   match to protein family HMM TIGR00231; match to protein
FT                   family HMM TIGR01393"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60021"
FT                   /db_xref="GOA:B5ZBD4"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006297"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR013842"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035654"
FT                   /db_xref="InterPro:IPR038363"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5ZBD4"
FT                   /protein_id="ACI60021.1"
FT                   /translation="MDKKFIRNFSIIAHIDHGKSTLSDRIIEFTNTLSKREMTNQILDS
FT                   MDIERERGITIKLNAVQIKYHARDNNEYLIHLIDTPGHVDFTYEVSRSLAACEGAILVV
FT                   DAAQGIEAQTLSNVYLALENNLEIVPTINKIDLPSADPERVKKEIEDVIGLDTSDIPLI
FT                   SAKTGLNIQDVLEAIIKHVPPPLDANDDAKLQALIFDSFYDSYKGVVCLVRIKQGTIKV
FT                   GDKIRMMANNKDYIVSELGIRTPKIVNKTELVAGEVGWVAAAIKTVKDINVGDTITHAN
FT                   NPADKPLPGYKKILPMVYCGLYPIDTSQYDDLKEAMAKISLSDAALTYEYETSQALGFG
FT                   IRCGFLGLLHMDVIRERIAREFNIELILTAPSVIYKIELTNNQEISIDSPAKMPEPTNI
FT                   KAIKEPFVKLAIITPDNYVGAIMELCQSRRGSYQDLEVIDGTRRRLIYKMPLAEIMYSF
FT                   FDSLKSITKGYATMDYELIGYQAEKLVKIDIMLNGNKVDALSIIAHRDFAYGKSKIICE
FT                   RLKEVIPKHQFEIPIQASIGSKIIARETIKAVRKDVIAKCYGGDVSRKKKLLEQQKEGK
FT                   KRLKAIGNVDVPQDAFVKVLSEN"
FT   gene            complement(371468..372127)
FT                   /locus_tag="UUR10_0332"
FT   CDS_pept        complement(371468..372127)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0332"
FT                   /product="LemA family"
FT                   /note="identified by match to protein family HMM PF04011"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59958"
FT                   /db_xref="GOA:B5ZBD5"
FT                   /db_xref="InterPro:IPR007156"
FT                   /db_xref="InterPro:IPR023353"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZBD5"
FT                   /protein_id="ACI59958.1"
FT                   /translation="MDLWKEQDPSGISPNVSNERKIATASSGEKALYIFIVILSIITII
FT                   GWIFLLIWWFKTKNHLIQTKNSVNEASSSIQVAQTKRFDLLNKMIEQTKSYYKFEQKVL
FT                   DEITKNRSVQMSSDINKNEEVLSKLQNLVNVQFERYPDLKSSNILMELMSTSSYLENEI
FT                   ASSRRAYNSRATDWNIMIFQFMTVIVAAKLKLDTFPIYAASKQERADVSMKSLSDF"
FT   gene            372276..372641
FT                   /locus_tag="UUR10_0333"
FT   CDS_pept        372276..372641
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0333"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60188"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZBD6"
FT                   /protein_id="ACI60188.1"
FT                   /translation="MEKTIIQLEFNEEELASIKKIKEKMDPNNNLELNVFLKDLIKDLA
FT                   RDYLNFSNQSFENIAKQMNDLKDLIGNMANDPSSFDFSSMMNEFQKYNKSQKDDEQEQT
FT                   TKSDKENKSTTKPTKKS"
FT   gene            372645..373418
FT                   /locus_tag="UUR10_0334"
FT   CDS_pept        372645..373418
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0334"
FT                   /product="rRNA methylase"
FT                   /note="identified by match to protein family HMM PF00588;
FT                   match to protein family HMM PF08032"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60286"
FT                   /db_xref="GOA:B5ZBD7"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR013123"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZBD7"
FT                   /protein_id="ACI60286.1"
FT                   /translation="MLKVITSNKNEDIIHFYNLIHDKKYREANQLFIIEGFKLLDEALQ
FT                   NQQTIVAIIINERVYDKEFETIFKYTLYDNVQIYKVSENVIKKLSVNIDPSPILAIVKM
FT                   KEETCDVNDNVLLLDNIQDPGNLGTILRTCFAFNVKQVIFNNCVDLYNAKTIKASMGAI
FT                   FKINFLRFNSSKLTLEFLLKNNFYLIATILDKNAISLNELKIKQKYCLMVGNEGHGLSQ
FT                   NFIDYASIKTMIKMNQTESLNVAVATAIFLYELNK"
FT   gene            373429..374346
FT                   /locus_tag="UUR10_0335"
FT   CDS_pept        373429..374346
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0335"
FT                   /product="DNA polymerase III, delta subunit superfamily"
FT                   /note="identified by match to protein family HMM PF06144"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60232"
FT                   /db_xref="GOA:B5ZBD8"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZBD8"
FT                   /protein_id="ACI60232.1"
FT                   /translation="MIISDNRLKIQQKIDEITTTFDELVKIDEQQISLFAFKSIVEQSD
FT                   LFNAKKIYLFKNVNWFESLEQLKNVQDLIDYFFSNHIPIIITTELTKISTAKKIQEIIA
FT                   KFGHQITFISYSNKNAATFLKDELNERHLHLDKLIVATIIQKTNFNINYLNNELNKLEL
FT                   INDSLKNVNLVDIDNFICDYGDYQIFSLLNLLYQQKTKELINLINKMLIDKIDEVTIIN
FT                   MMATMMSTYYLTKYLDEKKYDKNFITNSLNQKPFVVSLNLKLTKNYSAKFLYKKLCELL
FT                   NLEIKIKENKIDKYFGLMDWVLNF"
FT   gene            374504..375772
FT                   /locus_tag="UUR10_0336"
FT   CDS_pept        374504..375772
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0336"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60220"
FT                   /db_xref="GOA:B5ZBD9"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZBD9"
FT                   /protein_id="ACI60220.1"
FT                   /translation="MLNAELSSAQKDLYNSIKSYLNVIFLNQKLNYAIKNDDDYRSQLN
FT                   KVMNIFEYYEDNYEIANKNFHSYWQAFKSYAHYEKLVDNFDDFDDLKDIVSGLKIYVLN
FT                   TFQVDLEQESQKIADIDFKYDEKTQASMGFYTTDDQQNSSNPTYENVRAEPVSEENYSN
FT                   NAYQSASDFTTANIDNLTNMVFSARVLNGEIYLYETKPKVIPFLKYLFFAISLALVLFT
FT                   ALTYAFLMDFGTHMLTVVSVNGITHIVRLTSPTFPTQLVISLFIMIYAGLNAFKRKISE
FT                   NEKFHFKNFIWIILFGALLVVALANIFTGNLRFSSNSFDEMFRQAQINDVLANLSRNND
FT                   FSFDYSRLQSVFYGFSISQILVFLVIILGTILIIITFILNPKRDTQRIKLLLQEIHDDI
FT                   LTGKIDPNTYLRTKNPFRDLFGF"
FT   gene            375773..376756
FT                   /locus_tag="UUR10_0337"
FT   CDS_pept        375773..376756
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0337"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60051"
FT                   /db_xref="GOA:B5ZBE0"
FT                   /db_xref="InterPro:IPR024529"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZBE0"
FT                   /protein_id="ACI60051.1"
FT                   /translation="MNSKFKFNYNIDNKLALSFTNELIANKKQKIKKRFLLFLFPFYPL
FT                   KLFKTINLIVVFAVLVAIRLGMGFLHIKIPGFNMVISFTWMALMVLSWYFGPLIGIFAG
FT                   FLVDTLAWLISGGIWFWMYAIQEPAVGFIAGFLGSVVTLRKKTKRPIIDLIVNQVFILF
FT                   FSILTLFMILTLVNDGKNSLFSILKKRDKEINEDWISIFKYLAIAFLATFVLLVEAFVI
FT                   IYYLRNKNRSKVQLVNFIYCSLLAIFSTMLFSFALGPYVSVAYLKYIKVPITNYLKYGV
FT                   NYYLLPRIIKESIKTPIYIILLSSIISAFDYVFLNIKQINMHKWKH"
FT   gene            complement(376767..377069)
FT                   /locus_tag="UUR10_0338"
FT   CDS_pept        complement(376767..377069)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0338"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59835"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZBE1"
FT                   /protein_id="ACI59835.1"
FT                   /translation="MSYYYKSKFRITDHALARFRERAASTDVNIKNLSDTFIIPIINER
FT                   ILGIRPLNSLNDNFHIYMDPKNKGYYFLVDKYTNTIISYTKRTNKNDFYHIKKVK"
FT   gene            complement(377098..377721)
FT                   /gene="udk"
FT                   /locus_tag="UUR10_0339"
FT   CDS_pept        complement(377098..377721)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="udk"
FT                   /locus_tag="UUR10_0339"
FT                   /product="uridine kinase"
FT                   /EC_number="2.7.1.48"
FT                   /note="identified by match to protein family HMM PF00485;
FT                   match to protein family HMM TIGR00235"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60352"
FT                   /db_xref="GOA:B5ZBE2"
FT                   /db_xref="InterPro:IPR000764"
FT                   /db_xref="InterPro:IPR006083"
FT                   /db_xref="InterPro:IPR026008"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5ZBE2"
FT                   /protein_id="ACI60352.1"
FT                   /translation="MNAKSPILVLIAGASGSGKTTFANEIVARIPQNTTSVIICQDSYY
FT                   ISNSQLNKNERRLINYDHPSSFEWDLMREQLSDIKKRKKIKVPIYDYKTEIRLDKTIDI
FT                   SDVDVIVFEGIYAIYDDVINQIADLKVFIETPKDECLIRRILRDVNERNRSFESVITQW
FT                   RSTVSPMYDQFVEPSKKNANVSVLWNEHNRVALHLINKWINNIH"
FT   gene            377904..378077
FT                   /gene="rpmF"
FT                   /locus_tag="UUR10_0340"
FT   CDS_pept        377904..378077
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="rpmF"
FT                   /locus_tag="UUR10_0340"
FT                   /product="ribosomal protein L32"
FT                   /note="identified by match to protein family HMM PF01783;
FT                   match to protein family HMM TIGR01031"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59996"
FT                   /db_xref="GOA:B5ZBE3"
FT                   /db_xref="InterPro:IPR002677"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5ZBE3"
FT                   /protein_id="ACI59996.1"
FT                   /translation="MAVQQRRVSKSRKGMRRSHDHLTVSNTVACNECGKALLPHRACRD
FT                   CKTYRSIKLSIK"
FT   gene            378087..378344
FT                   /locus_tag="UUR10_0341"
FT   CDS_pept        378087..378344
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0341"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59945"
FT                   /db_xref="GOA:B5ZBE4"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZBE4"
FT                   /protein_id="ACI59945.1"
FT                   /translation="MNNSDKQTNNLDENQQKPTTNDFFNDKNNQLTKVLNIPSVVKYTE
FT                   SKIKKSGKNFSINLIITTTTMFIVIGIIITIAIAIGIKLG"
FT   gene            378458..380623
FT                   /locus_tag="UUR10_0342"
FT   CDS_pept        378458..380623
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0342"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60032"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZBE5"
FT                   /protein_id="ACI60032.1"
FT                   /translation="MIEKLKNNKTLFLNVKQAQKLGINNPLAQEIFLDDQKLNVDLIND
FT                   IRDEFYLDKAISKGYAYFNNLQQFKAIDLDILDHYQFAKAAVSNLDEYEQLVYTKTRQY
FT                   LINKEFWTNDGLDAFVGDDFKRKQLTNEEIVNLKTKYDLWIQELHFSNARISKQIHNLS
FT                   KHGQNELDYDQFYDKKATLESNLDILQILIYLKSSLLELDFDNVLKDDQNKISIRQLLV
FT                   DDLEYLPFSFQRYDYESRRNFIKNSRQLVDESIDFDDVEYDVLHTKQTSQQTSKTNEPI
FT                   KIAELKKFECSQLSDEQQANLEKEFYSAGAINCFDEVCENEQQTNINNKEEQVVVDKKS
FT                   GYLKPRSYPRHHETPFMVDVENRVDFLMAGYEVVKNDDPYAIKQEALKNNILEQQKAEE
FT                   EIEVVEQQVDDTLESVESTQSDEQINEELSINDFINETPIDDVKLENEDHAVVDIEIDE
FT                   PTQPIEVKQEQQVEVEEVQDVVEPQEVLETNKVDQEQLVEEENKPKKDLSAIQMRLDEI
FT                   VNLHEEDDKLQARLNSVVVDNDVIVDDKNLEDDLENNVNHIEQVHQSQVQEAEVANEQN
FT                   AIVDEELDDKNLNNKIDTGAISVEQTYEPQVQTNDTLNDFEPASVNELQDDSFNQVVLE
FT                   NNDLDDSKIENVDENSSSPLLESNVDFNDYEQNNDLSSQIELTPADFEIKTQEINDETE
FT                   RLLNELNNNKPKQKKKFWTWFSSKKDK"
FT   gene            380644..381933
FT                   /locus_tag="UUR10_0343"
FT   CDS_pept        380644..381933
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0343"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60098"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZBE6"
FT                   /protein_id="ACI60098.1"
FT                   /translation="MNKTNQIVDLLTNKKNDSIQRRDQVVFIKNEQEAKEVLASDISLN
FT                   DIFNPLLSNDYEQKKIKQLVILNNSIKVNKIEEYTKALENKVDDLYTNVSNQLIEDYQK
FT                   IQNVNTNEIVTKNEELLNTHLKEVEKICEQIIDEWKIELLGEINFKFEQDLVQIDEMQE
FT                   NKLKAKSLTNEDSFLTRRQVKIKNKIIEEFEKQRTQASQNHLSKRNDILQKERDALLKN
FT                   NELFELDSNGNWDNFKKIALFISSEIGIINDLEDLLNHQELIRTENYTKRATLNRYRIN
FT                   GHFKDEKNYFKALYDLRVKFMYGLGSEIVILKFLIEHYKTLSELRLKLQELKHPLSSYA
FT                   VYFDVLNRIEKQTYLLAKVEALKYDNYDFNADVILDGLEENTTNENQVVNKTKVIKTII
FT                   EPKYELELNSKDNKFSGVKVFVNDQEITPK"
FT   gene            381998..382804
FT                   /locus_tag="UUR10_0344"
FT   CDS_pept        381998..382804
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0344"
FT                   /product="methylenetetrahydrofolate dehydrogenase"
FT                   /note="identified by match to protein family HMM PF02882"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60199"
FT                   /db_xref="GOA:B5ZBE7"
FT                   /db_xref="InterPro:IPR000672"
FT                   /db_xref="InterPro:IPR020631"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZBE7"
FT                   /protein_id="ACI60199.1"
FT                   /translation="MKLKINFLYEKILNELLNKKNKNHKKIYVFYDSDLVNFNSAYIQS
FT                   KLKYAKLFCVDVIIYDLNAYKIQDNHQFLAKLKQDNTDFLFFEFPLSNKHLEQNYFQYL
FT                   TFENDLDGINSHLFLDHQRNQIIYHPATINAILALIQALDIDLVNYRICIIGRSIYLGN
FT                   YLYKLLNVKNNSIKVIHSQTKKPLAIIKQSNFIISCVNKAHIFSSNDLSNNSYLIDVTT
FT                   EYVNNKLCGSFLIDQNDVSNRNIKYTPVPGGIGKLTTLFLFLNYFK"
FT   gene            382876..384762
FT                   /locus_tag="UUR10_0345"
FT   CDS_pept        382876..384762
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0345"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60313"
FT                   /db_xref="GOA:B5ZBE8"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZBE8"
FT                   /protein_id="ACI60313.1"
FT                   /translation="MIDKQKTKQLIQNPINGFFDGFKKTLNNDLDKIINQQLKGQEDNI
FT                   NEINELTKKIKELQGNIKQRKKSEKINQRIFCNILIGICFVIIVGLFFLHFYLKNRKII
FT                   KNFKNFENEKVHEINTCNKHKNLYVYNVLMQVNPYKISQQIFAKNGLYLMPEIQYENIK
FT                   PTDLTISHDAKFVGFFGGIEVKFKSTDTFLVYYKEFSIKDVITSGTIQISYRRGDEIIS
FT                   ETLVAHHKEPTPFVDLRSNFIHKTNYAPEFNFSTYSQSVNSRSKSIFANLEFSKYYGLG
FT                   IATQNLQFDTKMLEFFTPFSQENYENFAKYLKQEDKMVPMFTKTTTSLVINDELSTNNI
FT                   KPYFINLLTNESYAKTCDFLIDTNINADLQTNLNTLKYQLTKILEKYILYLTTTSLSSV
FT                   IAREWYINNNSYKIGDNYDYENYYYANQNELTPSSISTKLFLKNQIAFINDCKVIPFAK
FT                   LVNSQMRFGINKAQFNIKSYHVHDRVDAVPVYAHGRTHVIPVPYQEYIEYEYPFICLYI
FT                   LKRKELEKDISLKYFLRTFDNLLLSNFEDHSDWSINDILDFSDDDLKKEENKMLQIYLK
FT                   ELDTIVTNANLNRSEFSFLVDNDGYFITISNKIELDEQTEQELCTWLRKVSM"
FT   gene            384933..386735
FT                   /gene="dnaK"
FT                   /locus_tag="UUR10_0346"
FT   CDS_pept        384933..386735
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="dnaK"
FT                   /locus_tag="UUR10_0346"
FT                   /product="chaperone protein DnaK"
FT                   /note="identified by match to protein family HMM PF00012;
FT                   match to protein family HMM TIGR02350"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60208"
FT                   /db_xref="GOA:B5ZBE9"
FT                   /db_xref="InterPro:IPR012725"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="InterPro:IPR029047"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5ZBE9"
FT                   /protein_id="ACI60208.1"
FT                   /translation="MTKEIILGIDLGTTNSCVAVIENKKPIVLENPEGKRTVPSVVSFN
FT                   GDEVLVGDAAKRKQITNPNTVSSIKRLMGTKEKVTILNKEYTPEEISAKILSYIKDYAE
FT                   KKLGTKINKAVITVPAYFDDAQRQATKNAGIIAGLTVERIINEPTAAALAYGIDKLDKE
FT                   QKILVFDLGGGTFDVSVLDMADGTFEVLSTSGDNHLGGDDWDQVIINWLLKSIADEFNI
FT                   DLSKNKMAMQRLKDAAEKAKIELSGVNTTTISLPFIAMDSSGQPINFEKELNRATFDNL
FT                   TKNLIERLKKPVLDAMKESKLSLADIDQVLMVGGSTRMPAVQNLVKELTGKEPNHSLNP
FT                   DEVVAIGAAIQGGVLAGEIDDILLLDVTPLTLSIETMGGVATPLIPRNTKIPVSKSQVF
FT                   STAADNQPSVDIRIVQGERSLAADNKLLGNFELSGIEPAPRGVPQIEIKFNIDANGIMS
FT                   VNAKDLKTQKETSITIKDSQGLSQEEIDKMIKEAEENKEKDAKVKHERELVNRADSLIN
FT                   QLEQVVKTENVPQEQKDAFNKQIEELTNARDAQDYTKLEAEVKKVEDLLANAAKFAQQT
FT                   QQQDPNNQKDDVTEATVTDDSTKK"
FT   gene            386852..387961
FT                   /locus_tag="UUR10_0347"
FT   CDS_pept        386852..387961
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0347"
FT                   /product="conserved hypothetical protein TIGR00481"
FT                   /note="identified by match to protein family HMM TIGR00481"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60334"
FT                   /db_xref="InterPro:IPR005247"
FT                   /db_xref="InterPro:IPR008914"
FT                   /db_xref="InterPro:IPR036610"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZBF0"
FT                   /protein_id="ACI60334.1"
FT                   /translation="MVEDKFLKQIKEGEQIKIEIKGLDEFNNFDEQSYGLNNISPQMRW
FT                   SPVLEAASYAVAIIDYEAVGGAPFVHWYALNIFEPQLELNVANLGYANLYQGENSTSKH
FT                   FTHSTVDANYQTDVANNYFPPCPPNKAHKYEIKIYAVHHKMSTNRNEILYLDDFEAKLN
FT                   EAKIIAMGSTYVYAPQISFENNELVVGSLEHKHPYLFTDAKNEYHVIEDVIVDDIEKNV
FT                   YDETQLNNFQDLEQAKIKIIDSSDALSYAVIISSNHTFKKYGRPIINYAHIVEKKSNKR
FT                   IKFNNSYKLNHAFSYISPSKYEHLGNELLILKDNDANIESGLFTIHVFGLNKKINQLNK
FT                   VENPTDSIIDLFEMISGNVISYKAKFFKL"
FT   gene            388011..388580
FT                   /locus_tag="UUR10_0348"
FT   CDS_pept        388011..388580
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0348"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60080"
FT                   /db_xref="GOA:B5ZBF1"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZBF1"
FT                   /protein_id="ACI60080.1"
FT                   /translation="MNRQQIHAKTRLTINELNKFYALIKVQKQSLEDLENKIKKLDWIN
FT                   FKEIKDQKLFNDSKFDYKNITPYVISQIQDLVSAYNTKQISEIILELNQVNIQVQAKDS
FT                   EFYIKNNNKLNLISSEFEKYSLKNYDAYEHFKITMDDPKIQTLNHQMPFESKFNTKIII
FT                   FTILGFCLLCLFIIVIVCALLIAGVI"
FT   gene            388584..389252
FT                   /gene="cmk"
FT                   /locus_tag="UUR10_0349"
FT   CDS_pept        388584..389252
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="cmk"
FT                   /locus_tag="UUR10_0349"
FT                   /product="cytidylate kinase"
FT                   /EC_number="2.7.4.14"
FT                   /note="identified by match to protein family HMM PF02224;
FT                   match to protein family HMM TIGR00017"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60131"
FT                   /db_xref="GOA:B5ZBF2"
FT                   /db_xref="InterPro:IPR003136"
FT                   /db_xref="InterPro:IPR011994"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5ZBF2"
FT                   /protein_id="ACI60131.1"
FT                   /translation="MKKYINVAIDGPSGSGKSTAAKGLANKLGFLYINTGLMYRAYAYF
FT                   LNENNLDINTNETACIEAIKNARFIFNGDDVKIDDQDVSDILRSNDVAMLASVVAANAK
FT                   IRNLATNEQRKIASENNVVMDGRDIGSIVLVDADLKFYLNTSIQTRAKRRLAQNKDIEK
FT                   LDYESIYNDIKERDYRDMTRDIAPLKKAIDAIEIFNDNMNLDQCVAHLYEIYLNKIKKS
FT                   "
FT   gene            389336..389620
FT                   /locus_tag="UUR10_0350"
FT   CDS_pept        389336..389620
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0350"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60099"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZBF3"
FT                   /protein_id="ACI60099.1"
FT                   /translation="MNFDINLINENDYVFSGYIVLKKNNEEVIELLTYLGDDPVSDEAK
FT                   IITLYNNDHIDLKNLNDGDLIIVKASLITNDNSKQLMLKDINKLELSIN"
FT   gene            389674..390468
FT                   /locus_tag="UUR10_0351"
FT   CDS_pept        389674..390468
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0351"
FT                   /product="1-acyl-sn-glycerol-3-phosphate acyltransferase"
FT                   /note="identified by match to protein family HMM PF01553"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60019"
FT                   /db_xref="GOA:B5ZBF4"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZBF4"
FT                   /protein_id="ACI60019.1"
FT                   /translation="MNFFKNLLWFVAYPFVALYIIVQMILAAIMAKKYKNDPEAVNVND
FT                   RYKKIMAIIDAVLYLKNIKVDLIGKENVSIKSMLYIGNHKSNGDPLVLLKALYQISPHN
FT                   VRFVAKIELQKSFLKFLFNLIDVIYIDRNNLRQAISTIDEQVNALKQTYRGLVIFPEGT
FT                   RNFSHEFNEFKSGTLTAAYNTLSSIQPFVIFNSQGSFESKDDKKQKLRNNPFKTQHIKV
FT                   SFLEPIHSFNYINVNKDILMRRIQTNIKKNYDELLKSTIKTN"
FT   gene            390613..391449
FT                   /locus_tag="UUR10_0352"
FT   CDS_pept        390613..391449
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0352"
FT                   /product="ScpA/B protein"
FT                   /note="identified by match to protein family HMM PF02616"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60247"
FT                   /db_xref="GOA:B5ZBF5"
FT                   /db_xref="InterPro:IPR003768"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZBF5"
FT                   /protein_id="ACI60247.1"
FT                   /translation="MSQNQMQNSLFEYKFIDFNGPLDTLCVLIKQKRLDINNLDILELS
FT                   KQYLNFVNQLIKTIDIDVLGDHLAMASYLIELKTRMLMPSIDEKQILNIEEDRQNLIDR
FT                   LIEYNGYKNLTEHLKQRLDFRATMIDLPQQDYEPFYSEDVVYKPLPNCLDPIILKNIMD
FT                   KIIYENELKNYEIDEIKVQEYDINQLEWLLLNYLNQSPNQQASMFSFFNVQASVDKNKR
FT                   FFVMMFLIILILINRNEILFEEIENDYLLKINNEKINDDYNSSSIEQAKNLTNDLT"
FT   gene            391481..392647
FT                   /locus_tag="UUR10_0353"
FT   CDS_pept        391481..392647
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0353"
FT                   /product="segregation and condensation protein B"
FT                   /note="identified by match to protein family HMM PF04079;
FT                   match to protein family HMM TIGR00281"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60178"
FT                   /db_xref="GOA:B5ZBF6"
FT                   /db_xref="InterPro:IPR005234"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZBF6"
FT                   /protein_id="ACI60178.1"
FT                   /translation="MSNDKKNKKNSLNDELDLAKYTLHNVSVKNDEDENDLELDWADID
FT                   DEIIDNNQQVYQKKRNNHKTRLFLEKDNEINNHGQVGLYKETINQPKALSGKEFLEFVN
FT                   SKLIQKKVEKSNYDGIDNEFLENRLVKNNNKILREKLKPQNDFNKIFKPKGLDDYIDEQ
FT                   QAEAQKVEFKNDFNNSTKKPKSIKQNSVSFRNSFNLNDLDQKQIVNIKSIIDSTLFLAG
FT                   EEGVSLQDLKRTTGLGESSQIKLILNELQKDYDADDSGLILVQFGDKFKLLTQSKNKDA
FT                   LSKFVTTSFKTPLSQRNLETLAIIAYNQPTTRAKIQAIRDRDPKPSIDALLKLNLIVEA
FT                   GRQDTPGHPILYTVSQKFYDLFGIRNLTELPRLNKEIKEFNPIDETTN"
FT   gene            392741..394159
FT                   /gene="tig"
FT                   /locus_tag="UUR10_0354"
FT   CDS_pept        392741..394159
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="tig"
FT                   /locus_tag="UUR10_0354"
FT                   /product="trigger factor"
FT                   /EC_number="5.2.1.8"
FT                   /note="identified by match to protein family HMM PF00254;
FT                   match to protein family HMM PF05697; match to protein
FT                   family HMM PF05698; match to protein family HMM TIGR00115"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59819"
FT                   /db_xref="GOA:B5ZBF7"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="InterPro:IPR005215"
FT                   /db_xref="InterPro:IPR008880"
FT                   /db_xref="InterPro:IPR008881"
FT                   /db_xref="InterPro:IPR027304"
FT                   /db_xref="InterPro:IPR036611"
FT                   /db_xref="InterPro:IPR037041"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5ZBF7"
FT                   /protein_id="ACI59819.1"
FT                   /translation="MKLLNKIKNENAIEFQVLIEKSEWEKKHNEAFEKVAKKTASKLKI
FT                   PGFRPGNVPVEEAKKHVNEIEVFETTTNDLVPQALTFLEQDESFTSDNSETVDTPSIDI
FT                   LDFKDGELTLKIAYDLYPVATIDSYNDLVLTPIVNEAFDHEVNAEIEHALSSKSQRRVK
FT                   DENELIEKGDEVRFDFKGMIDNVPFQGGSAKDHLLTIGSNQFIPGFEDQMIGLKVGEQK
FT                   NLEVKFPDDYHATDLAGRSAVFEVLIKEITSVKPQELNDEFAKSFNLPNVNTVQELKDY
FT                   IHNQIVLAKQERNSERAWLEIAQQLLAKAKVTPIPQSLIDREVSTLKQQVISQLSQYKI
FT                   DLKQYLEFSKKSESQFQEDLVKQAKETIALALLVDDIAENQKIVVSDDEVKERIAEMAK
FT                   LYQGEEEAIIERLSQNPDAVKEFLLHKKVVNYLIDLNKNNQPKDTASTLSKQEDKPKVA
FT                   KAKTSNTKKVASKK"
FT   gene            394261..396636
FT                   /gene="lon"
FT                   /locus_tag="UUR10_0355"
FT   CDS_pept        394261..396636
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="lon"
FT                   /locus_tag="UUR10_0355"
FT                   /product="ATP-dependent protease La"
FT                   /EC_number="3.4.21.53"
FT                   /note="identified by match to protein family HMM PF00004;
FT                   match to protein family HMM PF05362; match to protein
FT                   family HMM PF07728; match to protein family HMM TIGR00763"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59750"
FT                   /db_xref="GOA:B5ZBF8"
FT                   /db_xref="InterPro:IPR003111"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004815"
FT                   /db_xref="InterPro:IPR008268"
FT                   /db_xref="InterPro:IPR008269"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027065"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027543"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZBF8"
FT                   /protein_id="ACI59750.1"
FT                   /translation="MKKPILISRAIVVLPYETTTIEVGRPKSIQAIDLAKQSSSKEIIV
FT                   ISQKNIDTDEVVNFDELYKVGTLVKIKSIVDNFDDGYSIEVEGIKAVYINSDSEVIDAI
FT                   EYEYEDVITNPILSTKDEVAINEINSEIFNTINKRTKHKDITFENMHALISLEKEKFAY
FT                   LAAATYINDYDGEIKEKTIKDRINILLQPNLLLVHETILHFLFDQLVDKRVIEEEVEKM
FT                   IADKINNNLQKQQREFFLREKLKVVKEQLGELSSREEDADKIRAKIEQLELPPNVRERA
FT                   LAELNRFESAMSSNESSVIKSYLDWLLDLPWTQQGVDNTDLMSVRTHLDDNHYGIEKVK
FT                   ERILEYLALRMRNPNLKGPIICLVGPPGVGKTSLVTSIAQALNKKFVKVSLGGVRDESE
FT                   IRGHRKTYVGAMPGRIIKGMKKAGVVNPLFLLDEIDKMTSDQRGDPAAAMLEVLDPEQN
FT                   KNFSDNYIEEEYDLSKVMFMATANYYQQIPYALIDRLEVIELSSYTAIEKREIAKSHLL
FT                   KRIFTDAKLNENELIFNDDALDFIINHYTKEAGVRELDRQLGHIVRKYIVETYKNKNNK
FT                   SKPSVEVDEAVIIKYLGKIKFDFNKKEETTIPGIVNGMAYTAAGGDLLPIEVNHSTNGK
FT                   GGNITITGNLEKTMNESVSVALGFVKANAEKYGIDTKKVSFKEIDIHVHVPSGGIPKDG
FT                   PSAGIAITTAIISSLSQRPVRTTLSMTGEIMLRGNVGIIGGVKEKVISAYRAGVREIIL
FT                   PIDDERYLEDVPKYILDDIKIHLVKHYDEVYNIVFGTK"
FT   gene            396731..398077
FT                   /locus_tag="UUR10_0356"
FT   CDS_pept        396731..398077
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0356"
FT                   /product="RNA polymerase sigma factor"
FT                   /note="identified by match to protein family HMM PF04539;
FT                   match to protein family HMM PF04542; match to protein
FT                   family HMM PF04545; match to protein family HMM TIGR02393;
FT                   match to protein family HMM TIGR02937"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59873"
FT                   /db_xref="GOA:B5ZBF9"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007624"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR012760"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR028630"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZBF9"
FT                   /protein_id="ACI59873.1"
FT                   /translation="MSTKQNEPLFENLEDLKQKVKLSFTEEFSFSYALSEREAGIFESR
FT                   NLKGADASNPEEILLNVVLDVSKRKRSRNEIKFNKLQNYFIHMNLRDEHFSEIVDVLEN
FT                   IGIRVPDYELVMQSKSKSTAKKKDEYGIDDTLEISTSKIGFSSTTTEKVDDGIKAYLGV
FT                   LGESKMLRSDEETEYAKMVISNDPALIKIGKNQLYTSNMRLVTSIAKKYLNRGLDLEDL
FT                   IQEGSSGLLKAIDKFDHEKGHKFSTYATWWIRQSITRAIADQARQIRIPVHMVETINKL
FT                   TKAERSLIQELGRDPTAEEIAQAMNKASQAKNQKEQLITAQKVVEIKKLNVDPVSLDKQ
FT                   IGHDEESQFSDFISDDEIISPEKYTEKKALNDQINEMFEKVLNDNEQRVIKMRYGLLPF
FT                   ERPYTLEEVGEHLGVTRERARQIESKAIRKLKHPSKTAKLRSFIGESEN"
FT   gene            398061..398726
FT                   /locus_tag="UUR10_0357"
FT   CDS_pept        398061..398726
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0357"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF04816"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60135"
FT                   /db_xref="GOA:B5ZBG0"
FT                   /db_xref="InterPro:IPR006901"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZBG0"
FT                   /protein_id="ACI60135.1"
FT                   /translation="MNQKTRIAFIADLINHAQNIVDVGSDHAYLAKILLLNNKAQHVTN
FT                   IEVNQGPLENGINNLAKNNLLQQTTNILNNGFKDLILEKTYDYCVIAGMGATSIIEILD
FT                   QNKNQIKNFILQPNTQSYKLRKYLNEHSYQIKIEHIFVENKIFYEIIICFKTINVPKLI
FT                   EKDYYISSQIHKDSLKLYLEFLKKRYEYLKTLDLSLVSENIVKEYEYIKEFIHEKNRY"
FT   gene            398707..399495
FT                   /locus_tag="UUR10_0358"
FT   CDS_pept        398707..399495
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0358"
FT                   /product="NIF3 family protein"
FT                   /note="identified by match to protein family HMM PF01784"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60047"
FT                   /db_xref="InterPro:IPR002678"
FT                   /db_xref="InterPro:IPR036069"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZBG1"
FT                   /protein_id="ACI60047.1"
FT                   /translation="MKKTDIKAQDILDFLTKKYDLSRAESWDRNGLFFDEQQIINNIQI
FT                   ALDITDDVVNDAILNNANLIISHHPLFTNQDLNDELDYFVNNDLIEKIKKNKISVIHLH
FT                   TAFDASPYGMSMQMAKRLGLLNIKQDDQNPYLVVGELKLGVSVDYISRIIKQKFLSPIV
FT                   KYNNIFRLETNLKKIGIIGGSGYKFADDAFVRHELDMLITSDLKYHNWLDAQAKNQNII
FT                   DMNHLSESIFIDVIYDELTKFYGNDENLNKSLSIIKINYI"
FT   gene            complement(399548..399877)
FT                   /locus_tag="UUR10_0359"
FT   CDS_pept        complement(399548..399877)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0359"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60360"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZBG2"
FT                   /protein_id="ACI60360.1"
FT                   /translation="MCISKVDMAKVKKFFKQYLFAKFQCKNWELCRELKDYDPKDDQKY
FT                   LKWEHFVEYVEQVLDALDKTSARIIKEIYIQNKRICELPYSYSTYYAYRKKAIIELLAY
FT                   LDLKI"
FT   gene            complement(400094..401122)
FT                   /locus_tag="UUR10_0360"
FT   CDS_pept        complement(400094..401122)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0360"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59744"
FT                   /db_xref="GOA:B5ZBG3"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZBG3"
FT                   /protein_id="ACI59744.1"
FT                   /translation="MKTILIVNKSFQKKRIFDTRFLHDSGPIYTNDRFLKIVRESFDAH
FT                   INKKSKFLFYFMEWWFQTTNYKLNPEISHTKRSLRSWLIEIFFLFCIIALIVCILAGVA
FT                   RPIIDCVIKSITLSRGQFKGDLIIDGQVIAKGLIPSSASGLVGGSSILNVEQWELIPKV
FT                   WKTYFSSPSVVVLILLVLFFLFFSCLYIYMLKKIRPRTNKMSLEDYLVSRMNLINSFKF
FT                   ILKRKVLFVEGIKEYNHRFIFNMSADYNLMRLMNYIYSGLVELNIIMVVDFESDEKIFE
FT                   LQKIIKQDFDNLDLIILEKEVADKLKSIHQNGCLNSKNPSLINISNKEIDQNQEIQNIE
FT                   IY"
FT   gene            401223..401912
FT                   /gene="truB"
FT                   /locus_tag="UUR10_0361"
FT   CDS_pept        401223..401912
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="truB"
FT                   /locus_tag="UUR10_0361"
FT                   /product="tRNA pseudouridine synthase B"
FT                   /EC_number="5.4.99.-"
FT                   /note="identified by match to protein family HMM PF01509;
FT                   match to protein family HMM TIGR00431"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59812"
FT                   /db_xref="GOA:B5ZBG4"
FT                   /db_xref="InterPro:IPR002501"
FT                   /db_xref="InterPro:IPR014780"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5ZBG4"
FT                   /protein_id="ACI59812.1"
FT                   /translation="MYTINKNIIVINKPINWTSNDVVQKVKRIIKAKKVGHAGTLDPNA
FT                   SGILVLGINEGTKLLTKLTLDSKTYVAEIQFGISTNTYDSTGEIISKINKFITLTEIES
FT                   AIENLYKNEYWQKPPKFSALKINGKKAYELARNNISFEIEPRLVKIFEYNILDFNYEKQ
FT                   ILKIIIKVSKGFYVRSFAVDLAARINNLAHLLSLVRTESGQFSINDAIEIEQVYDYWNN
FT                   INKHSTN"
FT   gene            401872..402723
FT                   /locus_tag="UUR10_0362"
FT   CDS_pept        401872..402723
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0362"
FT                   /product="riboflavin biosynthesis protein RibF homolog"
FT                   /note="identified by match to protein family HMM PF01687;
FT                   match to protein family HMM PF06574"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59970"
FT                   /db_xref="GOA:B5ZBG5"
FT                   /db_xref="InterPro:IPR002606"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015864"
FT                   /db_xref="InterPro:IPR015865"
FT                   /db_xref="InterPro:IPR023465"
FT                   /db_xref="InterPro:IPR023468"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZBG5"
FT                   /protein_id="ACI59970.1"
FT                   /translation="MIIEITSTNIQQIRDQYFINELVIGFFDGIHLGHMNLLSDPNNQT
FT                   ILTFKNIPRKIKKLYDFNERIQQLEDLGFKRIFIYDIDQNNLSGEEFIDQILKPLTPKK
FT                   IIVGANFTYGNNFCNASSLKQYFNVEIKIITNDVSTTKIKELIINKQVEIANKLLIKPY
FT                   YRVGNVVRGDQIARNIGFNTANILCDNNLIDIAEGVYKAQVIFNNKKYDSVVYLGIPKT
FT                   INTRSFSMIEAHILDFNQNIYDERIKIVFLKYLAPNLKFNNIDELITAIKNYIKLVLDK
FT                   TN"
FT   gene            402865..404514
FT                   /locus_tag="UUR10_0363"
FT   CDS_pept        402865..404514
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0363"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59842"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZBG6"
FT                   /protein_id="ACI59842.1"
FT                   /translation="MKMKAKKFLITGLLGVVSLATITTVATACTNGNNQKANTVNNKSD
FT                   LKTNPNINLTQQDVENLEKQRQQWSEDLDVYFNGGLSKSGKNFDRINTLSSNATEWFKN
FT                   HQKLAATRDSGSLVQDDAAYSFGIAPDYVHYKWVSKDGGDVSPSYLKPYWNKNLTEGRN
FT                   FSKLDPKTLDDNGIGVLLISDHHYGKWNDNFLSKKTVGGLIMQSRVSGLPSHYPAVLTP
FT                   KFLFDPNLNPNLKKYASANYALPNYYSDPLDGIILTGKTLDRIYDAKKFSNVYNAHVAG
FT                   KTHFETFTDFAKAMVDETRRGISQWSLKNDKWKDKTVLMVMPNFTPTAKMVDVNFKPED
FT                   LEFLSNVCINEPMYCPTIYSDPNDKYLPGLGAKFPIPVNHISQVQNYIDDYGQIGGKVL
FT                   NGTGNPEASKQVGPTLGDAFKGTSDVVVFCYNEYGLLNYKPGTEEGEALVQQFEKNLTN
FT                   YVNGLDINTKNNFNPTKMLKEKPVVGKNFFIIRKSSFYDAFLGFLGTIHNFNTFNKWMN
FT                   GENARPIELNIPKFNKDNVQHIRAFKDDFKNK"
FT   gene            404592..405692
FT                   /locus_tag="UUR10_0364"
FT   CDS_pept        404592..405692
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0364"
FT                   /product="ferrichrome ABC transporter"
FT                   /note="identified by match to protein family HMM PF01032"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60136"
FT                   /db_xref="GOA:B5ZBG7"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZBG7"
FT                   /protein_id="ACI60136.1"
FT                   /translation="MIEKEIFRFKLKDKLKNPIIDNGNLKKSFKKYSNFNKNHIILWIF
FT                   TILAIAFFSLIIIFVNIDKNGHFVKLRDPKDTFILSYETILQIWISGMSIGISAFFLQR
FT                   MTNNRLVDTSTIGIGNICLIGLIILVLSLSFESGFEAQNLFQKIVPFVFIISSIIAGLC
FT                   LYFFSKRRHGFNNRKLIICGVFINCISIALAISLKSNLTKVGSEYLDSRIVGSFDTRSY
FT                   LEEYLSYAIFLFIILWCFIRSPKFKIVLTDNIIAEQLGLKVKLINLEMILITSVLTGVS
FT                   YIMSGNVLFLGVASANIAYSFHGKKVMRSMLFSGLITTLFLLVGQFFLSNIIFNLTQLY
FT                   FETPMITTLLVTPIFIAVILLKKQKV"
FT   gene            405795..407420
FT                   /locus_tag="UUR10_0365"
FT   CDS_pept        405795..407420
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0365"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60031"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZBG8"
FT                   /protein_id="ACI60031.1"
FT                   /translation="MKLKYKKILLVGLVAAIGLASATAIITSCKDTKKNNSNNPTTKFD
FT                   LESRRKDYAEGLKFWLNGGKTSLGTKFEKVITESSQIKERLSKNQKLGTTRDSGSLVQD
FT                   DAAYSFGIAPDYVHYRWNSATIKDAVPEYLRSYYNENLTKGDSFKNATADKFANYNIGV
FT                   LLVADSKVASHGKLLEASGGSVGGLLIQSRSTGYTSKAPADIEPNFLFGNQNPYVAEKE
FT                   SDHAGRPNYFVDPFSGLITTGKTLDRIYDAKKFNNVHNATINGKTGFNSFEEYAQVASD
FT                   IARKNFSNWAKSNNEWKGKTVLNMMSNPQDYAGFLINPEIKTDVDKFNVGNVFIPQPVY
FT                   FPGIYAAQDDPFTPGLGAKFPLPLKNINQIQSYVDDYGWIGGKTLVGDSNKELSKTISP
FT                   TIGDAFENTTDIVIYSYNEYLIEGFEPGTAKGEEVLKKFETNLANYVNGLTKETKNQFV
FT                   PTKVLKEKPVVGKNFFIERKGKFYDACYGFAGQDLVVNTLNKWTRGANAQNIDLGYPIF
FT                   NKNTVKHIRAFKDSLGVKVLDEQK"
FT   gene            407435..408505
FT                   /locus_tag="UUR10_0366"
FT   CDS_pept        407435..408505
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0366"
FT                   /product="citrate-dependent iron transport, membrane-bound
FT                   protein"
FT                   /note="identified by match to protein family HMM PF01032"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60289"
FT                   /db_xref="GOA:B5ZBG9"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZBG9"
FT                   /protein_id="ACI60289.1"
FT                   /translation="MQTKQVNINKKDLSIYKKIIEAKKFVSTQIRRPYMITIIVLTFII
FT                   LAVGMFFMNVFYERSTYFDANYNTHVTYFRTWAKVVADDKSILLYWYPPIVKLFVAISM
FT                   PVAGYAIQITTQNRLSSPSTLGYIPVSILAYVAMLMIDQGKSWLVYVFGFIFSSFIILV
FT                   NYILQRQKSSNRSFKPVLIGFAISATITAVGLVIAVSRPNILNRVTIWTGELPNVYEWL
FT                   KLYISMPLILICLFAFLVLSPKLKIMQRDFALAKSLGIKVNLIFWVVTVLTAIVTIATV
FT                   NITSPMILLGLIIPNIVRATFNKHEPLFVFFVSIVFSLALLEVSLFLSLNYRFGPNFLM
FT                   AIVSAFVLVFIMRKHG"
FT   gene            408511..409614
FT                   /locus_tag="UUR10_0367"
FT   CDS_pept        408511..409614
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0367"
FT                   /product="ferrichrome ABC transporter"
FT                   /note="identified by match to protein family HMM PF01032"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60027"
FT                   /db_xref="GOA:B5ZBH0"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZBH0"
FT                   /protein_id="ACI60027.1"
FT                   /translation="MKNPSRFIFKIKNNILNTINNATFIDNGNFKKKFQIYARKQHLAA
FT                   WVISIITILFLSLLVMFIKINNQGQLLNNRTPLDLFKVNYETILQIWITGASLGASAYM
FT                   FQRITKNRLVDTSTLGIGNVCLIGLFFLAISINFENYGSQKLFENLLPFIFIISGVCAG
FT                   LILYWFSKKRTGFSHTKLIVSGVFINFIAIALSISLKDNLTLVASNYIDDRLLGNFSNR
FT                   NSTEKYLSYAVFLFLMIWCFLRSAKFKVVITDTMIAEQLGLKVKLLNLEMIFISSCLTA
FT                   VSYIMGGNVLFLGIAAANLGYAVFGNRFSSSIIFSSFITIIFLIFGQFILDNIVQNLTS
FT                   LVFDAPIVTPLLVAPIFTFIILFRNNI"
FT   gene            409764..411398
FT                   /locus_tag="UUR10_0368"
FT   CDS_pept        409764..411398
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0368"
FT                   /product="putative ABC substrate-binding protein-iron"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60193"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZBH1"
FT                   /protein_id="ACI60193.1"
FT                   /translation="MKYKRIWITSIASIAFITTIVSTTTACSKVNNEVKSSNDIFKQIL
FT                   PTKEELTNLIKRRKDWANDLQVYFEGGKSASGKEFERIQTLATNASIYYQKNQKIAMTR
FT                   DSGSLCQDDAAYSFGIAPDISNYRWKAGDVEEVVPHYLSYLYNPKLTKGMELKGVKAET
FT                   LAAENVGTLFIADFKFGNYKTNFLDKNKIGGIVMQSRSSGLPSKTPALFMPNWLFGKNN
FT                   PYLETDVNASAGITDFFVDPYDGLIFTGKTLDRIYDAKKFDNVNKAVIDGKSNFQTFTD
FT                   YAKAIVSVVRKNVSNWAKQHSYWKNKTVVMTMPNVMKGARIIDPNFSKDDLLFLGNIFI
FT                   PQPVYFPILYADQNDEYTPGLGAKFPIPKKDINEVQRYVDNWGWIGGAILSDATNPDAA
FT                   KRVGPTLGEAFEGTVDKVIYSYNEYLIKGYKPGTAEGEAIIKKFEANLAKYVNSLDINT
FT                   KNSFNPTRILKEKPVVGKNFFIERKGNIYDANYGFIGQKTMVNILNRWMNGENSPEVDL
FT                   GIPNFTKDNVKHLRAFKDELNVKNTDE"
FT   gene            411491..413125
FT                   /locus_tag="UUR10_0369"
FT   CDS_pept        411491..413125
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0369"
FT                   /product="putative ABC substrate-binding protein-iron"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60065"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZBH2"
FT                   /protein_id="ACI60065.1"
FT                   /translation="MKLKFKKILLSISTSLIILSSIITIAACSNQVKSKTNFSKTTPTL
FT                   EELTELKKREEAWKADLEVYFEGGVSKSGKKFNRIETLSSKASSYYQKNQKIAVTNDSS
FT                   SLCQDDALYAFGIAPDYSGFRWKTSELEEVHPHYLNYLYNSKLTKGMNFTGKGALPENF
FT                   AKLNVGTLFIADFKFNKYKENFLDKNEIGGVAMQSRSSSLPSKTPALFMPSWLFGKNNP
FT                   YLETNVNASAGITDFFVDPYDGLIFTGKTLDRIYDAKKFDNVNKAVIDGKSNFQTFTDY
FT                   ANVAVKAVRKRVSQWAKQNNKWKDKTTVMISPDVMPNGRIVDPNITKEDLLHLSNFFIT
FT                   QPVYLPILYADQNHPYTPGMGCKFPIPKKHLEDVQKYIDNWGWIGGAILSSSAENPDAA
FT                   KRVGPTLGEAFEGTVDKVIYSYNEYLIKGYKPGTAEGEAIIKKFEANLAKYVNSLDINT
FT                   KNSFNPTRILKEKPVVGKNFFIEREGTFCDGCYGFMGQKTIVNILNRWMNGENSPEVDL
FT                   GIPNFTKDNVKHLRAFKDELNVKNTDE"
FT   gene            413282..413806
FT                   /locus_tag="UUR10_0370"
FT   CDS_pept        413282..413806
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0370"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60307"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZBH3"
FT                   /protein_id="ACI60307.1"
FT                   /translation="MKNKYFRKSKFWLLIPISFISLGSITLVATACVKKNFYPNTFADD
FT                   QIYITKNNEKTVKFRISRNDEENKKYFKDDLKWNTFINKLKKTYINVETVIPKENAKQN
FT                   IKQQDLCMRALPVQVLSNNKYVDIYVKIPVLLANTKMLVVGDDLLKSFYFDTDNLIMNA
FT                   KHFQPIPIKML"
FT   gene            complement(413848..415275)
FT                   /locus_tag="UUR10_0371"
FT   CDS_pept        complement(413848..415275)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0371"
FT                   /product="aldehyde dehydrogenase (NAD) family protein"
FT                   /EC_number="1.2.1.-"
FT                   /note="identified by match to protein family HMM PF00171"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60227"
FT                   /db_xref="GOA:B5ZBH4"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZBH4"
FT                   /protein_id="ACI60227.1"
FT                   /translation="MNYKTLINGAFVDAKEKLAVYNPSNNQIIAYVPNIHDENEINTIF
FT                   ENAHKAYLKFKDTTIECRCDLLLKLADKLDKHKQELAQIISTEIAKGLKDSLIEVERSA
FT                   DYLRETVFEYQKLMQKPIIFDETVHHVKNKVATYYRIPVGVVLAICPFNYPINLLISKL
FT                   APALVSGNSLVYKPSTQGSLIGIRISELVHEVGFPKGVVNCLTTEARITGDLLVTNKYV
FT                   KAISFTGGPKVGNHIAEITSKISLVLELGGKDPALVLDDADFELAANEIVKGAYGFSGQ
FT                   RCTAIKRVFVSHKNHDLLVNLINKKVDALTVGLPQQNPIITPLINSNSLKYNLSLVEDA
FT                   IKKGAIVHQKIVYNEKNNLLHPLVIDNVTKEMRVAWEEPFGPILPIITYNSIQEAIDLI
FT                   NQSQYGLQACIFTTNYASIEQLALQIESGTININKSSSRGPDILPFFGVKDSGFGIQGI
FT                   VDAILSMTTIKGIIINK"
FT   gene            complement(415307..416296)
FT                   /gene="asnA"
FT                   /locus_tag="UUR10_0372"
FT   CDS_pept        complement(415307..416296)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="asnA"
FT                   /locus_tag="UUR10_0372"
FT                   /product="aspartate--ammonia ligase"
FT                   /EC_number="6.3.1.1"
FT                   /note="identified by match to protein family HMM PF03590"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60345"
FT                   /db_xref="GOA:B5ZBH5"
FT                   /db_xref="InterPro:IPR004618"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5ZBH5"
FT                   /protein_id="ACI60345.1"
FT                   /translation="MGQLQKAKINQTQKAIVEIKNRFQKYFAKNLNLSRVTAPLFVEGQ
FT                   SGLNDHLDHKQKAVSFYAKKLNKTLEIVQSLAKWKRLALLDYGFSLYEGLYTDMNAIRA
FT                   DDDIDEIHSIYVDQWDWEILINKQDCTLDFLKSIVNKIYSTIKTVQLEIDQLYNPKQII
FT                   LPDSITFIGSQELEDLYPHLTPSQREYEFAKMHQAIFIYQIGYPLKSGYIQSIRSPEYD
FT                   NWNLNGDLIVYHKLNDQAIELSSMGIRVSKQDFIKQTNFANLKNDQENNFYHQMILNDQ
FT                   LPQTIGGGIGQSRLCMFLLNKKHIGEVQVSVWPNEYKDELLKKGIKLL"
FT   gene            complement(416274..416930)
FT                   /gene="pgsA"
FT                   /locus_tag="UUR10_0373"
FT   CDS_pept        complement(416274..416930)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="pgsA"
FT                   /locus_tag="UUR10_0373"
FT                   /product="CDP-diacylglycerol--glycerol-3-phosphate
FT                   3-phosphatidyltransferase"
FT                   /EC_number="2.7.8.5"
FT                   /note="identified by match to protein family HMM PF01066;
FT                   match to protein family HMM TIGR00560"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60266"
FT                   /db_xref="GOA:B5ZBH6"
FT                   /db_xref="InterPro:IPR000462"
FT                   /db_xref="InterPro:IPR004570"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZBH6"
FT                   /protein_id="ACI60266.1"
FT                   /translation="MAKLNFKKNILTSPFFRNIPNIITIFRIFLALICIILLLVDFYTK
FT                   NLNIVYEVLDANISALRLSATTIFIIAAFSDFLDGYIARKYNLVSNLGKILDPISDKIL
FT                   VNGVLICLTLDHTALAYLTIINILRDIFIDGLRMFASSKKIIIPANIFGKIKSILLFIS
FT                   ICFILFLLSLTSSWKNVYLFNIPLFFATSLSIVSAIIYYIDFYKGVKKRGSITKS"
FT   gene            complement(416911..418275)
FT                   /gene="asnS"
FT                   /locus_tag="UUR10_0374"
FT   CDS_pept        complement(416911..418275)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="asnS"
FT                   /locus_tag="UUR10_0374"
FT                   /product="asparaginyl-tRNA synthetase"
FT                   /EC_number="6.1.1.22"
FT                   /note="identified by match to protein family HMM PF00152;
FT                   match to protein family HMM PF01336; match to protein
FT                   family HMM TIGR00457"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59870"
FT                   /db_xref="GOA:B5ZBH7"
FT                   /db_xref="InterPro:IPR002312"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004522"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5ZBH7"
FT                   /protein_id="ACI59870.1"
FT                   /translation="MQLKIKEIFDQDYTKLEGQKVQIKAWVRSNRDSKKIGFLVLNDGS
FT                   SLTNLQAVYRVDKISNYEEITAARMWAAVAIEGVIKLTPTAKQPLELEVLNAQILKQSD
FT                   EDFLLSNNDLSLETLRLNAHLRPRTNLFHAIMKVRATLAFAVHEFMNQNEYSWLAAPLF
FT                   TGNDAEGAGETFSIQKFDNEEFFGKQTHLSVTGQLQAEAYAQAFGNVYTFGPTFRAEKS
FT                   HTNRHLAEFWMIEPEMAFVDLKGMQDIVENLIKHVIKAVLEKNQQELEFLAQRNDENLI
FT                   KKLQKVVDSKFERIEYKDAVKILANAVKSGHQFEDNEIFFGMDLGSEHERYMCETYHQG
FT                   PVFLQNYPKDIKAFYMKLNDDQQTVASTDLLIPGVGELVGGSQREDNYEKLLKRCQELK
FT                   MPIESLQWYLDLRRFGYYMSSGFGIGFERLVMYVTGVNNIKDTIPFPRSHGQIEF"
FT   gene            complement(418369..418992)
FT                   /locus_tag="UUR10_0375"
FT   CDS_pept        complement(418369..418992)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0375"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59977"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZBH8"
FT                   /protein_id="ACI59977.1"
FT                   /translation="MSVTNKKYDPQISELLKLRDLANKVDNLKRKLKTIEYNHYCEHEN
FT                   YDSDVNETNNVYEQEVSLNHETQIVKLRVDLNDLTNLSNPKIVEVEKPVYIEKVIEVEK
FT                   PIEKIVEKIVYVNQENQVNKQESIKEERELKTPIKSGKYVKYRRLKNNGMSDAGWKIFE
FT                   LVKQTQQDKVAAEKRFDEQQEEKKRQREQKRLEKQQKLEAKNEQ"
FT   gene            complement(419132..420649)
FT                   /locus_tag="UUR10_0376"
FT   CDS_pept        complement(419132..420649)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0376"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60012"
FT                   /db_xref="InterPro:IPR019219"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZBH9"
FT                   /protein_id="ACI60012.1"
FT                   /translation="MKTTANKKIKLINIEKLEFEILEPINTNEILVFKDENSTIYESFN
FT                   QNLEKQRDEFIKKIREEEEQNWRNDFIANDRDYNELVKQRYEFEKQRDELKEKLKNEGD
FT                   KAIAHFKDSDEYKSLIKAQEKINSLNKTIESNEQNYKKEIENIKLKLKNKFEGETESLK
FT                   NTIIEQKSKLDNVERMAIVNFKESDEYQKIIKDKRDLDLEIEKLKLSIQNHEKDMENAK
FT                   LKWNYQKTAEIKDLETKKNNEIDKLKEGIEQLKREKSSNVKLVGEELEQWLKNKFDETY
FT                   SFSCPDMAFTKINEVIDGKKADFLLEFFDKETSNDDKKLIFSATIEAKTEFYDNQKGTK
FT                   NSVHYKKLNQDRINQKSEYAILVTELEPDDHFIIKKINEYENMFAVRPQYFIPLVDMIR
FT                   NFATLKARINSQIIKYEDRAKIETNLEELKKDIIDNTLQYINDKTKKIIDDSKAIIKKA
FT                   ESIEETAGDIINKKLNTLKKKINGLTIRKIDPNKLLLKFNDDENDEE"
FT   gene            420894..422195
FT                   /gene="pdp"
FT                   /locus_tag="UUR10_0377"
FT   CDS_pept        420894..422195
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="pdp"
FT                   /locus_tag="UUR10_0377"
FT                   /product="pyrimidine-nucleoside phosphorylase"
FT                   /EC_number="2.4.2.2"
FT                   /note="identified by match to protein family HMM PF00591;
FT                   match to protein family HMM PF02885; match to protein
FT                   family HMM PF07831; match to protein family HMM TIGR02644"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60103"
FT                   /db_xref="GOA:B5ZBI0"
FT                   /db_xref="InterPro:IPR000053"
FT                   /db_xref="InterPro:IPR000312"
FT                   /db_xref="InterPro:IPR013102"
FT                   /db_xref="InterPro:IPR017459"
FT                   /db_xref="InterPro:IPR017872"
FT                   /db_xref="InterPro:IPR018090"
FT                   /db_xref="InterPro:IPR035902"
FT                   /db_xref="InterPro:IPR036320"
FT                   /db_xref="InterPro:IPR036566"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZBI0"
FT                   /protein_id="ACI60103.1"
FT                   /translation="MLNVVEIISKKKNNIELSEQEIKFVYDGFVNKTIPDYQMAAFLMA
FT                   VNFCGYSENEQYYATKAMVESGKVLDLRVENKIVVDKHSSGGVGDKVSIILTPLLSALG
FT                   LYVGKMSGRGLGHTGGTVDKLESLNLNLDFDLKTYMDQLKDNGLLLTGQSDDMVLADKY
FT                   IYALRDVTATSDVFDLMVGSIMAKKLALITDYIFLDVKVGEGAFCKNVEQAESLATKML
FT                   KLSKKFNRNTIIHLTNMDKPLGKAIGNAIEIKESMDYLLGKPVPQDLYDLINQFALDIL
FT                   IDTKFAKNKEDAQAKIDNVIKNGLAYQKFVNWVKWYKGDYISLENNTYFNPKYKLEILA
FT                   KQDGYLDFKSTKELGMIAVDLKAGRKVKTDQLDFQAGIYLNKKNNDFVKTNEVIATLYA
FT                   NQPISDEVVNKYHNNVVYLKTPKQIAPSIIKVMR"
FT   gene            422226..424946
FT                   /gene="alaS"
FT                   /locus_tag="UUR10_0378"
FT   CDS_pept        422226..424946
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="alaS"
FT                   /locus_tag="UUR10_0378"
FT                   /product="alanyl-tRNA synthetase"
FT                   /EC_number="6.1.1.7"
FT                   /note="identified by match to protein family HMM PF01411;
FT                   match to protein family HMM PF02272; match to protein
FT                   family HMM PF07973; match to protein family HMM TIGR00344"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60328"
FT                   /db_xref="GOA:B5ZBI1"
FT                   /db_xref="InterPro:IPR002318"
FT                   /db_xref="InterPro:IPR003156"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR012947"
FT                   /db_xref="InterPro:IPR018162"
FT                   /db_xref="InterPro:IPR018163"
FT                   /db_xref="InterPro:IPR018164"
FT                   /db_xref="InterPro:IPR018165"
FT                   /db_xref="InterPro:IPR023033"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZBI1"
FT                   /protein_id="ACI60328.1"
FT                   /translation="MLKLSTNEIRKKWIEFFESKDHLFIEPKSLIPKNDPTLLWINSGV
FT                   STLKDYFSGKVKPPHKRLVNSQKAIRTNDIFNVGLTSRHHTFFEMLGNFSIGDYFKKEA
FT                   IDWAYEFLIDVLKIDVKKLWVTVFEDDQFTYDEWIKLGIIKEQIIKCNRDRNFWDVGNG
FT                   PCGPCTEIHYDRGEHFDPNKVGSKLILEDIENDRYVEIWNIVFSQFNNDGHNNYTELLQ
FT                   KNIDTGAGLERIACISQDVPTNFDSDVFMQITKSVEQFSEYKYDMNEYFHPNVAQNKIN
FT                   FAYKVIADHMRATVFAIADGAIPSNKERGYILRRLIRRTMVLVRRLNINNLLWVDAVVN
FT                   AIASTMGDFYTYLKDEKTLAKIKMILNKEVQLFEKTLQLGLNIFESSIHNQELDKDITF
FT                   KLVDTYGFPIELIKEICEQRNVKVDLEAFDAMFKHHQLVSKANKANLKVMESQNESLMQ
FT                   LDVDSTFHYEIFKWENAKIITLFNEDFELVDGLDHEDGYVVFDNTCFYATSGGQQHDTG
FT                   YIIKNDQQFFVDDVFKAPNRQHVHHVKNASLSMNEYVILQINEQDRKSITANHTAEHLL
FT                   HYCLKQVLSPDIKQEGAAKYPHKVTFDFTYHAQPTKAQLDKLENVLNEMVQSNFDVQEL
FT                   HMDLDEAKAVGAAAYFEDVYKKLKGKLRVIKMGPSIELCGGTHAHHTSEIERIKIVECA
FT                   SKGAGSWRITMVTGHDNLAKYIHDLYVEYLNEINHLKANLDINDHKLNDLYNAFANWKN
FT                   LSIDDYDLLNEKFTELKQALINFKIEFDKQNAKQAIIDIKNTFNAQQTNKRIHVFKNTD
FT                   NKNIFNALNELINENQNTLFISFNLDENKIQYLLAINEKFATTNQINLNKYIKELNTIS
FT                   NGKGGGKPYFVQGGTSEQEKLDELLTAIDKWVINA"
FT   gene            424939..425382
FT                   /locus_tag="UUR10_0379"
FT   CDS_pept        424939..425382
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0379"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF03652;
FT                   match to protein family HMM TIGR00250"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59788"
FT                   /db_xref="GOA:B5ZBI2"
FT                   /db_xref="InterPro:IPR005227"
FT                   /db_xref="InterPro:IPR006641"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR037027"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5ZBI2"
FT                   /protein_id="ACI59788.1"
FT                   /translation="MRKLALDLGTKSCGFAISDLLGIIASGLDNFIYEENDFIAVLAKI
FT                   DEIMINYHHEIDTIVLGYPTNVYDGSKNKRTYLIESFYTLLKQHFLNHEKIKIVYEDER
FT                   FSTKIATQRLKNSCVKAAKIKKVKDKMSAVVILESYLSKNHFN"
FT   gene            425398..427818
FT                   /gene="leuS"
FT                   /locus_tag="UUR10_0380"
FT   CDS_pept        425398..427818
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="leuS"
FT                   /locus_tag="UUR10_0380"
FT                   /product="leucyl-tRNA synthetase"
FT                   /EC_number="6.1.1.4"
FT                   /note="identified by match to protein family HMM PF00133;
FT                   match to protein family HMM PF08264; match to protein
FT                   family HMM PF09334; match to protein family HMM TIGR00396"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60167"
FT                   /db_xref="GOA:B5ZBI3"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002302"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015413"
FT                   /db_xref="InterPro:IPR025709"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5ZBI3"
FT                   /protein_id="ACI60167.1"
FT                   /translation="MYNHNKIEKKWQKYWLDNKTFKFVDNPNNPKKFYVLDMFPYPSGK
FT                   GLHVGHPKGYTATDVISRFKRLNGYDVLHPIGWDAFGLPAEQYALETNNHPHTFTQQNI
FT                   KIFRKQLQMIGFDFDYDKEVDTTDPQFYQWTQWIFVQLYKHNLAEIQDIDVNWCENLGT
FT                   VLSNEEVVLNDKNERVSERGGHPVVRKPMKQWVLKIVDYADKLLDGLNEVEFSESLKSL
FT                   QRNWIGKSIGTNVQFKIKDSHLALDVFTTRIDTIYGAQYLVVAPEHPILKSIVSEQQAS
FT                   VVQAYVDQTKKISDLDRIADTNKTGVFSGTYAINPINQEIIPIWVSDYVLMNFATGAVM
FT                   GVPAHDERDYAFAKKYDLPIKSVIDTKQSLPYTGDGLHINSPMINGLNIEQSQNILNDY
FT                   LVKNHLAKRVVNYKLRNWIFSRQRYWGEPFPVLFDENNQIKIIEDLPVLLPNLDEFKPS
FT                   KTGESPLANAQEWLYVEIDGKKYRRETNTMPQWAGSSWYFLAYILKNEDGSYTPLNSEE
FT                   AKKRFAKWLPVDVYIGGQEHAVLHLLYARFWHRFLYDIGVVPTKEPFYKVINQGMILGE
FT                   NNEKMSKSKGNVINPDDIIASHGADTLRIYEMFMGPLTASLPWSPDGLDAMRKWLDRVY
FT                   RLYHNLSELEVVEDVNKLNEEIIITYHTLIKNYTKAINEQAFNIAISEMMVFVNVLYKN
FT                   KVINYKLLDNFLILLSCFAPHLAEELYSLNHSESVCLQKMPIYDEQKIIAQNVTIPIQI
FT                   NGKLKHTINVLRDTNAEQLINLALACEQVKQAIGDQPIKKQIVVVNKIINFVI"
FT   gene            428036..428428
FT                   /locus_tag="UUR10_0381"
FT   CDS_pept        428036..428428
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0381"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60233"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZBI4"
FT                   /protein_id="ACI60233.1"
FT                   /translation="MIVYYAPKKKIIAFEYAKQHWDETKNTYQWDFVEKLLKYIDQHIT
FT                   NLVDFEFVKQSYGKPYFKKLIDYYMFANATYIIDQKPKIFANEMSTKKLISTTDHELYT
FT                   QLGFELFKKYYHCDTNDLVSKKLMNN"
FT   gene            428444..428572
FT                   /locus_tag="UUR10_0382"
FT   CDS_pept        428444..428572
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0382"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60008"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZBI5"
FT                   /protein_id="ACI60008.1"
FT                   /translation="MYFINNIKSLFLIIMMLKKGLVYDTYNDWKFDIHAKLPGIAF"
FT   gene            429096..429356
FT                   /locus_tag="UUR10_0383"
FT   CDS_pept        429096..429356
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0383"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60090"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZBI6"
FT                   /protein_id="ACI60090.1"
FT                   /translation="MSQYLYLQTLLNILKQQKDVNLEQIQKCLKEINAQIVNLEQNKVK
FT                   ILNDFEELLKKHQINFDDNLNINESTLIYYLKANNHNPFRF"
FT   gene            complement(429861..430466)
FT                   /locus_tag="UUR10_0384"
FT   CDS_pept        complement(429861..430466)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0384"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59857"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZBI7"
FT                   /protein_id="ACI59857.1"
FT                   /translation="MPFIDLIVNQKDLDNQKLDQINSIPTISNIIISNIAIKNEQGSNF
FT                   QKRLTNHAIVFDPSVLKNQIECWIKNISFNYITHLPNSEKSIDINLFTTKIKNFNQNVR
FT                   LKILCYDDNGNHIFEDFNFGKITKKTKNEISITFKFTKELLRERKYYISEIEFVDEKIK
FT                   FKTYNDSITDPNIKGNYSFYINNYKSDSNIEIYTKIIL"
FT   gene            430963..431406
FT                   /locus_tag="UUR10_0385"
FT   CDS_pept        430963..431406
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0385"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59894"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZBI8"
FT                   /protein_id="ACI59894.1"
FT                   /translation="MMKRNELKQLQELQLKINDFYTLVMTTKNLDLCNLSALLEFLDIN
FT                   WGVWVNLSTQRDEFNKKRYEYITKANYGLRMALNELLCRNASYDKELNNQGLRKFRTQE
FT                   YFKRLDFELANEQKSTDIEDTTITFEKVDDNNKLTIKKLINVI"
FT   gene            431763..433208
FT                   /locus_tag="UUR10_0386"
FT   CDS_pept        431763..433208
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0386"
FT                   /product="phage terminase, large subunit, pbsx family"
FT                   /note="identified by match to protein family HMM PF03237;
FT                   match to protein family HMM TIGR01547"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60341"
FT                   /db_xref="GOA:B5ZBI9"
FT                   /db_xref="InterPro:IPR004921"
FT                   /db_xref="InterPro:IPR006437"
FT                   /db_xref="InterPro:IPR035421"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZBI9"
FT                   /protein_id="ACI60341.1"
FT                   /translation="MRIKLDFIECFGFYSDLVEFVAKKLPIPFNEINLLGGRSSGKTFA
FT                   TLDFLSSLVAIKQQNAIYVFRQNISDAKKIFSDYLNFLDQKQLLKFAKINHSERTVIIN
FT                   GWTVMFEALNETRNNINKGAKVGFRLWTQARYVFAFFEEASQLDFNLVKNSQQSLRGTK
FT                   DTQVVSIFASNPWTSEHWYIENFNNHLAENEFSIQQNPYYEYSVVDKKLFLRSTYRANK
FT                   FTSQQEIEQFEWWKDIDYSKYRVISLGLSGSVEGAIYARSLSVMHEPYGEYDNYAMQFF
FT                   GGMDWGDGTSSSSSDTACLFGSISKENGIEILDEMVYNNNVNPLTSEQQIELVVRWFIK
FT                   KQQEVNVKIVIYIDNAHLRYFYETFNATFKRIAFQYNMYGSELVFAPAIKHAIWDRVVL
FT                   VNYMLASGKLRFSKNACPKLYKDLKNCYVVLPKTIKEDTKKERSHEHTHTINALEYLMC
FT                   AFHLYFYAQAPAINEKGAIRYGT"
FT   gene            433198..434562
FT                   /locus_tag="UUR10_0387"
FT   CDS_pept        433198..434562
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0387"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60040"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZBJ0"
FT                   /protein_id="ACI60040.1"
FT                   /translation="MALKTNTIIKSKWNPSNFDINIDIKEMIARTAQESTVNDVILKTK
FT                   DNVPLEWMEFIDNINENNEILKLIKGDCRIKSLYGINYVGFEIYNNDILIFNADINNAM
FT                   NKSIRINQQQEYSSTIYRKIALMKDSEYLSLKELHTPYEIKRLIYNSTGVYKIIFNEFE
FT                   VSTPMYFKDIFKNKNVVHNYGVLCTKEFLNRSFIDFENKINEKLPDWYPVNDLINDTNA
FT                   LLNFIKKERELNKTRIVGSIINHNDAQTYRNQWIDEIQYMSSDLILNTNTPDKNAFEIM
FT                   QSTFNESIHLQAITEKLNLIFKGCGYVWNMGDSLSYQNSETATNLNKATFETTKMKVEL
FT                   YTNDWIDFFKNIAIAWFKTKRYGNKRLSSIEQKQVNKLIRQEFDQYVEFKIISNLIKDY
FT                   NDNMEKVISLYGANLMPLNLAVQKLYPELTPTEQDELVKELEQKHKLENGEFENE"
FT   gene            434555..438037
FT                   /locus_tag="UUR10_0388"
FT   CDS_pept        434555..438037
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0388"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60059"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZBJ1"
FT                   /protein_id="ACI60059.1"
FT                   /translation="MSNIYLDELEGYSQKNIEDSIDSLIEPNQKPIHLCPFRILKGFIK
FT                   ITNTGEQSLLVNDKDFSTVWNIKASNEPIIAYWDKSFTYNFKGSLNYISKDYARIDPSN
FT                   TTLKNNFKPYYFQAWVQNYSQANNVSSIVFNDKEHTVIKTITTVTLIVKYPSVYEDEIY
FT                   QNEQGNLVSHKARFKQWTTDMLKEYLFIIPDEHAQANQWLMVNEVIPFYSTTSKRYEGA
FT                   QITLTNVNDLLTSSGNDILATIQPCQPGDGYLWPVIQNGKLTYDERKEKPLGVKSIQLL
FT                   TNGPYALNSMLITGRTYNNDTRELSANKRLLLYKAKIPVASKFFNVSAPTSNYVYLYNA
FT                   FFEIEKIYKDQYEKQKDFTFDHNANIKLNGGLLLNHKWDASNNALSYEDNRYPFKLWDE
FT                   GFKIHASFFNFKLGGTGAQKGGSLTENAAQNNPLADAVVTGQVAGEVVSTVFESIGRNV
FT                   SQGFNLNNLGLWSFNMGFAKTKAEQIKEATKIGLNNITMPPGTNLHTFLNHNAFMYDLI
FT                   KYLPYSYKETIRQNLGELIDNTPLSLGKIRRGIVDILYPGWTKVEDATGYNMSNIWLNT
FT                   RGFNFIAPCLPLELEVSNKLKADLINLDIFTNKPAKTFSPLGIPAIACCYHFDITDRFA
FT                   KFVDDELKVFDTELIGQTTYRDGTYIRKDKKPLYWDSFCEALPPNTPLSYEPAVINISS
FT                   GKREDVNRVKYPYVIDTIDIKGLGKCDMKLTAFSGFYSPDARLKDEFKNVYEAIFESNG
FT                   KYTDDMSQWSNYINFSTLDEINSVGTKLSYPKPPVETDFLKNTKTNSDDGVNASLQTIN
FT                   ETLYKVGDNSLLSATQYRKPRFYFYEPDSSKLANLFGYGSYTNKLNYLFGGSNLSDVIV
FT                   ANKVIAYSFVFKWDFNYREWLNLGSVNKTKRNLKLTFEIESNWIQKGWTNQFNVDNSFQ
FT                   SANNFVGFELTKDNKLKYGGNYAVDLNTPNKKSTISTFSIKTDVYDLLISKPNNSSIRI
FT                   NLGEVDDKLEFNLVAINQEFSVNSVVDNKENISVSVKPNENKYIILTKINENTFKIELK
FT                   DYESTTKDTVYSIEPTNRVNYRLVSNYLPTYKIEKPFDLSDANNANIYIDDMGNEKEIS
FT                   KNNKPIDEFKGEDNERRWFKTTPFDLSDVIKELETNNCIKSKTIKLKTIELVE"
FT   gene            438048..438416
FT                   /locus_tag="UUR10_0389"
FT   CDS_pept        438048..438416
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0389"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59966"
FT                   /db_xref="GOA:B5ZBJ2"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZBJ2"
FT                   /protein_id="ACI59966.1"
FT                   /translation="MNKIIKFHNERIKWLWILTAILAISFFVICFNNVKWIYTENTAKY
FT                   ELLTSSLEKIVKFYSFSLVDKPFTRGVPNSIDVFSRAIIGIAFGLGFVGTMLIDYFIIS
FT                   KVAYIVKQKIKQSKKVGM"
FT   gene            438419..438745
FT                   /locus_tag="UUR10_0390"
FT   CDS_pept        438419..438745
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0390"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60258"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZBJ3"
FT                   /protein_id="ACI60258.1"
FT                   /translation="MVDELEKNQVQPQETEENKENALYDEIDKRIQKQFENYLKTNEQL
FT                   DNANKLVEAKLKEIKDLENTFKQREQELLNKIATLEQNQQFVNIHQEKPVVEDANSHFL
FT                   KFFN"
FT   gene            438761..439948
FT                   /locus_tag="UUR10_0391"
FT   CDS_pept        438761..439948
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0391"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60153"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZBJ4"
FT                   /protein_id="ACI60153.1"
FT                   /translation="MADNQNTWKRPDPNAKYTITQYLDVVNANNERVVAGGFEKYMLEN
FT                   QFNAEFLGSATMTPTKIMDDMRTAIYEVGVIGQVEEYRDDFTQKQVPAIDRLTLHLSND
FT                   YQKEVSISVFDKKTGAQWNDFLAKTLANLEVVKQDQINLINIDAIYQSCLATGNYIIIP
FT                   ELSPDRVESLTDDERLKIVEKIYRKAKQVTKSRTKFNLGADPNKLRFVLSDDAALVVLT
FT                   AKTYKIRDGQAYSDYSTKGLGSSSQYMGDYLGMPIYSSAYLGEDYLKSTDQKYTSNLIR
FT                   DYKFSKLSGIITMPETTICLKQELMLTTFQSPTSKSHQLIHNSWSMNSAVFPQFAHLNF
FT                   VILNDKPTKDEINKARSNLYSQFPSLYAEFKTPISEDSKITEVNKANWRGLSTYK"
FT   gene            440109..440786
FT                   /locus_tag="UUR10_0392"
FT   CDS_pept        440109..440786
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0392"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:AAF30569.1"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59779"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZBJ5"
FT                   /protein_id="ACI59779.1"
FT                   /translation="MFKFDFFKMFKNKTGAFMKKGKTVFHDFNLKPDDILKKFFDNSSL
FT                   EKIFNSKELKIIQDNKDLAKKLKDAINEAIKDIAKQTSKYTTKQKDSIIKHLTDTLDNA
FT                   SKTEKKNFEKVRKENQFKDVDNVDIDFNKHWIDYGTWYASDGVGKIGYLTLKLMKPSKR
FT                   NPLARYTWRNIPKRIATMLKFAPTGTTFWNVFYHANRKNLVHLQKESIYWFGASRKFFE
FT                   GVK"
FT   gene            440786..443029
FT                   /locus_tag="UUR10_0393"
FT   CDS_pept        440786..443029
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0393"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60362"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZBJ6"
FT                   /protein_id="ACI60362.1"
FT                   /translation="MNNKLLLSVQEYLSLFPLIVRNENLEDNQLQLERKKQALTTFILR
FT                   AQSMIDDCIAANGQAGFIYGWFDDAQTTDYQKTKFKEAIATLTNYLWLQGHFIDKDYSS
FT                   GIGDGLSLSFKSENADFEKKRLDIINKLRVCGLYKKSKFANFNDDGIYVNYDELKINAI
FT                   NNVHEELRDHYISKNNPVVNNNFDLNHHNINNVSSINASGNLATLNGFILNDCTLPNDL
FT                   TTDKSNKVYDNAIANYVDIHDVKNLAWYGQNNNNAITRQELYEYCNKINSKMYWDAIYD
FT                   YKAGELVYDLDEKTNTIKVYKALVNNGVSTHNIVDPSKQINENVWELINIQQIDLNKIK
FT                   DGVQNAVDNKVAEIKKAIDTKENTFTKNLENKVNEAKQAVLSSYEQDKASGVFKGEKGE
FT                   PGIQGPVGPKGETGPKGEKGDSANVDTLKSDLNDFKNTAVIGMLGFRENYNNLIKYLIN
FT                   DVSAGNREGSDTVWPFGTVTLERLDWNSDKPENDGIIPRMNKSIAKNTSNLLQLQTSLK
FT                   ETKNNLEQKYIKLENQQSTASSTLSNLENTVKSNYSSLNDKINSVQTVNNANSSTITTI
FT                   ESKIKNLENKKSSNNYKIHSQWYYAGRVRLPENFKWTGRDEEYGDNKTIPWPDIKRTFP
FT                   NMANHEVIFKWYLSLNFNNSSVDWSDKDYSLTFSFDRNTDRNNMLSDSGETQQQILLWN
FT                   QYQPQFLVVRVNAEKSGVNVDLWLVDIVNKTFATNFEVGLNYEWSVRTIYVGE"
FT   gene            443467..444015
FT                   /locus_tag="UUR10_0394"
FT   CDS_pept        443467..444015
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0394"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59731"
FT                   /db_xref="GOA:B5ZBJ7"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZBJ7"
FT                   /protein_id="ACI59731.1"
FT                   /translation="MMNNKNKFKNKEWKFSKKQVQLIYLISSIISGLFLGLALLSTYLI
FT                   AGLPNDNVFVLFVKEQKFYFPFFMTIGFINLIISMLTLLPTLKTLWRTVAKMHQYGDLN
FT                   KEEFEALDILVEQIRNRYISVENIKAVISSNNYKTLDEELKKLEQQEKQLKIQEQEQKV
FT                   KRLEQEIIKDDKTRVQSDY"
FT   gene            443984..444427
FT                   /locus_tag="UUR10_0395"
FT   CDS_pept        443984..444427
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0395"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59872"
FT                   /db_xref="GOA:B5ZBJ8"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZBJ8"
FT                   /protein_id="ACI59872.1"
FT                   /translation="MTKQEFKAITKELFFFNKKRLMLWIAILIFVIAFAMIIVFVPFFN
FT                   FNDKIKSLFDKLKHINWQDPTALFGLVFSVLGYLITALSIPLKVFELMLMLRFRLMLAK
FT                   LIKDGILDPKAFIDDIRHSYLSRRKQRKLEEEIEYLKRIKSDY"
FT   gene            complement(445311..445988)
FT                   /locus_tag="UUR10_0396"
FT   CDS_pept        complement(445311..445988)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0396"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59946"
FT                   /db_xref="GOA:B5ZBJ9"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZBJ9"
FT                   /protein_id="ACI59946.1"
FT                   /translation="MNKWVIGIDLSTTITGVAILRNEQIIKTFAVAFDNFNEKNLYNNV
FT                   IRLIKEINLNVWLLADDDYYIGIEVANFSNPKLTQRFSIYAGMIIALMSQVLRDFNAEF
FT                   KMFNANAWQLKIPQIQYNTLRKDRKLITKNLMIKTFNIKSNLNEDEYDALAIAYFYDSI
FT                   NSTLEQEEITKAKKVVKMNKVKQQLSISKKINKLLEKKSKLKKATAISKVDEQIEELKK
FT                   LNK"
FT   gene            complement(445970..446431)
FT                   /locus_tag="UUR10_0397"
FT   CDS_pept        complement(445970..446431)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0397"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59745"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZBK0"
FT                   /protein_id="ACI59745.1"
FT                   /translation="MRSKQWHLSTQDANLANKKYDYIYFRGVNQLYLKRLKKSSNKFFV
FT                   YKKCKIVPRMISKHLNNDHLINVNDYVPLTKEFIKKSVEKEVKHYLRFISYESKTKQMP
FT                   ELINFLEKTLEDKLFIVAKDYDPLFSVFLRYYIQSLIEKYINELWINEW"
FT   gene            complement(446421..447110)
FT                   /locus_tag="UUR10_0398"
FT   CDS_pept        complement(446421..447110)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0398"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59783"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZBK1"
FT                   /protein_id="ACI59783.1"
FT                   /translation="MSSNNFDNNMPRIEFKKMPLTFIRLNTKKSNNAPFVSGSFWLADK
FT                   VNANVYFSEYLMERIVPFENNKTNIVILENVSCYINFNWEEKRIIMRVVSFDNIFYKHQ
FT                   LSEQQTIDFVSAEKEYNYQTQTVNSYSSSDDEIEIINWLESDEQKAYFDSQLMFIDYKN
FT                   QGFFKNKTMPDKLKNNANALELYKQIIKLDLEAFSGLYNGLKPFEAANKLIEKGYITLN
FT                   DFFKYAI"
FT   gene            complement(447100..447756)
FT                   /gene="bet"
FT                   /locus_tag="UUR10_0399"
FT   CDS_pept        complement(447100..447756)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="bet"
FT                   /locus_tag="UUR10_0399"
FT                   /product="phage recombination protein Bet"
FT                   /note="identified by match to protein family HMM PF03837;
FT                   match to protein family HMM TIGR01913"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60046"
FT                   /db_xref="GOA:B5ZBK2"
FT                   /db_xref="InterPro:IPR010183"
FT                   /db_xref="InterPro:IPR018330"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZBK2"
FT                   /protein_id="ACI60046.1"
FT                   /translation="MVKDDKLVPSIRLLTPNELSEQWANPNSEINQITRAVLTIQGIDL
FT                   KAIDLNQAAQIIYFCQANNLNPLNKEVYLIQMGNRLAPIVGIHTMTERAYRTERLVGIV
FT                   QSYNDVNKSAKTILTIRSPGLKGLGTVEAEVFLSEYSTNKNLWLTKPITMLKKVSLAHA
FT                   LRLSGLLAFKGDTPYIYEEMQQGEAVPNKKMFTPPVAEVIEPAVENIKKVDFNEF"
FT   gene            complement(447756..448091)
FT                   /locus_tag="UUR10_0400"
FT   CDS_pept        complement(447756..448091)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0400"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59950"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZBK3"
FT                   /protein_id="ACI59950.1"
FT                   /translation="MTNSIKREILSALNDETKKVISKLQQTNNLIKQLSDEKKTLEQYL
FT                   KDNVNNHEIVDLDSDLKIKIYDLTSKDSIVLDYDKIITDYKVDTKKYETIKKGTTSTRI
FT                   TWSGADK"
FT   gene            complement(448081..448317)
FT                   /locus_tag="UUR10_0401"
FT   CDS_pept        complement(448081..448317)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0401"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60194"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZBK4"
FT                   /protein_id="ACI60194.1"
FT                   /translation="MTNWDKEHALSEELRQLKDEFEDLMDDLARINKDLDFNIWERKDL
FT                   EYRKASYETDIESIRLRINQKQNEMMEIIKNDK"
FT   gene            complement(448310..448492)
FT                   /locus_tag="UUR10_0402"
FT   CDS_pept        complement(448310..448492)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0402"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60187"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZBK5"
FT                   /protein_id="ACI60187.1"
FT                   /translation="MKNQNEKQIKEYVNKFKDLRNQLTKNNDVKKVCDLINDLFFEVYK
FT                   NNLIDEVIKEINKHD"
FT   gene            complement(448449..448685)
FT                   /locus_tag="UUR10_0403"
FT   CDS_pept        complement(448449..448685)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0403"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60108"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZBK6"
FT                   /protein_id="ACI60108.1"
FT                   /translation="MAMLCMCDECQAIINYYVVQIEQLCNEIVKTRKRVEPYKKLGKLF
FT                   FEIIKNDLFEAIAEEVFRIDEKPKRKTNKRVCK"
FT   gene            complement(448692..448988)
FT                   /locus_tag="UUR10_0404"
FT   CDS_pept        complement(448692..448988)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0404"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59876"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZBK7"
FT                   /protein_id="ACI59876.1"
FT                   /translation="MEKIVGFIVNIINVQKQMIKDLKELKNHKDIMVKDHEKLNDMLNA
FT                   MIDEAVKNYKIALKNITEILNVHLNCVLYNHNLKCGVKDEKLLLPLFKRKKAS"
FT   gene            complement(448994..449335)
FT                   /locus_tag="UUR10_0405"
FT   CDS_pept        complement(448994..449335)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0405"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60243"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZBK8"
FT                   /protein_id="ACI60243.1"
FT                   /translation="MDKIKNYLEKLQAFYKLYSLNLTQGTEILIIQIIDKGNLIFDSIE
FT                   KGKTFNESKIIEPLLFIFKKINTILAILKLTFTKDDLIGILQSLEEHISEFIIANYKYD
FT                   FEIEEDDED"
FT   gene            complement(449337..449510)
FT                   /locus_tag="UUR10_0406"
FT   CDS_pept        complement(449337..449510)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0406"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59772"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZBK9"
FT                   /protein_id="ACI59772.1"
FT                   /translation="MNYILNKNKKVSLTELMNQQPHWYLEELQEHLIKYLDTNGLNDTK
FT                   KLIKQTIKEWKK"
FT   gene            complement(449494..450120)
FT                   /locus_tag="UUR10_0407"
FT   CDS_pept        complement(449494..450120)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0407"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60215"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZBL0"
FT                   /protein_id="ACI60215.1"
FT                   /translation="MINNIFNKKLLVYNEKDQRWYNKFDRTKPLFSPSRLLSFKNYIFE
FT                   KIPAKNLEYPIEFGTSLMQIIQYYFENQSKLDVILNSINEEKLKEVFLLFLDYLKTNDY
FT                   SLIAVELHLFSPKLNHYWHGFADVVVKTKDDKYKVLEIKTHNEIQSVPSWKFQAGVYDY
FT                   IISQELSNYEPSAILAFSRKQAKLSVYENDSLDLSFINKINELYS"
FT   gene            complement(450110..450877)
FT                   /locus_tag="UUR10_0408"
FT   CDS_pept        complement(450110..450877)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0408"
FT                   /product="integrase-recombinase protein"
FT                   /note="identified by match to protein family HMM PF00589"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60253"
FT                   /db_xref="GOA:B5ZBL1"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZBL1"
FT                   /protein_id="ACI60253.1"
FT                   /translation="MINKFLQSIKKRNLSKNTYLTYESHLRKFKVQEQSFKQIIKQLLN
FT                   NNYKPKSLKLAKSILSEYWKFTKQYQYVQDLQEIKLSKEQKSYKKIFSLNEIQRCLKIN
FT                   KQDTKQIKFYKTILLFYATTGIRAMEIYQLKQINNDLFVISGKGNKNRQICYIEHLWNN
FT                   IKNKKLPSTKTLRKYLKVFFDNKNVSLHTLRRSFITNFLTSNDNYKRGDMLKIVQDLVG
FT                   HENIQTTLQYVQITKEQVDDVYKKFFKEFENDK"
FT   gene            complement(451043..451171)
FT                   /locus_tag="UUR10_0409"
FT   CDS_pept        complement(451043..451171)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0409"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60073"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZBL2"
FT                   /protein_id="ACI60073.1"
FT                   /translation="MDDRKAVLDGIVGYLSKINYKIRKEFERREKESTKSINKQNN"
FT   gene            complement(451264..451761)
FT                   /locus_tag="UUR10_0410"
FT   CDS_pept        complement(451264..451761)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0410"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60143"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZBL3"
FT                   /protein_id="ACI60143.1"
FT                   /translation="MSPPPLTIDNQRKEIASLYSIRTKWDGRRWHYINERENKTIEEIN
FT                   REIELLNDQAKIYNKYKIREWINFDFNITKEGVYTYFEYYYNKSTKNQNYETLSNNEIK
FT                   KLKEEEEFNRVMDEYKIKIKMNYWIILMDLLKLIDKPRAQKNEHLLIKKTKIMNMFELE
FT                   KN"
FT   gene            complement(451743..451937)
FT                   /locus_tag="UUR10_0411"
FT   CDS_pept        complement(451743..451937)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0411"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59883"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZBL4"
FT                   /protein_id="ACI59883.1"
FT                   /translation="MTKTNKKLKWTLIALSGIVLSGLCIGVSTSCNASKETSNNKKQDT
FT                   LNDKLKNKKQSAKSCLRHH"
FT   gene            complement(452110..453036)
FT                   /locus_tag="UUR10_0412"
FT   CDS_pept        complement(452110..453036)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0412"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59938"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041677"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZBL5"
FT                   /protein_id="ACI59938.1"
FT                   /translation="MPNQFPLGRFLNKSEYPLSLMQQIAVNKLTKMEEENLSIQSVNGP
FT                   PGTGKTTLLQDVVAELIVKQAYEICYLEKRVFDDENIDQLNRSITKNSVMVVSSNNGAV
FT                   QNIVNEWIQTNKIQTKAFIEKLLEIDYFSEIANEEDILKNEFWGLLSCEGGKRTNVNKM
FT                   LEKLEHIVDNLNKATDHKNVYQDFKDAYEELKNEQNKIHNEAEKYLKYKRHVQKLKNLC
FT                   NKTIDNSLQQTNEILCKPISNTQNSKQNHRFHKLIEWFSKKKSKQTKELVDDDQYEIEN
FT                   LKKSISDYEQEAKANGVINLLCQKYSY"
FT   gene            complement(453112..453834)
FT                   /locus_tag="UUR10_0413"
FT   CDS_pept        complement(453112..453834)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0413"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60182"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZBL6"
FT                   /protein_id="ACI60182.1"
FT                   /translation="MVSDSKKILESWLMFERLVDGSISNKDKKLLKFDQKEINDEFNFY
FT                   QFFQEKLKTIKDKNKGIIFYCGIFDFDKLLNKLQKPYVLDPLDENEEVDDKKFSFALCF
FT                   DGDLKCCYEQSFFSLSGYLYYQNENDLDFDIDNKFQEFEANQKNILKDLFEDLSDNDLI
FT                   NNTDIEMKFNDAIKTYLQKNTNGKISINSLECCAYKIVNNFKNECNYLHSFFVKDLKKA
FT                   LKIDLNECKNLKAYLDSE"
FT   gene            complement(454152..455189)
FT                   /locus_tag="UUR10_0414"
FT   CDS_pept        complement(454152..455189)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0414"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60088"
FT                   /db_xref="InterPro:IPR009849"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZBL7"
FT                   /protein_id="ACI60088.1"
FT                   /translation="MNYQTEKVDFENAPTPTPEPTPTPTLKEDKAVVSKVELVDPNKEN
FT                   KQAKVKLEFSELSLKDETKKVLKLTLTSGNENKEVELELSTDKTSSISKELVDFSTKTY
FT                   KVTKLILNDTNVDLTDAIKNQELKVEASPSPQPTPPTPTPKKDEAIVSGVKINKDENNI
FT                   ATIEITFSKLVLANDNKKSFILEVKDSTNANNSPIVATELVLDKNKKTLVGKLNNLKTN
FT                   VDYKISKLTLNNQNVEFDENALLKSYVDQAKLTMTFNNTNKKVNVKLENFSVLNSLEDK
FT                   QPILVFDIEITKNGTIPQTIHKSLTKSQLLNSNGLEINLKDKIKDTNGSYTVKLTNAKL
FT                   LNINI"
FT   gene            complement(455388..456659)
FT                   /locus_tag="UUR10_0415"
FT   CDS_pept        complement(455388..456659)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0415"
FT                   /product="multiple banded antigen"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60338"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZBL8"
FT                   /protein_id="ACI60338.1"
FT                   /translation="MKLLKNKKFWAITLGVTLVGAGVVAVAASCSSSNVKSKLSSQLVK
FT                   SKDEKSFYAVYDIENFDDLNENDKKALNEAEFNVAITSAENKTENATTKGHLLNKKIYV
FT                   KLPREPKAKEQLTIINKGGLLKTASLVLPDNLNYQTENIGFETQPGSGSTTQPGSGSTT
FT                   QPGSGSTTQPGSGSTTQPGSGSTTQPGSGSTTQPGSGSTTQPGSGSTTQPGSGSTTQPG
FT                   SGSTTQPGSGSTTQPGSGSTTQPGSGSTTQPGSGSTTQPGSGSTTQPGSGSTTQPGSGS
FT                   TTQPGSGSTTQPGSGSTTQPGSGSTTQPGSGSTTQPGSGSTTQPGSGSTTQPGSGSTTQ
FT                   PGSGSTTQPGSGSTTQPGSGSTTQPGSGSTTQPGSGSTTQPGSGSTTQPGSGSTTQPGS
FT                   GSTTQPGSGSTTQPGSGSTTQPGR"
FT   gene            457049..458116
FT                   /locus_tag="UUR10_0416"
FT   CDS_pept        457049..458116
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0416"
FT                   /product="multiple banded antigen"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60346"
FT                   /db_xref="InterPro:IPR009849"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZBL9"
FT                   /protein_id="ACI60346.1"
FT                   /translation="MNYQTEKVDFGNAPTPTPEPTPTPTPKEDKAVVSKVELVDPNKEN
FT                   KQAKVKLEFSELSLKDEAKKVIKLTLTKKDTQELQEVELELSTDKKSAISKTPFTFSTD
FT                   IYKVTKLTLNETNIDLTDVIKNQELKVEATNGQSDQPSNPQNDKDQKVKEAQDKLNAAN
FT                   EALTKAKTTATEKETLATNAKNESDKAKKDVETKTAEVESAKKALEEANKLTGNDKDQK
FT                   VKEAQDKLNAANEALTKAKTTATEKETLATNAKNESDKAKKDVETKTAEVESAKKALEE
FT                   ANKLTGNDKDQKVKEAQDKLNAANEALTKAKTTATEKETLATNAKNESDKAKKDVETKT
FT                   AEVESAKKALEEAKK"
FT   gene            458180..459661
FT                   /locus_tag="UUR10_0417"
FT   CDS_pept        458180..459661
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0417"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60300"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZBM0"
FT                   /protein_id="ACI60300.1"
FT                   /translation="MNYQTEKVDFENTPTPSPTPTPKKDEAVVSSVTFTKVEKKSNEAT
FT                   VSLVFSKLELADTSKKIFVLEVTKKDKTTPIQVIDLKYDEASKTLTGKLTNLTKGEYSI
FT                   SKLTLNNNEINLNDTFKNSKLLIEDQNNNGNGGNEQGDQPSNPKDQAEVDKLTKLIKEK
FT                   EAKVVEVQKAIEEGEKVVKTKQATKTTAENELTAAQKVVDDKKAEKTTLDKELADAKAQ
FT                   LDKANKKDPKDQAEVDKLTKLIKEKEAKVVEVQKAIEEGEKVVKTKQATKTTAENELTA
FT                   AQKVVDDKKAEKTTLDKELADAKAQLDKANKKDPKDQAEVDKLTKLIKEKEAKVVEVQK
FT                   AIEEGEKVVKTKQATKTTAENELTAAQKVVDDKKAEKTTLDKELADAKAQLDKANKKDP
FT                   KDQAEVDKLTKLIKEKEAKVVEVQKAIEEGEKVVKTKQATKTTAENELTAAQKVVDDKK
FT                   AEKTTLDKELADAKAQLDKANKKDPKDQDIGSNGK"
FT   gene            459757..460833
FT                   /locus_tag="UUR10_0418"
FT   CDS_pept        459757..460833
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0418"
FT                   /product="multiple banded antigen"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59928"
FT                   /db_xref="InterPro:IPR009849"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZBM1"
FT                   /protein_id="ACI59928.1"
FT                   /translation="MNYQTEKVDFENTPTPTPNPQPTPTPKEDKAVVSNVEFSDVDAKA
FT                   KTAKVKLTFASIVQLKDESQKSLKLTLTKDSETKEFDLLLSEDKLNATADLSELKEGTY
FT                   KVSKLTLNGNEVSLSDEIKNKELKVELTSTSQSGSSETQKLLVKSVEFNNTTTNKTTIK
FT                   LTFETLNLKEEDKNKFSIALQKQIDDTREENTKIEKVEFNNEQKTVELTINGLTKKTKY
FT                   KLQGLSFDSNTLDISKLQNKEFETLSETNGSGSASGSGAQSGNGSGSASGSGAQSGNGS
FT                   GSASGSGAQSGNGSGSASGSGAQSGNGSGSASGSGAQSGNGSGSASGSGAQSGNGSGSA
FT                   SGSGAQSGNGSGSASGSK"
FT   gene            460941..462329
FT                   /locus_tag="UUR10_0419"
FT   CDS_pept        460941..462329
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0419"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59828"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZBM2"
FT                   /protein_id="ACI59828.1"
FT                   /translation="MNYQTEKVEFENTPTPTPKPTPTPTPKEDKAVVSSVELVDKDTAT
FT                   KKAKIKLTFSKALVVANETTPSLKLTLTKKGAQETKEVELVLSEDKLSVTTKDLVEFAT
FT                   DTYNVSKLMINDTEANVDAIKSSDLKVAEEAPKEDKAVVSSVELVDKDTATKKAKIKLT
FT                   FSKALVVANETTPSLKLTLTKKGAQETKEVELVLSEDKLSVTTKDLVEFATDTYNVSKL
FT                   MINDTEANVDAIKSSDLKVAEEAPKEDKAVVSSVELVDKDTATKKAKIKLTFSKALVVA
FT                   NETTPSLKLTLTKKGAQETKEVELVLSEDKLSVTTKDLVEFATDTYNVSKLMINDTEAN
FT                   VDAIKSSDLKVAEEAPKEDKAVVSSVELVDKDTATKKAKIKLTFSKALVVANETTPSLK
FT                   LTLTKKGAQETKEVELVLSEDKLSVTTKDLVEFATDTYNVSKLMINDTEANVDAIKSSD
FT                   LKVA"
FT   gene            462620..466948
FT                   /gene="polC"
FT                   /locus_tag="UUR10_0420"
FT   CDS_pept        462620..466948
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="polC"
FT                   /locus_tag="UUR10_0420"
FT                   /product="DNA polymerase III, alpha subunit, Gram-positive
FT                   type"
FT                   /EC_number="2.7.7.7"
FT                   /note="identified by match to protein family HMM PF00929;
FT                   match to protein family HMM PF02811; match to protein
FT                   family HMM PF07733; match to protein family HMM TIGR00573;
FT                   match to protein family HMM TIGR01405"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60083"
FT                   /db_xref="GOA:B5ZBM3"
FT                   /db_xref="InterPro:IPR003141"
FT                   /db_xref="InterPro:IPR004013"
FT                   /db_xref="InterPro:IPR006054"
FT                   /db_xref="InterPro:IPR006308"
FT                   /db_xref="InterPro:IPR011708"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="InterPro:IPR016195"
FT                   /db_xref="InterPro:IPR029460"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR040982"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZBM3"
FT                   /protein_id="ACI60083.1"
FT                   /translation="METKNALFKKIVMIDDELLDKINIKKLTKDKKNNLFVYFNQLVDA
FT                   TIINELHQLPKTTLMHDLQIWYINDLKDIDQKILLTFFKKISEQSIDLVFLEQITDLNT
FT                   KIEYDFDLNQLNLKIDNKLIYDHFITNKLKILNTLKAWSLPYSELEIHFENISLILNEN
FT                   HEQAVNEIINHHIQQQKQLEQQINQQQDYQNNQKSNFNYYKNTSNKTITKLIDINPLMN
FT                   NAKIQAYVFAKKVDVLKSGAIAYKLNVIDDSETLTIMTYLSNSEHPLKKFLDELKNDQL
FT                   IEAEIDIVLDNMSKSGQVPIGKIKKIYTIQDNHIKKTITPRLELNFHTKMSSLDAIISA
FT                   QELIDFAVKNQLKTIGITDRNVVQSYPEIAKFSKKQDLKIIYGLETEELEERIPLALNV
FT                   RDQNLDDATYVIFDIETTGLFPNFDEIIEFGAIIMQNNKQIGDKIQFFVKPIQEINENI
FT                   TNLTNINQEMVNDAIDEKTALLKIKEIFANHILVAHNGISFDINFINQRLLKWGLEPLE
FT                   NPSIDTLMISRAINPFKSHRLGAICKKYEVDYNDEVAHRADYDAMVLADVFKIMKNSLV
FT                   NDFEIINLNQINTKLQSLMLKNRSFGNWVNLYIKTQANVKDMYELVSISHTDMYYTRPT
FT                   ITTSFLANKKDKLIISNSVHESDLINALYSKSNDEIKSIMQRYDFITLPSIGSQKHLVY
FT                   AKKITLENVQKAFKKLVSLALELNKIIIYSSSPYYFLKDDKKFYDVYVNTKGLEGKSHR
FT                   FANEEYVPDLEYVDQKSAIDELAYLEDENLINLIINENPQIINSWFDDKIQPLKEGLYA
FT                   PKMEGVDQKTIDYVYHTAKKIYGDNLPTIVEQRIKKELDSIIKHGFSVVYWISHLLVEK
FT                   SMQDGYGVGSRGSVGSSLVATFLNITDVNPLAPHYLCPKCKKCEFITNADDGFDLVPKD
FT                   CEQCQIQMLTDGHNIPFETFLGFDGDKVPDIDLNFSGVYQAVAHNFIKSIFGETHSYRA
FT                   GTIGTMAEKSAENAVKKYFENRFSENQIVRDSTVSLYVQKCIDSKRTTGQHPGGIIIVP
FT                   KEYSIWDFSPYNFPANDINETWKTTHFAFEYLHDSLLKFDILGHDNPTILKLLKDYTGI
FT                   DDRDVPMYDPLVMKLFSDISALNIKPSDVLNETTGAISIPEFGTRFVRGMLVDTKPKSF
FT                   ADLIRISGLSHGESVWLGNAQSLIKSGKLLKDVIACRDDIMTYLIRQNVEPKTAFLIME
FT                   DVRKGKKIKPEHQSILKELKIPEWYIESANKIKYMFPKAHATAYVMHAWKFAWYKIYHP
FT                   LEYYAAFFSVRADNFDLFVINQGKEFIEKTYNDIEQRSKSRDPQKKVSSRELALQPIYE
FT                   IVIELLARGFKISNISIEQSQATSYVIDKQNNAIIPPFVAIQGLGETVANSIIEARNQK
FT                   AFSTIEDLKNRTKISRTDLKNLRELGVLDHLSETEQLTLF"
FT   gene            467062..468702
FT                   /locus_tag="UUR10_0421"
FT   CDS_pept        467062..468702
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0421"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60180"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZBM4"
FT                   /protein_id="ACI60180.1"
FT                   /translation="MKKINKKILFSSLLFGTVAIGTVAVATACSDDKKTKKTINTGTIQ
FT                   PGSSTGTTSKSLTQEKVLRNEIISEILNAKSKKPDRDKMWVNWWNSSFEQARKLAMEMD
FT                   KAVDLTKSSNFKKLIAEGKYKSTFSAQIEDIIAKVKHDIKMYAESPFWKKWRDEKKTVI
FT                   TLVNNNAPREDLAAMNVTSIDLPADFPIIYSKPDYDGIPGLGARFPTPKSKVAPEKLLD
FT                   DGFSFGDIIVEDGSETQKANLPGQLTESFENTADKVIYLYYDSGLPEAFKNNQRQPEKI
FT                   KQFEDWMKSQNANDFIAKRMLKNPNNKDDLIVMPMSSLWYASYGILGVNYSLHALSEAF
FT                   GMPKSELDALKAKEEFKVPTQLFTLVNQDTDLKEDKKTIKDECDPFKSHRDPNHKIDWK
FT                   VWATNSQVLDIAITLGLKPDLLVNGELSTSGHEERQLALYLSEYINGPLKDCRTITPSD
FT                   GIRWETTSLTKIKDLNVNLILAGIHGEAATKMFGALMNEHKEIANFAITNRRFSDETRK
FT                   VVAPQDRDQYSQNAALVDWEDYLKTKDLH"
FT   gene            complement(468778..469581)
FT                   /locus_tag="UUR10_0422"
FT   CDS_pept        complement(468778..469581)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0422"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59902"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZBM5"
FT                   /protein_id="ACI59902.1"
FT                   /translation="MKNWAKSLLINFINIDFHNFKSIQIVLDAWTNQVFEVVDIINLSW
FT                   YIRIKIKKGNTLEHYLFTKFFKGYFYYDQQSHHLISQKINVKKPYVINEWFMANVIHNI
FT                   KELQTLTINKKIKIKDFDYLSYLPLVKNDPLAAYFKSIYEQEVKKTKLVLAHNDFSINN
FT                   ILANECENLFILIDFEYSSRNLKDWDLFNFLRDLNDTQLNFGISFIKEKLGYDEHLIYK
FT                   YLFLTSYYGFLWATNAFLKTNELKIKIYGENAYQKADFYLQKLNK"
FT   gene            complement(469581..470087)
FT                   /locus_tag="UUR10_0423"
FT   CDS_pept        complement(469581..470087)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0423"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF02525"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60086"
FT                   /db_xref="InterPro:IPR003680"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZBM6"
FT                   /protein_id="ACI60086.1"
FT                   /translation="MKKTLVLYARVCPTKSFHTQQIFEAFQKQTNFVCVNLDANQPFDV
FT                   LKEQEFILGFDRIILLFTLNWYNIPWSLSRYFIEVWRTFPFSLENKEVYKIITTGANQD
FT                   FYEKKDPNINNISVEEYLNNVNGMLKKLRASIQKSFYYYGAINQDQARLNQFVNELIKY
FT                   FKNQN"
FT   gene            complement(470231..471985)
FT                   /gene="uvrC"
FT                   /locus_tag="UUR10_0424"
FT   CDS_pept        complement(470231..471985)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="uvrC"
FT                   /locus_tag="UUR10_0424"
FT                   /product="excinuclease ABC, C subunit"
FT                   /note="identified by match to protein family HMM PF01541;
FT                   match to protein family HMM PF08459; match to protein
FT                   family HMM TIGR00194"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60242"
FT                   /db_xref="GOA:B5ZBM7"
FT                   /db_xref="InterPro:IPR000305"
FT                   /db_xref="InterPro:IPR001162"
FT                   /db_xref="InterPro:IPR004791"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="InterPro:IPR035901"
FT                   /db_xref="InterPro:IPR038476"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5ZBM7"
FT                   /protein_id="ACI60242.1"
FT                   /translation="MNDLLKTKLKLIPHKPGCYLWKDEFDQIIYIGKAKDLYNRTHSYF
FT                   NGPKDNKTSKLVSNIKDLEYIVVNNVNEALILENNLIKTHRPKYNILLKDGSNYPYIMI
FT                   TNEQYPRLKYVRTYDKNKGIYFGPLADSTNKYQLFNLLNSIFPFNKCNHQPHQKCIYYD
FT                   LHRCINQVQPQTYEKAIAEVKEIFKGNLDHILAILENKEQHAVAKLDFENAQKYAEQQK
FT                   ALTYIINSGLVQLDNNESFDVVGFYEKNNYLVIIIFNYVKGKLLNKSADTFAIYDHEIN
FT                   ELITSFLMQYYSQNRISTKIIVSLDDDNLLALSQRFKTKFINAQTKFHKQILKLAFDNA
FT                   ILYFDSNIKSVINKQNELDEALNQLKQILKLPDLSMIECFDNSNINLSLPIAGMIVYQN
FT                   GKLNNKLNRKYNLMTTKNASDYHFMIEVITRRYQRLVSQHQKLPNLIVVDGGKLQVNAA
FT                   LYALEQLQISIPLIGLKKDQKHKTNAIVLANGDEIILDRKSVLYKFLANMQNDVHNYAI
FT                   SFLRNKHTKSIFNSLLNDVQGLGKKRLNELLNYYDSINDLKSASDQELLQFLPKNVLVN
FT                   LREKLNKI"
FT   gene            complement(471985..472959)
FT                   /locus_tag="UUR10_0425"
FT   CDS_pept        complement(471985..472959)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0425"
FT                   /product="NAD+ dependent glycerol-3-phosphate
FT                   dehydrogenase"
FT                   /note="identified by match to protein family HMM PF01210;
FT                   match to protein family HMM PF07479"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60201"
FT                   /db_xref="GOA:B5ZBM8"
FT                   /db_xref="InterPro:IPR006109"
FT                   /db_xref="InterPro:IPR006168"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR011128"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZBM8"
FT                   /protein_id="ACI60201.1"
FT                   /translation="MSKILIIGSGAFGSALTQVLVSNHHAVDVYGINQNELNDLQQNQK
FT                   NTTYFQDQKLSQPINNTYLDIHLALKNHYDFIVIVIPSFAIKNFVDSIKTLDLSQAIVV
FT                   NAAKGLNLETKSSWCDYIQQNLKIKALIGLVGPSFAIDVFLKKPTVVNLVGTDLDALIK
FT                   TKQAFENDWFKCVLSKQFEVANYISCFKNALAIGCGIIYGLEKSHNSLVAFLTKGINEM
FT                   QLILETIYQKKVNPLEYFFIGDTILTCTDQKSRNFSFGLLVAQQGVQTALENKQKTVEG
FT                   LNNIKVIYEIIKTKQIDAPLFESLYEVINENLTPKSLFNKSFC"
FT   gene            complement(472969..474297)
FT                   /gene="engA"
FT                   /locus_tag="UUR10_0426"
FT   CDS_pept        complement(472969..474297)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="engA"
FT                   /locus_tag="UUR10_0426"
FT                   /product="ribosome-associated GTPase EngA"
FT                   /note="identified by match to protein family HMM PF01926;
FT                   match to protein family HMM PF08477; match to protein
FT                   family HMM TIGR00231; match to protein family HMM
FT                   TIGR03594"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59767"
FT                   /db_xref="GOA:B5ZBM9"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR016484"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031166"
FT                   /db_xref="InterPro:IPR032859"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5ZBM9"
FT                   /protein_id="ACI59767.1"
FT                   /translation="MRTIAIVGKPNVGKSSLFNRILMRRKSIVDDQPGVTRDRIYDVGN
FT                   WLTRDFMLIDTGGIISSEDTYQDNINEQVLFAINEANTIIFLVSAKDGINNDDKKIAKM
FT                   LKEKAKDKKVILVVNKVESEKYYFNEGELYSFGFGKFFKISAEHGIGMGDLLDELVKDM
FT                   PIQNALDQQERFKFCIIGRPNVGKSSLTNTILGEQRMIVNAEAGSTRDSIDNDFSYHNK
FT                   KYTIIDTAGVRRKGKIVEAVEKYAVLRTQKAIERSQLILLVLDGSEPFKEQDEVVGGLA
FT                   YDANIPTIIVVNKWDNIVNKNSHTMEMVKKQIRSQFKYLSWAPIVFISALDNKRIHTIF
FT                   ETIELVREQAMRKVATSLLNDVVIKANAFQEPPPFKGGRISISYVVQVQSQIPTFVLKC
FT                   NNPKFLHFSYARYIENEIRKAFGFDSVPITLYWQDKNKKLRGE"
FT   gene            474437..475534
FT                   /locus_tag="UUR10_0427"
FT   CDS_pept        474437..475534
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0427"
FT                   /product="ComEC/Rec2 family protein"
FT                   /note="identified by match to protein family HMM PF03772;
FT                   match to protein family HMM TIGR00360"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59960"
FT                   /db_xref="GOA:B5ZBN0"
FT                   /db_xref="InterPro:IPR004477"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZBN0"
FT                   /protein_id="ACI59960.1"
FT                   /translation="MINNTFKTKNYYISFLILATSIACCFYYNNFWILIVNVCQFYWLY
FT                   QIKFNYKLIILIIVFSILCFALCLLIHKNFNIHYLITNLEKECDWSLRKQIIVYLSKKY
FT                   LNKNTLMLIKLMIFNEKVSGNFKQILYDLNIAHLFIVSGLHLNIFLLIINKIFFKKWPK
FT                   ISFVIGICFLIFYGYLLEFSIGFIRVFIMHILSIKFFQKISKMDKLAISGLIIASLSIY
FT                   NLSMLSFIFAYLALFCIYLLNLFIKDNSILKNIYINLYILSITFIISINLNEKINFLSI
FT                   IFGYVMNLPILFVYQVLFWFMFIPHFEVVLDGVTNILVKAIYFINEIDANIYIKNYSEI
FT                   ITIFYTSIWLTISLWIYYKKILKKV"
FT   gene            475611..476048
FT                   /gene="mraZ"
FT                   /locus_tag="UUR10_0428"
FT   CDS_pept        475611..476048
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="mraZ"
FT                   /locus_tag="UUR10_0428"
FT                   /product="MraZ protein"
FT                   /note="identified by match to protein family HMM PF02381;
FT                   match to protein family HMM TIGR00242"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60316"
FT                   /db_xref="GOA:B5ZBN1"
FT                   /db_xref="InterPro:IPR003444"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR020603"
FT                   /db_xref="InterPro:IPR035642"
FT                   /db_xref="InterPro:IPR035644"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="InterPro:IPR038619"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5ZBN1"
FT                   /protein_id="ACI60316.1"
FT                   /translation="MFIGTYNHSIDSKNRMLIPSKVKATLNEVTFVYLSLGFDENIDMR
FT                   LESEFNQFVDNINNLPIGSREARNLTRLLLSQTYKVEIDSASRILIPQNLIDKAKIKKD
FT                   IYIIGTNDRYEIWAKEVYDDFSLNQEDTLSDLAEKLLINGI"
FT   gene            476038..476964
FT                   /gene="mraW"
FT                   /locus_tag="UUR10_0429"
FT   CDS_pept        476038..476964
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="mraW"
FT                   /locus_tag="UUR10_0429"
FT                   /product="S-adenosyl-methyltransferase MraW"
FT                   /EC_number="2.1.1.-"
FT                   /note="identified by match to protein family HMM PF01795;
FT                   match to protein family HMM TIGR00006"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60060"
FT                   /db_xref="GOA:B5ZBN2"
FT                   /db_xref="InterPro:IPR002903"
FT                   /db_xref="InterPro:IPR023397"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5ZBN2"
FT                   /protein_id="ACI60060.1"
FT                   /translation="MEFNQHTTVLLNETIELLHVKPDGIYVDCTFGRGGHSQLILKKLS
FT                   KKGKLICIDQDQQAIDFANNLFKDNPNVIVIKTNFKNLKSVLYDHQIFHVDGFVFDLGL
FT                   SSPQLDDPERGFSYHKDALLDMRMDQEQKLNAHYIVNHYSFAKLVNIFTKYGEIKYAKT
FT                   IANGIVKERSTKAINTTLELVEIIKNYSPKKILFEKKHPARLFFQAIRIEVNDELNILK
FT                   KAFNDAISMLNPLGVVAIISFHSLEDKIVKKVFNNYAKNKLPKEIPLNNYVNQYSLLNQ
FT                   KIMPSTQELNDNNRSRSSILRGLVKNY"
FT   gene            476982..478166
FT                   /locus_tag="UUR10_0430"
FT   CDS_pept        476982..478166
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0430"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59789"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZBN3"
FT                   /protein_id="ACI59789.1"
FT                   /translation="MNKPVCLLRLDNYYFTLIAFIYNDVTKANDLVFIKSLPNNNQNNY
FT                   ESSNFLQTDLKMQLNSLISCLKKELHINFIDEIIISYGFSSFQTTNTTFYNYNDFMKLE
FT                   SNFCNNDHTELLSSDQKSYVAVDFGISHYSKENSYKLISYYILKYDYQLIIDLCQSLNL
FT                   KIKQFIVSQAHLNGFEFNDHDSKASLLLEIEDYKTIFKTYNQTNLISNVISEAKNHFCL
FT                   ANVITQTAQSLNINSKKIESYFRDINYNNQKIIEINVDPKLLFTYNSICGQDLENVFLK
FT                   IFQEHFEKSLLLQFDHPLLDFNPKNLAFLFINTPFNNLNQIFHRFFSSYFKEIKVEVFQ
FT                   NKSFVSSNCYEYSTSQALAKQDFYNMHNVKNFDNFSNENILAKMYHQTVNVKNF"
FT   gene            478326..479201
FT                   /locus_tag="UUR10_0431"
FT   CDS_pept        478326..479201
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0431"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF07751"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59869"
FT                   /db_xref="InterPro:IPR011664"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZBN4"
FT                   /protein_id="ACI59869.1"
FT                   /translation="MALSKHSIGLIKNLKNKGLIIKNKEKFISFLFNYGVIRVIDGYSF
FT                   FLKKDNQYVEGLKSKDLINFVLLDRKIANLMGDCIMLFEQQLNAVVVQNFLKINNLTSK
FT                   YVIDMRADPFLKFDSPRHYEILSENIYTYANSSNLLSQFNISVQQIPLINLALSWTLNT
FT                   TIGFYRAVDANVQISVLEHFELNHITPLEFIDILHIVKHFRNSISHNDMVITNSFNDNA
FT                   SAFAKVLRLKSVKKVVGFLDVVDFLTAFTNDKFHVLNGNLRDKIMQAIKKAKFKGAVLH
FT                   HINNLLGIEG"
FT   gene            479207..483064
FT                   /locus_tag="UUR10_0432"
FT   CDS_pept        479207..483064
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0432"
FT                   /product="viral phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59904"
FT                   /db_xref="GOA:B5ZBN5"
FT                   /db_xref="InterPro:IPR025103"
FT                   /db_xref="InterPro:IPR026851"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041677"
FT                   /db_xref="InterPro:IPR041679"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZBN5"
FT                   /protein_id="ACI59904.1"
FT                   /translation="MQDEQLNNKAIKQKVLNLLSTDTRDSCIRTRLTKYHLDITNTFNK
FT                   HELQDFIEGKINVLKIKSFINTNMFENNLKKAESMDDVIDYLQDFNLKLKDLLSMRKIN
FT                   EWNQDFLLYKNERIADMIKAIESEPKKFDHLSREARSIYAQTGVWPLFIAKNFLIGPTP
FT                   KPSSLNAPLIFIDVEIKKHNDEIFLKRKNTNFIVNEKLLSFLKNDFKNNIVSLNEIKNF
FT                   NYLDIQNLIKKITLKEHLESIVDNNGFLNLKQNEIKEQFNNLFLYDAYVLGIFEPLGGA
FT                   IKNDLETIINSNIDPFDEEINNTNQQIYNKNYHHLAEENKLPLIQINRPLNIFQKYAIH
FT                   SALVKNTLIYGPPGTGKSEVIASIIANVINDLKTTLIISEKKAALDVLHERLTKISFFA
FT                   LFIYDTNNDDQFYNNIFNLIEKIGGLRFIDSQNSNQVHDFKYKNNIISNIFYKKIHELK
FT                   KEIINISSLIKNLHNEKDTNNNNFANYLYWLSRFNESEIKFINDENLINQIKNLIKTYS
FT                   YTFDEIIAHAKNSHYFFKKYNYEFSKNNLLKFKEENNQLNQLQIDFNLITKSLYQSQTF
FT                   LARINLLESFLVKNNMILTSFIYEDANLLSNAYVETNEFYVKFNYLLKDDFKKFLEENT
FT                   KTHSTFLNNLNNLKNTDWPYVFEQYLLTNNPLAKKGMFKKIKGDEKTLLKQLEVLKAYF
FT                   NNPILSKFNFLFLEDLMNQPIEIFNIENIVYLNNKQLLTKPYAKDLYENVFDKNLSYEL
FT                   ILQLKDLNLNSEQYDIINDLIQYQNEVLINYEFIKNTDFFNLCKKLRDANIQFSKNADE
FT                   IIYNNYLDYLQIKLITAPKQMQTKIKEIAQICRLTKKPNIVKFILKYYEVLRFLFPIWI
FT                   SKPELVSEMLPLINKSFDYGIFDEASQMFLERSYPSIYRCNINIVAGDDKQLCPTNFFI
FT                   NRQDSESDEFELADVDVAESLLDRAKTALWSEYLLKNHYRSNRDDLISFSNENIYNNEL
FT                   HFASKNGLFEPGIEVINVNGTFENDNSIEAQKIVEILKEQAANYKKIIVITFNIKQSEL
FT                   IENLILQTFSFNDVIYQRFENDEIIVTNLENVQGNEADLVILSVTYAKNKEGILRNNYG
FT                   PLMKKGGANRLNVAITRAADKMIVVKSIKAVDMMVNINNDNIRTFKNFIAYCDEITQLA
FT                   NQNKFQNYLSFNEEFLTSFEKIILTILKDHKKANQQILHKLKIGNFNIAFALYNLDNQK
FT                   IDLLVCLEEFNEWKSYNLLEIYDQFNFLMDRGYKTIIINDYEICLNYHQVKNNIIKLIQ
FT                   L"
FT   gene            483093..483905
FT                   /locus_tag="UUR10_0433"
FT   CDS_pept        483093..483905
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0433"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59981"
FT                   /db_xref="GOA:B5ZBN6"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZBN6"
FT                   /protein_id="ACI59981.1"
FT                   /translation="MNLRSFEFLKGNETVWDKEKKAINVSLIKASISCTIMCILIVIFG
FT                   FLMRKYLFEYSSAVSLTINSKFVFQIITGIVIVLSIIYFIVHLILYFRRRYNFFAPKIG
FT                   WSITLYILDGITMCFMISYVSAIVGLDLTLIAIGISLSIIVAMGILGFIMNHKIAFKLS
FT                   IANIVLFTIATIGSIILLIVFFTTRYNHGFNQGIIIADIVLSIIWLISLSIGFASTIYS
FT                   MRIMAEHHNLENHKIMRDFTTWNSYLLFASFNRILLYVIRLIALFKRV"
FT   gene            484028..486142
FT                   /locus_tag="UUR10_0434"
FT   CDS_pept        484028..486142
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0434"
FT                   /product="chaperone protein ClpB"
FT                   /note="identified by match to protein family HMM PF00004;
FT                   match to protein family HMM PF07724; match to protein
FT                   family HMM PF07728"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60327"
FT                   /db_xref="GOA:B5ZBN7"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028299"
FT                   /db_xref="InterPro:IPR041546"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZBN7"
FT                   /protein_id="ACI60327.1"
FT                   /translation="MEFKQKNTSNPLEEFGRNLNQEILDNKIDPIIGRDEEIRRTIEIL
FT                   SRKTKNNPVLIGEPGVGKTAIVEGLAYRIVHKDVPSNLLDKTIIELSLSSLIAGASYQG
FT                   QFEERINAILKEVKKSNGNIILFIDEIHQIVGMGRNQGSNMDVANILKPMMARGEIKLI
FT                   GATTLDEYRLYIEKDQALERRFTKVLVNKPTIQETLTIMRGLKPRWEAFHGIKIHDNAL
FT                   IAAVNLSERYINDRNLPDKAIDLIDEAAAKIKTQINSQPIYLDEIKRDLQHLQTEKAAL
FT                   ESEKDEKSIKRLNDILEKIKLKQDEFNNLNDIYLKEKKQIDDLKNLRQKIERIQHDIEF
FT                   YQSEGKYEKASRLLYSDLPALEKQRGELENKINENSSQKMIVDSLTENEIADVIARATG
FT                   IPLNHLLADEKTKLLSLNKRIAAHVIGQDEAVKLISDAVIRGRAGINNPNQPIGSFLFL
FT                   GPTGVGKTELAKTLAKELFDSQKALIRFDMSEYMEKHSVSKLVGAPPGYVGYENAGLLT
FT                   ESVKRKPYSILLFDEIEKAHPDVLNILLQILDEGSVKDAKNNEINFKNTIIIMTSNVGA
FT                   EALLENNKTNALMELQKTFKPEILNRISEIIFFNKLSKEVIFKISENLLKELSDLLAKQ
FT                   DYSIKFNDNIAKIMVDEAYSSNYGARPLKRWITKHLENEIAKLIIENRITKNRNYEINY
FT                   DREADQVLIK"
FT   gene            486295..488079
FT                   /locus_tag="UUR10_0435"
FT   CDS_pept        486295..488079
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0435"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60248"
FT                   /db_xref="GOA:B5ZBN8"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZBN8"
FT                   /protein_id="ACI60248.1"
FT                   /translation="MLKNHFHSSWLYTTFLSRLVLFKKSTYFLVGISLFINLIFIIINA
FT                   LNIANDKQNYLILFYVFISINLVLTIIFSTIKAINLFKDLKDDGIEILVFSKSISRKNI
FT                   IFTKIGFLVLNCVLWSLITYIFNIIFYVVNTKNNNDINLFYLYAFFNYYFCALIFGSIA
FT                   ALIVSRWSNKIAMIVPISCFLPFLVAGGVANLYSTSKINQVAKYMNINYDKYDSNTILD
FT                   VEKFYLNNKSDEVYLITKNLNNPRFSQRQNEFLKTAFNQAKNASKPFQILSWLSIPYQL
FT                   NNSFYKNDLDPFNINNHQQNHLNQYFNYHGLESKLYDYELNKNPNLPQFNINENQKQYF
FT                   VPGALKNVSQFSTLENRNLIYARENVDRFDVNFLEDDNLFSSTNNFIGELKWEVIKNTL
FT                   ESKVFNNFAKKFYDNFDQDIEKPQIITAYNDVINEQSLINFSTIIDESSILFAKKIDNH
FT                   YVKNLVEKKIYFIVALMYYLYFNKNYWHLLEKLLKNNKVINFYRPSPIRINVNNYAYNI
FT                   GGIASYELMKKVVNNKTLYRYQLQKSNNYVFQTAQEVYSIKRSKQIVNKNYYWLIWIIF
FT                   SMILIICLALVYLKRDYK"
FT   gene            complement(488087..488443)
FT                   /gene="acpS"
FT                   /locus_tag="UUR10_0436"
FT   CDS_pept        complement(488087..488443)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="acpS"
FT                   /locus_tag="UUR10_0436"
FT                   /product="holo-(acyl-carrier-protein) synthase"
FT                   /EC_number="2.7.8.7"
FT                   /note="identified by match to protein family HMM PF01648;
FT                   match to protein family HMM TIGR00556"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59896"
FT                   /db_xref="GOA:B5ZBN9"
FT                   /db_xref="InterPro:IPR008278"
FT                   /db_xref="InterPro:IPR037143"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZBN9"
FT                   /protein_id="ACI59896.1"
FT                   /translation="MKLVHGIDIIEWNREELNNPSFAKRILVDDELKYYLQLNSLKEKN
FT                   RYLASIFASKEAVMKAFKLKYGYNDILILKTKNERQVYLNKILIKELVLSISYTENYVV
FT                   ASVVGLINTVESNS"
FT   gene            complement(488447..488746)
FT                   /locus_tag="UUR10_0437"
FT   CDS_pept        complement(488447..488746)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0437"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60106"
FT                   /db_xref="InterPro:IPR007793"
FT                   /db_xref="InterPro:IPR019933"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZBP0"
FT                   /protein_id="ACI60106.1"
FT                   /translation="MININKINEYKNKKFIANKVGYDPESVDVFLDELINELETFVDEH
FT                   KNLLTKIQELSEYKIKFEKEQEYTTSLNNFIDLLEKVVDKKSTFDVWEKRPVRK"
FT   gene            complement(488791..489015)
FT                   /locus_tag="UUR10_0438"
FT   CDS_pept        complement(488791..489015)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0438"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60013"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZBP1"
FT                   /protein_id="ACI60013.1"
FT                   /translation="MPLITGALGIWNKVLFGTIIANTAISVIGGITNIAMAASTLPKQE
FT                   SETIETIDVDMTTMVGAKTPYANIYYLGS"
FT   gene            complement(489059..489337)
FT                   /locus_tag="UUR10_0439"
FT   CDS_pept        complement(489059..489337)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0439"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59936"
FT                   /db_xref="GOA:B5ZBP2"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZBP2"
FT                   /protein_id="ACI59936.1"
FT                   /translation="MQKMSNNFKQEYYGGFAASNSFNYMWNNALISSMLGQTVVGFFGM
FT                   ISQLVYAFNPQPRFHAHQMVDNSAARTYARIAQKPMNSTISLGSPFF"
FT   gene            complement(489391..490344)
FT                   /gene="rnhC"
FT                   /locus_tag="UUR10_0440"
FT   CDS_pept        complement(489391..490344)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="rnhC"
FT                   /locus_tag="UUR10_0440"
FT                   /product="ribonuclease HIII"
FT                   /EC_number="3.1.26.-"
FT                   /note="identified by match to protein family HMM PF01351"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59840"
FT                   /db_xref="GOA:B5ZBP3"
FT                   /db_xref="InterPro:IPR001352"
FT                   /db_xref="InterPro:IPR004641"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR024567"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZBP3"
FT                   /protein_id="ACI59840.1"
FT                   /translation="MTIVSIKLTSNQVDQLLELWKTYLVPNHHYYAKYTFNIQNTQIII
FT                   YTTNTCTINTHDLELFLNTFLKKEDLNLFNYIKQQLNTTKNSKQKVLSEREIYQNNQII
FT                   IGSDEVGVGDLFGGIVVCAVSLKQSDLKFLAHLNIVDSKKLSDHQMQEIYEKIKNQISY
FT                   TVLSYNPKEYNELINQYNNAHVLKTILHYKAVQSEIVKHQNYSIFSVVDAFSSLKNWNQ
FT                   YLQKAHLKPYEPNLLIPKAESSYTSVALASIIARVMFLKMIAIIEQELKIKIPLGSSNL
FT                   LVNTTAMSIFKKFGIKILKQIAKEHFANFQEIIKNN"
FT   gene            490449..491054
FT                   /locus_tag="UUR10_0441"
FT   CDS_pept        490449..491054
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0441"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60234"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZBP4"
FT                   /protein_id="ACI60234.1"
FT                   /translation="MKFKRFDSKKSILRFLHVDEAKREINLSFNDTTDFIFFLKEIAED
FT                   PNIAKKNAKKMTNLYVEISDKLGNDDNTDLSAYETKCNNLIEACVIDEAIFLIYMAKNM
FT                   IIFLAHNKLDILQKDFFDKLLLIESHFSFDQNLSYSYIKNSSIALLIFHLKQFVAVYDE
FT                   FLNDFEKVINDVLENAIPTKTKLNQQINHLHTLKRRPS"
FT   gene            complement(491153..492199)
FT                   /locus_tag="UUR10_0442"
FT   CDS_pept        complement(491153..492199)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0442"
FT                   /product="hemin permease"
FT                   /note="identified by match to protein family HMM PF01032"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60342"
FT                   /db_xref="GOA:B5ZBP5"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZBP5"
FT                   /protein_id="ACI60342.1"
FT                   /translation="MKTKFNFFKNKQNVIGQKQLLELNKKSFVPYRFKPLLTTMILLIT
FT                   LLIIIILIFSVTLANDLNFSELAKIIWQEVVQMIITGAALGVSSYVLQRITRNRFADVS
FT                   IMGIGTINLILLCALSIPIDFTSANELNILQKKEPWIFMSMSCCLMIVYFIVSRQKENF
FT                   NYKKLILIGVILTFFLVAIAQSIRGWLNYHANDYVIGHIVGSVQKAPLNTLIIASSFVI
FT                   LGLLWLLFNSYKLNIISTNQQVAKQLGIKINFQIFVALVFVGIMVGASYSVSGDFVYVG
FT                   LLAGNAAMRKRNNSFSYGILNSGLYGILSTLITYWIGISLIGMDVHHIGAILPLLIGPY
FT                   FIYKVLRS"
FT   gene            complement(492209..493090)
FT                   /locus_tag="UUR10_0443"
FT   CDS_pept        complement(492209..493090)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0443"
FT                   /product="ferrichrome ABC transporter"
FT                   /note="identified by match to protein family HMM PF01032"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60321"
FT                   /db_xref="GOA:B5ZBP6"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZBP6"
FT                   /protein_id="ACI60321.1"
FT                   /translation="MDFKTIGEEISEGSSSYTRKFIGTPIAIFLSALALSFSGYSMQVV
FT                   SRNPLASPTTLGYLPAAILGLAISKLAINHVLYLPFIIGIVFASCLIVINFFLVKGNAL
FT                   EASFKPILVGFAIGGIITGINVLLEDFAKDIHIKITGFVEPPINFQWQHLYVGGPLIII
FT                   SGLANLFMAPYYTIISKDYLLAKSLGIKVDLVFWLTAFFAIVSTVSSIILVGVLTLLGM
FT                   IAPHVARILNPKGNSFQQLLLSFMISLLLLTSSRWLISVYNQFDINFFSAIAALPVFAY
FT                   IFVSKQYRKNVE"
FT   gene            complement(493244..494692)
FT                   /locus_tag="UUR10_0444"
FT   CDS_pept        complement(493244..494692)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0444"
FT                   /product="putative ABC substrate-binding protein-iron"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59850"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZBP7"
FT                   /protein_id="ACI59850.1"
FT                   /translation="MFKKKLNKKSLIALFMGVSTIFVSTIAVATACSKTNNDNNDIKKE
FT                   GKTTINKLITKSTQKQSAIEVSEKYELSESNENSQFFNTLTDPYKAFEMFAKSLDEAGY
FT                   EITSHEPLKNSGKSSFLEYAKDINAKVREYVRKVANLPTIKKLRDNNTTVLWAESTQEF
FT                   DSSDKSKLDLYYFQQQDLFPLLYSQPDDANVPGLGLRFPKPKNHKADKYFDNWHGIGAA
FT                   QNNASKNDFDWMLSMQEAFYRTADYVFYNYDSNKLAGETTKSQFESFFKSTVNNDKIIP
FT                   VDFQIEYSSIWGPIGTVRLIQSFAKKLGVSDSELATVKLDWTLPTKQTLKHIRPKNNKD
FT                   EKYQNFGIFFYNLWDHCVALGIQPDYSSFTNKQGKTYPKVPGFLVDLVDDTKTKFEEFS
FT                   GKTQNLAGMKLYALAGNNSHINRSFKESIGEGKEILKRVETERGDTNRSRSQTDFKFYD
FT                   RETNKLHSVNGKQVLNWVDPTTKK"
FT   gene            complement(494815..495957)
FT                   /gene="trmU"
FT                   /locus_tag="UUR10_0445"
FT   CDS_pept        complement(494815..495957)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="trmU"
FT                   /locus_tag="UUR10_0445"
FT                   /product="tRNA
FT                   (5-methylaminomethyl-2-thiouridylate)-methyltransferase"
FT                   /EC_number="2.1.1.61"
FT                   /note="identified by match to protein family HMM PF03054;
FT                   match to protein family HMM TIGR00420"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60205"
FT                   /db_xref="GOA:B5ZBP8"
FT                   /db_xref="InterPro:IPR004506"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR023382"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5ZBP8"
FT                   /protein_id="ACI60205.1"
FT                   /translation="MEVNTKKRVVIGLSGGVDSSVSALLLKQQGYEVIGLFMANWDTVA
FT                   NFENNRESDKKHQGCESELDYQDAQAVAQKIGIPLYRVEFIKEYWNNVFEYFLSEYQKN
FT                   RTPNPDILCNQFIKFDSFLNYAKNELKADYIAMGHYAKVKHTNNLSYLLKATDVNKDQT
FT                   YFLCNLKQTQLQNALFPIGDLTKQQVRTIAKEYGLVTANKKDSTGICFIGERNFKYFLE
FT                   NYIPNQPGEIVNIVNNQIVGHHMGTMYYTIGQRKGLNLGGMNERMFVCEKDINKKIIYV
FT                   SPLSLEDQYLISNQALVENMNFIEPYNPQIPISVRFRHRQNLVVVNSFLCIENTNNVLI
FT                   NYEPAKAITPGQYAVFYQNDHCIGGGVIAQTNANHKKINF"
FT   gene            496071..496967
FT                   /locus_tag="UUR10_0446"
FT   CDS_pept        496071..496967
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0446"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60163"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZBP9"
FT                   /protein_id="ACI60163.1"
FT                   /translation="MKKAILISIASLVGVSAIVATSTFLSLSAKTDVYAKSIQASSVNQ
FT                   SLNYTNLSNANVGIKEMLLGTKKINNGNYVLYIGTQSNLDNLDFVYSNQANHINSVNDL
FT                   QYNDNLNFNGSLSKTINNVKNYADKDIYEHVPQFYSFIDLINSDVFKQKQEYENLIKQN
FT                   KSSTIKEDQNWANNAPAEYSFDVNKKYKDKNGKEVYFRNDAQAIKFREILNFLKTYLSK
FT                   EKLVELSATKTPGIVLFYSQDNLSKGPRVYASSKTYDQSKNERKESYPSGNNVYNSAQP
FT                   EFGGDLNAAIYSIYGKK"
FT   gene            complement(497174..497971)
FT                   /locus_tag="UUR10_0447"
FT   CDS_pept        complement(497174..497971)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0447"
FT                   /product="integrase-recombinase protein"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60055"
FT                   /db_xref="GOA:B5ZBQ0"
FT                   /db_xref="InterPro:IPR001207"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZBQ0"
FT                   /protein_id="ACI60055.1"
FT                   /translation="MDKKNIFTILEKLIKKYEYLYKPILDDYISNFTRTFLEYILTIEM
FT                   KYHLNYERFERYLSNSSRNYRNGFSKKQLHMNDLKILVNIPRDRNGAFESKIISKYQVD
FT                   ISRFEYRLLSLGINNLQLNEYEKILEDFYDIYNDKTIDKLRNEIALKVYDYLENKKQEL
FT                   NNIDVDQIFIDGFSLSTNRYLTIVITKSLDKQLTILGFWVINNLQNKWWNDIIAKIAMH
FT                   HPQVISYKILFKNDDELLMSLKNHSSNDFERARFIFINKRILK"
FT   gene            complement(498058..498816)
FT                   /locus_tag="UUR10_0448"
FT   CDS_pept        complement(498058..498816)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0448"
FT                   /product="putative membrane protein"
FT                   /note="identified by match to protein family HMM PF02660;
FT                   match to protein family HMM TIGR00023"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60138"
FT                   /db_xref="GOA:B5ZBQ1"
FT                   /db_xref="InterPro:IPR003811"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5ZBQ1"
FT                   /protein_id="ACI60138.1"
FT                   /translation="MDQVYSVAMAYILTLIISPLYSYLIGSLNASIILSLLLKKQDIRH
FT                   FASKNAGMTNMTRVYGKKLGILTLFLDIVKPIITISLTYIIYKYALNAPFVLSNGFNQA
FT                   ILVYFGGIFTIIGHCYPIFFKFQGGKGVASYGGFLITIDPIVAVIGIITLLIILLITKY
FT                   MSLSAMITATITCFLVLIPGINYIPYYNEHFVEYLFDLNHVIKGTWYVWLFLLISASIL
FT                   IYRHKTNILSIATKQERKTFLFQPKPKNNI"
FT   gene            499027..500223
FT                   /locus_tag="UUR10_0449"
FT   CDS_pept        499027..500223
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0449"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59855"
FT                   /db_xref="GOA:B5ZBQ2"
FT                   /db_xref="InterPro:IPR011631"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZBQ2"
FT                   /protein_id="ACI59855.1"
FT                   /translation="MINNKKFVNKTLDNANQIRIQNNLKTYAPKFLNLIILNNLFLLIM
FT                   IVSLCIFFSDPRFLYRNDVISNQYRQFIFTYQQTSIAITLYTLAWYIMVNFFFFGYILE
FT                   YVKLNKLETFNFAVASILFNPYAYVIIAKNWTSWTYYWQRSLYHILSENNKIEFNIKDS
FT                   RSIFALIFLIIAIPFIVFSSIDYVPKNPGRLIIFDKNSMGTEIIYTNNIWFHNMHYFTS
FT                   QGNWMCIGMAFLYFINPKARFVKNNRVLLIVLSYILIVSSIWLFVLFPVFSQRSTWVWF
FT                   NNMVGFYNHLVTPVTFTIFAYYCIVKNKYVIHLKYFYAWKGFMFYVVIYAIYAMFLPLL
FT                   ANVTVYGAITNIWPSANGNPIFTTMLFALIGYEILIFTINWMILKFINKRKKAKILIN"
FT   gene            complement(500308..500964)
FT                   /gene="grpE"
FT                   /locus_tag="UUR10_0450"
FT   CDS_pept        complement(500308..500964)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="grpE"
FT                   /locus_tag="UUR10_0450"
FT                   /product="co-chaperone GrpE"
FT                   /note="identified by match to protein family HMM PF01025"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59925"
FT                   /db_xref="GOA:B5ZBQ3"
FT                   /db_xref="InterPro:IPR000740"
FT                   /db_xref="InterPro:IPR009012"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZBQ3"
FT                   /protein_id="ACI59925.1"
FT                   /translation="MSKNNENIKHQNEGKLHDQVDKKETKNHAKQEFKYKELYEHELKK
FT                   NKELQNVNELLINKNQQLEIQINQLNQDFVKQLETKTKQAQEILEQKVNELEARHETKV
FT                   NDAVFKIFKFKMEPLLDAINHFTKIVNQNYDDPKIQAFIEGFKMFSQNMIDGLENLKIT
FT                   KISPQINDMLNDDTMEVFEVVQNTNKPSMHVTEVISDGFKYNDKVIKFAVVKVAK"
FT   gene            complement(500964..502091)
FT                   /gene="dnaJ"
FT                   /locus_tag="UUR10_0451"
FT   CDS_pept        complement(500964..502091)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="dnaJ"
FT                   /locus_tag="UUR10_0451"
FT                   /product="chaperone protein DnaJ"
FT                   /note="identified by match to protein family HMM PF00226;
FT                   match to protein family HMM PF00684; match to protein
FT                   family HMM PF01556; match to protein family HMM TIGR02349"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60290"
FT                   /db_xref="GOA:B5ZBQ4"
FT                   /db_xref="InterPro:IPR001305"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR002939"
FT                   /db_xref="InterPro:IPR008971"
FT                   /db_xref="InterPro:IPR012724"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="InterPro:IPR036410"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZBQ4"
FT                   /protein_id="ACI60290.1"
FT                   /translation="MAKRDYYEVLGVSKSASPEEIKTAFRKLAKEHHPDRNKSADDTVF
FT                   KEINEAYEVLSDPKKRAQYDQFGHDGPQGFAGAGGFSGFSDGFGGVDFDINDIFGSFFK
FT                   NGASSRSSSSQYETYDIHLRLHLEFIEAIKGVSKNISYDRKITCNKCQGTGAKDPKDVK
FT                   TCTKCHGRGTTIENVHSLFGTIQQEVECHECEGTGKVANSKCEQCYGKKVINERVNLTV
FT                   EIPAGTQDNEKLVVSKKGNIINNQEFDLYLHISVKPSKYFAFDGLDIYSETYVDPIKAI
FT                   VGGVIEVVTTSGIKTIEIPPNTPEGKKFRISGAGIVNKKPNIFSKKNGDFYTTIRYAKP
FT                   LELTKEEIAYLKNISARTNQSVEYYKNKLLKEVNK"
FT   gene            complement(502224..502694)
FT                   /locus_tag="UUR10_0452"
FT   CDS_pept        complement(502224..502694)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0452"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59726"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZBQ5"
FT                   /protein_id="ACI59726.1"
FT                   /translation="MSKIIDNIDTKALRIDHYEEWEQNHIIKVINAYRHHESKKEKFKM
FT                   IHELIKNHQMHLTKLIPLFDVSISGYYKWLEDLKIDQVCPIKKRNMDLIEKICKSHKHY
FT                   VGCRKIQKILETQYNVKLNYKTINLYMNKMDLCKPCHHDYDAHRHEHCENEE"
FT   gene            complement(502675..503595)
FT                   /locus_tag="UUR10_0453"
FT   CDS_pept        complement(502675..503595)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0453"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60297"
FT                   /db_xref="GOA:B5ZBQ6"
FT                   /db_xref="InterPro:IPR035319"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZBQ6"
FT                   /protein_id="ACI60297.1"
FT                   /translation="MSTNYFLIAITILTIICIGLGNFFIKPVQTQKINWWTWNHFINTK
FT                   WIINILISISFLIYFCCLRWAPGAKDFFSNEMEIIKTLNDKYANYINSYEASITFSRTF
FT                   LLDWCPCFSVLISIVAIFDKKQIIVNYLGFLCFCFGLLTIVGGLVGDEAIGWENLINYV
FT                   FIGKSPNTIYFALHFYLCVFGFYLFVNTRKTIKIYWIYIIIHTILIGYIIYVNVMIVIF
FT                   NVKNNASGFSFGDWYSPVYAQYSTVAQVLQLDYRLNALVMCLFMYAIFVVGYLIRYYLQ
FT                   KVYINKYNIKYSQEGSYFAYVKNHR"
FT   gene            503745..506447
FT                   /gene="ileS"
FT                   /locus_tag="UUR10_0454"
FT   CDS_pept        503745..506447
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="ileS"
FT                   /locus_tag="UUR10_0454"
FT                   /product="isoleucyl-tRNA synthetase"
FT                   /EC_number="6.1.1.5"
FT                   /note="identified by match to protein family HMM PF00133;
FT                   match to protein family HMM PF06827; match to protein
FT                   family HMM PF08264; match to protein family HMM PF09334;
FT                   match to protein family HMM TIGR00392"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60184"
FT                   /db_xref="GOA:B5ZBQ7"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002301"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR023585"
FT                   /db_xref="InterPro:IPR033708"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZBQ7"
FT                   /protein_id="ACI60184.1"
FT                   /translation="MKDYKSTLNMPSTAFEMRANLNIKEPKIQQFWIEHGIYEKLLAKN
FT                   KDKKPFVLHDGPPYANGNIHIGHALNKILKDFVVSYHNMNNYYSPYIPGWDTHGLPIEV
FT                   ALSKKVKLSNLSVNERREQCKKYALEQVDNQIQQFLRLGMVSDFKQRYLTLDHSYEIDQ
FT                   LKLFANMLKKGFIYQDFKPVFWSWSSQTALAESEIEYGDRQSPAIYVKMQVVDSSELFN
FT                   DKPTSFVIWTTTPWTLPANLAIAIHPELTYSLIEYKNENYVIAKSLVESFTKKVGFEDY
FT                   KLIKDFKASALEKIKYISPITKKHAFIIMDEYVSANDGTGLVHNAPAFGLEDYYACKKY
FT                   GIETEVIIDQFGKYNALVNDSELENMFYEDANQVILDRLICNQLLIHHELITHSVAHDW
FT                   RTKKPVMYRATKQWFVSIEKILPNILQTLKNDVKSTSFRGIERMHEMIVNRKEWCISRQ
FT                   RVWGVPIPMIFDENHEAIMDPDLVENIINVLNEKGVNAWFDLDVNAFLTPKYLSMKNKT
FT                   FYKEKDIMDVWFDSGSSYNVLQHYNLPYPADVYLEGYDQYRGWFNSSLITGTILNNKAP
FT                   YKYLVAHGMVLDGEGYKMSKSKGNVVDPLDVCKVYGADVLRLWIANSDYQNDTRISEEI
FT                   LKQNAEIYRRIRNTLFKYSLSILNDFEPSVDFSFDVRQEDQFVLNEFNELHLKVIKAYE
FT                   SFDYQTIVKLFNKFILDLSSWYFENIKDDMYCLAVDDPIRKQIQSTVYWILKNSLIDLT
FT                   PIIPHTTEEAYSFLNDANKKESIRLEDFYDQSQFQFKKGIAHVKAFFSIKDEIFNELEN
FT                   ARKNNVLKKNNEALVTIAKNLILDDYLLNNPKLLAKWFGVAKIEFTNTTSVVNANFKKC
FT                   LRCWNHFADDEMYDDELSMNCYKVINKIK"
FT   gene            506451..507413
FT                   /locus_tag="UUR10_0455"
FT   CDS_pept        506451..507413
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0455"
FT                   /product="O-silalo-glycoprotein endopeptidase"
FT                   /note="identified by match to protein family HMM PF00814;
FT                   match to protein family HMM TIGR00329"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59990"
FT                   /db_xref="GOA:B5ZBQ8"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR017861"
FT                   /db_xref="InterPro:IPR022450"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5ZBQ8"
FT                   /protein_id="ACI59990.1"
FT                   /translation="MEEKYLILSIESSCDETSLALFENNKLIAHKISSSASAQAFHGGV
FT                   VPELASRYHEHNINRLFVDILNETKIDPLTITHVAYTAMPGLPGCLHVGKVFAKQLASL
FT                   INAELVPINHLHAHVFSASIDQELVFPFLGLVVSGGESCLYLVSDYDQIKILNQTQDDA
FT                   IGECYDKVARILGWNYPGGPIIDKNYQEDLATLEFIKSQPAAKNFSFSGLKTAVINYVH
FT                   NSKQKKLDFDPIVIASSFQKFAINEVIKKVKYYLDLYQLKRLAIGGGVSANSLLRKKIR
FT                   DLNVISYIPQMIYTGDNAAMIGAYAYALIKNHKKSILIK"
FT   gene            507434..508564
FT                   /gene="metK"
FT                   /locus_tag="UUR10_0456"
FT   CDS_pept        507434..508564
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="metK"
FT                   /locus_tag="UUR10_0456"
FT                   /product="methionine adenosyltransferase"
FT                   /EC_number="2.5.1.6"
FT                   /note="identified by match to protein family HMM PF00438;
FT                   match to protein family HMM PF02772; match to protein
FT                   family HMM PF02773; match to protein family HMM TIGR01034"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60079"
FT                   /db_xref="GOA:B5ZBQ9"
FT                   /db_xref="InterPro:IPR002133"
FT                   /db_xref="InterPro:IPR022628"
FT                   /db_xref="InterPro:IPR022629"
FT                   /db_xref="InterPro:IPR022630"
FT                   /db_xref="InterPro:IPR022631"
FT                   /db_xref="InterPro:IPR022636"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZBQ9"
FT                   /protein_id="ACI60079.1"
FT                   /translation="MQYKKIITSESVGAGHPDKICDQISDAILDECLSQDQNSRVACEV
FT                   LACNRLIVIAGEITTHAYVDVVKTAWEIIKPLGYDENDFTIISNVNKQSVDIAQSVDKT
FT                   NKNLIGAGDQGIVFGYACDETPQYMPLTSVLAHELLKEIERQRRSKEFIKIQADMKSQV
FT                   SIDYSNSTPLIETMLVSIQHDEDYDVEYFNKKVSAIMEQIAKKYNLNTNFKKIINSSGR
FT                   FVIGGPIGDTGLTGRKIIVDTYGGVGHHGGGAFSGKDPTKVDRSASYFARWIAKNVVAA
FT                   KLAKQCEIQLAFAIGQPQPVAMYVNTFNTNLIDETKIFEAIKKSFNFDIKTFINDLNLW
FT                   TTKYLPVATYGHFGRDDLDLSWEKLNKVEDLIKNSK"
FT   gene            complement(508614..508697)
FT                   /locus_tag="UUR10_0457"
FT   tRNA            complement(508614..508697)
FT                   /locus_tag="UUR10_0457"
FT                   /product="tRNA-Leu"
FT   gene            complement(508759..509592)
FT                   /gene="mutM"
FT                   /locus_tag="UUR10_0458"
FT   CDS_pept        complement(508759..509592)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="mutM"
FT                   /locus_tag="UUR10_0458"
FT                   /product="formamidopyrimidine-DNA glycosylase"
FT                   /EC_number="3.2.2.23"
FT                   /note="identified by match to protein family HMM PF01149;
FT                   match to protein family HMM PF06827; match to protein
FT                   family HMM PF06831; match to protein family HMM TIGR00577"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60042"
FT                   /db_xref="GOA:B5ZBR0"
FT                   /db_xref="InterPro:IPR000214"
FT                   /db_xref="InterPro:IPR010663"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR012319"
FT                   /db_xref="InterPro:IPR015886"
FT                   /db_xref="InterPro:IPR015887"
FT                   /db_xref="InterPro:IPR020629"
FT                   /db_xref="InterPro:IPR035937"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZBR0"
FT                   /protein_id="ACI60042.1"
FT                   /translation="MPELPEVQTIVDYLNLNVLNLLIKKVIVHLPKILKNKTPAEFENL
FT                   LVNHKITNIKRLGKYLLFFLDNNLVLSVHLRMEGKFYYQPKDEWFNLAHTHIIIEFENG
FT                   MQLRYNDTRQFGTFHIYEQESFLDSKELKKIALDPLDANFTPQYLYEKLKKSNKAIKTA
FT                   LLDQSNVSGIGNIYADEILFATKIFPTTLAKDLTIKDYENIAKEAKRILLLSIQNKGTT
FT                   IHTYKFGNDETGMFQKMLLVHTHAKKPCQTCGTIIQKTKVNGRGTYYCSNCQNQK"
FT   gene            complement(509629..510498)
FT                   /gene="exo"
FT                   /locus_tag="UUR10_0459"
FT   CDS_pept        complement(509629..510498)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="exo"
FT                   /locus_tag="UUR10_0459"
FT                   /product="Exo"
FT                   /note="identified by match to protein family HMM PF01367;
FT                   match to protein family HMM PF02739"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59777"
FT                   /db_xref="GOA:B5ZBR1"
FT                   /db_xref="InterPro:IPR002421"
FT                   /db_xref="InterPro:IPR008918"
FT                   /db_xref="InterPro:IPR020045"
FT                   /db_xref="InterPro:IPR020046"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="InterPro:IPR036279"
FT                   /db_xref="InterPro:IPR038969"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZBR1"
FT                   /protein_id="ACI59777.1"
FT                   /translation="MKKAIVIDGNSLIYRAFHATYKQAEWAVENQLMPTNAIKLVASMI
FT                   FKILNEDQFSYALIALDASKKTFRAQEYAAYKATRKPMDEKLVVQLPYIKKLFTAMGFH
FT                   IISQPGIEADDFVGSFSNLMSKSNIDTIIYSTDRDMLQLINPNTKLKLLKTGTSIVQEI
FT                   NLANFALLNNGLLPKQIIDYKGLVGDSSDNLVGVKGIGPKTAINLILKYTNLENIYANL
FT                   EEITPSVKNKLIEHEKMAFLSKKIATIQTDLLLDETLENFILKPYNIQELDTLFESLKI
FT                   NNMHNYYK"
FT   gene            complement(510502..513411)
FT                   /locus_tag="UUR10_0460"
FT   CDS_pept        complement(510502..513411)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0460"
FT                   /product="DNA polymerase III subunit alpha"
FT                   /EC_number="2.7.7.7"
FT                   /note="identified by match to protein family HMM PF02811;
FT                   match to protein family HMM PF07733; match to protein
FT                   family HMM TIGR00594"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59802"
FT                   /db_xref="GOA:B5ZBR2"
FT                   /db_xref="InterPro:IPR003141"
FT                   /db_xref="InterPro:IPR004013"
FT                   /db_xref="InterPro:IPR004805"
FT                   /db_xref="InterPro:IPR011708"
FT                   /db_xref="InterPro:IPR016195"
FT                   /db_xref="InterPro:IPR029460"
FT                   /db_xref="InterPro:IPR040982"
FT                   /db_xref="InterPro:IPR041931"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZBR2"
FT                   /protein_id="ACI59802.1"
FT                   /translation="MFINLNVHSYYSLLNSALSIDDLIQHALDNNQPYVCLTDLNNMYG
FT                   CIEFYDKAKAHNLIPIIGLEFEYQNTTLVAYAKNYNGYLKLIKWSSWIMTNTTFIIQED
FT                   FDDLIIVCKKGGLVFENPNFYQAQNQNASNAIALQSVFYAQENDKTVFLAMLAIKNDLK
FT                   LDDFIDCHEFDKNYFLNDHEAQSLFSTIALDNLNKVLNELQVEIHDLPINIPVYDKNNL
FT                   TVSSEILKQLCISGLKQRLNAHDGQVKKVYAKRLKYELDVISEKQFDDYFLIVYDFINY
FT                   AKSNGIIVGPGRGSAAGSLVAYCLYITDIDPIKHNLIFERFLNPTRKSMPDIDTDIMDE
FT                   KRDQVIEYLFEKYGNDHVAYIVTFQRLKAKMALRDVGRILGIDLKVIDKICKNIKTDYD
FT                   EDIDLAIKKSATLKEMYVLHKELFEISKKLIHAPRQIGTHAAGIILSNSSITNIIPIQL
FT                   GINDRPLSQYSMEYLERFGLIKMDLLGLKNLTIIDNVLKMIYKTQNKKIDLFNIDYNDK
FT                   FVFQDLAKAKTNGIFQLESPGMKKVLLKVKPQNIEDISIVSALFRPGPQQNIKTFVERR
FT                   FKREEFSYWNEQTKKILEPTYGIIIYQEQVIELVKTIANFDIATSDNFRRAISKKDEKI
FT                   LMQLKDDFINGALANNYKQPLVNQIFEYIFSFAHYGFNHSHSLAYSYISYWLAYLKHYY
FT                   PLEFLSVLLSHTSASKEKLLSYLDETKDFNISIKGPDIQHFSNDFVIDNHKQIIRFGFK
FT                   TIKGFGDELLKKIKLALENAELSDYISYIDALKKGNISLKNIEILIRIGAFDSFEINRL
FT                   FLLNNLEEIFEKTGLNGHFFDLNLVGLDYANDMSINERFQEDEIQYLGINLSSLNYTNY
FT                   TNEIDYSNLKYEIESFNEINTNYEVNIVAQVLNIVQSKTKKGNDIFYLDVLVENKKEKL
FT                   TIFQNSKHLVDEIDINGIYVFGVKLLNHFNFIVSVKQRV"
FT   gene            complement(513411..513623)
FT                   /locus_tag="UUR10_0461"
FT   CDS_pept        complement(513411..513623)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0461"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60240"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZBR3"
FT                   /protein_id="ACI60240.1"
FT                   /translation="MSDKKSDFEKLFERSKVQETSIFDINDIDEQKPYEQHSIEELSYI
FT                   LEYEKIDKKTREKIKKIIKEKQRNL"
FT   gene            complement(513710..514675)
FT                   /locus_tag="UUR10_0462"
FT   CDS_pept        complement(513710..514675)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0462"
FT                   /product="DHH family protein"
FT                   /note="identified by match to protein family HMM PF01368;
FT                   match to protein family HMM PF02272"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60339"
FT                   /db_xref="GOA:B5ZBR4"
FT                   /db_xref="InterPro:IPR001667"
FT                   /db_xref="InterPro:IPR003156"
FT                   /db_xref="InterPro:IPR038763"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZBR4"
FT                   /protein_id="ACI60339.1"
FT                   /translation="MQKDLLNKLIEQTYGFSKISIFVHTNPDCDALGSAFALARILKLN
FT                   TFGTRVKIVGINTLNPNDFKNFFTFDKNEVEDEFIEGSLAFIVDTANQERVLSQKHTLA
FT                   KKTILVDHHVKTVSYTDLTYINDQSIATCEMLAYSLMHTNLNFDVKTLNYLLLGLTTDS
FT                   NRLMYDKVSDITYEIMAWFFKNNVKHYQIYQQLYERNLDDILFDNELIKTIKTHKQIAY
FT                   LNIDKSWNQKYNFTRWGDKVYLLSNIKNYPIWFVVYFDETTNTYKVSLRSNKYKVRLVA
FT                   NQFNGGGHDLAAGCSLANIDQLNDLLKALELLIKNQEVVD"
FT   gene            complement(514686..515864)
FT                   /gene="thiI"
FT                   /locus_tag="UUR10_0463"
FT   CDS_pept        complement(514686..515864)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="thiI"
FT                   /locus_tag="UUR10_0463"
FT                   /product="thiamine biosynthesis/tRNA modification protein
FT                   ThiI"
FT                   /note="identified by match to protein family HMM PF02568;
FT                   match to protein family HMM PF02926; match to protein
FT                   family HMM PF06508; match to protein family HMM TIGR00342"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60105"
FT                   /db_xref="GOA:B5ZBR5"
FT                   /db_xref="InterPro:IPR003720"
FT                   /db_xref="InterPro:IPR004114"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020536"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5ZBR5"
FT                   /protein_id="ACI60105.1"
FT                   /translation="MKPIIYIKYGELTLKGKNRAQFIKVLVHNIKQMLLEYHELVYQVG
FT                   YDNLKIINLEKYNLQQVINDLQQVYGIAFICVAYQVNKEINEIQLACNKLVNNTDQTFK
FT                   IEARRNDKSFIYDSMQIKQICATYLLQNQPTLKVDVHHPQLLINIEIKHDCAIVYGHKI
FT                   PGAKGLPVGINGKALVLLSGGIDSPVASRLIMKRGISVDFITFITPPHTSQKALDKTIA
FT                   LAKQITLNNHLTKANLYVCNFTKLQEEIAHISKESYRITLMRRYFMRIAKRLAIDIKAG
FT                   ALVTGEALGQVASQTLNSMQTISSVLNDFLVLRPLITYDKQEIISLAKQFNTYELSILP
FT                   YDDSCSLFAPKNPTTNPNVQTAMKLEQESLVLDAIYELVFTKEITKINLSSK"
FT   gene            complement(515842..516708)
FT                   /locus_tag="UUR10_0464"
FT   CDS_pept        complement(515842..516708)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0464"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59975"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZBR6"
FT                   /protein_id="ACI59975.1"
FT                   /translation="MPFIKTPNKDFELFDNQIVLSNDYKKRYQRYFAKITGSRLGAILN
FT                   VGDFANPVKTWAMMVKIYNEPIDPIYAQAGVIIEPKIKDYVESVLKIKYKQYEPAQIGY
FT                   DVFKDNLIFGGIPDGEPVDENGELLYPNQPMLEIKTTSIDSFAFKTIDYVLVLQKDEFN
FT                   RPIVKKKGDKRAKWFNSDESQVIISEDYKLQLGLYCYLRKITKGIFAIAFLTSEDYINP
FT                   QSFDINKNEIILVNYEINLNEFEKVISKAKTWYEEYIIKGISPKLSKDDLEWYKVWVNK
FT                   YETNNLY"
FT   gene            516831..517559
FT                   /locus_tag="UUR10_0465"
FT   CDS_pept        516831..517559
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0465"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59897"
FT                   /db_xref="GOA:B5ZBR7"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZBR7"
FT                   /protein_id="ACI59897.1"
FT                   /translation="MKTINLKKEFIQYCSSLKTQDFVQQYFNDDQLKEKLLKNRLVGLI
FT                   SVIVGFVIGVAIIICGAFVNKGNGANLNSGAIVCIIIGIFIFLCLLIPYSIVANQNKKI
FT                   MHDYIEHHFNEANVAQLIKKISTFFQEFRLLSGSFLNFKQSSQVINVNYCNDQYSLIYS
FT                   FQPQPQVQLMKNNNSNKISSKEWDLKGNYDLKIYELQKWNAGFSKFYFENNVESIAFQI
FT                   ETKLGTIINDFEELLIKGGF"
FT   gene            517563..518636
FT                   /gene="hrcA"
FT                   /locus_tag="UUR10_0466"
FT   CDS_pept        517563..518636
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="hrcA"
FT                   /locus_tag="UUR10_0466"
FT                   /product="heat-inducible transcription repressor HrcA"
FT                   /note="identified by match to protein family HMM PF01628;
FT                   match to protein family HMM TIGR00331"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59910"
FT                   /db_xref="GOA:B5ZBR8"
FT                   /db_xref="InterPro:IPR002571"
FT                   /db_xref="InterPro:IPR005104"
FT                   /db_xref="InterPro:IPR021153"
FT                   /db_xref="InterPro:IPR023120"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5ZBR8"
FT                   /protein_id="ACI59910.1"
FT                   /translation="MKNNKILQEQIIEPKLSDRQKKVLKSIIDEYTITATPVSSKLLVQ
FT                   KEFQDQSSATIRNEMMLLEKFGFIEKQHISGGRVPSLKGYDFYNKNLINKNNDVSDNFK
FT                   MRLHKILSKRYSNIDEILNAAVSIINETTQLPAVVTKSSSEELLKRIDLVKINDNSALV
FT                   LIVTSSENILTHSIKLDKNTNFNDLQTCFSVLDERLVDTKLSLISSKLDLIVDIVRAKI
FT                   EEAEYYFSKIVHRVFDFYAHKPTVNSKTYGVKYLTKHSEFEDQQKLNDLLNLLEDSTIW
FT                   QQIALNKKTDGLAKIMLGNEIGHEHLAIATAQINLPNTNRQITVVGPTRMDYAKIKALL
FT                   DFLKIEVEKILGSSNEH"
FT   gene            518626..519144
FT                   /locus_tag="UUR10_0467"
FT   CDS_pept        518626..519144
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0467"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60161"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZBR9"
FT                   /protein_id="ACI60161.1"
FT                   /translation="MNIKKIKQEFSFSYELIEKEIKNIIKNWAMFKNEWEFLMATIYFS
FT                   SKAIFREISLNNWKKFSSYANEIFLEINAKNNPLQTFDLDYWYLEIKKLIQELSISNHL
FT                   LNEQLEQIYLKFLIFYWHNITIPKTYEIGDFSIVCLRNKALVDCMQILQEYYHINVDIL
FT                   IDLVIKQIK"
FT   gene            519160..519870
FT                   /locus_tag="UUR10_0468"
FT   CDS_pept        519160..519870
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0468"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF04167"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59927"
FT                   /db_xref="InterPro:IPR007295"
FT                   /db_xref="InterPro:IPR035930"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZBS0"
FT                   /protein_id="ACI59927.1"
FT                   /translation="MDEKTQEKNKNLQDLSQLKIGDELMVHAYKLNGWLYRSWNNPKVV
FT                   YIDEQLLILSSTNTLVITSEEKSIRNFPSFTNKMSYWFFFKNEWFNLIATVENDGIKFY
FT                   INVASPFIYEEQAIKYYDFDLDFKISSDDKWKEVDINEFIENAKKYHYSETLIQKILSV
FT                   ETKIENYIKEGYFRKLVTRQLLIKLHVLDRVEGFKNNFNNYTNERNYNPKKYFNKKSSS
FT                   HYFKNKKGSSKDNE"
FT   gene            519863..520630
FT                   /locus_tag="UUR10_0469"
FT   CDS_pept        519863..520630
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0469"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59838"
FT                   /db_xref="InterPro:IPR024503"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZBS1"
FT                   /protein_id="ACI59838.1"
FT                   /translation="MNNDYKGHIKKYFDDILKQAKQVLQKRDYGYAYDLISNEFNNPLI
FT                   DLKTLQEFEDFALEIKKSAELDFIDENEAKLAKTEFYHKIHDPKTTYVSLAYLETFLMR
FT                   FINEIDQLDIAFLNNLLSNKTINGSTKLDILDLLAVNNIDQNFDFYNKYLKQSKSINPT
FT                   NPSEHHLMVVQIQNYLNNDLAKNPSLLNLANKLLMMYITYHFPFAFTHDPNIIAKTIID
FT                   YTKSAMSDFECEYNQQQKDIVACINKILEEEQE"
FT   gene            520790..522526
FT                   /locus_tag="UUR10_0470"
FT   CDS_pept        520790..522526
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0470"
FT                   /product="lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60317"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZBS2"
FT                   /protein_id="ACI60317.1"
FT                   /translation="MPKKFKKWFLWISLTLVSTTTLISTLVSCAQQNKISKSDLFDFSE
FT                   QEPTQWEKEIIDSAKNKNPTFHINEWNASFAYLQEFNAIIGELEAKKDNLNSNDFSKAK
FT                   TNKIITFIPYVEFDSNKYLGNQIISDNTRVNWPSIISQYTNNKQHDLMAFTNDLLIYSN
FT                   LKQTPKYQVDNKDLKEDFVRNNNWLNENIDYHLSIFKDIKYDFYLSHWLYQYWIDQNRL
FT                   DVVLKLIYHANKIILYPDGNAELYYVANYYAQAVKNLISKDPHLSKQKIDDHLHNFINM
FT                   KSFKEAKNYFSSKLNNNKDWLTVFVLNKLFKIFAIDESWVDCDYFKFSKEFMPKSYKIR
FT                   TNYANVLNSLNLSLTAKNQFKKNFEYAFRMHNKTFLDFIVDGKQYYDPKKQNLIFMGSS
FT                   LFKDNVLKDRKIVKQELQQWALKIKNKYPNANYFFKLHPIYNQNQVLDYIQEITNGIFK
FT                   PIILDAKTPWENILLRDYLSIKNNKAVLFKDKNTPNFSLWGFQPTTSALLTSFDFIRNN
FT                   TKLTNDEVQSIIGFDNFLVGKNYDILRRDYEPNKDYTNQNLQILERTYGQLIFAKILKK
FT                   FY"
FT   gene            complement(522846..523049)
FT                   /locus_tag="UUR10_0471"
FT   CDS_pept        complement(522846..523049)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0471"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60231"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZBS3"
FT                   /protein_id="ACI60231.1"
FT                   /translation="MSLSGVLLTTSVVAIASSYAKKQTKIESVRHSFLFATNSDKTSFY
FT                   GVYNITNFDKLSKIKKRCIKKS"
FT   gene            complement(523353..523865)
FT                   /locus_tag="UUR10_0472"
FT   CDS_pept        complement(523353..523865)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0472"
FT                   /product="urease"
FT                   /note="identified by match to protein family HMM PF00210"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60259"
FT                   /db_xref="GOA:B5ZBS4"
FT                   /db_xref="InterPro:IPR001519"
FT                   /db_xref="InterPro:IPR008331"
FT                   /db_xref="InterPro:IPR009040"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZBS4"
FT                   /protein_id="ACI60259.1"
FT                   /translation="MVKSQKVIDVLNAHYNLNLELGSVYAQYAHIADDQFSMPFLAKFI
FT                   NDLSNDKLGVHKDLISEYARKIEIPLHTKFSVDVSFKPTDPKELVKHILETEQKVRKHV
FT                   ANMAKVCLEEGDFETFSFVKWFVDDGIKDFDDVRTIHDFFENGNNNLQVEYAIRKYLKQ
FT                   MKLEEEK"
FT   gene            complement(523988..524851)
FT                   /gene="ureD"
FT                   /locus_tag="UUR10_0473"
FT   CDS_pept        complement(523988..524851)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="ureD"
FT                   /locus_tag="UUR10_0473"
FT                   /product="urease accessory protein UreD"
FT                   /note="identified by match to protein family HMM PF01774"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60186"
FT                   /db_xref="GOA:B5ZBS5"
FT                   /db_xref="InterPro:IPR002669"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5ZBS5"
FT                   /protein_id="ACI60186.1"
FT                   /translation="MILSKEKINNYAAYLYIKVAYDEAHNKMAHTVYFTNFYRSSKPLF
FT                   LDEEDPINPCFQTISMGGGYVSGEVYRSDFEVEANARCIITTQSSAKAYKAVDGKTSEQ
FT                   HTNITLGKNSILEYISDNVIVYEDGKFAQFNNFKMDSTATLIYTECFGPGWSPHGSAYQ
FT                   YEKMYLNTKIYYDNKLVLFDNLKFQPRKNDESAFGIMDGYHYCGTMIVINQEVVEEDVI
FT                   KIRDLVKEKYPDMDMIFGVSRMDIPGLGLRVLANTYYHVEKINAVAHDYFRRKLFNKKP
FT                   LILRKP"
FT   gene            complement(524861..525481)
FT                   /gene="ureG"
FT                   /locus_tag="UUR10_0474"
FT   CDS_pept        complement(524861..525481)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="ureG"
FT                   /locus_tag="UUR10_0474"
FT                   /product="urease accessory protein UreG"
FT                   /note="identified by match to protein family HMM PF02492;
FT                   match to protein family HMM TIGR00101"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60112"
FT                   /db_xref="GOA:B5ZBS6"
FT                   /db_xref="InterPro:IPR003495"
FT                   /db_xref="InterPro:IPR004400"
FT                   /db_xref="InterPro:IPR012202"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZBS6"
FT                   /protein_id="ACI60112.1"
FT                   /translation="MKRPLIIGVGGPVGAGKTMLIERLTRYLSTKGYSMAAITNDIYTK
FT                   EDARILLNTSVLPADRIAGVETGGCPHTAIREDASMNFAAIDEMCDKHPDLQLLFLESG
FT                   GDNLSATFSPDLVDFSIYIIDVAQGEKIPRKGGQGMIKSDLFIINKVDLAPYVGANVEV
FT                   MKADTLKSRGNKDFFVTNLKTDEGLKSVADWVEKRLQLALLEE"
FT   gene            complement(525558..526265)
FT                   /locus_tag="UUR10_0475"
FT   CDS_pept        complement(525558..526265)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0475"
FT                   /product="urease accessory protein UreF"
FT                   /note="identified by match to protein family HMM PF01730"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60022"
FT                   /db_xref="GOA:B5ZBS7"
FT                   /db_xref="InterPro:IPR002639"
FT                   /db_xref="InterPro:IPR038277"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5ZBS7"
FT                   /protein_id="ACI60022.1"
FT                   /translation="MMLNSDYLNLLDLMQITNANFPIGTFSHSFGIETYIRKDIVFDGD
FT                   SLIRALLLYMNEQLLHGDLLAIYQIFKLLPKQKINAIWEIDQMINFQGLARETREGQRR
FT                   IGQQMVKIYNELFDCELLVEYAQRIKDRKSYGNPAVAFALLAMHLKIDLKTALYTHLYS
FT                   TVAALTQNCVRAIPLGQVKGQKIIHKLKHVYFDDIIDKVFSLDFKTDFCKNIPGLEIAQ
FT                   MEHEDTPVRLFMS"
FT   gene            complement(526252..526701)
FT                   /locus_tag="UUR10_0476"
FT   CDS_pept        complement(526252..526701)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0476"
FT                   /product="urease accessory protein UreE"
FT                   /note="identified by match to protein family HMM PF02814;
FT                   match to protein family HMM PF05194"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59853"
FT                   /db_xref="GOA:B5ZBS8"
FT                   /db_xref="InterPro:IPR004029"
FT                   /db_xref="InterPro:IPR007864"
FT                   /db_xref="InterPro:IPR012406"
FT                   /db_xref="InterPro:IPR036118"
FT                   /db_xref="InterPro:IPR036675"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5ZBS8"
FT                   /protein_id="ACI59853.1"
FT                   /translation="MTVFKEILGNITDIENVESYQIENIHLTSDDVLKRVIIISSDQNV
FT                   EYGIRLEEDKKLRDGDILYKDDYKLVVIRLELSDVLIITARTIGEMAQIAHNLGNRHMP
FT                   AQFTETQMIVPYDYLVEQYLQDNKALYEREKIKLKEAFRHCSDAK"
FT   gene            complement(526768..528564)
FT                   /gene="ureC"
FT                   /locus_tag="UUR10_0477"
FT   CDS_pept        complement(526768..528564)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="ureC"
FT                   /locus_tag="UUR10_0477"
FT                   /product="urease, alpha subunit"
FT                   /EC_number="3.5.1.5"
FT                   /note="identified by match to protein family HMM PF00449;
FT                   match to protein family HMM PF01979; match to protein
FT                   family HMM TIGR01792"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59907"
FT                   /db_xref="GOA:B5ZBS9"
FT                   /db_xref="InterPro:IPR005848"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR011612"
FT                   /db_xref="InterPro:IPR017950"
FT                   /db_xref="InterPro:IPR017951"
FT                   /db_xref="InterPro:IPR029754"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5ZBS9"
FT                   /protein_id="ACI59907.1"
FT                   /translation="MFKISRKNYSDLYGITTGDSVRLGDTNLWVKVEKDLTTYGEESVF
FT                   GGGKTLREGMGMNSTMKLDDKLGNAEVMDLVITNALILDYTGIYKADIGIKNGKIASIG
FT                   KSGNPHLTDGVDMVVGISTEVSAGEGKIYTAGGLDTHVHWLEPEIVPVALDGGITTVIA
FT                   GGTGMNDGTKATTVSPGKFWVKSALQAADGLPINAGFLAKGQGMEDPIFEQIVAGACGL
FT                   KIHEDWGATGNAIDLALTVAEKTDVAVAIHTDTLNEAGFVEHTIAAMKGRTIHAYHTEG
FT                   AGGGHAPDILESVKYAHILPASTNPTIPYTVNTIAEHLDMLMVCHHLNPKVPEDVAFAD
FT                   SRIRSQTIAAEDLLHDMGAISIMSSDTLAMGRIGEVVTRSWQMAHKMKAQFGALKGDSE
FT                   FNDNNRVKRYVAKYTINPAIAHGIDSYVGSIEVGKLADIVAWEPKFFGAKPYYVVKMGV
FT                   IARCVAGDPNASIPTCEPVIMRDQFGTYGRSLTSTSVSFVSKIGLENGIKEEYKLEKEL
FT                   LPVKNCRSINKKSMKWNSATPNLEVDPQTFDAAVDYNDLENWLEQPAAELAKKLKKTAN
FT                   GKYVLDAEPLTEAPLAQRYFLF"
FT   gene            complement(528603..528977)
FT                   /gene="ureB"
FT                   /locus_tag="UUR10_0478"
FT   CDS_pept        complement(528603..528977)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="ureB"
FT                   /locus_tag="UUR10_0478"
FT                   /product="urease, beta subunit"
FT                   /EC_number="3.5.1.5"
FT                   /note="identified by match to protein family HMM PF00699;
FT                   match to protein family HMM TIGR00192"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59941"
FT                   /db_xref="GOA:B5ZBT0"
FT                   /db_xref="InterPro:IPR002019"
FT                   /db_xref="InterPro:IPR036461"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5ZBT0"
FT                   /protein_id="ACI59941.1"
FT                   /translation="MSGSSNQFTPGKLVPGAINFAEGEIVMNEGREAKVISIKNTGDRP
FT                   IQVGSHFHLFETNSALVFFDEKGNEDKERKVAYGRRFDIPSGTAIRFEPGDKKEVSVID
FT                   LVGTREVWGVNGLVNGKLKK"
FT   gene            complement(529029..529334)
FT                   /gene="ureA"
FT                   /locus_tag="UUR10_0479"
FT   CDS_pept        complement(529029..529334)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="ureA"
FT                   /locus_tag="UUR10_0479"
FT                   /product="urease, gamma subunit"
FT                   /EC_number="3.5.1.5"
FT                   /note="identified by match to protein family HMM PF00547;
FT                   match to protein family HMM TIGR00193"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60150"
FT                   /db_xref="GOA:B5ZBT1"
FT                   /db_xref="InterPro:IPR002026"
FT                   /db_xref="InterPro:IPR012010"
FT                   /db_xref="InterPro:IPR036463"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5ZBT1"
FT                   /protein_id="ACI60150.1"
FT                   /translation="MNLSLREIQKLLVTVAADVARRRLARGLKLNYSEAVALITDHVVE
FT                   GARDGKLVADLMQSAREVLRVDQVMEGVDTMVGIIQVEVTFPDGTKLVSVHDPIYK"
FT   gene            529664..530815
FT                   /locus_tag="UUR10_0480"
FT   CDS_pept        529664..530815
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0480"
FT                   /product="ferrichrome transport ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59801"
FT                   /db_xref="GOA:B5ZBT2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZBT2"
FT                   /protein_id="ACI59801.1"
FT                   /translation="MSFFKKKNDTEKEEHKHVSVVDMDEILGYEDGEEFKDDEIDSNEA
FT                   IFQLNNVSLGYGKKMIIKNLTATIHRNDFIVVLGPNGSGKSTLIKGLCRINNPSSGYIK
FT                   YRDKLISRPWLPLLWLEKAWASIVNVFTKDRKEVIKTIDWHIKNYKKIHAYKSKELALN
FT                   LAYVPQLAVFPEATSIYDFVKMGRFPSSNALGINTNTEREKQIIDEALKNVGIYEFRHK
FT                   NLEDLSGGQKQKALIALALAQDTETIVLDEPTNHLDIRSQLEIIELLHKLHHEMKKTIV
FT                   LVIHDINNGLKYAHKVMIMKNGEMVRYGKLKETIDHEILLDVFGVESIIVKNESKYPQV
FT                   SVTDFSLPKDYKINEVQENERTNLIYNDGEENELEKEVSKKKN"
FT   gene            530945..531688
FT                   /gene="rrmJ"
FT                   /locus_tag="UUR10_0481"
FT   CDS_pept        530945..531688
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="rrmJ"
FT                   /locus_tag="UUR10_0481"
FT                   /product="ribosomal RNA large subunit methyltransferase J"
FT                   /EC_number="2.1.1.-"
FT                   /note="identified by match to protein family HMM PF01479;
FT                   match to protein family HMM PF01728"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60026"
FT                   /db_xref="GOA:B5ZBT3"
FT                   /db_xref="InterPro:IPR002877"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR004538"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZBT3"
FT                   /protein_id="ACI60026.1"
FT                   /translation="MSQRLDHYLKNTNQCETRSKAIDLIKRGFVFVNNLQILKPSFLVQ
FT                   ENDFVDIKNNENNFVSKGGYKLFKIIQELNLKIKDFIIADLGSSTGGFTDCCLQLGAKK
FT                   VYAIDVGVDLLHPNLKNHPKIVNYEKTNVKNLDKSYFLEELDLIVGDLSFISLEQIFPT
FT                   IEKISSCKTLLLLLIKPQFELGKDIANKYKGIIKNKNLQQLAINKIINLANNYGFKYKH
FT                   LTPTDIFDQKKQNQEYMIFLQKYAK"
FT   gene            531678..532760
FT                   /locus_tag="UUR10_0483"
FT   CDS_pept        531678..532760
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0483"
FT                   /product="DNA polymerase family protein"
FT                   /note="identified by match to protein family HMM PF00817"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59868"
FT                   /db_xref="GOA:B5ZBT4"
FT                   /db_xref="InterPro:IPR001126"
FT                   /db_xref="InterPro:IPR017961"
FT                   /db_xref="InterPro:IPR022880"
FT                   /db_xref="InterPro:IPR036775"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5ZBT4"
FT                   /protein_id="ACI59868.1"
FT                   /translation="MQSSGQKIIMHLDIDAFYATVSELLHPEYKNFPIAVGSLNSRTGI
FT                   ISSPNYLARSYGVKSAMPIFLAKELCPNLIILPCEHDIYQTYSNHFFQIVNKYCNKVEI
FT                   TSIDECFIDATNSIKKYHNNVRLLAAKIQNEVKNKLNLSISVGISFNKTIAKMATELNK
FT                   PFGISIIDENKITNLIHELDISKIPFIGEIKSQELYAINIFKIKELIASNNKQKASLVL
FT                   GSMYQNLVNDLKGLNEIKTIEDDIYKSISHSKTFNEDLNDFYEISNELNELISNVVNRL
FT                   KKHNLMTNNISINIKYPNFQTKVKQKRLDYYTDDYQTIFLAIKNLFKKVYKDELVRLIG
FT                   VSLNKLVPKESVKKQLFLFD"
FT   gene            complement(532749..533687)
FT                   /gene="ruvB"
FT                   /locus_tag="UUR10_0482"
FT   CDS_pept        complement(532749..533687)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="ruvB"
FT                   /locus_tag="UUR10_0482"
FT                   /product="holliday junction DNA helicase RuvB"
FT                   /EC_number="3.6.1.-"
FT                   /note="identified by match to protein family HMM PF00004;
FT                   match to protein family HMM PF05491; match to protein
FT                   family HMM TIGR00635"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60255"
FT                   /db_xref="GOA:B5ZBT5"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004605"
FT                   /db_xref="InterPro:IPR008823"
FT                   /db_xref="InterPro:IPR008824"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR041445"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5ZBT5"
FT                   /protein_id="ACI60255.1"
FT                   /translation="MKTNNEFRPQYLKDFIGKDQLKSNLKIYLNATKRLKSSFDHTLLH
FT                   GLAGTGKTTLATIIANEMGVDCHMTQGNLLNKPVDIINLLSLIKENDVIFVDEIHACGL
FT                   AAFETLYSVLEDFCIDISIGKDFNAKMTRLKVPHFTLIGATTMLGKIPEPLEERFGHVF
FT                   YLSEYETSEIAAIILKNNQIHFQINLNDQEIDLIANSAKGIPRLANRLLKRVVDFKING
FT                   FDNIKNIFEKIQIYDFGLEEQDINYLNVLYQQENEIGLKSIAQILRLDQYTIETKIEPY
FT                   LIQHHFINKNLRGRKITAKGIEFLKNNQLIK"
FT   gene            complement(533677..534264)
FT                   /locus_tag="UUR10_0484"
FT   CDS_pept        complement(533677..534264)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0484"
FT                   /product="holliday junction ATP-dependent DNA helicase
FT                   RuvA"
FT                   /EC_number="3.6.1.-"
FT                   /note="identified by match to protein family HMM PF07499"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60096"
FT                   /db_xref="GOA:B5ZBT6"
FT                   /db_xref="InterPro:IPR000085"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR011114"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5ZBT6"
FT                   /protein_id="ACI60096.1"
FT                   /translation="MNYLVFKVIYANANVVIGEHNFIGYQIRVPKDYELEVNKFCKLYL
FT                   YEYASIMPNKNLIIKDLYGFRTYNERLLFIDLISINSIGPKTAINILKYDINLIIDAIA
FT                   TKDVDFLATIKGVNQRSANLICDQLNYKYINKVSEKNPWAKELSIGLENLGYDKKDIEY
FT                   AITKVKVDTQQNIDISEIIGCAIKEISLRHEN"
FT   gene            complement(534300..535475)
FT                   /locus_tag="UUR10_0485"
FT   CDS_pept        complement(534300..535475)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0485"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60347"
FT                   /db_xref="GOA:B5ZBT7"
FT                   /db_xref="InterPro:IPR022791"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZBT7"
FT                   /protein_id="ACI60347.1"
FT                   /translation="MADNNLSEKTNFWTKKNICFLSIGLLVCLLMIIVSILFILDIDFH
FT                   NLFMKISNSLKTIKLAVLWLLILIGFSFFRAFMFTIIAVFDAYKNQVKIDWWKWILYSF
FT                   SLIFLNAVTPFSVGSEPFSIYFLNKNGYHNLKKVSALLLVSSTFYELGQVIVTIPSFIY
FT                   VNYELITYAVENKTALPFYYYLAVVGVIVDLCMTGVYFILGFSKKLHFNLALVFNWVKK
FT                   ILKFKYLSKAELIQKSDENTSFKAIYLIYFKNLRVSLVAFIIGIVYNVAIYALMYISYR
FT                   LIESNPHNVFFDLFNYTNVAVTATNFVPLPGSEGSIQYMLRIFLANDQHQIRYAMNYLS
FT                   TQDVNNIIFIWRAFSIYLGSFIGMFGFGYFLVTDLYKFIKKAKVNKKISKS"
FT   gene            complement(535579..536583)
FT                   /locus_tag="UUR10_0486"
FT   CDS_pept        complement(535579..536583)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0486"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59778"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZBT8"
FT                   /protein_id="ACI59778.1"
FT                   /translation="MGLFSKKNKLNQELSTNQNTVNDEVSHDDKSIYQLYDETIVTKKV
FT                   KVRCKVCGVFMWVDYTKTIKSLRNLALTNVQQEVITIEEPQVLEDNSDVLLTPVNDQEE
FT                   LVSEEYESAPIESIQEEQIVEDNEPIQDENEEITPPVYEVEEPTLKRTSFTPVAFEFEE
FT                   PIFENIYSNQKVYAENLFLESMFSEKENLINDDQNDFSWLSKYVSVWNKRDEAELAQMV
FT                   YDERLLAPEISEFTHNEYFIEEEYEHADPDNHHNKHKAQRHLHGHDLVAKKHEKQLEKK
FT                   TNEIIDQAIVAIDSMDEEQQTSLKTIISEEEFKANPVLKKTWWETESANKSSK"
FT   gene            complement(536688..538106)
FT                   /gene="proS"
FT                   /locus_tag="UUR10_0487"
FT   CDS_pept        complement(536688..538106)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="proS"
FT                   /locus_tag="UUR10_0487"
FT                   /product="prolyl-tRNA synthetase"
FT                   /EC_number="6.1.1.15"
FT                   /note="identified by match to protein family HMM PF00587;
FT                   match to protein family HMM PF03129; match to protein
FT                   family HMM PF09180; match to protein family HMM TIGR00408"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60010"
FT                   /db_xref="GOA:B5ZBT9"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002316"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR004499"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR016061"
FT                   /db_xref="InterPro:IPR017449"
FT                   /db_xref="InterPro:IPR033721"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5ZBT9"
FT                   /protein_id="ACI60010.1"
FT                   /translation="MAKKLEKIITRNENFADWYTSIVNNAKLIQYTDIKGMMVFQPNAW
FT                   AIWEAIKNQIDLEFKKHGVRNLAMPTLIPLSEFQKEKDHIEGFAPELFMVNQIGDKKLD
FT                   NPYAIRPTSEILFCNYFKNIVNSYNDLPIKNNQWCSVMRAEKTTRPFLRNAEFHWQELH
FT                   AIFASEHEADEFAKTILDVYTDFVQNYLCIPVIKGLKTPWERFAGAQKTYTIEAMMQDG
FT                   QALQSATSHYLGQFFAKAYDIKFQGQDNQMHYVHQMSAGLSTRIIGALIMVHADDQGLI
FT                   LPPDIAFNQIAILSIFANKNPQLLTISEQIRNELSDYRLFEDHSDKGVGYKLAQQEIEG
FT                   TPICILVGVKELANQQVVLVRRDTHEKINVNLIDLKSTIKKLLLDIKTNIYQKAKKQLD
FT                   ESIVFVNSIEELKQVIAQNKMAKAFFDGSKEDDEQIKLLTNASTRCIFDETQSGQCFYT
FT                   NKKTNKLTLFARAY"
FT   gene            complement(538164..538613)
FT                   /locus_tag="UUR10_0488"
FT   CDS_pept        complement(538164..538613)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0488"
FT                   /product="SUF system FeS assembly protein, NifU family"
FT                   /note="identified by match to protein family HMM PF01592"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59921"
FT                   /db_xref="GOA:B5ZBU0"
FT                   /db_xref="InterPro:IPR002871"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZBU0"
FT                   /protein_id="ACI59921.1"
FT                   /translation="MASYNINDNLTLRSIIMEHYERPKNKVCFVQNETDYLSCHNTTEG
FT                   CSDDITVYVKLVNQKIVDVVFLGTGCAISTSSTDIICELVKNQDLQQALELINNYLNMI
FT                   QGLEYNQDIMQELIAFHNVKNQMNRIRCARIGINALKTCLEQYKQ"
FT   gene            complement(538600..539808)
FT                   /locus_tag="UUR10_0489"
FT   CDS_pept        complement(538600..539808)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0489"
FT                   /product="probable cysteine desulfurase"
FT                   /EC_number="2.8.1.7"
FT                   /note="identified by match to protein family HMM PF00266"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60038"
FT                   /db_xref="GOA:B5ZBU1"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZBU1"
FT                   /protein_id="ACI60038.1"
FT                   /translation="MDNYKQFFPWFKNNKDVVYLDSSATSLKPQVVVDAIVDYYTKYST
FT                   NPHNSDSNFAFHPHKIMYETRANVAKFINADFEEIVFTSGATESLNLIANGLRPYLKKD
FT                   DEIVLTYVEHASNLLPWYKLRDDLGIKIVFANQKNQFPQLSDFLNAISPKTKIVSFASG
FT                   GNLIGNILDENVIIKHIKQLNPNILVCVDATQSVQHRMFDVEKCQSDFMVFSAHKLLGP
FT                   TGIGVAYIKNEWIKKLQPLKYGGGMNFSIDLDSYQLYDDYMKFEGGTPHVAGFYGFNAA
FT                   LKFLMDIGYEKIHDHELKITQYAREQLALIPQIKTYVQDPTSSTITFSYEGVFCQDFAS
FT                   YLGTKNIIVRSGLSCAKIINNIIQTECAIRASFYIYNDFSDVDKLVQAIKEYQKGDELN
FT                   GIL"
FT   gene            540021..543407
FT                   /locus_tag="UUR10_0490"
FT   CDS_pept        540021..543407
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0490"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59940"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZBU2"
FT                   /protein_id="ACI59940.1"
FT                   /translation="MKLKKVLLTSALSILGVASITSLVAACSQTKTKVNQYKVVINKLD
FT                   SLNLTSNLSTKQALKNTLFSMEGQNEFLLSNVKKVVYDWAKNNNDPKLARAVSEYDTQL
FT                   DDQLKRIKENVKKSYPNDWETVLQSELYDSEGGSEKLWKQAKAIDEAYKTITSTMFDDN
FT                   NDWISVLNEQNQLVDAYSNDATKLLENENVFKATNTGERNKIVAKTNNPWQKGYANLFD
FT                   FLIDDYIKYNLPLSFANLEFKYDDLKNQNIYNKEFFKKVPSSGTSFDFPWFDPKPADNK
FT                   STNTTTNYLEVVKLLKENKYLDQKDNTNNIDKKFNNNNDINKNLNLNDFITQDSTNSVL
FT                   AIGLLAKFLSLFGNQNFGIHQSDNLDETSILNNFINKNQSTSNSDSVNLFYPLAKKDKT
FT                   AFLNDFKGVKAIRQINDLKNEYTLLRNEKSVDLWGINNFKRLQQAAQLGLNALLTELKN
FT                   DFLYNGALYLNSRKSSSVKKQGFDIKAKIKDYFNTNKERLLASYIATHQNDSDFLFKSN
FT                   LKSHAKVFSFDQKTTDIIKQYNEIHLLNHYDNLVHKLNDKLIKFNKKTFITPNVDNLYD
FT                   NGINTPIYLNKDQNQQISLFQTLKTKLVGNKNLVDENKKLSTMINNYVESFDVQKHLVA
FT                   NNQKSQSIVFDDYIINKVFTKGINSVFANVIKQKQIKKSVANFFEFADFSFKNNLVENQ
FT                   EILAAFNQIIKNSSVLETEQTNSFSSFDDLKKVYEQALKLWNENYTKNGPYNQLSINYQ
FT                   KYQALFETLAVISYLLDFKNNKPTYQNLINYLLKRTANHQPLFIGWKALNDTTKITDFG
FT                   KDSKKDFSFKKYQANLYNGLDLYQLKKEDVYELDQTSQEVKFKKTFLDALTYTDDKVYW
FT                   NSTINKDGSIYNNFIGLIDQNNQKNKLGKAFEKINLFDKLVYANNPSTQFKGSLYGYGS
FT                   KENLIKILDKFTSYHDYQALAQLLYNLNFNSEANAEFKTILDNKKQVIPGDQKDNKVKN
FT                   IDLATNEIKAIMIKGINKIPQTAFERLDLDLVYNKLDKNATPLVNKENNSNLKYVLLVS
FT                   QFNANDVQNLVINNELNQSATGYLGLSKNQFYNLLFDLALNDQTLKVEAFSQIENEHKI
FT                   KVYDKRLANNSNLKGWIINNL"
FT   gene            543407..544066
FT                   /locus_tag="UUR10_0491"
FT   CDS_pept        543407..544066
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0491"
FT                   /product="D-ribulose-5-phosphate 3 epimerase"
FT                   /note="identified by match to protein family HMM PF00834"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59739"
FT                   /db_xref="GOA:B5ZBU3"
FT                   /db_xref="InterPro:IPR000056"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZBU3"
FT                   /protein_id="ACI59739.1"
FT                   /translation="MNKQLVPSLLAFDKKQPYEQLKIFQKHHLQTIHYDVMDLAYVNNT
FT                   AFETEHLEWLLKNNFLVHIHLMVINPLQKIKQYFKYKPTHISFHFEMNDYQTNLLIIDE
FT                   IKKHSIFAGIAIHPHLSLNDYAFYLKEVDYITFMSVVPGKGGQLFLEESLLKLQELYDY
FT                   KIKNNLTFKIEIDGGITLEIIKKINIPIDFFVSGSYLVRNIEKLDQIINAFNQLVN"
FT   gene            complement(544335..545171)
FT                   /locus_tag="UUR10_0492"
FT   CDS_pept        complement(544335..545171)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0492"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59738"
FT                   /db_xref="InterPro:IPR029501"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZBU4"
FT                   /protein_id="ACI59738.1"
FT                   /translation="MSEFCFVHANEGKFVNANDKNKIRLDTGGHGQANLELLKRLRIGY
FT                   EINVIFENGVRVGNVKNHKNKDKSENNGQTWLPKSWTEEMILEAGEDVAKSTENQNVPD
FT                   GVIIYGTYQNVRIGLIKRDNKIVSFFPDSKQDCSVKWVNEKNTMDQSKLKRKKRNKNMK
FT                   INIQKFKRIIKKRHQADRDIKLYLGRQSIWDTLVAFICKSEASFSGFIEYMKTKMTSYE
FT                   YIILSEISDDIVAIFPWISFIKAYRFLEQRYPTTTKEYNIKLFIDDAEEYVLSKNN"
FT   gene            complement(545210..545953)
FT                   /locus_tag="UUR10_0493"
FT   CDS_pept        complement(545210..545953)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0493"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60329"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZBU5"
FT                   /protein_id="ACI60329.1"
FT                   /translation="MKFNYKKFKKLIEQRHQADYDIRLYLGVQSIWEDLVAVICKTEVS
FT                   FSVFIEYMKTEMSDYEYFVLSEISYDLVGIYPWTSFIDAYHFLAKKYSKQTKKHEIFNA
FT                   IYEAEEYVKSRSMIDDENTIFSIKQFKDLIMERKIIGKCPLNYWDLDLVWEKLVKLICA
FT                   SEASFSVFIEYMKTKMTACEYSTLKEISDDIVAIFPWISFIKAYRFLEQKYPTSTKEYK
FT                   IKLFIDDAEEYVLSKNNERIEDGHK"
FT   gene            complement(545958..546491)
FT                   /locus_tag="UUR10_0494"
FT   CDS_pept        complement(545958..546491)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0494"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60324"
FT                   /db_xref="InterPro:IPR029501"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZBU6"
FT                   /protein_id="ACI60324.1"
FT                   /translation="MGTSKSGRYLSTVGSGTKVSEFCFVHVNEGKFVNANDKNKIRLHT
FT                   GGHGQANIELLKRLRIGYEINLIFENGVRVGNVENHKNNCKSKNNGQTWLPKSWTDKTI
FT                   LKAGEYVSKLKKNINAPDGKIVYGTYRNVRIGLIKRDNKIVSFFPDSKQNSKIKWMDEE
FT                   KYNGPLKIEKKEDE"
FT   gene            complement(546591..547208)
FT                   /locus_tag="UUR10_0496"
FT   CDS_pept        complement(546591..547208)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0496"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60282"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZBU7"
FT                   /protein_id="ACI60282.1"
FT                   /translation="MKKFKQIIKKRHQADRDIKLYLGVQSIWDALVAFICKSETSFSGF
FT                   IEYMKTKMTSYEYFVLSEISDYLVGIYPWTSFIDAYHFLAKKYPKQTRKYEIFNAIYEA
FT                   EEYVKSRSMIDDENTIFSIKQFKDLIMERKIIGKCPWNYWDRDLVWEKLVKLICASEAS
FT                   FSVFIEYMKTKMTACEYSTLKEISDDIVAIFPWISFIKEYRF"
FT   gene            complement(547183..547857)
FT                   /locus_tag="UUR10_0497"
FT   CDS_pept        complement(547183..547857)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0497"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60183"
FT                   /db_xref="InterPro:IPR025530"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZBU8"
FT                   /protein_id="ACI60183.1"
FT                   /translation="MNLINFMVKSKNWNIDTIKANNTIIPIDIVPFEKHHKIIDKKKVV
FT                   LHFYMFDNSFKQVINNPNKYVSILKQFGGIISFDLSLYIDMPLSLQMVNKFKNHKVAAY
FT                   LQKLGINVIPNVRWGDERSFSFCFEGFEKRGIYAVSTHGCIKTKIEKTMFVNGLRKMIE
FT                   VLEPKVILVHGPMPKEVFDQFKRKVVFVNYSSWISRCKNNNNNNNKENKYENKYEKIQA
FT                   NN"
FT   gene            complement(547919..548602)
FT                   /locus_tag="UUR10_0498"
FT   CDS_pept        complement(547919..548602)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0498"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59806"
FT                   /db_xref="InterPro:IPR025530"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZBU9"
FT                   /protein_id="ACI59806.1"
FT                   /translation="MTKDDLFFASILKDAKFITDLEIPLIKREEKCDLNNIVSFNSKIK
FT                   DLHNLENLFFHFYDVNLKFEDYLKLFKYKKFAKIKFCKGIIMPNLNIKDNENIIEYIYK
FT                   IYQNRQLIYFFQKHGLIVIPTIDWYDFLSINYSLISLFKYGIYAIDIRNKINNDLNIKC
FT                   FKKCMRKIILKLKPLSIWFYDDNKQIKVDIFANKNKLNFLDISNLVLGFFNKKIKNRSY
FT                   TTNEK"
FT   gene            complement(548829..551096)
FT                   /locus_tag="UUR10_0499"
FT   CDS_pept        complement(548829..551096)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0499"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:CAE77662.1"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59729"
FT                   /db_xref="GOA:B5ZBV0"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR034074"
FT                   /db_xref="InterPro:IPR036852"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZBV0"
FT                   /protein_id="ACI59729.1"
FT                   /translation="MNNILELKGSIYSKSNPNKPGPRNLPAKQSISLDHIKKIVKDLQT
FT                   SLDEWESYTDYGVNPIINITYKKIVAKSNRAKKIFSFDENKECDPNYFVIGARYADKNK
FT                   KHIITYNISKQNLNETIEKIKTVISMLENNFKTIDINFEGISYSFIADINANKYKKIFD
FT                   NNKISKTTFVSLIVDCYYIENINCNYSDVLLEDNAIITFYKTNKNIVEILQEIGINLNN
FT                   SKIIKDENFYLRIDELKIVKEKIPYLISMGVKDLNQIDLDQSLDYIDDSIKTTLKIHKP
FT                   TNEPTIGVIDTIIVDHTQVYFHEWIDYHYENSKELEPILKEENPIHGLEVSSIIVNGPS
FT                   FNPNLDDGCGFFRVRHFGVMGQNFTTFELIKKIRSIIENNQDIKVWNLSLGTKYEIKDN
FT                   FISIEASILDDIQAEYDVIFVVSGTNKTSKESKNYKIGSPADSINSLVVNAVNDQQEPA
FT                   FYTRKGIVLSFFNKPDLAYYGTCYVFESNNKVKKVQGTSYAAAWISRKLGYLINILGFS
FT                   REVAKALLIHAAADSIKENHDFSFLGYGVVPIKINDIVYAKDNEIKFFINGSISEYETY
FT                   THTIPIPTETNKHPYLAKATLSYFPQCSRNQGVDYTNVELDLHFGRIDEDKKSIISINN
FT                   NLQDEDKMLNLFEGDARNYFRKWDNIKYISDYSLKNVKPRKAYGDCFWGFSLKAKTRFN
FT                   YNVYDKKLKFGLVFSFFEINNKNRIHEFIKSCLFNGWLVKSISVDEKINLYNKLQEKID
FT                   IK"
FT   gene            complement(551089..552144)
FT                   /locus_tag="UUR10_0500"
FT   CDS_pept        complement(551089..552144)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0500"
FT                   /product="AAA family ATPase"
FT                   /note="identified by match to protein family HMM PF00004"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60304"
FT                   /db_xref="GOA:B5ZBV1"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZBV1"
FT                   /protein_id="ACI60304.1"
FT                   /translation="MKKVDIVNLIKYHVSNDENSFINQANEIAKYFDDHGDNEIASYIM
FT                   GLISRSNVFTPQSLKSELTSDFFEKVDLHKFEPLPIPEAIQKEIDGLINAYKKGFDLNK
FT                   FLFKGPPGTGKTESVKSLARLLKKELYKVNLSSIVDSMLGRTAKNIKELFDEINAFPNP
FT                   ENVLILLDEIDAITMDRINNNDSREMGRATSTILTCLDNLNKSILLIATTNLHQYFDDA
FT                   LLRRFDYAIDFSHYEKEDIQDIGWIILEYYSQRMENINKNKNLFKKIIKNAKVMPYPGK
FT                   LKNLIKSSLAFSDPNDPNEYLKRLYYDLVDNHLDINILKEQGFTVREIETLTDISKSKI
FT                   AKDLKENKDYE"
FT   gene            complement(552285..554603)
FT                   /gene="pheT"
FT                   /locus_tag="UUR10_0501"
FT   CDS_pept        complement(552285..554603)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="pheT"
FT                   /locus_tag="UUR10_0501"
FT                   /product="phenylalanyl-tRNA synthetase, beta subunit"
FT                   /EC_number="6.1.1.20"
FT                   /note="identified by match to protein family HMM PF01588;
FT                   match to protein family HMM PF03483; match to protein
FT                   family HMM PF03484; match to protein family HMM TIGR00472"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60077"
FT                   /db_xref="GOA:B5ZBV2"
FT                   /db_xref="InterPro:IPR002547"
FT                   /db_xref="InterPro:IPR004532"
FT                   /db_xref="InterPro:IPR005121"
FT                   /db_xref="InterPro:IPR005146"
FT                   /db_xref="InterPro:IPR005147"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR020825"
FT                   /db_xref="InterPro:IPR033714"
FT                   /db_xref="InterPro:IPR036690"
FT                   /db_xref="InterPro:IPR041616"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZBV2"
FT                   /protein_id="ACI60077.1"
FT                   /translation="MILSLNLLHKISPKLKKISLNELCTALMDLGCEVETINTIKPSTN
FT                   LVFAKVLEKTKHPNANHLNLVKVKANQEVYEIVCGADNFNVNNWVVLAKINAELANGLK
FT                   ITPRELRGYVSNGMLCAYSEINPEVAHFLGQTDLDGILVLHDSYDHYKTPNQIFNLDDV
FT                   ILDLSIPSNRNDLNGYFWMAKELCAYFDLEYVIDATINHRSHKEIVNVRILSDDVNSYG
FT                   MIEVKNIQNYTLKWNTKSVLVNNQIKIVNNFADNMNFLTLLTANPLHAFDAHKISGQII
FT                   VKNAEEDSILLGLDQKEYAIKKGDLIIVDDQKILALAGIIGSNDSKIDNNTTTAYIECA
FT                   NFNPLLIANTARRLKINTTAAMRFSKPLTNYVTKATLKKLLAHFKLDAKLICYFKHLVH
FT                   NVIKNKIDQVSDFVGTKINLDTAHTFLKRLGYKINKTNLITPSHRYDVLNEFDVYEDIM
FT                   KKFSIQQIKPQPINFDILSFKNNIAYDFEKKVSDFLVDQGLFECKTYNLKSQTQAYEID
FT                   FFNFQQAYEINNPISNIRSHLKLNNLNSLLEVLEYNQNQKNELENIFEISKINPINSNQ
FT                   QTILSIVLCKPLINAKLNDSIVVNNFVTTKALLHVLLTKLNISYVYDTNHIVNELYENN
FT                   QLALVNENKQVFGFIGQLKNQIKKTYGLNNDIFVINLNLTSYLNQEQAITKVIKPSVYH
FT                   DIVRDVSVKLASNVDLNDVMDNIEKIKNIRKVEISDLYVKDDEIIYTFKYYINDYSSNL
FT                   SSEQIAVIEQEVNNYLKQF"
FT   gene            complement(554636..555637)
FT                   /gene="pheS"
FT                   /locus_tag="UUR10_0502"
FT   CDS_pept        complement(554636..555637)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="pheS"
FT                   /locus_tag="UUR10_0502"
FT                   /product="phenylalanyl-tRNA synthetase, alpha subunit"
FT                   /EC_number="6.1.1.20"
FT                   /note="identified by match to protein family HMM PF01409;
FT                   match to protein family HMM TIGR00468"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60170"
FT                   /db_xref="GOA:B5ZBV3"
FT                   /db_xref="InterPro:IPR002319"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR022911"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5ZBV3"
FT                   /protein_id="ACI60170.1"
FT                   /translation="MDIANLIQNLKQTLQNASNERHLIELKNIFVKQHLLPLYDELKKS
FT                   DNKKEMGLLINEFKQQIELITNQALVELNNKSDQIDLKKWANKTLFTPFIKNGHHHIIN
FT                   NIIDDIAQFFKKLNFEIVSGPEVVSPVYNFDHLNIDENHPARATADSFFINSVQMLRTH
FT                   CTTTTAQVLENNPHKDIRIMSFGNVYRKDDDDATHSHQFNQVDFVWVKEGLTVANLKWL
FT                   IDSLIKYLFGQNLKTRYRLSFFPFTEPSFEVDVQCFKCDLKGCAVCKKSTWIEIMGTGM
FT                   LHENVLKAANINDIKTGMAFGVGIDRIAMLKYEIDDIRYLYSNNFKFNAQIK"
FT   gene            complement(555644..556111)
FT                   /locus_tag="UUR10_0503"
FT   CDS_pept        complement(555644..556111)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0503"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59924"
FT                   /db_xref="GOA:B5ZBV4"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZBV4"
FT                   /protein_id="ACI59924.1"
FT                   /translation="MNNKKSKKFYDFLKTIKGFKVITIISYIFVAILLAILIWSAVRLS
FT                   YYVEDYYARIDDYNELKQNIIKIFKTKDFRLDSPYNQIKMFKYGSIIGVSSFLIIIINI
FT                   NIFAYWSYSNVYIPELKDKKLVKNWFRNFQKNNKVQKTDKQEQEDLKKESE"
FT   gene            complement(556104..556871)
FT                   /gene="nadE"
FT                   /locus_tag="UUR10_0504"
FT   CDS_pept        complement(556104..556871)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="nadE"
FT                   /locus_tag="UUR10_0504"
FT                   /product="NAD+ synthetase"
FT                   /EC_number="6.3.1.5"
FT                   /note="identified by match to protein family HMM PF02540;
FT                   match to protein family HMM TIGR00552"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59982"
FT                   /db_xref="GOA:B5ZBV5"
FT                   /db_xref="InterPro:IPR003694"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR022310"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZBV5"
FT                   /protein_id="ACI59982.1"
FT                   /translation="MNNDLVKYLQWLKNDFIKFLNDAQTNNIILGISGGVDSALTLAIL
FT                   NDLKKEYALNIYAYFLDIHNSNLDYECVSELKKVYPNIEIINLVDIYNSYRLLINKKTN
FT                   DNYVLYNLKPKIRTNYLYAMANAYRGVVVSNLNYDEYILGFFTKHGDSAADYHMLIGLL
FT                   KKHIYELGAYYSLPTKILNRAPTPSNEDDEHQTDESFFGFTYADLDQFLLYRKIDPTIA
FT                   DMIKKRYEINAHKHFVFDKKKLFLNYKLGTKHE"
FT   gene            complement(556879..558186)
FT                   /gene="cgtA"
FT                   /locus_tag="UUR10_0505"
FT   CDS_pept        complement(556879..558186)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="cgtA"
FT                   /locus_tag="UUR10_0505"
FT                   /product="Obg family GTPase CgtA"
FT                   /note="identified by match to protein family HMM PF01018;
FT                   match to protein family HMM PF01926; match to protein
FT                   family HMM PF09269; match to protein family HMM TIGR00231;
FT                   match to protein family HMM TIGR02729; match to protein
FT                   family HMM TIGR03595"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59760"
FT                   /db_xref="GOA:B5ZBV6"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR006074"
FT                   /db_xref="InterPro:IPR006169"
FT                   /db_xref="InterPro:IPR014100"
FT                   /db_xref="InterPro:IPR015349"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031167"
FT                   /db_xref="InterPro:IPR035101"
FT                   /db_xref="InterPro:IPR036346"
FT                   /db_xref="InterPro:IPR036726"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5ZBV6"
FT                   /protein_id="ACI59760.1"
FT                   /translation="MAFIDKCKIVLIAGNGGDGIVSWRRETHVPEGGPAGGNGGNGGSI
FT                   WFVGNHNETSLEFLKYKKIIRAKHGEKGDIKNQHGANAEDVFINVPLGTVVYDAITNEI
FT                   LADINIDQQKYLVAQGGLGGHGNTHFKSAFNKAPNLYELGELGENIEVVLELKTIADIG
FT                   IIGLPNAGKSTLISSFTNAKPKTANYMFTTLNPVLGTIYRDQNRIIFADIPGLIEGAHT
FT                   GVGLGHDFLKHIERCFLLIHLISLDPNDNSDIISAYETIVNELKQYKQSLVNKPIVLVA
FT                   NKIDQIGALENLQILKEHLKDNQYIKVISALTNLHVDAMLDDVIKIYFDQKKIYEQRLK
FT                   EHLPVDQILKWASDTPKNKELDKTIKIVKVDDHFFEVFGEYLKYWVHRIPLKTQDNLIR
FT                   FNQKLQSINFNQQLLQAGAIAGDSIKIYDITLEFEE"
FT   gene            complement(558189..558890)
FT                   /locus_tag="UUR10_0506"
FT   CDS_pept        complement(558189..558890)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0506"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59730"
FT                   /db_xref="GOA:B5ZBV7"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZBV7"
FT                   /protein_id="ACI59730.1"
FT                   /translation="MIVFFILYGEINLLGFNGIVGANGRWYGEGFKLDEHQQWVVGVKD
FT                   FYHWNPIVYDQLKPKPDAFMIEKMQALVTKITNERNHGVEFGTSIISSYPVWVAMFSTL
FT                   GLAIIVCSILAFSTPKIRWDILTPVVSCWFGMFILIVSGFIPSQIWGYLVRFLILVVAF
FT                   VLPIFIMAKITNAIMNRSKHFETYAADLYNEFKDSEQYYNEFNKKRLELKKRNKANEKT
FT                   KYKVEDDYEGK"
FT   gene            558895..559044
FT                   /locus_tag="UUR10_0507"
FT   CDS_pept        558895..559044
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0507"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59997"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZBV8"
FT                   /protein_id="ACI59997.1"
FT                   /translation="MTTKNDVIKNLYKRGDLKRVLVWKGFLNQEVFECFKFIYYPFYAN
FT                   IVKL"
FT   gene            complement(559058..559975)
FT                   /gene="fmt"
FT                   /locus_tag="UUR10_0508"
FT   CDS_pept        complement(559058..559975)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="fmt"
FT                   /locus_tag="UUR10_0508"
FT                   /product="methionyl-tRNA formyltransferase"
FT                   /EC_number="2.1.2.9"
FT                   /note="identified by match to protein family HMM PF00551;
FT                   match to protein family HMM PF02911; match to protein
FT                   family HMM TIGR00460"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59933"
FT                   /db_xref="GOA:B5ZBV9"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR005793"
FT                   /db_xref="InterPro:IPR005794"
FT                   /db_xref="InterPro:IPR011034"
FT                   /db_xref="InterPro:IPR036477"
FT                   /db_xref="InterPro:IPR037022"
FT                   /db_xref="InterPro:IPR041711"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5ZBV9"
FT                   /protein_id="ACI59933.1"
FT                   /translation="MKYNVMFFGTPEIAKIVLETLFNMPEVNLIGVVSQPDSHFDRKKN
FT                   VVYSPVKQFCLDHDIKLFQPQKIKEIEEEIRSLAPDIIITCAFGQFINQGIIDIPKYKI
FT                   VNVHASLLPKLRGGAPIHYAILNGDLQTGITLMHTIKKMDAGNILFQRSLAINEQTTTK
FT                   ILTLELANLGALMIKEHFLELVKSDLVGIQQDENDVSFAYNIQKNQNIIDFNKPAFFVN
FT                   RFVNAMYDKPIAIMEYNDVLIKVHQIKITNQKSTQKPGTIAISKHQIFVSTQDFNVELL
FT                   LIQLPNKKPLAPKALLNGKNPFSN"
FT   gene            complement(560050..560775)
FT                   /locus_tag="UUR10_0509"
FT   CDS_pept        complement(560050..560775)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0509"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60015"
FT                   /db_xref="GOA:B5ZBW0"
FT                   /db_xref="InterPro:IPR035325"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZBW0"
FT                   /protein_id="ACI60015.1"
FT                   /translation="MLDKQEIIESILQADATKGGNSNFLMILIIIIPIILVVVFIMRKK
FT                   RKQNGENQANVNNKDKSDTNEVWATIKKYLRSIDDKGKEVIDSYVVKRAEPHNLAQMTK
FT                   QQKIDYKNEQKAIKALKTTNPEQYKIEMERIKKEKRAKPKELYVVLFTTRNAKTLVVDE
FT                   PRAIECEVRLVKVNKKENRREIDVVRALDYDEEMLWIEPIKAKDDEIYNKRLEADKKKQ
FT                   QKAAERRQKQLEKQKSKTK"
FT   gene            561028..561624
FT                   /gene="def_1"
FT                   /locus_tag="UUR10_0510"
FT   CDS_pept        561028..561624
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="def_1"
FT                   /locus_tag="UUR10_0510"
FT                   /product="peptide deformylase"
FT                   /EC_number="3.5.1.88"
FT                   /note="identified by match to protein family HMM PF01327;
FT                   match to protein family HMM TIGR00079"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59800"
FT                   /db_xref="GOA:B5ZBW1"
FT                   /db_xref="InterPro:IPR023635"
FT                   /db_xref="InterPro:IPR036821"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZBW1"
FT                   /protein_id="ACI59800.1"
FT                   /translation="MYNVKFLDLLNANLKPNPQWIFKDPHPVLREVTQDIQGYELSKDD
FT                   IYYLKKMVRYIDVCYHNQAKKYKIRAGIAIAANQVGWNKRATYIHFDDGNEEYHYLLIN
FT                   PHITKRSSQRAYLNPGEGCLSVDHDRSGYVIRYEKVHVKAYDLISEQFIDKEFSGIIAI
FT                   CIQHEIGHLDAGLYYDNINQDQPFYTEPDWVKIGR"
FT   gene            561631..563557
FT                   /pseudo
FT                   /locus_tag="UUR10_0513"
FT                   /note="DNA topoisomerase IV, B subunit, degenerate; this
FT                   region contains one or more premature stops and/or
FT                   frameshifts; identified by match to protein family HMM
FT                   PF02518"
FT   gene            563563..566130
FT                   /locus_tag="UUR10_0514"
FT   CDS_pept        563563..566130
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0514"
FT                   /product="DNA topoisomerase IV, A subunit family protein"
FT                   /note="identified by match to protein family HMM PF00521;
FT                   match to protein family HMM PF03989; match to protein
FT                   family HMM TIGR01061"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59891"
FT                   /db_xref="GOA:B5ZBW2"
FT                   /db_xref="InterPro:IPR002205"
FT                   /db_xref="InterPro:IPR005741"
FT                   /db_xref="InterPro:IPR006691"
FT                   /db_xref="InterPro:IPR013757"
FT                   /db_xref="InterPro:IPR013758"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR035516"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZBW2"
FT                   /protein_id="ACI59891.1"
FT                   /translation="MSVNQQKIINTPLDNIVGESYAKYAKYIIQDRALPDIRDGLKPVQ
FT                   RRILYAMSELGIFHDKPYKKSARTVGEVIGKYHPHGDSSIYEAMVRMSQDWKNNLCLLD
FT                   IHGNKGSIDGDNAAAMRYTETRLSKIASVMLTNLKKDVVKFSPNFDDSEKEPSILPSLF
FT                   PNLLINGATGIASGYATSIPPHNPNEVFDALIYRIDHPDCSIEKLIKICPAPDFPTGGE
FT                   IHDLNGCANAHKTGEGKFVIRASIEFKTSEAKINQIIINSIPYETNKALIIKEIEDIIY
FT                   NKEVAGLIEVRDESDAKGVSIIIDTKKDVNLENVKNYLYKKTSLEISYNTKFIAIVHRT
FT                   PTLVSLSTYLDAQINHSLDVINKVDLYDLNKVLLRIEIVEGLIKCVDLIDEIIKIIRAS
FT                   DSRQDAKNALIQTFAFTNNQAEAIIMMRLHNLTRTDIFDLRNEWESLQQQAKILKERIK
FT                   SLQVRKNYLKQKMIEFKKEFGYQRKTKLFDEFIKAEVNEDQMIEKQSLNLVISRDGYIK
FT                   IVSKKSFESSKYDELGLKTNDLLFYHNVINSHDRILIITSKAKLINLIAHKISCMRWKD
FT                   VGEHLNNYAKFDANEKVVAVYVCNEQFKVDEHQLVLGSKLNLIKRIELNELDLNKNSKQ
FT                   ISIMKLNENDGLISANLIKKDHNQFVVAISKLGLVLMFLVHEINCLNRLAKGIKIMKLK
FT                   PNDEISSILIVPNNGYSIQLFLDQGNKCFSISELKLSKRAMTPSPLYLPTKKAQSVLAA
FT                   FLVGNENVFYLLDEQQKINPYYLPNPKPIKLNSKINKYENDLIITDVVKDSFLSDSVIS
FT                   DFKKISMYANEFDSELLKTNENQEQDDLQLELMRKKKMINDNK"
FT   gene            566117..567189
FT                   /pseudo
FT                   /locus_tag="UUR10_0515"
FT                   /note="putative membrane protein, degenerate; this region
FT                   contains one or more premature stops and/or frameshifts"
FT   gene            567263..567457
FT                   /locus_tag="UUR10_0517"
FT   CDS_pept        567263..567457
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0517"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60124"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZBW3"
FT                   /protein_id="ACI60124.1"
FT                   /translation="MLIIEPENIKFRTQISKPKLVSITNVDSVNNNQIDINVKFDNMSS
FT                   VYNNKILSLTYEYLNNGRK"
FT   gene            567908..568093
FT                   /locus_tag="UUR10_0518"
FT   CDS_pept        567908..568093
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0518"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60319"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZBW4"
FT                   /protein_id="ACI60319.1"
FT                   /translation="MHFNKKPHNDLNTNINNSAQNIVYEYDDNSNEVFSFNLFDNCGIS
FT                   WLTDQKLMSIYKYWIW"
FT   gene            568209..568448
FT                   /locus_tag="UUR10_0519"
FT   CDS_pept        568209..568448
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0519"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59992"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZBW5"
FT                   /protein_id="ACI59992.1"
FT                   /translation="MRSKNDGKLYYSEKGIIYNNQNYRNYAEQTEFRLKQNKNWPTGEY
FT                   EIYGVKYWTNKLGEANAYIAPAGYAKSIISIDLR"
FT   gene            complement(568499..597808)
FT                   /locus_tag="UUR10_0520"
FT   CDS_pept        complement(568499..597808)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0520"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF07198"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59754"
FT                   /db_xref="InterPro:IPR009849"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZBW6"
FT                   /protein_id="ACI59754.1"
FT                   /translation="MDSKKSKKVPITKSENNKKNRKQRLFFLLASLNLAWAGVITGIVL
FT                   RLKDSDQLSDNDFYGFNDDGDLIIKGQLPKTYANKYVYGVFVDENGKEHKVEAKVDPYG
FT                   KFEFDIKTLPVPGKYKLNKIVDSNNNVIHENDKLRPEQKISISKPTLVNIYEDQKDEKH
FT                   IEAKVNKVLVNKTLIARFVDQNNQVHTIEARVGLDEKVDLDTSGLKDGNVYHLTDIILR
FT                   DSNPITKVVNTNDIDPSFKKIDKTHTYNKDGNVVLKVDLTNKIKNPALSIAVFRDENGK
FT                   EHLIPATNAKNGAAHFDTKKLPLNHKYKLDRIIDNVDLNKVLVPNNELVNEHKFSIEKP
FT                   TKAGVKFVENKKVYEVDLGTQLKNTPIELTLKDLNNKKIKINAKTDEMGRAVFDVSSLG
FT                   DNNLYEVVGIKKPNQVGVTNLQDIPYHNKIINNLNSDALNTPYQYTKNGDINLIAKVAP
FT                   YYVNQQVYGIFKDQNNKEHQVLAKVKKDGTVEFDTGLLKNHDNYSLDRIVSISNPKNVL
FT                   VSNFDLARKQKQLIKKPAAKPSIDATKKAQILENLNDDLINQKLIATFVDNNNKEYKVI
FT                   GVVDQNNKIVFESDSLPKGYIYHLSKVENNDLNKVVNTNDFELKDITIDKRYPSSPTSR
FT                   PSFEYDNEGNLEIHTELPKELSDDLKQKAQTNGSTKAIVVDQNGVEHEVETSVDTNGKV
FT                   IVKIKNLPNGDPSKPNTYTLKKLVLKQNGQPNTDLIGEKQLNGDNHTSFQKPTVVAKVK
FT                   ENNDYEISFSNPNLVNKKIKLTFKTDDNDSNTKTIEATIGLDGKANFKTSDDTTFEPNH
FT                   KYTLTKIEADNKNVANIEEIPLVDRIINKQKNGNINGDNKHEFNIPNQKNKDLIGIYKD
FT                   KNNNEIHVPIKPDDKGKAIVDPNNSPFDSNKIYEFDKIIDPSQHPNKTILDKNGINKDV
FT                   GTINDDLTKARKIVLKTPTISNLTPNAVNLQISLFDLNKLSHNRQFALTIAKVSDLSDT
FT                   QKYIATYDPETNNYKLNFDFTHLDANTKYKVVDVELLELNNKEKPIKLVKDNVLNFEFT
FT                   TNSIIRINEPIWTKFNANVKANNDTTLTFEINDEHNILKNDQKIYGELSLLNNKLEDLN
FT                   EPTLSISFNKTNGIVELKGTSLKGNSKYSIKNLYYLDENNNKVYLFKNDVTKYEQSFIT
FT                   NQNAIDVSFDKNNSKQEIFANSTNLFVDYNDQDQKLQIDNPIQLEYEYLENGKPIIQIA
FT                   YGKVIENNQIQFSLFGLKEKTVYTLKRFSALVKNPDSIKPYIFNELDTNANSFETAYAK
FT                   TTLVNLVTKDHFANNEKVLGQALISIGTNFKDNQQIQLIYESTDHKEIKSKPITLLKDQ
FT                   KSYSFEFEQLLKNRTYNFKKWVYVNNNNEDGLTLSHIKDSFSIDPSNNAVSLANNNLSI
FT                   INRSLENNTNSSIIAKLEINDVDDILTTTDQFDVFYKSTNSANDQEWLGIETQIIVENN
FT                   KKYFQFKLSGLSINQNYAISRIVFKNKPQKALFNVANNKNNNVIFTDDTLSKISFKNEI
FT                   NGLKYTPQSIDETNKSVPIQVEIQADDYLLNNKYLRIQFKRLSDNEIVWSEPTLFNKNN
FT                   LTINLNNLINNRAYEFVGLYYFDNNTSANAVDEQKINFTSQITPSNIVFKPSTTRIDVQ
FT                   TNSFATNTQSDYASVSFDLVSNDQVFENDQVVMATFEAVNGDKTQTIEQEAKLVYKNNK
FT                   SNVIYNLSQLQESTKYRLTKVWFKTKPTKAYTNLNSDTNNVVYEYKNNAVEHSFTTISY
FT                   GHQVVAITSNDEIATTSQNIQVKISGLKKEWRTNTKAKIIYSSNASNENDVVSQEITLD
FT                   STTNTYTFTLNNLNYGRKYTFKKLELSFGNPQQTIDFPLSNSVNNNKDSFEVLSQNTIA
FT                   PINLVETQDRAFNKLNEAKIRIQVNDNENLLSQDEVATITYDINRSVDAKVIVENSKKY
FT                   LEATFNNLVLNKNSVINKIEFKTKPKNAPSAIGKNKDNVIYNNALVSNFNLVINNNLKI
FT                   TTSTTIANPQEVTVAELSNKTINLEGLFNQKIAQTLTFKAKYVNVNDETDVVYSEILQP
FT                   TDITYTNGVSKLPLVFKTLVSNRLYKLDSIYYFDKNATSQDLNESHKVLIDTNNQDLQI
FT                   KTIKGQTSFTKKGSNNWVNAVPDTQVATFKFLLISQDQDTLDAQTRVKVNFSNNKSFEA
FT                   NLKQENDQWVVEGSITDLVPSTEYSLESVQIINKPKKANEVPVVEIQNKDQIKFTTPAN
FT                   KTVLESITPNKLTLQLDNNSSNTNKTVDFSIVVSGVNKQYASKKIKLIYAYGNGNDEQG
FT                   TIETTTTTLVENQTNYNGLTLTPSIPNRIYKFKKIQIENSVGSNKFIDLEHDSNLENSI
FT                   TYAHSKTNIVVDNNNFATNQTDNSVTLTFKVTSHDQVFEDNQKVKITLTPDEGQVITQE
FT                   INLSNVTNNNEVTLTTNLTGLNAETTYKLTKVEFVQKPSKAYEDLNSGNIVYEDPSSTH
FT                   TFKTNKANNKVISVTSDPITNTSSHEITMTINSIERDWRNKKVELVYSSNVSGEEDIKT
FT                   SVHLVNNNNQDVILSDTKKEYKFTLSNLKPGRRYSLKQVNVLNVNQNQSVEFTKDSGVT
FT                   NSFDVNLQNPISVKNIEEYQDRVANELQKAHVRFELEDIDNILKTNDIAEITYNSNVKA
FT                   TGTVVVEGNKKYLQATLSGLDFNQNAVINQIEFKTTAQTHTKVGANNSNIVYDKTTQNA
FT                   KVFEINNDFKVIGPLSSNSNTTQNMVANNKYIVSSTLEFKVNPHISKNLRFKLKFQDNN
FT                   GNIVYSSILPSNLITNNNGQDLINFKLTNLNSNRSYTFVDLYYLDSSANDNIDENKKVE
FT                   KANDIKRVIEIAPDTTTITKASDGWIVSDDSASFKFEINSLDGNDVLENLSAIVTFKNG
FT                   NQKLLPVSAIVTKEQNKYIIKGNLNNLNPNTTYTLDSITLTKPPKTYCSLLLNDYNNPL
FT                   ITIKTEVGPTTLVSLNATSPISTQTQTINAVVSGVNSKYTGRKIKLTYVSNNNGNESIS
FT                   AEQTLAKDQVNYSFSFNNLITNRNYRLHKVEIESSVGSNTFSILTTSVSNNFITQPGST
FT                   TFEYTNPTDSEIQTNQVSLPKLKIKTTDRALENDQDIRIYFKSDTDNQRQLVWTRDIVN
FT                   VVNNGNESSISNPVFDNLKDETTYYIWKVELVSKPRKAHTNVNDSANNIIYEYKTGMQK
FT                   HEFTTKVADHKVNNITYTTQPTPTKTQNINVTLSGIKNEWVNKQIQLTYVSSDGSKVTT
FT                   TPQNLEKNKLSYDLIISNGLKFNRSYTLEKIELINGQDKVELPKNNNLNNSSFNINTTN
FT                   TVSVSGIEEYEDRQANVLTTAKVRFELNDADDVLSDNEQASITYTTKDNNNLITTGTIR
FT                   KDTNSNKKYLKATLTNLELNKTASIKTITFAQKPARAAFNIGNANKIYDNTTSNAQALS
FT                   ISNEFKVSGPNANDLDAKKEINYNEKDNVSSTIELTLNKHISKNLKFKLKFTNTKGDTI
FT                   YSKVVSDDQITKSATGTNKYTLTFNLSNLSSNQLYTFAGLYYYVDNNISANPIDKNKVI
FT                   NDNDVNRTILVKPGATTIIKQEPGLTNTSTKVFFKFKVDTQDLGVLDQSTPVTVVLVDD
FT                   KQQEHSLTTNISQINNEWIIKESIDHLVPETTYKLKSLTITKPDKAALDLNVKITNQDQ
FT                   ITYTTAPGDYKATKIKAKSPSISNTTQIVDVTIDGLRKDWINQKLKLTYKTSNNEVASG
FT                   LVTLEANKLSYEVSLTNLQPNRTYTLEKIELVNENTVEAFTKDASISDSFTVLGQNHVG
FT                   VVNVSEIADREANNLTTAKVQFELNDNDDVLTNGEQAEITYDNNRTTNGIVKTVNGKKY
FT                   LEATLNNLVVNYETYINKIEFKIQPSKSGSYIGLNNSNVIYNDSSLRINNDLIVSGPSL
FT                   NQKQTFEPTQKNNVSTTLELKVNDHLAKNLHFVAKFVDNNNDEVWSTPVSSTAITTSGD
FT                   KKIITFSLSNNLESNRLYTFKELYYSPTSPTNNSSLTTKFLKLNANRFVEIKVDKTIVT
FT                   KENSWNPPKHNSAHFKFSVTTNDGDVFDNSLDATVTFKDSQNHLKQKTVKLKKDASSNK
FT                   WIIEGNVDNLNPETKYSLDSITISKPSKTNSGLKIEITNKNQINITTAQSNTVLTQVSA
FT                   NDLTWNDNNQNQTQSVNITLSGVNSDYANKKIKVVYTYGNDNVEIESQPIALTLNQKTY
FT                   SLILSNLLPNRQYTFKNIKIENTANSGTYIELQKESNVSNSFVYNPSTTSIEYGTNAAK
FT                   EITANIAKVSFKIKTNDQVLENNQVVKATFVAVNNANDQKIVEANLSSVNSSFNEGQLE
FT                   FSLSGLTEETQYKLIKVEFEQKPTKAYKALNDQNNVVFDNANSTHTFTTTPFAHQVTNI
FT                   SSNDSINTTNQTITMTITGIQNAWINKKAYLTYTSNDGHSITTDEISLEKGKQTYNFTI
FT                   NNLKRNRTYTLNEIKIKDVNAQDISFDKQSNVNDTFTVTASANPISVISVSESTDRAFN
FT                   KLKEATVKFELTDTDDILSANDQATITYSSDGTNSLEVNAQVVIDSSNNKKYLQAILSN
FT                   LVFNKDTIIKKIEFKQKPTKAINNVGVVYDNTNANNNQTLSINNDFKVVGPTNNQIQDV
FT                   EYTNKASVNSTIELKINKHISKNLKFKLKFTNNKNDVKYSEVVQDSAIVKGTSDNHTLT
FT                   FVLSNPDSNQLYTFNEIYYLDKQANNDNVNEQQKLEKNNNVVKKIHVKRGATTISKHGN
FT                   WSKAGVNSANFKFKVESQDTGALANTISATVSFEATNKNIKTKTVNLVNEGGNWLIKGS
FT                   IEGLEPDTTYTLKNITLTKPANTQTDLNVNISGKNFISLTTQPADTVLTSINSTDSISN
FT                   PSQTINVTVSGVNDKFNNRKIRVVYKYGSSLINSSTTPLSNTTNDYTLSITTGLIPNRN
FT                   YVFERIEVETAVGSNNYEKLTHNPGLNDSFVYEPSVSSIEWNKSNAVTNIKAKGANISF
FT                   KIKTNDQALANDQEVVAVFKKADGTGQLEFTRSLSSVNVNGTEGTVTYNLSNENHFDEE
FT                   TKYQLFEVKFKTKPAKTHKNLNTTGIIYTKRNGDDYSFTTIAGDHKVTAISNAKVNNQN
FT                   TKQNITLTLSGVKNEWVGKQIKVIYSSSDGSSVESQPLSLQKDKTSYTLQLNNLKPNRL
FT                   YTLNGIKLVNNQTITDFPKNNNLTNSFIIERTNAVSATSIIETNDRLASALTSAQVKIT
FT                   LVDPDNVLVGNEQVTITYDNNQTVDGTVIVDNGNKYLQATLTGLVLNTNTTIKTITFKQ
FT                   KPSYAGENIGISKSNNIIYQNTNSSATPLVINNNFEINGPLASNNAESVKNVSATNAKN
FT                   TNAISLNLNSNINTHISKDLFFKAKYVPINDQGNESIYDASEAVYSNVLSADDIANNKI
FT                   SFNLGNLQTNRKYKLKAVYYLTSRNTNVNESNIVTLKSNVKSEIIVAPGNSTIEKYGDW
FT                   SQTPLANKSTKISFKLTSADGNVLDTNIVATVVYESTTGNPKDTKTLTTNLKQVGNDWI
FT                   IETDLSNLKPQTTYTLKSISISKPSKTHTNLLISTLPSIDIRTQVADTVLNELSATSPL
FT                   TWVSNNANNQTISATFSGVNDSYANRLVKLVYQYNYRGSMVQVESNAITLQKDQTTYSV
FT                   SLPISVPNRVYSFVKAKIQTTVNGTDYVDLNTKANLANSFTVNPGKTSFEFTQPTSDQI
FT                   TYQGLNSLSIKIKSEDKSLVDNKEVTVWFRSDNDSRVDTIKWTRKLANTNGDGSEASLA
FT                   DLVNLNSFKEETEYYIYKVEFHNSDKGNLPYGNVPANANKVVYEWRQGQEKPYKFTTKV
FT                   RDHKANNITSNSSINTTTQNITMTVSGIKNDWVNKKVQLVYTSNDGHVVNSNEVTITKP
FT                   TNYNSSNDNNTTSTFNFSLNGLKHNREYTLTSIKLIGPNNTKVDFPKNDALTNKFSVNP
FT                   SQAISATSIVETQNRNANVLTSAQVKIALTDVDDVLVVDDQATIVYDDNKNATGKIVVE
FT                   GNNKYLQATLSELVLNQDAVIKTITFNTKPTKAHANVGLNNLNKIFDSTTNNSQQLVIK
FT                   NNFKVSGPLSNEASKTMNVAYDNKNNVSISLDLDVNEKIVPNLRFIARFKDNNQQNKDS
FT                   VSIASSAIKTVGNKKVIEFNLSSLDANRKYSFDELYYLVDQNNNTINSNHKLTKANNVV
FT                   KEIIVAPGNSTITKTNDSNNVGPNSFDFKFKIETQDGDVLENSLQAKVKFKGSDNTNKE
FT                   QTVNLVKEGNNWFIKGTLSNLSPEITYTFQSIELLNKPTKTHTNLKLVQPTQPISIKTS
FT                   PGDFKVTSITSDATTNGTSHNITVNLDGVNDGWVNKKLKVTYKSSDGQDIVGEATLSKT
FT                   NKTYTINLNGLKPNRAYTFNKVELVDGNNKTTFAKDNSVSDSFITNSKQYVSVVSVSES
FT                   TNRNTNNLKQATMRFELSDPEDVLTDNETATITYKNNQEVVGTVVSEKGKKYLQATISG
FT                   LVFNENLEINKIEFKTKPQKAGTNIGANNNVIYELTNSTPQNNKLIINNDFKVVIQNDS
FT                   QTIEHTPNQTSQSIKVKINKHISKNLKFKLKFTNTKGDTVYSDVLDDTKIKMSGSDQIV
FT                   EFSLKNLLSNQQYIFNGIYYYSDNNTNATPQESNKLTQDNNVVKNIITKPKDTTISKHG
FT                   NWTVSENSASFEFTVTSLDGNDVLDNLEATVVFKKDNQTKQTKVNIIKQGSQYLIKGNL
FT                   SGLSPNSQYTLESISLSKPTKVHSDLKIVYSNKQNITFTTEVDATTLVSVQTADSINTN
FT                   TQTVTVNVSGVNSKYAGRKLKLTYRSNSGEDIHGELTLEKNRTSYSLTLNNLVLNRQYS
FT                   LTKVDVQNGLNEVEYTNIKNNVVDNFATQPGNSSIEWNAQTSATEISPTGVKISFKVKS
FT                   PDKVLENNQTIRFWLAPANSVSDQNSWKMFSTAKLSQTNNDKTEATASLDLRSGNYFDE
FT                   ETTYKLVKVEFVNKPTKAYQALKSTNTNNNIIFENQNSSYQFTTSVGDHKVSDLIYTTT
FT                   PGSTLSQNINLTLSGIRNAWVNQKVKLTYTSSDGTSVSSNEVVLTKSKKSYDFVINSGL
FT                   KHNRTYTLQKIELINPNNQNAVSNLPQNNGLNKVFTISSNNKVSVVNIVETQNRAATAL
FT                   GTANVEFTLNDQDDVLTNGLTVTITYNTNKTVTGTISVANGQKKLSATLTDLALNRITT
FT                   INKIEFSQKPPKAAVAIGHSNTNKIYDSTIDTNNALTINNNFKLSGPSTNVQITKNASE
FT                   KASVTTTLELDVNEEIIHNLKLKAKFTATNGDVVESEVINGNSVVTNGSQKTINAVLKN
FT                   LKANQLYTLTDLYYNLNNNAIVEANKVVKSNDSVSRTILISPGNTTIAKEGNWSEPSDT
FT                   EATYKFSVSTEDNNGTLSNGITATVKFKNGSNTIVSAANLAKESDKWTISGKLTNLTPN
FT                   TKYVLEDITLSKPSSVHDNFRINITNKPNISVTTQVGDPVLKTISKKSDNANNQKTISI
FT                   SLSGVNSKFANRQIRLVYKDNNDQVYTSGTVDLVKGKNDYDLVLNNLVSNREYRFDKIE
FT                   VNTIPNGAEFNSLQKENNATNTFTINPGNTSIEWTDASATIVGTRGVNFNFKIKSDDKI
FT                   LENNQEVIAWFAPKESIDNQSTWLQYTRPLSNVNTDKTEATWSHDLSNSNDFKEETTYQ
FT                   LVELQFKNKPTKAKNNVNNKENNIIIDNINGSNYQFTTKIGDHKLTSITSTPSINTTSQ
FT                   DVDLVLSGVKKAWVGKQLKLVYSSSDSSETISATINIEQNKTSYRATLSGLKRNRTYTL
FT                   TGVNLVDDTSVTTFPKQTNLKDSFITTRTAAVSAVGIEETSNRVANNLKSTTVKIVLND
FT                   PDNVLKANDQATIRYGNNQSVTTNVVVSGNQKYLQTTLTNLEFNTNTNISNISFATKPS
FT                   VAAQNIGTSVDNNIINNGSSPTLTISNDFKLTSPTSNIRIVKEANQKNNVQISFQLKSN
FT                   PKIINNLLFKAKFRGTNNEIVETDVVNGSSLNNTNGVSTINFVLNNLKANQLYTLVDVY
FT                   YLTDANSNNIVDANIISKENNVSREVQIKPSSSTIQKSGEWPTTDTSVNFKFLVTTNDN
FT                   DGELGTDATATVTFNKNGGSSKTTTVNLSKEGNKWFIKGELTGLDVDSTYNLSTISVTK
FT                   SSNIYTNISATLYGASFKTQPGPTVLNSLTVANDNINTNSQTINAVVSGVNDSYNNRQI
FT                   RLIYKDNNDATYETNWVSLTKNNKNYTFTLNNLPANRSYRFDSVKIKNTNDNNSSDLQK
FT                   ASGLTNTFTRQPSQATIEYSAPSALGANNVTFKLTIRSDDQVLANGQQVSVYLLPKNSN
FT                   SIDQNFKWTRTLTNVNNNGSQGDLSIDISSGLNEQTEYKVVKVEFTQKPPKAHTNLLTN
FT                   NVIYEDVNSTHKFKTLAGPTMLNSLSVTNQNISTDIQTISATFSGVNDQFKDRRVKLVY
FT                   QDNNNQTYETGTVTLVKDTNTYNFVLNNLPANRSYRFVNVKINDRTNSVNFTDLSKATN
FT                   VNNTFKRVPSTTSIEWTNPTNITHNGANLSLKLKSADQVFETNQDVVVYLVKTSEPNGT
FT                   PLQWTRKISSVNQNKTEATINVDISSGLNEQTEYKLLKVMFTSKPRLANENLSPGNTIP
FT                   NTNANYKFTTEAGPTILNSLSVDQSTISNSNQTIHAVFSGVNNEYNNRKVKLIYRDQNN
FT                   EKYETGLITLTKNKKNYDFTINNLVGNRNYTFEKVQISSTSNDNSFVDLSKNNSLTNIF
FT                   KRSPSATSIEYSAPTTLGATNATFKLTIKSADKVLANDQEVSVYLLKQGQTQIIPSFKW
FT                   TKRLSNVKSDGSQADLNIDISSGLEEQTEYRVVKVEFKQKPPKAYENLLTNNVVYNEIN
FT                   SNHKFTTISGPTTIRSISSTKSEVKETNQTINVVVSGVNNSYVGRKIKLAYKDNNGTIV
FT                   WTNEVPLAANNKKDYSFNLNNLTTNREYTFFKAQITNTNNSNNYSDLTTTGITHKFGVT
FT                   PYNSYLTINSSSWATNISENGANISVDITSTDQVFENDQQVEATFVSMKSPQETKKFVG
FT                   KLSGVNVNNKNNAKITWILTGLKPETEYKLTNVKFVNKPPLAKWMLTANKNNVVFGGAQ
FT                   TYKFKTLNAKPTIVSIVRGDVNNQGLITLFNPNMELGKVDVTLSRVANQFNNKNVRIVY
FT                   SYIDNNNGHRTNWESDPIKLTTNNANKLYQFSLRRLLPNRRYKFERIEIQNGSSWETFI
FT                   DNTNKQNEFNYKPSQTRISIRSGKTFKNDTKVNEATVEFGIDSQDKFFEENQEYRLIFR
FT                   STRDTSHTKEYTARVSEVWNNNNSANLIHKLTNLDELREYYLDKVILVNRPSKLAYGPN
FT                   ENANNEIFSSSASSERYTFMLSGNYNATKEGVWETPTTTSAKYKFNITTTNNGTMLNTN
FT                   SKFELVFNKVGDNTKSFTQVTNLVREGYKWILKGELFNLESNTEYVLSSIRVSRPMANG
FT                   TFDLVYNTNINIIEPNKAKFKTQDVTPSIVSLTSTNINETTQQINLNLQNVDSRYNNRK
FT                   VRLSYVYNDQGQKSITKEISLVGRRQNYEIEFNNLIANRVYTLNKIELLNQNNTTVQEQ
FT                   FDKSAQQIQKSFTLEPSRTSLSNYTYENDQGYKYLMFEISNKDKAFILAQGQSIIPKVY
FT                   IKNVTKNIEYNLDYFASPEITQDPITKKIIMKIYIGSTNDLSEENEYQLMKVWLNSKPN
FT                   NDLNKNINNSNQHIIYEYNAKPNVNKLYESDAVYKFTQSRFIGTFKSIIKNEFEITNYP
FT                   ERHIKFGGYFENIFNPGDEPVLNARVVYKNLRDNKLYYSSEGKLSTEGNNTIGFNGWSD
FT                   FRVNKQNKFTSGTYVFWGIKYWGKTGEQDAYIAYIDGVVSNPIGLAEI"
FT   gene            598411..598578
FT                   /locus_tag="UUR10_0521"
FT   CDS_pept        598411..598578
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0521"
FT                   /product="MTA/SAH nucleosidase"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60115"
FT                   /db_xref="GOA:B5ZBW7"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZBW7"
FT                   /protein_id="ACI60115.1"
FT                   /translation="MELAAIAHVCTRMLTPLVSIKMVSEHIMHPSSNQEQFNKNLVLID
FT                   KWFNKYLLEC"
FT   gene            598719..599315
FT                   /gene="def_2"
FT                   /locus_tag="UUR10_0522"
FT   CDS_pept        598719..599315
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="def_2"
FT                   /locus_tag="UUR10_0522"
FT                   /product="peptide deformylase"
FT                   /EC_number="3.5.1.88"
FT                   /note="identified by match to protein family HMM PF01327;
FT                   match to protein family HMM TIGR00079"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60189"
FT                   /db_xref="GOA:B5ZBW8"
FT                   /db_xref="InterPro:IPR023635"
FT                   /db_xref="InterPro:IPR036821"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZBW8"
FT                   /protein_id="ACI60189.1"
FT                   /translation="MYNIKFLDLLNSNLKPNPQWIFKDPHPILREVTQDIEGNELSKDD
FT                   IYYLKKMVRYIDVCYHNQAKKYKIRSGIAIAANQVGWNKRATYIHFNDEAKEHHYLLIN
FT                   PHIIKRSSEIAYLNPGEGCLSVDDDRSGYVIRNKKVHVKEYDLISEQFIDQEFSGIIAI
FT                   CIQHEIGHLDAGLYYDNINQDQPFYTEPDWVKIGR"
FT   gene            599322..601250
FT                   /gene="parE"
FT                   /locus_tag="UUR10_0523"
FT   CDS_pept        599322..601250
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="parE"
FT                   /locus_tag="UUR10_0523"
FT                   /product="DNA topoisomerase IV, B subunit"
FT                   /EC_number="5.99.1.-"
FT                   /note="identified by match to protein family HMM PF00204;
FT                   match to protein family HMM PF00986; match to protein
FT                   family HMM PF01751; match to protein family HMM PF02518;
FT                   match to protein family HMM TIGR01058"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60256"
FT                   /db_xref="GOA:B5ZBW9"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR005740"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZBW9"
FT                   /protein_id="ACI60256.1"
FT                   /translation="MANKYDGSAIKILEGLEAVRKRPGMYIGSTSSAGLHHLVWEIVDN
FT                   SIDEVMNANAKNISVVLHEDNSISILDDGRGIPVDINPQTKISTVETVLTVLHAGGKFD
FT                   ESAYKTAGGLHGVGSSVVNALSAWLICEVYRDQKIYQAKFSNGGHIDQPLKVIGTTKKT
FT                   GTLIHFLPDPLIFKNLFFNPNTIKERLHESTFLIKDLKISFEDKINNKKYEFINDQGLI
FT                   DFIKFINETKKTFSDVIFFKNTINKIDVEVAFQYSDQNNEIMVSFANSVKTSEGGVHEN
FT                   AFKNALTSVVNNYARKHDLLKEKDKNLEGDDIREGLSSVISLRIPESLISYEGQTKNKL
FT                   FTPEANEAVKKTIEDNFSFWLEENKTQALDLVNRAIVARDAKLAAKRAREETKKVKKIK
FT                   EERGMGGKLTPAQSKDPTLNELFLVEGDSAGGSAKLGRNKKYQAILPLRGKVLNVLKAR
FT                   LVDVLKNEEIASIFTCLGTGIGAEFDLKKLKYHKIIIMTDADTDGSHIQVLLLTLFYRF
FT                   MRPLIENGNIYIALPPLYKLTNKNTKKFFYAWDDVELDQLKKEQKNYEIQRYKGLGEMN
FT                   ADQLFETTMDPSKRLLLRVNINDILQAERQINTLMGNDVSIRRQWIDNNIDFSVIDELQ
FT                   INNEESK"
FT   gene            601256..603814
FT                   /gene="parC"
FT                   /locus_tag="UUR10_0524"
FT   CDS_pept        601256..603814
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="parC"
FT                   /locus_tag="UUR10_0524"
FT                   /product="DNA topoisomerase IV, A subunit"
FT                   /EC_number="5.99.1.-"
FT                   /note="identified by match to protein family HMM PF00521;
FT                   match to protein family HMM PF03989; match to protein
FT                   family HMM TIGR01061"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60320"
FT                   /db_xref="GOA:B5ZBX0"
FT                   /db_xref="InterPro:IPR002205"
FT                   /db_xref="InterPro:IPR005741"
FT                   /db_xref="InterPro:IPR006691"
FT                   /db_xref="InterPro:IPR013757"
FT                   /db_xref="InterPro:IPR013758"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR035516"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZBX0"
FT                   /protein_id="ACI60320.1"
FT                   /translation="MSVNQQKIINTPLDNIVGESYAKYAKYIIQDRALPDIRDGLKPVQ
FT                   RRILYAMSELGIFHDKPYKKSARTVGEVIGKYHPHGDSSIYEAMVRMSQDWKNNLCLLD
FT                   MHGNKGSIDGDNAAAMRYTETRLSKIASVMLTNLKKDVVKFSPNFDDSEKEPSILPSLF
FT                   PNLLINGATGIASGYATSIPPHNPNEVFDALIYRIDHPDCSIEKLIKICPAPDFPTGGE
FT                   IHDLNGCANAHKTGEGKFVIRASIEFKTSEAKINQIIINSIPYETNKALIIKEIEDIIY
FT                   NKEVAGLIEVRDESDAKGVSIIIDTKKDVNLENVKNYLYKKTSLEISYNTKFIAIVHRT
FT                   PTLVSLSTYLDAQINHSLDVINKVDLYDLNKVLLRIEIVEGLIKCVDLIDEIIKIIRAS
FT                   DSRQDAKNALIQTFAFTNNQAEAIIMMRLHNLTRTDIFDLRNEWESLQQQAKTLKERIK
FT                   SLQVRKNYLKQKMIEFKKEFGYQRKTKLFDEFIKAEVNEDQMIEKQSLNLVISRDGYIK
FT                   TVSKKSFESSKYDELGLKTNDLLFYHNVINSHDRILIITSKAKLINLIAHKISCMRWKD
FT                   VGEHLNNYAKFDANEKVVAVYVCNEQFKVDEHQLVLGSKLNLIKRIELNELDLNKNSKQ
FT                   ISIMKLNENDGLISANLIKKDHNQFVVAISKLGLVLMFLVHEINCLNRLAKGIKIMKLK
FT                   PNDEISSILIVPNNGYSIQLFLDQGNKCFSISELKLSKRAMTPSPLYLPTKKAQSVLAA
FT                   FLVGNENVFYLLDEQQKINPYYLPNLKPIKLDSKINKYENDLIITDVVKDSFLSDSVIS
FT                   DFKKISMYANEFDSELLKTNENQEQDDLQLELINEKEEND"
FT   gene            603814..604899
FT                   /gene="yqeH"
FT                   /locus_tag="UUR10_0525"
FT   CDS_pept        603814..604899
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="yqeH"
FT                   /locus_tag="UUR10_0525"
FT                   /product="ribosome biogenesis GTPase YqeH"
FT                   /note="identified by match to protein family HMM TIGR03597"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59797"
FT                   /db_xref="GOA:B5ZBX1"
FT                   /db_xref="InterPro:IPR010914"
FT                   /db_xref="InterPro:IPR019988"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZBX1"
FT                   /protein_id="ACI59797.1"
FT                   /translation="MITNKKCKGCGAFLNDEINTIGYTPKLNDTKTNLCQRCFKLIHYN
FT                   KLEKVHTNLNKNIKNTIDNLDFSNLQIFMVLDILDLEHTIIDELKKYQEQIIFLVNKID
FT                   LLPHRYNSELVNENVIKTLVDHGFNNPQIVYVSTHSNTSLKKVMDCIKNATNKKQKSIF
FT                   LGKSNVGKSSLINALLALNKIKTKLTISSYTNTTINLNKINLLEHQIIDAPGVCFNENI
FT                   LNYVRDEDNKSIMISYGAKAINYQINPQQAIMISGLVGVQYLQGQKTTFTLYVSSQLDI
FT                   HRCKLENFITNFNNRYLLAKFNYVDQDIEFIDHTIALNKNQKTNICIAGLGLLVINANA
FT                   EQICIRLPKCVGIKVAKYAII"
FT   gene            604927..606105
FT                   /gene="nadD"
FT                   /locus_tag="UUR10_0526"
FT   CDS_pept        604927..606105
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="nadD"
FT                   /locus_tag="UUR10_0526"
FT                   /product="nicotinate (nicotinamide) nucleotide
FT                   adenylyltransferase"
FT                   /EC_number="2.7.7.18"
FT                   /note="identified by match to protein family HMM PF01467;
FT                   match to protein family HMM PF01966; match to protein
FT                   family HMM TIGR00125; match to protein family HMM
FT                   TIGR00482; match to protein family HMM TIGR00488"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59864"
FT                   /db_xref="GOA:B5ZBX2"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR005248"
FT                   /db_xref="InterPro:IPR005249"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZBX2"
FT                   /protein_id="ACI59864.1"
FT                   /translation="MKIILFCGAFDMVHNAHIAMAKYAIDLIKADKLIFLPSNFKFFKP
FT                   INKDDNLEYEKTKLTHGHHRLAMLKIATKNLVNTEVSDYELNQVNKSYTINTIDHFKKL
FT                   YGAEHEYYFIIGSDNLERFKQWKDWERILKEVKIICFKRSGVCLKKTCFQNQCNCENFN
FT                   FFEHQIILVNDFNYNISSTEIKKQHNLASGIDPAVLDYINEHGLYALWLLEKHLISYDN
FT                   FNNLEKKIARINHCRRVAQMCVDLMNVYDKKLIDQAYCAGIYHDILKCLDEQESIAYFN
FT                   EHKSELNIGDDFISWRILHSYLGAHLLQTQYGFKNQLILNAIRRHTRPFDFIKDYSELT
FT                   TLDKILYCADKLEPNRREEIDQINIDYYRKLVFEDLDKAFIEVYKYQQRQRK"
FT   gene            606115..606807
FT                   /gene="mtnN"
FT                   /locus_tag="UUR10_0527"
FT   CDS_pept        606115..606807
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="mtnN"
FT                   /locus_tag="UUR10_0527"
FT                   /product="MTA/SAH nucleosidase"
FT                   /EC_number="3.2.2.16"
FT                   /EC_number="3.2.2.9"
FT                   /note="identified by match to protein family HMM PF01048;
FT                   match to protein family HMM TIGR01704"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60214"
FT                   /db_xref="GOA:B5ZBX3"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR010049"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZBX3"
FT                   /protein_id="ACI60214.1"
FT                   /translation="MIGLIVALNSEIKTFFKQIKKKVYQINNIDFYLCTHQNIEFVLVF
FT                   TDVGKTNASFITALLINNFKPKVILNVGSCGALNDQLQVLDIAIIDQCQYLDVNVSAFG
FT                   YLKNQIPRLDKFFILDKNYNQQIKNQLIKKKLKCWIANVGSSDTFINRDNILFFYDQQI
FT                   DLVDMELAAIAHVCTRMLTPLVSIKLVSDHITLPNSNQEQFNKNLSLIDKWFNEHLTSI
FT                   IEAILEIY"
FT   gene            606915..607166
FT                   /locus_tag="UUR10_0528"
FT   CDS_pept        606915..607166
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0528"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59774"
FT                   /db_xref="GOA:B5ZBX4"
FT                   /db_xref="InterPro:IPR004029"
FT                   /db_xref="InterPro:IPR036118"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZBX4"
FT                   /protein_id="ACI59774.1"
FT                   /translation="MIYKEIVRNIIKHPLILPEGKHYHLHKILTSKDELRKGEVSLVAE
FT                   NGKEYTVDLSAFVDLLVDGDCIIDDNHSLVALYFDESK"
FT   gene            607471..609798
FT                   /locus_tag="UUR10_0529"
FT   CDS_pept        607471..609798
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0529"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF07198"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59884"
FT                   /db_xref="GOA:B5ZBX5"
FT                   /db_xref="InterPro:IPR009849"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZBX5"
FT                   /protein_id="ACI59884.1"
FT                   /translation="MKSNSKNYKFLNIKKRKYRIFFMLCSLNLIWAGVIIAIVLRLKNV
FT                   NKQFNKDDHKIARPTWEYDNDGNLEIHTQLANDLNDDLRQKALNNANVKGIVVDQNGVE
FT                   HEIDVSIDANGKVIIPTKDLVNNDPTKPNIYTLKKVVLKQNNQPNIDLISEEQLSGDNH
FT                   ISFKKPTVVAQTNDNNDYIMHFTNPNLVNKKIKLTFKVDDQDDHTKTIEAIIGLDGKAI
FT                   FKTSDNTIFAPDHKYTLTKIEANNKKVANINEIPLKNKIVDKNPIKRINLTQLKVAKDL
FT                   ILWNNTNQNQSITATFKNINDDFADYIVKLIYEYKYRGEMKEIASQPFKLEKNKTTYNN
FT                   ILLPISIPNRLYHFKEVVIQKLNHPNKSIVLDHDPDLKSFFIVGPGKTDFVWKKPNDDQ
FT                   ITYDGLKKLNIEITSQDYALQNGKKVMVWFKSDAEPNNDSLKFIGELSQTNANGTAAVI
FT                   NNLNNLYGMKEQTEYYIYKIQFIDELEYSKLPPNRNNIVYEYNKNIARNYAFRTKTAPL
FT                   ILEKIEKDDNGSIGGQNFYFYLNKASDDPSTIKQVTIYCRDNNNELYTSDDQEIDSVDL
FT                   VYHSWIHNLKSNREYVFDHAEIQTTYPDDPEYSGETNDLEIKRGLTFKFCTPPSKTEIQ
FT                   WKHPIKITNNGAILDIQLQSKDRAFEDKQKYRVTLVEAENQNNAVVGDFLLAGTSINKN
FT                   DSPIGDNNDKNKDIATLSCNFENKLKKGTKYLLKEVRFIANPNEEISAKPTKAARPFNN
FT                   DNVIYSLNPEISDPYDFTTLKD"
FT   gene            609858..613777
FT                   /pseudo
FT                   /locus_tag="UUR10_0531"
FT                   /note="putative membrane protein; this gene contains a
FT                   frame shift which is not the result of sequencing error"
FT   gene            complement(613870..615714)
FT                   /locus_tag="UUR10_0532"
FT   CDS_pept        complement(613870..615714)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0532"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59920"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZBX6"
FT                   /protein_id="ACI59920.1"
FT                   /translation="MKHKKYKSIWLKLSMISAIPLLATIITACAKVDTKQKAKEELQSS
FT                   LNKAVLLKEIVDQSSYEDFKKIYNQTLKSNLENINKLSEQKLKQEQQTIKNLITQVSVL
FT                   NELDSIKNMSDLIDVVELENTKKQLQDFLNQYEKLLNQASVDTTIIDKLKSDAHQKRLD
FT                   TKALIQKTILDLANKIKSLIKTSGLNKNIVELENDIQKLVNNDTKANFKKLYEDFKLIY
FT                   TKLNDINDLINKELKALPFIKKLDDIVNVINTIYEQNHHFLWFDQTKLTNLRQILIKNI
FT                   NHVLNAKKTLEIKEIKTLTNQLLFDLQNYLEGLKMIALESENSVNKLISIIESLQPDDY
FT                   NPYYSIEKQENKQKDENNSQATYNGLEHQIKSLKSIINLFDFNITNLSIDAIYNLNDEL
FT                   IKKFQKANSQINEVVIQIKQTILSNFKQTYLFKDFIKHLKEFNIELNNENDPIKKANRI
FT                   QTIQEVLKSYEKDLFLNTKINLKLAPNEVLTVNNLEKIDLTYASDSLQKPQELIAYLEL
FT                   NNNQEREFSKELENLSVRVFTIIDKKLYIPKAKELIDESKKIIQTKDEHANNKTKLQRL
FT                   EKFTSFVEQGISNENVSSYTLNLYIQRLTKLIEEIKKR"
FT   gene            complement(615870..618347)
FT                   /locus_tag="UUR10_0533"
FT   CDS_pept        complement(615870..618347)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0533"
FT                   /product="type III restriction enzyme, res subunit family"
FT                   /note="identified by match to protein family HMM PF04851"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60164"
FT                   /db_xref="GOA:B5ZBX7"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZBX7"
FT                   /protein_id="ACI60164.1"
FT                   /translation="MKLTKSQQKAVSQLVNCYLESVNNNKKEIIDFQAPTGSGKTFIIT
FT                   NTINKIIKTNKANGSPQKLIFVIATLSSADLPFQLEQNMNEYKYYINGLFDVELKESPS
FT                   SKNAKKDSSYNILAEENKVIIFGSSSFGKGRIITEEGILDAFLDEIKSQGYTLVYIRDE
FT                   AHHGGNVNKTKIFEDFDEKIHKNSFKKEETRFEYKIQEAASFIIKMTATPKGIHKLVFI
FT                   DEKDLMDDDTKLLKDEHVYNLEIKELKEENIDDELLLTTACEQFLKIKEQYSKAKELKN
FT                   IRPAMLIQVENEPNKKPQKSEFLDKIEKIIKILEKHNLSWVKYFSNDKEVQTNILINKK
FT                   NNKISLKEISKKTSNVDVILFKIGPATGWNIPRACMLVQLRNVSSKNLSVQTIGRIKRF
FT                   PNPSFDKNEISYNSISNQYFIYSNIISEDKIRQTLILKDKYKNDRFFYGEINQDKINNY
FT                   LNGETYKEEIVEKFEDSISNFEYYVNEEYRENFVKNQYLEGETSKIEGKTRVYTKIKNS
FT                   IELELYIIEQLRKYKHLFPQKIIDFLETKFNEWEKRWKLNISINMYWYVIIKEYLDKIE
FT                   KIYKNSLEQMKKDNHELLFKLQNNKNLPNQNEIFIPIEKYKKCENMLDLNVCDKYAYKD
FT                   LKEQNHYFDSLTESKFANRFLSLSNDNDKIKNNVELWTKNPVFHGLKYQYFNEDGQISN
FT                   SYPDFILKIKTHDQKDHYLYIEVKNLYSDYDYEKTKLLIESYQRYIENKNNNDNLILDE
FT                   LDKAEITILVCYINMKNQKDFYFYGASSNDVLNKKVNFDLLKNTSINKTPEQLVANKAK
FT                   FIIDIKHLLDFLL"
FT   gene            complement(618353..619435)
FT                   /locus_tag="UUR10_0534"
FT   CDS_pept        complement(618353..619435)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0534"
FT                   /product="DNA methylase"
FT                   /note="identified by match to protein family HMM PF01555"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60118"
FT                   /db_xref="GOA:B5ZBX8"
FT                   /db_xref="InterPro:IPR002295"
FT                   /db_xref="InterPro:IPR002941"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZBX8"
FT                   /protein_id="ACI60118.1"
FT                   /translation="MMNERLKLAKNLLKNDGVIFVSIDDNEQAYLKVLMDEIFGEENFV
FT                   TNFIWQKKSGGGLNKLIYEGHEYILCYSKNNYNFCLSEKNKKMSGFIKYKDKNNNSFFI
FT                   NSDIIRNNFGKKDNKFEHRNKAYEDLSKEDKEKWNLKLDNKNYILVPFKKEPGKHLVAK
FT                   IFNDERKTTYSIIKLPFTFVSGIWTKDGNNEVDSLNIDFQNPKPIQLIMHLLDLHSNKN
FT                   ARVLDFFAGSGTTGHAVLELNKEDGGNRTFTLITNNENQIGTNVCYERLYRINNGVGTK
FT                   NEADFDWINKNKPYLNNLNVYDLKYFNTNPIEIDNNEIKEAFTKMLVDFNNTSQSSLFE
FT                   NNQRELLINLSTLKPIEKKE"
FT   gene            complement(619564..619938)
FT                   /locus_tag="UUR10_0535"
FT   CDS_pept        complement(619564..619938)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0535"
FT                   /product="type III restriction-modification system:
FT                   methylase"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60335"
FT                   /db_xref="GOA:B5ZBX9"
FT                   /db_xref="InterPro:IPR016881"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZBX9"
FT                   /protein_id="ACI60335.1"
FT                   /translation="MIKDLDSYLKDIDEMSKSSLNEDQKQLIKKILEKTDPQDLDNVFQ
FT                   LLIQRVKIGFSFDVAPSVHQTKIAILAKNEQLSFMNDAHNLFKNDTNSLIIGENYDVLK
FT                   NLLVLERERERLVGATLTMM"
FT   gene            complement(620092..623168)
FT                   /pseudo
FT                   /locus_tag="UUR10_0536"
FT                   /note="putative membrane protein; this gene contains a
FT                   frame shift which is not the result of sequencing error"
FT   gene            623481..625100
FT                   /locus_tag="UUR10_0538"
FT   CDS_pept        623481..625100
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0538"
FT                   /product="putative membrane protein"
FT                   /note="identified by match to protein family HMM PF02608"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60267"
FT                   /db_xref="GOA:B5ZBY0"
FT                   /db_xref="InterPro:IPR003760"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZBY0"
FT                   /protein_id="ACI60267.1"
FT                   /translation="MIKKHIKKIVIGALSTLAFITTTVVATACAKHNNSVTKNNEPNVN
FT                   VKNEISSSNSELNDSHYYWKAPKSDTSEGFQTIHKSMVEDGKRAFLLPGFSQSNYLQDA
FT                   IKNAKFDKNAVGFLLDTVYNANNDPSLFDGANRVASVYFKVDDAAFLGGIAAAYMLNTN
FT                   QNIFATDGQLNWGGYVALNAKNTTNYLAGFALGIEWANKHLANKKVLQEGSSESKTWIK
FT                   VNEVQASQSSAGGFDENNENAKKILKELISKKADLILPVAITQMSLAVNEAISTTSHKV
FT                   AIIGVDTEQENDKTINKEANTFKNTNISGNKNGVIRFSIVKRLGVAIEKLLENAVNGAQ
FT                   FQGHVNKIGDEIDVHDKYKLGVNTVGSLVDGVVGISESAYHYLIDAFNLAQTDETNKVS
FT                   TYDQLVQKMIQDPLFKSLNQDPKIDGYINPKNLANARGNEGELINGKTISPEVNGGTIY
FT                   KAANGSYYYYPVAKSTYTAQNASTIFKEIWDKAKNDDDKRRLVGLILSFAGANVKDGGY
FT                   SEISYDGMLGFYAKHGIKIPKL"
FT   gene            complement(625432..642696)
FT                   /locus_tag="UUR10_0539"
FT   CDS_pept        complement(625432..642696)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0539"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF07198"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60340"
FT                   /db_xref="InterPro:IPR009849"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZBY1"
FT                   /protein_id="ACI60340.1"
FT                   /translation="MNNKKSKKIQTIKNDNNKKNRKQRLFLLLATLNLAWAGAIIGIVL
FT                   HSKNNNELSNNDFYSFNDDGDLIIKGQLPKTYINKDVYGVFVDENNQEYKIKTQIDSYA
FT                   KFEFDTKYLPKTGKYKLNRIIDLNNNIVRENEKLKPEQKIEVLKPVPTNVYEDQKNEKH
FT                   IQLKVNKILANKILVAKFVNQNNEVYSIEAHVGLDQKIDIDTSSLKDGNIYYLKDLILK
FT                   DSNPLTKVVNVNDIDAQFKKIDKTHTYDNESNLVLKVDLTNKTKNQALPTAVFKDENNK
FT                   EYLIPALSVKNNVGYFNTKKLPLNHKYELNRIVNNNDLNDVLVSNNELMLEHKVSVNKP
FT                   AKAKVNFIDNKKVYEVDLGIQLKNTTLEFTLEDLNHQTYKINAKTDEKGLAVFDISSLG
FT                   DNNLYEVIGIKKTNEVDVVNLKQIPYHNRSINNLNSNALNTPYQYTKNGDINLIAKVAP
FT                   YYVNQQVYGIFKDQNNQEHQILAKVKKDGTIAFDTGALNNNSNYSLDKIVSVSNPQNVL
FT                   ASNFDLTSKQKQLIKKPAANASVDSTKKTQILENLNNDLINQKLIATFVDNNDKEYKVV
FT                   ANVDQNNKIIFDSNDLPKGYIYHLAKVENNDLNKVINLNDFELKDKIIDKRDLNLLDSH
FT                   PNFTYDNDGNLEIHTQLANDLNDDLKQKALNNPNTKGIVVDQDGIEHEIDVSIDANGKV
FT                   IIPTKNLANNDPTKSNIYTLKKVVLKQNNQPNIDLISEEQLSGDNHISFKKPTITAKTK
FT                   ENDDYEISFSNPSLANKKIKLTFKTDDNNTNTKTVEASIGLDGKAIFKTSDDTIFAPDH
FT                   KYTLTKIEADNKKVANIDEISPLDRIVNKQKNGNVNADNKHEFKIPDQKNKDLTAVYKD
FT                   KNNNEIHVPIKTDDKGKVIVNPNNNLFDPNKIYDFDKIVDLNEYPNKTILDRNSINKDV
FT                   SAINDGVDQARKLVLKAPAVSNVTVNAINFQVNLFDLNKLSYNRQFALTIAKVNDLNDT
FT                   QKYIATYDPKTNNYKLNFDFTHLDANTKYKVVDVELLELNNKEKPIKLIKDDVLNFEFT
FT                   TSSATTINPPIWTRFDAVVKTNNDTTITFEIDDKDNILKNDQKIYAQLALMDDDLLDTD
FT                   VINPLVNFSKTNKIASINGLDLKGNSKYSIKNLYYLNDQNQKVYLFKNDVTKYEQHFIT
FT                   NPNKINLSFNKSAVEQDIFADHANLFIDYKDHDQKLRINDDVKIYYQNIDNTKNELQIG
FT                   YGKVVANNKIKFNLVGLKEKTTYVIKKLETLNKSASSIVNSEFDLLDPNNNFSTSNKNT
FT                   TLVGLNSIDNWNNDQAPIINAKINIGDDFQDNQQVKLIYVSNDNKEIESKAVTLIKGKR
FT                   NYQFEFSNLIKNRLYTFSRIVYETNNQALHKLDTLTHQFRINPSNNAVSLKNNTNIEVT
FT                   NRILVNNDQSLISAKIEVDDIDNVLTTADKPNIVYQLENSNDANNNLKLATNAQVVVEN
FT                   NKKFLKFDLASLKINQNYVIKEISFNSKPTNAYFNFTNNKTNNIVYSYDKQNKISLSNN
FT                   INPTSYKPQTINKNDKSVNIDVDLQVDKQLLANQYLRLKFKQLNDNKTVWTDPILFNKN
FT                   AKISFKLSNLIHNRAYELEGLYYFDDQNSVNNTSNNQISFDSKIYKPKIEFEPSLTRID
FT                   YDTNNAIKAISAHNAQVHFKLKTNDEALENDQIVEAVFAPTNNLNDQKVVEGKLNNVTN
FT                   SFNEGELEFNLSGLKEETTYRLIKVTFKNKPNKAYESLNKNGVIFEYKNGSQAYEFATQ
FT                   KFEHKVINVVSSTSTNTTQQEITVKIDGIQRAWNNKKLELVYESNILGDPEIKTTVDNN
FT                   NNSVHLSFDKKEYSLVLNNLKPGRRYSLKKINIKEVDNGQDQEFVKEINVNNSFDVNLQ
FT                   SEITASSVEEINDRAPNKLNQTTIKINLKDDNDILKTNDIATITYDNEQKVDAIVKTNA
FT                   QNQKYLEAIITNLVFNKNVIIKKIEFKNLAQTFIKVGKNNTNVIYDESNLNKLIINNDF
FT                   QIIGPLSTDVNSTQNIVANNKYVISSTLDFKVNPHISKNLKFKLKFQNINGEVVYSPIL
FT                   TNSSIIVNNNKNVINFTLDNLKSNQLYRLVDVYYIDDNNDTINDKNKVPKANNVTRIID
FT                   IAPGKTTISKSNNTWNTTSTSSQFEFVINSDDGNEVLDNLEATISFKKGQTLLTPIKVN
FT                   ITKENDKYLIKGQISDLEPENKYVLESILLAKPNKTNKPLVVEILNKDDISFQTQAGNY
FT                   KVIQIKSQNPSTVDTKQRIKLKLDGIQNAWNQKQLEITYSANDNSTKTAIIKLEKNKLE
FT                   YEFELTNLDKNRTYTFTKIELINNNSTKTPFNKSDSIQDKFIVLSNNQVGVGNIIEIQD
FT                   RDVNHLNSAKIRFELNDLDNALSNDEQATITYNNNQTTSAKVITDQNQKYLEATFSNLV
FT                   LNKDTIINKIEFNTKPKNASKNIGINDTNVIYDATNLIINNDLKITGPLHTLKEFEANN
FT                   KTNISVSLELNTNNHISKNLYFIAKFDSNDGQSILTSPIAADNIVTNNNNNKKELTFNL
FT                   TNLTSNRQYIFKGLHYVNSSNQTNIDENNKFEKNSNVDYKITVKPTITTIQKNGNWTFP
FT                   QPNAQKFKFNINSDENVDFSTDLEATITFSDQHDTKKTITTKLKQKDNQWYIEDTISDL
FT                   AYNDTYKLDDISITKPMNAFANLKIQIENKEQISFTTQSGPTQLVSITSHDLTWNDQPN
FT                   ASNQQTITAKVSGVNDLYNNRKIKLVYEYRSNNQKSLVESNELTLQKDQTQYTFTLPIS
FT                   VANRQYSFKEIKIKTSNNNFETLNNSTNVTNNFNVSASKTQIVIENNNLATNITSTSAT
FT                   ITYKLKSKDHVFQMGDSIITYFKSNDDERQQIPYTKTITSVSSDGSEATVSFNTDQTLK
FT                   EEANYKLIKVSFVRKPTLAYTNINNDANNIVFENNNSNYNFKTLIVDHKVTNVSSNDSI
FT                   NTTTQTVNIDIDGIQRTWINKKIQLVYTSNDGEEILSDQKTLLWANNHYSFELSNLKHN
FT                   RKYTLKEVRIIDDDNKTPIIFHLKNGIADWFIVNKTQSISISSIIEPIARAKNNLQSTQ
FT                   IRFILNDPDNVLSNEEEAIINYGENLSVKAKVKIVGSQKYLETTFNNLALNQDTIINSI
FT                   TFINKPIKAATNIGIDNSNKIYNNTNNINPLKIDNNFSVIGPVQSDTNKRITLEYNNKT
FT                   NVKVNLELKANDNILQNLYFIATFKDQNNETVKSSIVSYSSIKKEGKKQIIELRIPNLK
FT                   SNRLYHFDNLYYLLNQDDQDLIDNNKLIRSNNVVNEIEVKPGNTTFKKNNVEWQINSNS
FT                   VNFKLQVESDDEDIFDNNVMADVIFSSKSNQNDTKFVNNVKLKKEGNIWFIEGIVNNLK
FT                   PETEYELKSIVLTKPLNANSNLKTINPTNISFKTKPGNYGIINIESNETLTNSQNVNVT
FT                   IDGIRSEWFNKEAKLVYISNTNDEVEAKVNLEEDKLNYVFNFNNLKYNRKYTLKSIKWF
FT                   DGQNWIDFPNKQNLQNSFIIKGKTPISVNKLDEISDRVINNLNVAKIQFSLNDPEDVLS
FT                   NNEIAEITYDTNKKTNAKVITVNNEKYLEVSLSNLEFNHDTIINKIEFITRPNKAVDSV
FT                   GINNSNKIYELTNLTEETRKLKINNDFRISGPLSSNNLHLEIKNYNDKESINSSIEFTI
FT                   NKHIAKNLKFKLKFRNEFGHEVYSELIDGNDINKTGKQEVLFSVKGLKSNQLYKLVDVY
FT                   YLDNIHQNIDETRKIFKDHNVSKEIEINPGVTMISKHGNWKSPTDTTANFEFKIETQDD
FT                   NDVLDNIDATVKFKDEHNNIKQKIVRIIKENNDWLIKGQIDNLNPETKYKLENIELSKP
FT                   LKTHTNLSVSINDKENISLITETGNPVLKVIQTQNDAINDTQQTINVTLSGVNSKYNGR
FT                   QIKVVYKDNNNVIYESSLITLQKGKNDYQLLLSNLNSNREYRFEKIEINHISNTNNFED
FT                   LQKLNGVSNTFITQTKNTTVQWNDSSATIVGTRGVNFNFKIKSEDKILENNQQVVAWFA
FT                   PKETIRDTNTWLQYTRPLKDVTSDFKEGTWAHDLSNSVNFKEETTYKLVKIQFVNKPTK
FT                   AKNNINNSENNVILDNTNSINSNYEFTTKVGDHKLINITSSNSVNTNSQTINFTLSGVK
FT                   KSWVGKKIKLSYKSNDTNESIYTNEVLIESNKTQYNILLNNLKRNRTYTLIDVKLIDNN
FT                   NVSDFPKEGNLTNSFITTRTSAINALNIEEINNRVSTNLKSTIIKINLNDPDNVLRDKD
FT                   QATIVYGNNKQAMGFITVSGNIKYLTATLVDLNFNDKVNIVNISFNNKPSIAAENIGID
FT                   KSNNIIYNNDSMPKLEINNDIIVNGPINKEIVVKNANQKNNIDVDLGLQINPKIAHNLR
FT                   FIAKFKSTNNDIIETNVINGSSLVNNDGKTSIRFTLNNLKANKLYSLVDVYYLVNNNSN
FT                   TIVESNKLPKLNNINYQIKINKSHTIISKNGEWLNPSDTSAEFNFLLKTDDNDGELDAN
FT                   ATATVTFNKNGGTLKQVNVNLLKENGKWLIKGKINNLEPNSTYVLNSINITKPSNVYED
FT                   LDVSIENKRNISFTTQFGPTILNELLSTNEISVDSQTINATFSGVNDQYNGRQVKLIYR
FT                   DQNNELYESNIVNLKKGMQKYSFTLSGLIANRNYTFVKIQINDDKNNSQYIDLKKQNTV
FT                   NNSFKRNPSTTSIEWSAPLNITYNSAELNIKLKSVDQIFETNQSVIVYLENKNNGQISQ
FT                   WTRKISEVNSNKTVATINVETGATLNEQTEYKLLKVEFVQKPRLAYENLLPGNIIINNN
FT                   ENYKFRTISGPTTIVNITSNDNINNTTQTIKLTVSGVNDNYAGRKIKLAYKDNNEEIVW
FT                   TKEVTLENNKKIYDLVLDKDLITNREYKLFKAQITDSKDTNTVFNDLSINGVSHKFGIN
FT                   PYNTNLSIDYSNWVTNLTENSATINVKVNSTDQVFENNQIVEATFVSTSNPSEIKKIDG
FT                   VLSEVSANKNSAKIKWNLTDLKPETEYRFTSAKFKNKPDLAKWMLTINKNNVIYGGNLD
FT                   TKFKTLIDKLKLLKLESNNDIYYNIQENAVNPNRVIGTIKAEFSRINSNYINKKIKLVY
FT                   EDNNHQEWETNELTLSNNKTSYNFDISKLTPNRKYSFKKILISNNNIFEELLNSNNIAD
FT                   SFIYHHAPTAVTFKTEGDENQLWKSNIGITTAKFRLGLESLDKILENGDKISVTFANKK
FT                   YPNNQDKMKVYTMSIIDSRNDGLYANIKHDLVNLDEGNEYYIKEIRMIKKPNKAYEDVN
FT                   GNKIISPINDAQRRTLENINFKTNWAIYNAKKYGNWDQPTINSAKYAFEITTTNDGTML
FT                   NTNSKFQLVFKKVSDSTKTFIQTINLVRKDNKWILEGEISNLEPNTEYILSSIKLSRPT
FT                   GNDLFDTELNTNINIIEQNQNKILTKGIDPYIESITYEKTNDLRRRIIKLKIKDIKDYN
FT                   DGDRLVLEYRYNNSTSKKEVSLTLNKNQEDYSVNIENLTYNREYTLKNIIKINHNTNNI
FT                   TSIDISKLNGKTFVVEPSVTKLTNFKNITNFDEKKQIWSRIMEFNITNDDEWFSQSLLN
FT                   SYKIRAIVENLSTNKIDDNPIIKIVNDNGKPKLQIHINNIDINDQNNEYKLRIVKFENK
FT                   PNSYLYKNINNDWENIFYDTNKNGSVIYKSSNTSNYAGIVDITNVDHNIYTTNNASYTY
FT                   VSFSGSVRKLIFNNMNNQNDSIFGEVMYKNLDNGQIYNTTVGIIENNVNKNYNTPGQFQ
FT                   LPLDKMPRSSRYQFYGIKYWRANDKKDNAKIALVPNNKKTKIIWL"
FT   gene            complement(642923..646234)
FT                   /locus_tag="UUR10_0540"
FT   CDS_pept        complement(642923..646234)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0540"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60092"
FT                   /db_xref="InterPro:IPR009849"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZBY2"
FT                   /protein_id="ACI60092.1"
FT                   /translation="MKLIKKKLLFLFTAALVPIVATALASCSNKSKLNVNVLMKDIIHT
FT                   KSDHYYVVYEVNELNTSQGIYKNLILNTNLFNPLLNKKVDRLENIHPLIINNKIYLRLA
FT                   RKPKINDHFIINFSNDAFPAQHLIFDHTLNFIEQDINEDLNLQPSLPNITKIDHLEIND
FT                   ISFTNIKQNQVDIKIKLKTVSFKDDAIHNFSLKIVKKTNHQIITSDAVFNKQKNEIDAT
FT                   VYNLTSDCEYLLDELNFNNQKVQLTSIPNHSFKTLDDSDNLLKNLEITKINDNGANLTL
FT                   NFKELKIKDDSDEALNNIHISLAYNRVYKKGQLELNKKHFFIDKLNKRIIVYIDELERG
FT                   THYDIKQIKINDQVLNLNNQIHDFTTKGDYAKVEAIDYETAVDKITKAVTIKVKLSEDL
FT                   AFYNPNIHNFKFLIRKENDQNPIEFSEVKYDEQERSLTAVINGLDVDKTYEIDDILLNG
FT                   KPVSFPSDDDYAGGYYGPINKTFKIRPDRSSIEIFKDKSFYNSYYSAFNSWFWYLSTTK
FT                   EHDNERSKEVKKDYKEHLFISDITKNSAIINIKCEKLLLRKENSLKPKIKLRYHPLNNP
FT                   NEWAYKEFSFEDKNCFMSIDEDQKTIKIKLLNLDNHINYEFVSFILEDVDGNYHSDPFN
FT                   VNVYIGDFFDSHPFHLDLSFLKFKTNEFKKAVFSFTNTKSTSTDLNVDLQDNQYADSIE
FT                   HKIKYTLEDENHNKYKFVKNLSKSETTQLNATKNIILHLFALDKNQTFKLISFEIDDDN
FT                   YLTNNITVKTLNESSPHLLLNLEFNDIKNTNSTLKLTLNQAVINMPKRVDVILKNKKTN
FT                   KLLYLFKTDFYFDKKTHQVLTKLDNLDFNTDYEISELIIDKQQINLKNINNKTFKTLDE
FT                   GFDQFYLDKIDHEINQQQKNIKFKLHFSDFIFKDKNTHKMSLVLEDENNQQESIDLNAH
FT                   NQLKIDYEHQTIEFELKDLKPDIEYRINSIQLNDKNLDLTWVDNQRYFNFPGILNPNLK
FT                   WKVDNIKYEVNGSDPKINITFDQDIFLSNLSQDKECNIELNYVYNNSDGDTLESKIVAK
FT                   INKNNNKSVEITLTNENCYWLNDLKYICSNLDSNQISTQFLKSIKINGHKIPKVN"
FT   gene            646509..647669
FT                   /gene="ackA"
FT                   /locus_tag="UUR10_0541"
FT   CDS_pept        646509..647669
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="ackA"
FT                   /locus_tag="UUR10_0541"
FT                   /product="acetate kinase"
FT                   /EC_number="2.7.2.1"
FT                   /note="identified by match to protein family HMM PF00871;
FT                   match to protein family HMM TIGR00016"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60198"
FT                   /db_xref="GOA:B5ZBY3"
FT                   /db_xref="InterPro:IPR000890"
FT                   /db_xref="InterPro:IPR004372"
FT                   /db_xref="InterPro:IPR023865"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZBY3"
FT                   /protein_id="ACI60198.1"
FT                   /translation="MLIINIGSSSWKFCLFDMNLKQIFSGKIRLDVSPHQLKYIFDKNE
FT                   YVYLLDDDHNNHVDLIIKFLINKKIIKKLEDITYFGIRAVYVKNFYGASAFLNNEIYND
FT                   LNQHTDLCPIHNQNTIMLINDIKHLNTSAKIIIIFDNWFHRSINKNKYTIAIDQTIAIK
FT                   HKIRKYGFHGISFSYSNKIMQNYLGKQDVNLIILHLGSGSSVCAIKNGKSFDTSMSYSP
FT                   LSGIIMNTRSGDIDPSVLLTLKKVKNQSLKQLILFLNQQSGIYGLTKHHSINEVVNNLH
FT                   KKNNQLALEMYTDSIVDYFIKYLNHLQKIDAIVFSGGISEFEHLVLEKIISKIHLINLE
FT                   INDHLILTDTLNKISTSKSQIPIYLCLVNEEHEIAYEMLNLINKTK"
FT   gene            complement(647673..649790)
FT                   /locus_tag="UUR10_0542"
FT   CDS_pept        complement(647673..649790)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0542"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59934"
FT                   /db_xref="InterPro:IPR009849"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZBY4"
FT                   /protein_id="ACI59934.1"
FT                   /translation="MITKKHLTKIITILTCSTLIIGLSCLIGACTKSKSKVEDKQVLFK
FT                   IKKFKTTTNSIELFLEGSAVLASHSYSVVLKEKASGDLKTINNLKLVKDNDLNKLIINE
FT                   LKPNMGYELVDLLINNQKQLITKLDFITSTLAQENVDQFSIKKIDWKNITNNSADLNLE
FT                   FTKYFLANENENIFEISLLNLQTQQITKFKFNYQPNSPSITFNFTQLENNAKYQIHRIV
FT                   LNNKELVFSNQNLVLSNTNKQNSNPIIKDLNITKIEKEIYDTSAKLIFYFKDNKLGDLN
FT                   NQKFILKLVSARQPSNVLSFENYVYNNSKKTLSFNLTGLQINTKYSLNSLTLNGQPISL
FT                   ANLDLNILTSTKLTTVQRLENLEHESSDSWFNDENLDFKIKLYFENNVNYLKNKYLKLV
FT                   YMDNANNIIVSKPVLFDPTKKEYEFSFDKVLLNRKYIFSKLVFDDLQDFSEKQALEVNT
FT                   QGLNSSFNTPQAKIKIKKISYSSTDKSAKLEFHLEDDFDLVDGDKVSVKYRLKPSSNSI
FT                   DTTNNTVEGLVNNHILNVTINDLESNKSYEVIDFVINDYKNKQLLNKPEFLKNNTNHHN
FT                   HPFNIPLDFDTKNSDYKTKFNVNEISKSYNKETKLTTIKLKFDNIPTNPTSSNNFTFTI
FT                   KKQTGYKTNPISPKTLEYDVNKKTLIAKFENIEDQIVYDFVDVKVNNQNIEFNKSLDKY
FT                   FYIIHSADYHE"
FT   gene            complement(649975..651285)
FT                   /locus_tag="UUR10_0543"
FT   CDS_pept        complement(649975..651285)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0543"
FT                   /product="endonuclease/exonuclease/phosphatase family
FT                   protein"
FT                   /note="identified by match to protein family HMM PF03372"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60004"
FT                   /db_xref="GOA:B5ZBY5"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZBY5"
FT                   /protein_id="ACI60004.1"
FT                   /translation="MKNNKSRKWVITISLTLLIVLITSAVIGVVFYLKNKKKNDTSVNN
FT                   DSYIIQNNNNNNSLKEQPNSTRSFLNQKTICVGHWNVLNQGGINQLKNEALAKVILKSN
FT                   VDVIALTEINSAKNNEHDDLPMRAILKELNLHKNQFDQTANWNYVLSKNLFSKGNESQT
FT                   ERIGFFYKANIIKPVQEYIYKNNDNKDILFEQYFKNSNDNTKITYSRPPYAYEFQTLDN
FT                   KFNFTIVASHLDSPGANEHKTSKHDHTYGNKNLKINIKQGSKELNEAYQLGNVMDYIDR
FT                   LDGNNDDLIFVGDTNIKTKNELGAFASLYKRNYLSNFKDDNENNKTTLAKTYLKYAQHY
FT                   DKIFTSPSIKVLNTYKYDLWSVSLTNTLLDKNWKLAFLKTYFGSLSNQQMQNIVDNWDE
FT                   ITKSNDVYIKKATSIISDHTLVAVNIKIDENDIIDEN"
FT   gene            complement(651433..654174)
FT                   /locus_tag="UUR10_0544"
FT   CDS_pept        complement(651433..654174)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0544"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59848"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZBY6"
FT                   /protein_id="ACI59848.1"
FT                   /translation="MRLKNKNKYWNLLIASLISIPIISTISACSFSETRYKLKVLDYFL
FT                   KTENDDYYIAYEFNKLTNEDMQKMPKVIFSTSIINSSNQKIAFYVDIKPIIINNRIYIR
FT                   LPQRPKPNEKIIINSSQEFVGVQVIQTNKMLTESIDFNFNKKDDLIKVVDQSARFTNIK
FT                   KTEVEFEIKLLNLNLNDIKDKNIEIELTNKKTNKTFKLHFLKYQFNHLTHQNKKPVLTI
FT                   TANLNADANNQLDDGEYFISKLVLDQKKLEINQNVYKPSGLQLDGSINNQRPTYLLIPS
FT                   VFSKWTKINVLDTKVIKNDGIPQQLQLSYDHFINPYNFKDNMLSADIELISTKNNKTII
FT                   LKSLKFNHDKNNIVFDLANNLELQTLILKTPFFKIKSLTIMNDKQTLPLSIREKQLDLT
FT                   NKHLSKIIKFTFNDTDPQNMLMKFQLDSDSPIVQNTKKVLLTIKKINTDQQEDIKTFSF
FT                   DILENKITTGSFYDVKNKYFLLNLNKTLNAKSIGQIFENDSNYIITKLIAVNNEASINE
FT                   IPIKIDDLQNKQFTLKFAEYQSNVIKFNAKNDPELHLNIKHFKQLNLTKINKIKLTLKD
FT                   GKQIIFNRLNNEFSFQQAGFKLKINQNTFPNYLKQHQYVIKSISLINDDQSVIELLSKH
FT                   NHEAIFEIPLIASLDTWEYDKIHNILKIKMKLDTLSLHQSLNPSDYALNFYNLDTNIIN
FT                   RKFTLSPQTVLSSKVNNSNVIELIYDLDKDQNIYGGLNPDSIYQISSLMINAKPVIINT
FT                   SLTMIQISTPDPKIEKIIASYDSVTKKTKISLQFSNNWWYNKNADHKLFAIISSLKPKN
FT                   NKNADWTFSLSRVFNNPEAINSNKDTDFVLDKATKTLTYVINRPYIYYEDQNDHESLDW
FT                   YYDDLVLNKVTIIYNDLTTDVINSSSKDDQNLTIKLPNKINS"
FT   gene            complement(654391..654912)
FT                   /gene="apt_1"
FT                   /locus_tag="UUR10_0545"
FT   CDS_pept        complement(654391..654912)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="apt_1"
FT                   /locus_tag="UUR10_0545"
FT                   /product="adenine phosphoribosyltransferase"
FT                   /EC_number="2.4.2.7"
FT                   /note="identified by match to protein family HMM PF00156;
FT                   match to protein family HMM TIGR01090"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59814"
FT                   /db_xref="GOA:B5ZBY7"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005764"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZBY7"
FT                   /protein_id="ACI59814.1"
FT                   /translation="MINIDYIKSKIRDVPDFPKKGIVFKDITPLFLEPKIIEKIVDDFA
FT                   DFAKSLNIDAIIGAESRGFLFAAPLSIKLNKPFILVRKPNKLPNDVYSAEYTLEYGSSR
FT                   VEMHKDALKPNQRVLIVDDLLATGGTVAAIENLVHQAKGIVAGSVYLIRLGFLKGEEKL
FT                   SGKVHALINY"
FT   gene            complement(654933..655709)
FT                   /locus_tag="UUR10_0546"
FT   CDS_pept        complement(654933..655709)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0546"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60343"
FT                   /db_xref="GOA:B5ZBY8"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZBY8"
FT                   /protein_id="ACI60343.1"
FT                   /translation="MKSDLKDFNSHEFKTILDYKINDGVVSMQFDAKKPNVLSEIDLIS
FT                   LNHRFSDAIVYRSSQYHLINNITNSIAAYFIIFDIILIWSSIWLKPQSIIPIIINLICT
FT                   SLISFGIAGLLRLFNNQISIIAINTSFVLMTSFSLHICLNLKRTLDLMKHVTKKQLQFQ
FT                   IQDSLIKYFNTYNIIYIMILFASLWLMIFTPFVLISFNAIILFSLISTHYLSIIIIHCL
FT                   WMKMVYISKSLLAKDDNADNVYDKFDEQEIMNINKF"
FT   gene            655856..656200
FT                   /locus_tag="UUR10_0547"
FT   CDS_pept        655856..656200
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0547"
FT                   /product="glycyl-tRNA synthetase (Glycine--tRNA ligase)
FT                   (GlyRS)"
FT                   /EC_number="6.1.1.14"
FT                   /note="identified by match to protein family HMM PF03129"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59765"
FT                   /db_xref="GOA:B5ZBY9"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR027031"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZBY9"
FT                   /protein_id="ACI59765.1"
FT                   /translation="MNLKYDLAPYKIAVMPLVNKLKEKAEVVYNKILDLNISVTFDNSG
FT                   SIGKRYRRQDAIGTIYCITIDYDSFGDEHDPTFTIRERNTMAQKRIKLSELSLYLSQKA
FT                   HEDFQKQCQK"
FT   gene            656188..658101
FT                   /pseudo
FT                   /locus_tag="UUR10_0548"
FT                   /note="DNA primase, degenerate; this region contains one or
FT                   more premature stops and/or frameshifts"
FT   gene            complement(658181..675592)
FT                   /locus_tag="UUR10_0551"
FT   CDS_pept        complement(658181..675592)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0551"
FT                   /product="fibronectin repeat protein"
FT                   /note="identified by match to protein family HMM PF00041;
FT                   match to protein family HMM PF07198"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60211"
FT                   /db_xref="GOA:B5ZBZ0"
FT                   /db_xref="InterPro:IPR003961"
FT                   /db_xref="InterPro:IPR009849"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZBZ0"
FT                   /protein_id="ACI60211.1"
FT                   /translation="MNNKDKKRNAKIATGLTISALVWAGVITGIVLRSANKHSSQYFDK
FT                   YYEYTKDGNLIIKVRLFAKDSDSNQKIYAIFKDKIGKEKLILVTKDKQIGLIDTSNLDS
FT                   NNSWTLDRIANEKGDILISNDQLVWQQKIIVNRPNIFYSGIDKNADKFFQIKLNHELNS
FT                   KWLVAHFVNQNNAEYAFDVQVDKEGNVIVDTKKLPLGNFYKLNSLTLKEDSKNTKVVNL
FT                   EEIDPSIRSVDKTRSFDEEGNVIVNVRVSRNLANKTIQSLFEDENHQIHTLKVVVDKNG
FT                   LARLPVKKMDNHHQYKLIKVTDENDNDLLKPNKLSFAHQNIIYNPIKTKIEVDENNSQK
FT                   LFHIQVDPSLQNQSLTITFKNENHEKTKLLAKVNSDGEIVIDLNELKDGHLYKLDDIGI
FT                   SNTSPNKRVANLKQVYESAKTINKLNTSHLNNPYNYDKNGNLIFNAKVDPEQFANDQVE
FT                   AVFVDENNTEHKVLTNVDSNGKILINTSDLNQNHTYQLKEIVNLEEPKTSVLNNYELAS
FT                   NQKQKFSKPAANVKALEDKNFKIKLLNPDLANQSIVVTFEDENHQLYQLNAKLNDQQEV
FT                   ILKTKDDQLLPNNHTYTLTKITNTNNQAIVNVNDLDKKDKLLEKIDVNKLQQLNAYNYD
FT                   DLGNLIVDIHNNQKVLIDHEYDAHFIDENNKDHFIPTKIDLNTNKISINTKHLYKDHHY
FT                   HLSNIVDKKDHKQILLDNDKINALSKISIIKPLAIIKQDKNKNLNLQSFDKNLINRQLH
FT                   ATFVDENQKEYHVKAQSIVDSLGRVQFITSDEVLPNHHKYQLTAINYNNQKVINVNDLD
FT                   QKQIIINKLNVGKIDNNQLVFDVPNNVEEGEDVFVNYHDSDGNVIKIPAIVNNHQVQVD
FT                   LTNNPQLVKDKIYHFDSLTIEDEYHVPKETVISSDDVNNLIKTLNNTVDSGRKIIAKNP
FT                   KVIQNKPTILSLTINDFNKLVSDKWLKLTIALKNDPTHTVSAYGLIDYKNDTVIFNFNH
FT                   LKPNTSYYIKDLNFRNNDLNVIDIKKDACSETKINIIKNEIIGYTFVILSSNTLVLENY
FT                   HQYETNPSDTKLNLNISKTDKEPKTVVYRLLDVDNNPLEPDLFAKLDYDANNKFYNAHL
FT                   QNLKANSKYLIVGFNDQNNQRINYSTPIKTPLIFGTTPHAVAVNFDANNNKQIIKAEDA
FT                   RLIINFVDQDQKLQVGNLVELTYLNKNNHQVYKTVGYVKNIDTVNKSGELEFELNNLIS
FT                   NNDYELLELNALSVQNDAYQKVIFDRFDQNHNQFTTKLIGTYIESINSNDIIKKNENKL
FT                   DVNVKISFSQKDKTLNNAWAQLVYISKDNEVCLSQPLKLNVNNSNYTFTLLDNNSFGFL
FT                   RNRVYKFVKLVYAQDKNDLQSTNAIIKNSIDLSHGFKTEPTGSISLKNNDLKVIKRSYD
FT                   NIKLQIPLVDNDHVLIDNDGSSFVVKVSDLNDPNNIFDGDNQKIVIDQNGNRSLEFDVP
FT                   NTLLNHKYHINSITLTNKPINAAFDQNENHQKLYELNNSQSKLSEFGNELLVNAYNYEP
FT                   AITNTKTNTLNYKIKLTLKRSSTLMNDQYLKLKYVDNNGEIIWSNPVSINSDNNEYELN
FT                   LPHEKTLKSNRIYKFDGLYYFKNTNDTTTSLANKVNMNKIVPADIQTASRVSLDAQKVI
FT                   INNITPASADLLLPLVSNDDVFSEDQVVNITIGNKENNKNDQEFITNLEYDASTKTWMA
FT                   KIHASNLSQEVNYHIKSFKFKQKPILGAFNVNDSNDNHVLIDDSKTPSFSTPKASFDLV
FT                   SVIANDVIDSNVNTNNVNVVINNDGTSLNNCKAKVVYSDGKHEYISDNYVVLNFGINEY
FT                   SFHLNNLKHNRVYTFKKLIYTQAGQDNYQFSFLNTKKVQNIFKTASINKSLVVSDQLIR
FT                   KPDSNSNKINLNLKLNDPNDFLEQDSILEITFHDEKDRKSHHVIGKVNVDANNKKTLEF
FT                   SVENTDTFKIQTNHKYVIDNISYATNNHVQPAHPFDSTNKNRIYDANQNPNKTLSFTNE
FT                   LIINNIKVNKPNENLDPSASLDVELKCSENLLKDKYLRALYIDNNHQKVWSDYVSVNDA
FT                   NLESINFNFNHLTPNRKLNFAGIYYFDNQNQNNDESQGKKIVLKQETNNYDFNTPVSNT
FT                   KLLDFKATNIDEDRFNYDFSVNDDDRTLEAEMPVELYFEDLTDKNQPIVKVQTKLTKKD
FT                   ERSFSAHGLVDNLLATHSYRLVKINLKQKPRLANLNINNSDNNEIILNSVVDNQKIIQT
FT                   LAVSIVNKINNLETSYTKNANGTYDVKFNINIIKNSNKINNKYVKLVFEDNEHQLISTN
FT                   GVLVNNQTQESKIDLENFSFNDLKPNKIYRLQKVVYSNKQDFDAINEIKNTLVLNASLA
FT                   NTSFSTIPSKIKVRKNNIDVWQNEASINLILDDVDNQLHSGDEISINYRVKGTQNILSN
FT                   TILISDSNKKNINCRATNLVAGVNYEIVSVTIKSQKNKNTCPVIFELPSDVIDFYTLAP
FT                   FFKINNMSITPVYYENKNTADLKISLWFKSVGASLINKDIKFIFKRKHDGKEISFINKI
FT                   TSDKEDVKYEWEFKDLLRNREYTLERVVYLKDKDFSHNDVSEKDYTNVLINDSSNTLTF
FT                   KLLPTKPLSIIGAPIKEISDNGAKVQLKFAIEDHDDILKNGQTFKFNIQPNENNGASLS
FT                   EISEHDGKIEIVDGQKFFVINVNNIKVNKEYKVYKIYFDENQDVGNGVYKINFKNDYKE
FT                   PNNVVYDASVNTTQTYVFTNKFAIASFSNNLSDVNVTEKQNISINLDSRSETIEGYHFK
FT                   AKYISNDNRVVWTNTIPSPTNSTSNKNNIPLTFELDKNQLIPNRLYTFAGLYYSKDANV
FT                   DEKHANMVVIKNSVNPQTISTKLSSTYISLKTQKADENRIDLSLLLHSNDEIFEDKNSQ
FT                   QTIAKISIDELDVHDQIVGSSKHDYDLTLQKEGNEWLLKTQLFDLKPNTKYRVKKVWFT
FT                   NKPSENIYTNINKDNIIYPINEHKENIDLKTLNKSTLNSVKPTKVNFDKNDLIKLTINF
FT                   NKTGSSLENKYAKLVYKNNANQEIESNAVLLNWDVTTKQFDKEFSFNNNQTGLVANRDF
FT                   EFVKLVISDYADFKNAKELELTSNFNKEQAKFSINPTPIIINNVVQTTENTYDQIHLSF
FT                   DYDDQDHNLVDNSQITITYRKKGDQNWITSKSDEVSVKNGKINVAINDLTPNTTYEIGV
FT                   ISTTHINSPNTKISPIQYNDVAKKQLEKINLTTKVANNFITNIKINKNPVLVNGVYECA
FT                   KDQDVNFSVDLHKEGNELDGYDIYVKFVDKTDPNKPIIEVKSTNAITQNQNQIYQFQLL
FT                   KSQITPNHKYELSEICAIRNKGASDEYKKDLNKDNLSLILGLAPTKMDVQKPTISVVSI
FT                   ENTNKVSAHVKYIINDHDGILNATDCQKELLNIKYALFNETQNPHSIINVPIKYDQQTK
FT                   QFYCEFNINNLTLNQNYGIFEISFANKPTHAAFAKINDTNKPLALLNTNNQDENQKINL
FT                   SCEVNKIEIKEQNINYDQNTKISWPIQLSSNLLNNKYVRIKYSVSGHKFKQTDQFTNAF
FT                   KIVNNKVNVEINHDKLIANKTYEIEGIYFSDQSNDFACTNANQIKINSSIVNKKVVVNP
FT                   STTAINNHQISNITSTSATVNCSVNTNDGNIFEPSSQIIGYFAKSDNLTKTFAVNAVIT
FT                   KTNNQTSINFTLNNLEPNTKYTLVNVQFKKQPNSAYLNINNDRDNKFYSHSETNKIDFT
FT                   TSSPILEINTIKATKNVYGSNKEEININANFNKIDSYLNAKKLKLIYQTQNNGEVFETK
FT                   AVSINSSNHNYTFSFDKNASNKIIGNREYTLAKILYLNEHNQWCELNKNNVNDQFSIEP
FT                   TPISIANIVEDDSKRSKDVINFRIYFKDLNEDKVFNENDEVNVKLVYPNTNNERVSHNW
FT                   QIHFDQQKNKWYTDISLGVGTLSNQEFEVASVSIKQKPNKAKFNIHKTNSGYDNYIYDK
FT                   NVNNKNYAVGNVFSVNKIDITHPSTETNNNVTVRVKMKNNMKSAFKGKYLALRYKRKDN
FT                   NEFIWASTKIKIDENIHDDLEFNFTNLTKNRIYDFDGAYCVDDQNKPIFNTNTIANLNK
FT                   PQIKVLTNTVNNVSYVDANDKISNLGAKTAKLKLMFKDPDHIFKIGDQLNLVFNTQSNP
FT                   TSVKQKNVLASVKEVKNDQVILNDVDLIQLNENTDYELKEINISSEAWKQKENFVAQKP
FT                   HFTINNVHFKTLKHLFINKIEISKKAQENSYTLKLSLDGDSSQFKEKGFLRLLLVNNKN
FT                   EELFYTKSYSILENQNASVKDLIFDVDNLTWGMQYTIKWVGVSNTNTNTNDNTEFKKHK
FT                   LEKGYLTKKQDNLDNFTVRASKPLKIKQVNVSEIKAHHAKLNLKLEDQDSVLKNLNYEL
FT                   ELRFGPKNNQSSNSWITKKLKTKIVNNEIVLDEIVFDNLTEDMQYELKDAKLIFTKEEL
FT                   EKFNKVTAVNNLNVDFDQIVFKTMKSAYVETATINFVNNTPNATIDLKLNGDLSVFSKS
FT                   QYIRFEWKLNNSDPNTKPLYYTIPISSLDLNNLNWKKDFGNDLLWNSSYTLRIGYGDDN
FT                   KAIDDSKWTWLALEKTAKGNIKTPNAQRISINQMQTPTNYSLLTQEVNENGNKVKKALG
FT                   ALDLCFELNDPSNILTNQDQFSIKYAMLNNLKQSVSARAQVEIKENKKIVKFHISGIDL
FT                   NQDYKVCELMLLTKPARMGENINNNDKNNYSFIYQNSTNDDNQYKFKILLENNDLSTKQ
FT                   RPSKTGDVVNNKGKVDITITQAPKLLANKWISAAYVDNNGETKWTKPRLITTNDNNQIL
FT                   YQAEIDNLTTNRYYNLNGLYFGNQQSDFEQGNATYLLSLYPANLLVPTDGVRIQNIATP
FT                   ATTDAATVSFQLESKDQVFDKQVLHIQITPSNQNIPVFERTYTLNGNSNSANVLLSLNN
FT                   LEPNIEYKITKMWFEQKPTKAYANLNSKANNNVIYEYINDKTQPNISLKTKTVEPKIIS
FT                   LVKKDQTNDGISFDLKLQHDGTYIGKPFRLVYESSKRTSDKWDEKNNNWEINDKHNYWK
FT                   SNGRLIYSEPINFKAGQKDYLVQIIKDHNEYFKGNREYKILGIEWADPSFSQDKHHKKL
FT                   ISKDTDSEAFKNVNSNALSFSTDATTIKWYVATPKIVYNKNHKKMTFQIRYDDPDDSLF
FT                   MGQRIGIEKILMPNKRKQIPLNPPLVGMVDNKKKIIEFNIYNNNDYFKPGNLYQLISID
FT                   LVYEPEALSHKDLNKLMYENPQTKMYKNKVTFELDNSQYSSIKIEENQNPYEVKSVKNK
FT                   LDNKNLTLKSTVTFNNKDEHLYNKYMFALFTNTKTNAEVWSKPIQLNVNNYSKLEFDLP
FT                   NNGALEENSEYQFLGVYYNEKQTHPNKNEIEKQIYMIDNLKIINMIDNHIRKTIKTGIH
FT                   IDVNEVQNLAQFKDGISKQFKLVGKNNSTVLNQILNGDFSINIEYKPKDQPDNEAGFNT
FT                   GACKLFKKNNNDPFWYFNADFNNLNFNQDYYIKSISFVNKGINRIIGSINNDDNQIIYT
FT                   TKNYNSSKYHIKTVGAQIEFDQTTVVKNDIVFTKGDSGGYPASVVNFKLKGKEANTFVE
FT                   GQTYNVVLSTWDDPFNTRDYENKIDNNLNYDIKKDYVIVSIVAHNNCLEFKNIQLIPNQ
FT                   NYNIVKVLHYQASNTISAKDMGYSLKNAFSTKSVDWKVWKFGHGRNNFTWRYQVALSLK
FT                   GPFTGFGGYRETIFDLGLAKSLGVYARIYEHNTNKLALKGQDIDGFVAGDDTSLLTDFE
FT                   RASRATSANVLSTSCKLANYLRRNSDSLKNTIDIGKVWYEPRIDPNLPNSSNATYYSGE
FT                   PKTSIFKIDDQHKHYTDSFGTTNNDAMDTNNENQF"
FT   gene            675804..676940
FT                   /locus_tag="UUR10_0552"
FT   CDS_pept        675804..676940
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0552"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60081"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZBZ1"
FT                   /protein_id="ACI60081.1"
FT                   /translation="MKKNTRKKFLQLFSLIALIPLSSFIVMCSKAKTQEIKEQSKIKAR
FT                   SIRFMDKDLTSINIQFYFDKIDIDDILVKKFNIELEDDKKNKINIDVNPIYNKKLQLLS
FT                   FKLENLKPNTTYKITKFSITNQIADLTKVDNLSFNTSPENNLPNLPNLPNDPNIKIEDI
FT                   KTNEANNNSIKITLNINIENNNNLENKYVRLVYKDNENKLKLSNILKINDLKKQNFILE
FT                   DLTSNRKYSFEELIIGESNDLNLNNAQTKISTNQKQKFSFVTLPNPVKITAIEIDSKFD
FT                   NNPSSLITLKFKDNENNLKENDILKIKYKKAGPNQVVFEKSVRLTNNLEVLFEIENIKK
FT                   NEQYEIISIESNSKHGYNVNPSVFNFSSNSLRIFSIKD"
FT   gene            complement(677441..677572)
FT                   /locus_tag="UUR10_0553"
FT   CDS_pept        complement(677441..677572)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0553"
FT                   /product="transposase, mutator type"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59973"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZBZ2"
FT                   /protein_id="ACI59973.1"
FT                   /translation="MIRNNIKNVSYKYYKEFCLDLKTIYGAINLEEAQENLELFGQK"
FT   gene            complement(678185..678895)
FT                   /locus_tag="UUR10_0554"
FT   CDS_pept        complement(678185..678895)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0554"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59931"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZBZ3"
FT                   /protein_id="ACI59931.1"
FT                   /translation="MESYPKTTIDVDPQTKRPICEVKLFVMSIDYPWLVNKKARFVFSY
FT                   KTANGKEKEFMAQTDDIGDNDQKNYKDKFLFKLKNHLYIKVVLPVANRAYKLKRVEILN
FT                   DNNTWTIFNQSDKGLEFCCHGSQNSILTSANDFNENKNNKYIKNISSTQVNLNLELFSN
FT                   DQGFRDGLVANVELIDEKGNIKGPYQIALSKTDKNIDGTIKTNFDKESQLGLTSWLISD
FT                   NKINNLEPYTKYWY"
FT   gene            complement(679263..681328)
FT                   /pseudo
FT                   /locus_tag="UUR10_0556"
FT                   /note="putative membrane protein, degenerate; this region
FT                   contains one or more premature stops and/or frameshifts"
FT   gene            complement(681531..682052)
FT                   /gene="apt_2"
FT                   /locus_tag="UUR10_0558"
FT   CDS_pept        complement(681531..682052)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="apt_2"
FT                   /locus_tag="UUR10_0558"
FT                   /product="adenine phosphoribosyltransferase"
FT                   /EC_number="2.4.2.7"
FT                   /note="identified by match to protein family HMM PF00156;
FT                   match to protein family HMM TIGR01090"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59968"
FT                   /db_xref="GOA:B5ZBZ4"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005764"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZBZ4"
FT                   /protein_id="ACI59968.1"
FT                   /translation="MINIDYIKSKIKDVPDFPKKGIIFKDITPLFLEPKVIEKIVDDFA
FT                   EFAKSLDVDVIIGAESRGFLFAAPLSIKLNKPFVLVRKPNKLPNDVYSAEYTLEYGSSR
FT                   VEMHKDALKPNQRVLIVDDLLATGGTVAAIENLVHQAQATVVGSVYLIRLGFLKGEEKL
FT                   SGKVHALINY"
FT   gene            complement(682073..685096)
FT                   /locus_tag="UUR10_0559"
FT   CDS_pept        complement(682073..685096)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0559"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59742"
FT                   /db_xref="GOA:B5ZBZ5"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZBZ5"
FT                   /protein_id="ACI59742.1"
FT                   /translation="MSFKTKTKFKQKWKSVLAFLGIGALTVGTIVGTGVGAANYAYKNK
FT                   KTGDFGDKISARTQVLLNDYQTEEEQIDLLKTTANLNQKHLQALGVNNVSAKYGIYQRI
FT                   NKNTKKWEKFGEIVYEFYPTNSKLDIVNFLTKTKPYEQISSKIQLISLFTTANRLELQN
FT                   ISSLLSPKPELSQNKEFDDTNWLTLNSDAKKIEIKTTNEGQQVEVSLPKTSADDQKFDL
FT                   NFFAKEFDANFNYSASSGKTRAQTVAAFEKTKQNRKAPVNSWLLWVNRDGLIARFNMLL
FT                   TLAHAQKQKYVDAKSWDYVDATYKNLNVNGEEKAFIDWLATQDFDKYFIHNSSIIKPIN
FT                   VQVDQLLNIIRAFYQSSSHKVKTKDANNKDVAQTFKDNEMFYSWNINKLSLINGFVYAI
FT                   DYNNFFNYFEAPKKDDKLTLAQQSIVKYTSNKLVLNQKNTSRAFINTVYNLKQYYLPTY
FT                   FAQAIYSENDIKKDYAKTFYSLLNNFSTKLPNLKQGAIKMLDPIDAILIGIAVLILIVA
FT                   IIISVLYKVPGLIHSLLMAFNFVISLLLIKASNLGFSTETYGALIISVCWPLLNLVNFN
FT                   NHIKRLVEQKYSYKNALRISLNKTIINQGMFYLLMIFISLVFMYFGKNNISIFGFNLIL
FT                   ITFSCLLISYILFIAMMYLLWLIAHHVPKIHLWRQYLAATNAISQNRFNEEFDWNDQQK
FT                   YQQFIFKAMNQKVYKLSFLIFVFVIGLAGLFVLGFVVPNMSFSFGSVYELTMKNDLKNF
FT                   NEHEFSSFLDYEINNGIVSMYFDAKNPSALNEIASISLNNRFSDAIVYTSSLYNLINNI
FT                   TNSIAAYFIIFAIIVIWSSIWLKPQSTIPLIINLICTTLVSFGIAGLFRLFNNQASIIA
FT                   INTSFVLIVSFSLHICLNLKQTLNLAKVLTKKQLQLQIQDSLIKYFNTYNIIYIVMLFT
FT                   LLWLMIFAPLALISFNAIILFSLMFTHYLAIIIINYLWMLTMILYERLLAKTLAKSDNA
FT                   NNVYDKFDEQEIVNINKF"
FT   gene            685310..686059
FT                   /locus_tag="UUR10_0560"
FT   CDS_pept        685310..686059
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0560"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59825"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZBZ6"
FT                   /protein_id="ACI59825.1"
FT                   /translation="MNEYQNQKLELYFIKNAIKNEIMSFNECIQYLKYHTYFYKLKRLN
FT                   NLFENKIHDFFHLVRISNLDFVLRKNINNKIMILEHLLKLKIHNFINDEEEPRSVFESF
FT                   FNYYKNDKYLINYEKYFNKCKNIDLSSFVEILNLYVLMLLNAFIFQNKVEKVQAKLILM
FT                   IRNNCAHNVPVIIFFKKDFNNMSKALELIHEIANCSVENKIKNEILINDKYLNEYLNAN
FT                   FHWLKGYGLINKILIFIKNCFNSIAQN"
FT   gene            686129..686596
FT                   /locus_tag="UUR10_0561"
FT   CDS_pept        686129..686596
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0561"
FT                   /product="conserved hypothetical protein TIGR00043"
FT                   /note="identified by match to protein family HMM PF02130;
FT                   match to protein family HMM TIGR00043"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59886"
FT                   /db_xref="GOA:B5ZBZ7"
FT                   /db_xref="InterPro:IPR002036"
FT                   /db_xref="InterPro:IPR020549"
FT                   /db_xref="InterPro:IPR023091"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5ZBZ7"
FT                   /protein_id="ACI59886.1"
FT                   /translation="MRFLITNEVKSVFNDEIYLQRFEQIANLISIKLNIDKERFFECHF
FT                   VDEKTIQEINRDYRNKDYITDVISFAFDDGEIITPLLGEMYICYQKVVNQAKEFGHSFE
FT                   RELCFLFTHGLLHLLGYDHIEVEEEKIMFGLQDEILNELNITRNVNGNKNG"
FT   gene            686589..687491
FT                   /gene="era"
FT                   /locus_tag="UUR10_0562"
FT   CDS_pept        686589..687491
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="era"
FT                   /locus_tag="UUR10_0562"
FT                   /product="GTP-binding protein Era"
FT                   /note="identified by match to protein family HMM PF01926;
FT                   match to protein family HMM PF07650; match to protein
FT                   family HMM PF08477; match to protein family HMM TIGR00231;
FT                   match to protein family HMM TIGR00436"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59962"
FT                   /db_xref="GOA:B5ZBZ8"
FT                   /db_xref="InterPro:IPR004044"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005662"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030388"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5ZBZ8"
FT                   /protein_id="ACI59962.1"
FT                   /translation="MVKKYGIVAIVGKPNVGKSTLINAIMRKKVSIISNKPQTTRNAIK
FT                   EIYEDDDSAIIFTDTPGFHEPSNKLDLFLNHEIEVSYKEANVILFVSSMDKELSEDDFE
FT                   IINLIKESNKENVILVISKAEVAKNQDKIDERVHQLNKYIQFKDVIQISALHVINIDKL
FT                   INTIKQYLHKDVVTDYFRQKVEKEDKFIIAETIREQCLLNLNHEVPHGVGVEIDESKYN
FT                   QEANHWIIKASIIIEKNSHKPIVIGQNGAMIKKISMAARKQLHEIYDCHISLTIFVKVE
FT                   NNWRENNNVVKSLGYKIKK"
FT   gene            687491..688207
FT                   /gene="recO"
FT                   /locus_tag="UUR10_0563"
FT   CDS_pept        687491..688207
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="recO"
FT                   /locus_tag="UUR10_0563"
FT                   /product="DNA repair protein RecO"
FT                   /note="identified by match to protein family HMM TIGR00613"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0563"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60121"
FT                   /db_xref="GOA:B5ZBZ9"
FT                   /db_xref="InterPro:IPR003717"
FT                   /db_xref="InterPro:IPR022572"
FT                   /db_xref="InterPro:IPR037278"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZBZ9"
FT                   /protein_id="ACI60121.1"
FT                   /translation="MAEIITKGYLVARRDYDVFDEILTFINEHGNRFVMFAPGTKRITS
FT                   KNARALFFGNYLEIQFFHATNETKLSKLKKVIPLDQIDYKYENTYSMLILSELMSKVID
FT                   FNVEFYQFYQLILQYIILEYNDYYISCFLLVKFLIMNGINFNFRSCAYCNSSKNIKTFS
FT                   LVDRGLVCVNCESKIINKIDYDPKALQLWQKLYFASQVQKEQIEDNELTFKGLLKILNS
FT                   IMYDQLGIYLTIIKNI"
FT   gene            688243..689664
FT                   /gene="glyS"
FT                   /locus_tag="UUR10_0564"
FT   CDS_pept        688243..689664
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="glyS"
FT                   /locus_tag="UUR10_0564"
FT                   /product="glycyl-tRNA synthetase"
FT                   /EC_number="6.1.1.14"
FT                   /note="identified by match to protein family HMM PF00587;
FT                   match to protein family HMM PF03129; match to protein
FT                   family HMM TIGR00389"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60310"
FT                   /db_xref="GOA:B5ZC00"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002315"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR022961"
FT                   /db_xref="InterPro:IPR027031"
FT                   /db_xref="InterPro:IPR033731"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5ZC00"
FT                   /protein_id="ACI60310.1"
FT                   /translation="MKNKFKTQEELVNHLKTVGFVFANSEIYNGLANAWDYGPLGVLLK
FT                   NNLKNLWWKEFVTKQKDVVGLDSAIILNPLVWKASGHLDNFSDPLIDCKNCKARYRADK
FT                   LIESFDENIHIAENSSNEEFAKVLNDYEISCPTCKQFNWTEIRHFNLMFKTYQGVIEDA
FT                   KNVVYLRPETAQGIFVNFKNVQRSMRLHLPFGIAQIGKSFRNEITPGNFIFRTREFEQM
FT                   EIEFFLKEESAYDIFDKYLNQIENWLVSACGLSLNNLRKHEHPKEELSHYSKKTIDFEY
FT                   NFLHGFSELYGIAYRTNYDLSVHMNLSKKDLTYFDEQTKEKYVPHVIEPSVGVERLLYA
FT                   ILTEATFIEKLENDDERILMDLKYDLAPYKIAVMPLVNKLKDKAEEIYGKILDLNISAT
FT                   FDNSGSIGKRYRRQDAIGTIYCLTIDFDSLDDQQDPSFTIRERNSMAQKRIKLSELPLY
FT                   LNQKAHEDFQRQCQK"
FT   gene            689652..691598
FT                   /locus_tag="UUR10_0565"
FT   CDS_pept        689652..691598
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0565"
FT                   /product="DNA primase"
FT                   /EC_number="2.7.7.-"
FT                   /note="identified by match to protein family HMM PF01751;
FT                   match to protein family HMM PF01807; match to protein
FT                   family HMM PF08275; match to protein family HMM TIGR01391"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0565"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60226"
FT                   /db_xref="GOA:B5ZC01"
FT                   /db_xref="InterPro:IPR002694"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR006295"
FT                   /db_xref="InterPro:IPR013264"
FT                   /db_xref="InterPro:IPR030846"
FT                   /db_xref="InterPro:IPR034151"
FT                   /db_xref="InterPro:IPR036977"
FT                   /db_xref="InterPro:IPR037068"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZC01"
FT                   /protein_id="ACI60226.1"
FT                   /translation="MSKITNNVFQAIRDAVNISNVIQNYIKVIKKGNNYWAICPFHNDT
FT                   NESLSISDKKQIFKCFSCNHAGDVIKFVADYKKIPYVLAAQEIIRTMNLDLKLLNHLQK
FT                   ISPEETKKNKLFDLNKQIQKWFINFLNNKNNKHVLDYLVKRNLNQSDLEYFKIGYAPGN
FT                   DQLLNLIKSNYDNLVQENDEFELNKLINNSFLVIDKKGDYHDFFNDRIIFSIYDHLNNI
FT                   VGFSGRIINNEKTPKYLNTKTTLVFKKDEILYNFNNVITLDDNHQLFIVEGFMDAITTH
FT                   KSNKPNVVATMGVELSNKHLETIANYGIKDLILCFDNDHAGFLATKKQVLKLANLAFNI
FT                   FVVDHKNNDCKDIDEYANKYGYDATNKLLEQQLHISEFLLLDITNTNKSTPSLKHSYKQ
FT                   DCFEIIQKYGDIFYIDKYVDFINQTLQMDEVLLKKIIEELLIKKQSKPIQNKENEYSYV
FT                   YQDKKYHKTKKQITQQSFNNKKLPLTKINKHFNHLVIILLMNRKFLNRFDSQIRNKFSR
FT                   NQNLIVNIIEDFYLYNFEVNAILKDSEIFIEFINKNYAKYDEIINQFTKIIQVVKYNPK
FT                   LDNLIAFELAKNSFLYEWYNNEIKHLKLTNLNLDINDNQEQIANNEKLIKQYNDEKVLL
FT                   DNLINASLFHKNQ"
FT   gene            complement(691657..692265)
FT                   /gene="rpsD"
FT                   /locus_tag="UUR10_0566"
FT   CDS_pept        complement(691657..692265)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="rpsD"
FT                   /locus_tag="UUR10_0566"
FT                   /product="ribosomal protein S4"
FT                   /note="identified by match to protein family HMM PF00163;
FT                   match to protein family HMM PF01479; match to protein
FT                   family HMM TIGR01017"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0566"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59818"
FT                   /db_xref="GOA:B5ZC02"
FT                   /db_xref="InterPro:IPR001912"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR005709"
FT                   /db_xref="InterPro:IPR018079"
FT                   /db_xref="InterPro:IPR022801"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5ZC02"
FT                   /protein_id="ACI59818.1"
FT                   /translation="MSRYTGSIYKKSRRLGFSLLENNKEFNSGKKRTYGPGQHGNKKVK
FT                   LSNYGQQLVEKQKLMFLYGLNDRQFRRLYRVALGRPGVLTLNLLQVLESRLDSLVYRAG
FT                   FAPTRRAARQLVNHSHVLVNGKKVNIPSALVEVGSTIALKEKSLEMPLIKNTLNKPADF
FT                   IELVDKDKKVAKLSRLPERSELPADVNEAYVVEWYNRLM"
FT   gene            692536..694227
FT                   /locus_tag="UUR10_0567"
FT   CDS_pept        692536..694227
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0567"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0567"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59728"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZC03"
FT                   /protein_id="ACI59728.1"
FT                   /translation="MSLIYLLIGFVLLFSIPYIVFALLDDWAIKKYNTFRRHFFNFDQL
FT                   VNTKFNDIYASTDNIYARTSKQKVAIINEYLIAINKELNFHKKSLLKLQDYLENHKIFS
FT                   YVSFIKYISENEIKIQNNVNDFIDLIESFWNDFIIIDQQEKKIADTHKKLDLMYKDLIS
FT                   KYSIPNLNFQKAINWTDELFNNLIETKISMNYPKYNYFLVQLIHRIKNKIHLLRNIIMI
FT                   LNSIKIIEEANKNSMQKVQEITFLTEDKIKELKQFNHDFNYFINNQLADFIYNSKFVNL
FT                   NNLYLNNYYQQALNWLNISSQNNIGGAVFDKYKKRFYDDFSLINDRINKVNNVLEQLKN
FT                   TSKNYQLKELDQLIFGLNEANQKIISSKIDKNDIKQNVDFIVSTQAFYTNLQKLLLYLN
FT                   ELSIKLTKWNHHWNALIKKIITIYNKKIEIQTYLENKNIFHDLSNDIFSEDFEYVEKLF
FT                   QKTNASKDFDPQILIDNELIIHQLNLINQRFDYVIEYINQTQLWMPKIYDLLYSKVNYY
FT                   GVNYELVKQNFANVNWNNIVEASKILSEFIDNIVVADHALKRLKFN"
FT   gene            complement(694302..694456)
FT                   /locus_tag="UUR10_0568"
FT   tRNA            complement(694302..694456)
FT                   /locus_tag="UUR10_0568"
FT                   /product="tRNA-Phe"
FT   gene            complement(694457..694535)
FT                   /locus_tag="UUR10_0569"
FT   tRNA            complement(694457..694535)
FT                   /locus_tag="UUR10_0569"
FT                   /product="tRNA-Met"
FT   gene            complement(694592..694686)
FT                   /locus_tag="UUR10_0570"
FT   tRNA            complement(694592..694686)
FT                   /locus_tag="UUR10_0570"
FT                   /product="tRNA-Ser"
FT   gene            complement(694753..694832)
FT                   /locus_tag="UUR10_0571"
FT   tRNA            complement(694753..694832)
FT                   /locus_tag="UUR10_0571"
FT                   /product="tRNA-Met"
FT   gene            complement(694833..694911)
FT                   /locus_tag="UUR10_0572"
FT   tRNA            complement(694833..694911)
FT                   /locus_tag="UUR10_0572"
FT                   /product="tRNA-Met"
FT   gene            complement(694914..694992)
FT                   /locus_tag="UUR10_0573"
FT   tRNA            complement(694914..694992)
FT                   /locus_tag="UUR10_0573"
FT                   /product="tRNA-Pro"
FT   gene            complement(695037..695115)
FT                   /locus_tag="UUR10_0574"
FT   tRNA            complement(695037..695115)
FT                   /locus_tag="UUR10_0574"
FT                   /product="tRNA-Arg"
FT   gene            complement(695119..695193)
FT                   /locus_tag="UUR10_0575"
FT   tRNA            complement(695119..695193)
FT                   /locus_tag="UUR10_0575"
FT                   /product="tRNA-Cys"
FT   gene            complement(695341..696132)
FT                   /locus_tag="UUR10_0576"
FT   CDS_pept        complement(695341..696132)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0576"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF00149;
FT                   match to protein family HMM TIGR00282"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0576"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59719"
FT                   /db_xref="GOA:B5ZC04"
FT                   /db_xref="InterPro:IPR005235"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZC04"
FT                   /protein_id="ACI59719.1"
FT                   /translation="MKILAIGDIFSKQGRKAVANELPKLKQEHQIDFVIANAENTTHGR
FT                   GLCWKHYEELVGYGIDCITMGNHTWDHPDIFEILTTKTNIIRPYNIINTHQYHLVGSGS
FT                   RVFYCNKKMIRVTNLLGNSIDMKGLQTNPFESLDKIIACNEAPIHIVDFHAETTSEKNA
FT                   LFLDFKGKLSLVYGTHTHIPTNDARIVDRTAFQTDLGMCGAANSVIGANPSSIIQRFRD
FT                   PNKRFILEPSDEKYVFCASLVEIDDETNQPIKITPIVIYEK"
FT   gene            complement(696136..698367)
FT                   /locus_tag="UUR10_0577"
FT   CDS_pept        complement(696136..698367)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0577"
FT                   /product="ATP-dependent DNA helicase PcrA"
FT                   /EC_number="3.6.1.-"
FT                   /note="identified by match to protein family HMM PF00580"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0577"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59766"
FT                   /db_xref="GOA:B5ZC05"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR013986"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZC05"
FT                   /protein_id="ACI59766.1"
FT                   /translation="MGVGIDYSRLNQEQKEAVTADLGPQLVIAGAGTGKTSVLTLRIAH
FT                   LITEKHIHPSRILGFTFTNKAADEMKERVGKTIGVSIPYLSTFHSMCVKILQQDIHYLN
FT                   YHNNIKIIDADDQEVLLKEIFDQLSIEKKSPIIKKTIKMISKVKNKFFDQSDIMNEKNR
FT                   KYLEIVDRNDAQKLADIYTIYCDRCFKLNYVDFDDLINLTYKLFAEFPEVLEKWQNKFD
FT                   YILVDEFQDTNKIQYDLISLLAAKHQNLFVVGDPDQMIYSFRGAEQWIINNFNQNFKNT
FT                   KVTILKTNYRSTQPILDTANRLIDANNNSYKKNLTAFNTNDHNIPIYLRGQNQIDEANW
FT                   IARTVKELLEEGTPANQIAILFRSNHYSRTIEQSMMRESIPYTILGSKKFYERAEIKDM
FT                   IAYLKVVNDLDELSFLRIINTPRRAIGPTTFEHVKHYAINNNLFLFEALAEVEKNHLIN
FT                   NTQKKNILNFVNLIKEIRDEMEDLKLHEVLELIYKKVNYEAYLLENERAEDKIDNVSEL
FT                   KRAMKMYVDRHPDDTINDYLNSIALYLNKDSKDSKENVLLMTVHNSKGLEYENVFVVGM
FT                   NEGHLPSDRAIDDDPIKGVEEERRIAYVALTRAKKNLYISSACCYDPLARRQVFESRFI
FT                   NEIGFNNLKIINSSFKNNKPEDMPLKSFLKQQEERSWFDSQQKQKEAEDNFYQTMKNDF
FT                   EIGERIVHTSFGNGVIIGIDGDILTIAFSKYRQPKQISFNHKTIVRRMG"
FT   gene            complement(698392..699213)
FT                   /locus_tag="UUR10_0578"
FT   CDS_pept        complement(698392..699213)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0578"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0578"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59803"
FT                   /db_xref="GOA:B5ZC06"
FT                   /db_xref="InterPro:IPR010432"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZC06"
FT                   /protein_id="ACI59803.1"
FT                   /translation="MSDKTTLKQENTIEYPVVSALRRAGAGVLDYIFVSILAFLLSLLV
FT                   FINSNFKISDVFVNNDELAPEPWRLFLMAIIAFFVYCTYYIIIPVFCKSYTLFRWAFSI
FT                   RMISLVKQNDKKILFVALIKHSLLTWLIFIMINLLAMGFCFAFADASFKSIEAMNEIEL
FT                   KEHYRQIKDLKAYVQSILSLKINDNFTSTTTMAILSILVKSLYSIMGLISCIIVIHMFM
FT                   NSKKRTLHDQVAKVVLLWMHYEKPKQAPKHKTKREVEIQKIDNLIQELDKI"
FT   gene            complement(699214..700152)
FT                   /locus_tag="UUR10_0579"
FT   CDS_pept        complement(699214..700152)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0579"
FT                   /product="glycosyltransferase"
FT                   /note="identified by match to protein family HMM PF00535"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0579"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60219"
FT                   /db_xref="GOA:B5ZC07"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZC07"
FT                   /protein_id="ACI60219.1"
FT                   /translation="MLLTIAFYLSKTTHYLKKNFNYFLDLLNQNKKHIELIIIDDASDY
FT                   NLFKTLKPLIENTNSKIKYFYLNETQGNAYAYNLATKYAHGKYIWYLGGHTELNLDASS
FT                   LLFSVLEKDYDVISFNLNDNVNQNPSLVFDSLNKEVLVGLWESISNKIIALDFIKKHQL
FT                   AFYNDKWYPALFIYDLFTKFSSWRNVNVNFISNNSGEVGYNVYDLLQQINELYAKFSND
FT                   GLLEIYKDELCYWITGICIHSFLKKIYELYTININSKKQIKERTMIISHALSNAKKYLE
FT                   TYFANFENNPYVRKYKTNILKYYLKSKQGLN"
FT   gene            complement(700240..700318)
FT                   /locus_tag="UUR10_0580"
FT   tRNA            complement(700240..700318)
FT                   /locus_tag="UUR10_0580"
FT                   /product="tRNA-Arg"
FT   gene            complement(700398..700476)
FT                   /locus_tag="UUR10_0581"
FT   tRNA            complement(700398..700476)
FT                   /locus_tag="UUR10_0581"
FT                   /product="tRNA-Arg"
FT   gene            700575..700778
FT                   /locus_tag="UUR10_0582"
FT   CDS_pept        700575..700778
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0582"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0582"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60299"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZC08"
FT                   /protein_id="ACI60299.1"
FT                   /translation="MNTKEITQAFLYKSKLFRIQYLFLDVWDEKQYLKIDVIEDLRFIN
FT                   KWNINKIKALNHKTKEGDENAC"
FT   gene            700768..701907
FT                   /locus_tag="UUR10_0583"
FT   CDS_pept        700768..701907
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0583"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0583"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60169"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZC09"
FT                   /protein_id="ACI60169.1"
FT                   /translation="MLVNPQINYYLQEKKYVPQYAYYVNKKQKPIELFARYRGRPALFI
FT                   RENTMINTSLASNVLNLDFEFEVAGDFKLPINYFFMDIKSEIGEFRNLEVRETKHSPYE
FT                   IGGTNYDLYTYKTSLKINLNQAGFVNKTTLNKKINFAFFLRINDDKRIHEQIDYTCGKS
FT                   LFFEAVQKEFENLNFDYFYKNTFLLNNHKKVDPTNFWETIPLFWLQQKDFHNQIAIANN
FT                   KRHIFNTKLTLNDKDSWTNRPTKETFESIKYCLEYTNLANQNKKIEWNEDYESINIAYD
FT                   LHQRPIDFLLTMKAKFLYDFSNDQLIVDNNHGFSGIWLPSKQKAKLKITFINNYLTPQK
FT                   YEMEQLIEIKNDFNPHNKRKISVRKAIIENYEDFKTIEN"
FT   gene            701930..702871
FT                   /locus_tag="UUR10_0584"
FT   CDS_pept        701930..702871
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0584"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0584"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60037"
FT                   /db_xref="InterPro:IPR035219"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZC10"
FT                   /protein_id="ACI60037.1"
FT                   /translation="MIIGAIACLLIVIIAIVLGVVLSNQESTKINKKEPLTQINEAINN
FT                   QKQKQHKIVGDVAIIDKKGEIINKKVDITEINQTDKQKEILNNYLKNKEKLKGKPKKYN
FT                   QNNTKPTINNKEQSDLNNNHINKTNDQNNHLSIKENEKKPLENKANNDKELTKSDDLNT
FT                   KNDDENNKQDLTKLENNNKVVNNDQIEKNNEIINEEDPIKLKRFNIINAIAKNKKLYEL
FT                   LDFKYYFSNENNSNDIKFNEELFIKNMYRIIESAISSFQEFHNIMQYIKIDIKYKFDKD
FT                   AKNIIVIVNWLFDNYNIKSETRYYEEFVLSIN"
FT   gene            702887..703120
FT                   /locus_tag="UUR10_0585"
FT   CDS_pept        702887..703120
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0585"
FT                   /product="acyl carrier protein"
FT                   /note="identified by match to protein family HMM PF00550"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0585"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60222"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZC11"
FT                   /protein_id="ACI60222.1"
FT                   /translation="MVVNVKDIIIKVAKENKINLNMNNLDVELKSLGIDSLSAMSLIMK
FT                   IEDKIGVQLVDEKLLKIKNLGDLIMAFEDALK"
FT   gene            703192..703266
FT                   /locus_tag="UUR10_0586"
FT   tRNA            703192..703266
FT                   /locus_tag="UUR10_0586"
FT                   /product="tRNA-Sec"
FT   gene            703778..704737
FT                   /gene="dcm"
FT                   /locus_tag="UUR10_0587"
FT   CDS_pept        703778..704737
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="dcm"
FT                   /locus_tag="UUR10_0587"
FT                   /product="DNA-cytosine methyltransferase"
FT                   /EC_number="2.1.1.37"
FT                   /note="identified by match to protein family HMM PF00145;
FT                   match to protein family HMM TIGR00675"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0587"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60158"
FT                   /db_xref="GOA:B5ZC12"
FT                   /db_xref="InterPro:IPR001525"
FT                   /db_xref="InterPro:IPR018117"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR031303"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZC12"
FT                   /protein_id="ACI60158.1"
FT                   /translation="MKDIKVASLFAGIGGICYGFKQAGAKIVWANEIDRDACKTYRYNF
FT                   GDSYLVEGDIKNIGPNDIPDIDILNGGFPCQAFSIAGYQKGFNDERGNLFFEIVRIIKV
FT                   KKPRAILLENVKNLETHDNGNTFKVIKNELEKLGYHVHHKVLNTMDYGNVPQNRERIYI
FT                   VGFLSKKAYEVFKYPCPITLTNTIRDVIDFNDKKLEKYYYNNSKYYSLLKPIMTKQDTI
FT                   YQWRRVYCRENKSNVCPTLTANMGTGGHNVPLIKDNYDIRKLTPEECVAFQGFPSEFQF
FT                   PIDISNAAKYKQSGNSVSVPVVRRVVEKLLEALKADEE"
FT   gene            complement(704769..705329)
FT                   /locus_tag="UUR10_0588"
FT   CDS_pept        complement(704769..705329)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0588"
FT                   /product="type II site-specific deoxyribonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0588"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59845"
FT                   /db_xref="InterPro:IPR019037"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZC13"
FT                   /protein_id="ACI59845.1"
FT                   /translation="MKQETIKLKDGSIVIGDTFDKNDFEILREIFKEWLIMNKKLKSLG
FT                   GRGLNVPDVFSEALFCLAFNAVRTNGTAYSYDCVIRDTGEGVQVKSASIPNDCTSFGPT
FT                   STWDLLYFVDFAPNGKVDGLVKFYKIEDDDVYNLVLNAKKGETFKDQQAQGRRPRFSIQ
FT                   SAIIRSKRLLPIKTINIITGEGL"
FT   gene            complement(705827..707194)
FT                   /locus_tag="UUR10_0589"
FT   CDS_pept        complement(705827..707194)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0589"
FT                   /product="cytosol aminopeptidase family protein"
FT                   /note="identified by match to protein family HMM PF00883"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0589"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60114"
FT                   /db_xref="GOA:B5ZC14"
FT                   /db_xref="InterPro:IPR000819"
FT                   /db_xref="InterPro:IPR011356"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZC14"
FT                   /protein_id="ACI60114.1"
FT                   /translation="MTLNEKKEFVYELKAVKKDHNLKGFEKNTAEHVVFGEVYQKQHYL
FT                   ILTPDFDSNELSRSLVSFLEKSPKPVSVDLNSFLDLVPESRHASLLNVVVSALEYVEVT
FT                   PFSLKSKVEPKNIHNLVVDAKYHDLIAKLQVIAQSQTITRTLQDTPANLMTPGDFEERI
FT                   KELFKDLPEVKVSVLYRKDLEAKGMNAHVGVGKAAVSDKAQPRLVVVEYNNNPDTDEKY
FT                   AFVGKGVCFDSGGYNVKTGSHMRWMKFDMSGSAIVSMTVRALALNKEKVNVVAVCPLVL
FT                   NLLAPEGQKPDDIIKSYNGKTIELDNTDAEGRLILADALTYAVRDLKASKLFDIATLTG
FT                   AMIFALGDTYSGVWATNNDIWNEVVVAADYAGELVWRLPFHNDFLKMLNSNVADIANSV
FT                   TDPRGGSSRAACFLKEFTEGVPYAHFDIAITADVGHKGTGVMLRTFYRIAQNQKFN"
FT   gene            complement(707291..709621)
FT                   /locus_tag="UUR10_0590"
FT   CDS_pept        complement(707291..709621)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0590"
FT                   /product="cell division protein"
FT                   /note="identified by match to protein family HMM PF01580"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0590"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59791"
FT                   /db_xref="GOA:B5ZC15"
FT                   /db_xref="InterPro:IPR002543"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZC15"
FT                   /protein_id="ACI59791.1"
FT                   /translation="MANDNKNSTPNKETISFYSYDDQLDESKKESNDLTSENKTQDKSS
FT                   KPKPKKTKFSKLDFNNKKKIIGICVFALSFLILLFAIFKVPYTGAILDNVLEFFFGWVK
FT                   YYIYAILLLFLIVFYIKKARKRLFSKWMIVFYVVTIILFTLIIGAVGYGVITHSLIYKF
FT                   IVNTNQQTIDQKVLDSYKNNYEYIALVNLHAKKLHLSEWWAANWSQDFLKAIDKNHYYY
FT                   TSIFAYGGIVGYANLDIYRANAWIFTIVIMSIILGIICFILITFGTRSRLGLKFKKWFI
FT                   NKIIANINTYHKKDYQLNERNYFEEKLGTDHHGTNQQFSAKQIVEQQNIQTKITNSEPP
FT                   INSPTSKNKKIEEIVSNPIVDNTNQVVDNTPITKNSKYEFYPRISIIDGKSQDYLHELK
FT                   SIGENLKLVIDQFLESNQLECQFNTINTYFSNVEIIYQFSRLSLSNFIKNYLNLMKQTI
FT                   CDTNEYEISIYNDNELLVVQAKAKNLNAQINIKDILNDLEYNDKLCLGIGKLKERSVVW
FT                   LEDNQVGSILVHGSQQASGRSMLISNIIISALYTKSPNELELFIVNNGSKPLKEFAKLK
FT                   HTINCVDHDDFENVINLLKTIVNNINNENTLFTNNGVDNLDDYNAKNQNQKLAKKLIII
FT                   SEYAEIINSEFKTRFDTLIRNIASVAKKHGIILILSSSITNENTVSFKNVFDYTIALKL
FT                   NNPYESILLTDRNWCNNLSGFGDMLLIRNFDNLPLRVQTAKVSNDQFANIINEINSADY
FT                   DINEYRHETKLTSKTQNFFNKQS"
FT   gene            complement(709641..711323)
FT                   /locus_tag="UUR10_0591"
FT   CDS_pept        complement(709641..711323)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0591"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0591"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59877"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="InterPro:IPR042173"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZC16"
FT                   /protein_id="ACI59877.1"
FT                   /translation="MAKINFLSLGGQDERGKSCFVLEVNDDIFIFNAGAKIPTSDVFGV
FT                   NMIVCDYSYLEKNAKRVKGIFIGTPTFNNVMGIKLLLAQVGYKIPIYTSPIGAIVVKKI
FT                   FEQKVNNKKIEPNIIELDPISDKKIGSIYVTAFKVSNSMPHSYGFVLKTSDGAIVYIDE
FT                   FIISNDKNKTFDSQINALNNITKNNTLALIVGMGQAGNPCFTAPNHKNKGFYESILQNT
FT                   KNRLIVGCYSNDAYSIFTLATIAKQQNRPFIVYSNNFINTFVGVLKLKLFNSKNLISLP
FT                   VSEINNSKNAIIVVIENQDTLFPRLNKILHNEDKHITLTSEDQLVLGVVITPGFEMLAA
FT                   QLSDEVGRLDIPYKALPKTVLPMTQSDEDLKHLINFLQPKYLIPINGLYKTEVKFTSTV
FT                   TTSWIKSDQIISISNGELFSIEDKVLNPKPQVIELEDKYISSFDALDVGANILFERAQM
FT                   GENGVINLIVIFDKQFQKLFNYVEFDYCGVVNDDPQVRAQVKEIEETFKKRMGECLVYD
FT                   DRKRLVLKDTKASLKRLLTKLFEKKFNKRPLVLPTVVDCYKTK"
FT   gene            711468..713438
FT                   /locus_tag="UUR10_0592"
FT   CDS_pept        711468..713438
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0592"
FT                   /product="ABC Transporter"
FT                   /note="identified by match to protein family HMM PF00005;
FT                   match to protein family HMM PF03412"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0592"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59918"
FT                   /db_xref="GOA:B5ZC17"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005074"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZC17"
FT                   /protein_id="ACI59918.1"
FT                   /translation="MKIVQQTSDNECGVCVINMLANYYHNKTIDKNLVLQKANLTKNGL
FT                   NLQDLENLANEFSLDAQSFQCSFQELIDEKINDYFIALINRNGLNHFVIVKYFNKGFFR
FT                   IYDPANQIYELNNEQFEHLFLNVIIRVCKNHKILNFPIFKEPYLKYIKASSLIIILLLE
FT                   LLNIPLSIFLSKTVNLLIDLVLINEQVKNLTYLFIIFSLFYISSAFKDLLITVYVNKIS
FT                   NRIFCSINNELITNLTNKLIQFFNKTNLGELSSIQIHLNNVIHFLLVSRIKLLVNVLFG
FT                   ICIICLLGLQNWILLLVSLTFGLLSLLIGLMNWKYFKNQSLKMINIENSLFIKYQNLIK
FT                   LINFEHNTDKYNNYIHSYKEQLDESIIFRNKITIFKSNINFYLSIINNIGLLVLLVCLI
FT                   INANYQYKIVSIITYIVFLHQNLNNLSFGIFNFFNELLNFKNSKQIIEKILYVNNCEKH
FT                   DGIEINKVLACKIIKDQKTFEFQKSCLIIGKSGIGKTTLLKNFLDFNNKNLFFNDLNIS
FT                   SLNLKQLKELIIYHPTNALINDFNINWFVNQNQEITNALKIVIATAKIDWSLNSNFEQN
FT                   INLSTGQQQILAFLNLLKYKNKLLLLDEPLAHVDTDNKKIILDSILPLVLKNNFVIYVS
FT                   HDHYLKNYFDQIINLNDEKMN"
FT   gene            713467..713778
FT                   /locus_tag="UUR10_0594"
FT   CDS_pept        713467..713778
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0594"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0594"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59984"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZC18"
FT                   /protein_id="ACI59984.1"
FT                   /translation="MFIAIGVAFGFKNKKYFKTSLNFKTKLTMINKVDYEKIKKRKQLE
FT                   LKIDNIVYYAKFKFIKQVNDYCVIKIFLNLKTNEKMIGISIYTNTQPLIKSIINNFKL"
FT   gene            complement(713768..714913)
FT                   /gene="cdsA"
FT                   /locus_tag="UUR10_0593"
FT   CDS_pept        complement(713768..714913)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="cdsA"
FT                   /locus_tag="UUR10_0593"
FT                   /product="phosphatidate cytidylyltransferase"
FT                   /EC_number="2.7.7.41"
FT                   /note="identified by match to protein family HMM PF01148"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0593"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59993"
FT                   /db_xref="GOA:B5ZC19"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZC19"
FT                   /protein_id="ACI59993.1"
FT                   /translation="MISVNKINEKTKTTFFKRFYSSIFIFLYLLIYFVLALLSDRNYSW
FT                   TPLIDHLYIQQAIAIVLLVWLLPLVWIASYEMNKVIFDNHKITRITLTIIFNICVYAPT
FT                   ISYFIYQYEFLDVNYLMTINYHYMIKLFGTCLGCSYFVALVILFFLLAFLKKVNFKNCL
FT                   YTILIFTFLIGFFIGLLYFTFIRSWITSLLLMLIVFLSDTFAYVGGVLFGKTKLAPKTS
FT                   PNKTVEGLIFGLVIATIVIMLIIFGLSYVPIKPKNDMILKSQNVLYNIFGLDFSNSNKT
FT                   NLTLHKQVLWWICTTVAFLFLSLISTIGDLVFSATKRNYDTKDYSNLIPGHGGLLDRID
FT                   SHSFVITIMFIFTLVITGSLQDENLFPSIQKVFVEISSSIV"
FT   gene            complement(714924..715475)
FT                   /gene="frr"
FT                   /locus_tag="UUR10_0595"
FT   CDS_pept        complement(714924..715475)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="frr"
FT                   /locus_tag="UUR10_0595"
FT                   /product="ribosome recycling factor"
FT                   /note="identified by match to protein family HMM PF01765;
FT                   match to protein family HMM TIGR00496"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0595"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60070"
FT                   /db_xref="GOA:B5ZC20"
FT                   /db_xref="InterPro:IPR002661"
FT                   /db_xref="InterPro:IPR023584"
FT                   /db_xref="InterPro:IPR036191"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5ZC20"
FT                   /protein_id="ACI60070.1"
FT                   /translation="MNFKIYETKIREEFELVLKWMHNEFIKLRTGRATPAILDGILVDY
FT                   YGSMTPINQLANISVPEPRVLAIKPYDRSSIKDVASAINASNLGVNPQVDVDIIRLTFA
FT                   APTEEVRKNLAKKAKQVGEEAKIRVRHIRQEAQDLFKKNSSTVEDDKKFFQTELDNLTK
FT                   ELNKEIEAVVSHKEKDIMTV"
FT   gene            complement(715493..716200)
FT                   /gene="pyrH"
FT                   /locus_tag="UUR10_0596"
FT   CDS_pept        complement(715493..716200)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="pyrH"
FT                   /locus_tag="UUR10_0596"
FT                   /product="UMP kinase"
FT                   /EC_number="2.7.4.22"
FT                   /note="identified by match to protein family HMM PF00696;
FT                   match to protein family HMM TIGR02075"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0596"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60202"
FT                   /db_xref="GOA:B5ZC21"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR011817"
FT                   /db_xref="InterPro:IPR015963"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZC21"
FT                   /protein_id="ACI60202.1"
FT                   /translation="MSKQRIVIKISGACLRQDDNSIIDVNKINDLAKQIKEISKKYIVS
FT                   IVLGGGNIWRGHIAKELGMNRNLADNMGMMATIINGLALENALNNYNVDAIVLSAIKCD
FT                   KLVYESSANNIKKAIEKEQVMIFVGGTGFPYFTTDSCAAIKAAETESSIILMGKNGVDG
FT                   VYDSDPKTNPNAQFYQHITFNMALTKNLKVMDATALALCQENDINLLVFNIDKPNAIVD
FT                   VLEKKIKHTIVSK"
FT   gene            complement(716291..717166)
FT                   /gene="tsf"
FT                   /locus_tag="UUR10_0597"
FT   CDS_pept        complement(716291..717166)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="tsf"
FT                   /locus_tag="UUR10_0597"
FT                   /product="translation elongation factor Ts"
FT                   /note="identified by match to protein family HMM PF00627;
FT                   match to protein family HMM PF00889; match to protein
FT                   family HMM TIGR00116"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0597"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60200"
FT                   /db_xref="GOA:B5ZC22"
FT                   /db_xref="InterPro:IPR001816"
FT                   /db_xref="InterPro:IPR009060"
FT                   /db_xref="InterPro:IPR014039"
FT                   /db_xref="InterPro:IPR018101"
FT                   /db_xref="InterPro:IPR036402"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5ZC22"
FT                   /protein_id="ACI60200.1"
FT                   /translation="MTKAELVKELRTRTQASMSECIKALDASENDIEKAIIWLRENGAI
FT                   KAANKLKNAATDGVTLAKKVGNKAILIEVNCQTDFVAKNENFLAYANQILEEALAKVES
FT                   KEDFDKLIINGKPIAESGLDLTAYIGEKIVFRRGEILKANDQQTLGVYTHNNNRVAAII
FT                   LVDGKVEDEVVRNVAMHAAAMRPRYLNEQVVDQVWLAKEREIIVNQLEHEGKPAAFAAK
FT                   IIEGRLNKILKENCLVDQSYFKQPELTIEKYLKNNNAVAVGYYSYEVGEGIEKAPQMSF
FT                   ADEVAAQMKK"
FT   gene            complement(717310..717395)
FT                   /locus_tag="UUR10_0598"
FT   tRNA            complement(717310..717395)
FT                   /locus_tag="UUR10_0598"
FT                   /product="tRNA-Leu"
FT   gene            complement(717398..717475)
FT                   /locus_tag="UUR10_0599"
FT   tRNA            complement(717398..717475)
FT                   /locus_tag="UUR10_0599"
FT                   /product="tRNA-Lys"
FT   gene            complement(717544..717698)
FT                   /locus_tag="UUR10_0600"
FT   tRNA            complement(717544..717698)
FT                   /locus_tag="UUR10_0600"
FT                   /product="tRNA-Thr"
FT   gene            complement(717743..717897)
FT                   /locus_tag="UUR10_0601"
FT   tRNA            complement(717743..717897)
FT                   /locus_tag="UUR10_0601"
FT                   /product="tRNA-Glu"
FT   gene            718100..719158
FT                   /locus_tag="UUR10_0602"
FT   CDS_pept        718100..719158
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0602"
FT                   /product="hypothetical ferrichrome ABC transporter"
FT                   /note="identified by match to protein family HMM PF01032"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0602"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60355"
FT                   /db_xref="GOA:B5ZC23"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZC23"
FT                   /protein_id="ACI60355.1"
FT                   /translation="MNKIKNNEKHLFLRFKKMHNLKTFSKKGHRLKTKQIVFIVFLILF
FT                   CSSFFLIDLFFTGNHLNDVKRMFENSSLSNSTYIFVPVANIIAGFSLGVGSISIQITSK
FT                   NILSGPSTLGFTPMTILASTISFIITSSGVFSTVLVYCLGLIFSFVVIGVNFILVRSNF
FT                   LENNFKPILVAFGIGALVTGINIVLIATHDNLKIVGWWRFIAINNTLINNYRMIVSSVL
FT                   MVISTIILLFLSPYLNIIKKDYLLAKSLGIKVNLIYWLVAICVVIITISSSILLGIIAL
FT                   LGVIVGIITQTIFKKTHVLLLMVLAGLFGSGILSFSSYINEYIPSAREMIICIFAVPVF
FT                   AYILSKRKGFVK"
FT   gene            719160..720185
FT                   /locus_tag="UUR10_0603"
FT   CDS_pept        719160..720185
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0603"
FT                   /product="ferric anguibactin transport system permerase
FT                   protein"
FT                   /note="identified by match to protein family HMM PF01032"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0603"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60142"
FT                   /db_xref="GOA:B5ZC24"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZC24"
FT                   /protein_id="ACI60142.1"
FT                   /translation="MINLSTWNKTYSFKNPLKYQNKLAYLKTIITVAISIIVFIITLAW
FT                   TYDFNFKQNNIALVYIVMQIFLSGFVLGFCAYFIQKLTKNRFGDTSIMGISSVNILGVI
FT                   IIAFQVDFNNFSIDKLTTLQRTEPLIFFIAPIILCSIYYFTCKEESNFNYKKMLISGVI
FT                   VNFLSVALGSSIAKNLPKLANAYISRYTYGSIEPQQESFFIALVLIIIGFLIIMFNFKK
FT                   IQIVSSNQDLANQLGINVKLISGLLLVAICLMVGASYSLNGNLIFIGLMAGNMGSVISN
FT                   NRFKSAAISSGSCGALIYMLSFLLFIKILNFDSQWLNLAIPLLISPYFIYIIVKKNKSD
FT                   L"
FT   gene            720225..721847
FT                   /locus_tag="UUR10_0604"
FT   CDS_pept        720225..721847
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0604"
FT                   /product="putative ABC substrate-binding protein-iron"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0604"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59881"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR022381"
FT                   /db_xref="InterPro:IPR022382"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZC25"
FT                   /protein_id="ACI59881.1"
FT                   /translation="MKNSKLLWTSGLILVAGISIPVIATSCSLVDLFKGNKSSNSYKQE
FT                   EFTHGKLKSNLDYNVSTAYLNKRSIALKFTIPLNNNQAINIFGTGWIFDFQEDPITENI
FT                   KTYYLATNIHVINLISAAKQNVSLALGQYDLASQSQDTRAFFNESLSFKSAKKTDNPQN
FT                   YVNHNRVGTFSILPVGLKNQLKNYGVQNPTALASLNNLTSAVDLAIVKITPDILQKNNI
FT                   DALRNFDKEVGIGFGNTISHHQRFYAAGYPHDEKYSRWNQYSNQPNQLFNSFTTSNYRK
FT                   DNPINFSYNEAYMTVNNRNTIGKNSPTKYEAYDYATKDFDLHSGASGSPIIDDNNNYVG
FT                   IYWGGFKIQEGLRTTFYGNFSPLFVNNKENGLSQDLLAYYLAYTSNETTYLDTNFNTNL
FT                   RYSALSKENKAIYDEFVEYLEKQFLSDSKYGDKNTLSLKTVDGYSKGKQDLIKTLYNFI
FT                   FNDINSPSFNEKYTHKSLKLEDIIDVKVEWNRKKNIDLRITFVTKKPLNFNVNHIVNFN
FT                   TSFTFFKEIKQPNENDNLIDQLF"
FT   gene            721929..722147
FT                   /locus_tag="UUR10_0605"
FT   CDS_pept        721929..722147
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0605"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0605"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60126"
FT                   /db_xref="InterPro:IPR018691"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZC26"
FT                   /protein_id="ACI60126.1"
FT                   /translation="MATDDKVVYYLSPNEDKGWKIFKKGGERATKLFSTKKEALEYIKT
FT                   LGRNQNAVVYIQTKDGKFQDVRNYREK"
FT   gene            complement(722259..722720)
FT                   /pseudo
FT                   /locus_tag="UUR10_0606"
FT                   /note="transposase, degenerate; this region contains one or
FT                   more premature stops and/or frameshifts"
FT   gene            complement(723289..726708)
FT                   /locus_tag="UUR10_0607"
FT   CDS_pept        complement(723289..726708)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0607"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:ACA32698.1; match to
FT                   protein family HMM PF07198"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0607"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60275"
FT                   /db_xref="InterPro:IPR009849"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZC27"
FT                   /protein_id="ACI60275.1"
FT                   /translation="MIISLVVANIVWFGVITAIVLSLKNKKQLSIDNNHFNFDENGGLI
FT                   IKGKLPNIYNKKPIYGIFIDENNQEHKIKAIVNDKGEYEFNTKELDSNHTYKLKHIVDG
FT                   QDLNKTLVKNEELNIDQKVTFSKPTKAQVKFVNNKKVYEVQLVASLKNTLVELTLKDLN
FT                   NRLHKIRAKTNQAGIVVFDVSTLNENNAYEVISIKNMNKVNIANVLDIPYYKKTINNLN
FT                   TNILNAPYQYTKDGDINLVAKVLPHYANQNVFGIFKDQNNQEHQILAKVKNDGTIEFDT
FT                   KNLRKINQYTLDRIVSVLDKQVELAYNFDLTNKQKQSINKPAGIPSINKDKHQLISHLN
FT                   SDLVKQKLIATFVDNNNQEHKIEAVVSSQNQVDFDTSSLPKGYIYTLNKVVNIKSNKVL
FT                   NVNDFELSQISIDKRFSEEDHRISRPNWEYDNDGNLEIHIKLAEDLNKDLKQKAQKNGS
FT                   VKTIVVDQDGNEHEIDTSVNQDGKVVIKTKNLPSGNSIKSKTYTIKKVILKQDGQANKD
FT                   LIDEKQLSGDNHTSFKKPTIIAKVKDNNDYEISFSNPNLVNKKVKLTFRVDNKDNNLKI
FT                   IEAIVGLNGKANFITSDDLDFAPNHKYTLTKITIDDKKIANIDEIPLQDRVINKQRNVI
FT                   LNELQVANDSITWDANTNKADQLITAKILNVNSDYNNRNAKLIYEYNYRGTMVEVESSI
FT                   FKLEENKTIYENIVLSTNVPNRKYIFKKIVIQNPSDPLVYTNLDMKNSLANTFVVQPGK
FT                   TWIDWVPPTDEQITNYYLKNFNIKIKSEDKAFENNKRVHILFKTLRGDNIEYECTAKLT
FT                   NISANGDEAIIENVHSNKDFFGDYEIYIAKIELLDDLAYANKTNKIIYSCDSKKESQYK
FT                   FKTKPYIYQLVPTQKIDPWYDSVNNKGHFRYYISHTYSGGGYWTPLRNLNSKFKVVFRD
FT                   RNEPNESDKVLVASNLSLIKDNSEENLYYIEGVFDKNVERKHHYYIKAIYISHPTSDNL
FT                   FDEDNNSKVDLGNNYNSSFSSYEIKSKSSYFGDGSGSGNEIINESENKKTYDLNLEMDY
FT                   RYHNKYLRAVYEYYDATTNKYEYLYSTPIKLDFFDKYEYKIDFEKTKNTEVWKKPRVFN
FT                   FKKLEYSDDSNNNWKTFECQMDANRLEKIRFK"
FT   gene            complement(726993..728780)
FT                   /locus_tag="UUR10_0608"
FT   CDS_pept        complement(726993..728780)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0608"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0608"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60277"
FT                   /db_xref="GOA:B5ZC28"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZC28"
FT                   /protein_id="ACI60277.1"
FT                   /translation="MATLIEKSPFIVRRYIFKKRYCVFTTLWEVIKDSSSFITSSLFSS
FT                   LALLLITVIIALHKFNGAFAATSISYITIFQFSFIQLGGNLGVVLALWAKRLYDGSKHK
FT                   FVPAHQTVNLASFYAFTFGLVMSGVYLASAYTYNLYANIHQNTLFAQLFGEQYLWSSLA
FT                   LVVLAPVHNYFLISIWSNDRRKILFTIILDFATWTTCLVTSFLLGKYSVLAYNGYGLGL
FT                   SIGYIAWTIIISFIKFHKEWKINNFGLSLNLLKITIKQIWSQTVLSVFASVAKMFVLLA
FT                   LYHLINQKMVGSVPLNLQSSRILWYQSMLFIQGFGFGFADYLFYVFQKQMIRDRRYHSR
FT                   QLFICIFSLLFIYSMIAAIIFGFSIKPLSAVYAKEQNQAYIHLESKIPEHFYASIRLKM
FT                   LENPKLVYLLGQKAHINPKLILAHLASNDPKVWKIVIEQLITPIWRAGPNFQYLYGIPN
FT                   PITKSFVSISAEGIEKLLTGDNTYIHLAIFGIFYSLSSSLMRYYNLITRRLDLPFVSLI
FT                   FQILVIAFVVGFGVDYQSGTKFAGLLAWSMPMSISSAVILIFSLFIFTTTYSKFLSTYS
FT                   YKDNNFENPYPFKWIRHIL"
FT   gene            complement(728878..730680)
FT                   /locus_tag="UUR10_0609"
FT   CDS_pept        complement(728878..730680)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0609"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0609"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60333"
FT                   /db_xref="GOA:B5ZC29"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZC29"
FT                   /protein_id="ACI60333.1"
FT                   /translation="MVEHKQKKTLKRCSSHFRKNLTIFRTLIELIKESSPFIAASVFTG
FT                   LSLILIVVIVAHHKDIGAYAATSVSYLTIFQLSFLQLGTTFGIVFSVWSKRSFKDGKYK
FT                   FEPTNDTANAASFYSFIFGLVVLLIYFTTSYIYNHFANDHQNTLINQNIGSAYIISGLA
FT                   VVGLAPLRNYLLMLIRSNKSINILLAIVLDFCTWTTALIAAFLLGSYSSLGYWGYGLGM
FT                   SIGFIFWTIIIGMTAIEKAQIVLRPLYISKKLFVLSIKLLWIQTILSSLKSVGKMFILL
FT                   ITFVVINERVVGSSLLDFQSSRILMYQSMIFIQMLNLGLSDFLFYLYQKQEVRDRRYHS
FT                   RQLFAWIFIFGILFALVGSIIFGFSIKQLVELYTREQSPSYIFLEKQVPEHFYQSLRKI
FT                   LINDDELLNIIVNHTNINKDEIINALSSNDKNIWLPMAKKVIDPIWKLGDKFETIYHMK
FT                   NPFTHRYVDISENNVYKYLIKNNAYILLTFFCTFFSFSSILGRYGGLIARRQRVPYVMI
FT                   VIQLVMVAFTSGFGLTHQTDPHFIGLMAWSFPLFISSIFILGYSAYKILRGYLNYLKKH
FT                   RYNDQKTSIMSEKPQEQQIKVRQN"
FT   gene            complement(730755..732581)
FT                   /gene="pepF_2"
FT                   /locus_tag="UUR10_0610"
FT   CDS_pept        complement(730755..732581)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="pepF_2"
FT                   /locus_tag="UUR10_0610"
FT                   /product="oligoendopeptidase F"
FT                   /EC_number="3.4.24.-"
FT                   /note="identified by match to protein family HMM PF01432;
FT                   match to protein family HMM PF08439; match to protein
FT                   family HMM TIGR00181"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0610"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59827"
FT                   /db_xref="GOA:B5ZC30"
FT                   /db_xref="InterPro:IPR001567"
FT                   /db_xref="InterPro:IPR004438"
FT                   /db_xref="InterPro:IPR013647"
FT                   /db_xref="InterPro:IPR042088"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZC30"
FT                   /protein_id="ACI59827.1"
FT                   /translation="MNNIDNKKYDWDLDSLLNNQSLNTLFNEFVNSNNEVILAFNSWIN
FT                   SLNDFIHFHEVSEKNLIINNRINNYVSNKLQENLIDDEMISWSQKLEHEHYRVAKAFVN
FT                   FDNIVIKNKDLINIYLKDPRLTKYQLEYDELWRFENHTLNEEQQKILTSVGRFSGGFGD
FT                   IFDTLLDSDMKYQDGLNHKNQKVCFKNQVDIYVALKAKDRVLRKSAYESHFKAIYDLRN
FT                   TFTKTLYYEYAKQNELAKIHHFKDYIEADAFSDEVSKDFIEHVYTQTKKFAKGIKKYAH
FT                   YRALFLKQQYKLKKLEPWDKNLDLINKKNKFSIEEAKQLSLEALALLGDEYLNVVKKAF
FT                   DERWISWLPTKNKISGAYSIGDTKGLDKFFILMNYDETYNSVLTLVHELGHSVHTYFAN
FT                   QAQEVYNEYKTFYAEIASISNEVLMNYYLLQKYKENNLIRLYILDEMINGFIATTTRQA
FT                   IFSNFEWIANQWVNEGQEFSWNKIALTYLTINQEYTGYKFNKNKISKHDEANALIAINV
FT                   PHFYAGNFYVYKYVVGQICGLINAERIFNNTPNAKEKFFAFFKSGGSLSALDTIKILDI
FT                   KIDESGVWDEANNIFNGWINDYATLINKLLNK"
FT   gene            complement(732678..733862)
FT                   /gene="tuf"
FT                   /locus_tag="UUR10_0611"
FT   CDS_pept        complement(732678..733862)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="tuf"
FT                   /locus_tag="UUR10_0611"
FT                   /product="translation elongation factor Tu"
FT                   /note="identified by match to protein family HMM PF00009;
FT                   match to protein family HMM PF03143; match to protein
FT                   family HMM PF03144; match to protein family HMM TIGR00231;
FT                   match to protein family HMM TIGR00485"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0611"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59909"
FT                   /db_xref="GOA:B5ZC31"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004160"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004541"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR033720"
FT                   /db_xref="InterPro:IPR041709"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5ZC31"
FT                   /protein_id="ACI59909.1"
FT                   /translation="MAKAKFERTKPHVNIGTIGHVDHGKTTLTAAISTVLAKKGQAIAQ
FT                   SYADVDKTPEERERGITINASHVEYETKTRHYAHVDCPGHADYVKNMITGAAQMDGAIL
FT                   VIAASDGVMAQTKEHILLARQVGVPKIVVFLNKCDFMTDPDMQDLVEMEVRELLTKYGF
FT                   DGDNTPVIRGSGLKALEGDPVWEAKIDELMDAVDSWIPLPERSTDKPFLLAIEDVFTIS
FT                   GRGTVVTGRVERGTLKVNDEVEIVGLKDTQKTVVTGIEMFRKSLDQAEAGDNAGILLRG
FT                   IKKEDVERGQVLVKPGSIKPHRTFTAKVYILKKEEGGRHTPIVSGYRPQFYFRTTDVTG
FT                   AISLPAGVDLVMPGDDVEMTVELIAPVAIEDGSKFSIREGGKTVGHGSVIKTSN"
FT   gene            complement(733999..736065)
FT                   /gene="fusA"
FT                   /locus_tag="UUR10_0612"
FT   CDS_pept        complement(733999..736065)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="fusA"
FT                   /locus_tag="UUR10_0612"
FT                   /product="translation elongation factor G"
FT                   /note="identified by match to protein family HMM PF00009;
FT                   match to protein family HMM PF00679; match to protein
FT                   family HMM PF03144; match to protein family HMM PF03764;
FT                   match to protein family HMM TIGR00231; match to protein
FT                   family HMM TIGR00484"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0612"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59919"
FT                   /db_xref="GOA:B5ZC32"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004540"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005517"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009022"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035649"
FT                   /db_xref="InterPro:IPR041095"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5ZC32"
FT                   /protein_id="ACI59919.1"
FT                   /translation="MSKELKLFRNFGIMAHIDAGKTTTSERILYHTGKNHKIGETHDGA
FT                   ATMDWMAQEKERGITITSAATYAKWKGHSLNLIDTPGHVDFTVEVERSLRVLDGAVAVL
FT                   DGQNGVEPQTETVWRQATKYNVPRIVFVNKMDKTGADFYYSIETMKNRLGVKATAIQIP
FT                   IGAEADFVGSIDLIEMKAYIYDGQADEEYKIEDIPADYVTKAQVMRSQMIDDVAIFDDE
FT                   VMEKYLSGEELSHEDIKKCIRKGVISTELYPVLCGTAFKNKGVKKLLDAVVDFLPSPID
FT                   VPPIKGVDDHGNPIEYHNDPSEPFAALAFKVATDPFVGRLTYIRVYSGKLDKGTYVYNA
FT                   TKDKKERISRLVKMHSNNRDEIDSISAGDICAVIGLKDTTTGDTICDEKKPVILEQMVF
FT                   AEPVISLSVEPKTKADQEKMSLALSKLAEEDPTFRTYTNEETGQTIIAGMGELHLDVLV
FT                   DRMRREFNVQVNVGAPQVSYRETFTEIADAEGKYIKQSGGRGQYGHVWIKFEPNHDKGF
FT                   EFVDNIVGGKVPKEYIKEVENGLIEALTSGPIAGYQTIDVKATIFDGSYHDVDSSGMAY
FT                   KIAASLAFKEAAKVCKPVLLEPIMSVDVTTPDDYFGTVMGDISKRRGVIEGQEQRGNAQ
FT                   AIKAKVPLSEMFGYATDLRSNTQGRGQYIMQFSHYAQAPKSVTEEVMAARAKK"
FT   gene            complement(736092..736559)
FT                   /gene="rpsG"
FT                   /locus_tag="UUR10_0613"
FT   CDS_pept        complement(736092..736559)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="rpsG"
FT                   /locus_tag="UUR10_0613"
FT                   /product="ribosomal protein S7"
FT                   /note="identified by match to protein family HMM PF00177;
FT                   match to protein family HMM TIGR01029"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0613"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60074"
FT                   /db_xref="GOA:B5ZC33"
FT                   /db_xref="InterPro:IPR000235"
FT                   /db_xref="InterPro:IPR005717"
FT                   /db_xref="InterPro:IPR020606"
FT                   /db_xref="InterPro:IPR023798"
FT                   /db_xref="InterPro:IPR036823"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5ZC33"
FT                   /protein_id="ACI60074.1"
FT                   /translation="MRKLKPQKRQVLADPVYNSRLVTKLINAIMYDGKKGLAQSIIYSA
FT                   FEIVEQKTGKPALEVFNKAIDNVMPIIELKVRRVGGSNFQVPTEVTPERRQTLGLRWIT
FT                   LYARLRHEHTMIEKLAHEIIDASNNVGAAIKKKEDTHKMAEANKAFAHLRW"
FT   gene            complement(736589..737014)
FT                   /gene="rpsL"
FT                   /locus_tag="UUR10_0614"
FT   CDS_pept        complement(736589..737014)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="rpsL"
FT                   /locus_tag="UUR10_0614"
FT                   /product="ribosomal protein S12"
FT                   /note="identified by match to protein family HMM PF00164;
FT                   match to protein family HMM TIGR00981"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0614"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59740"
FT                   /db_xref="GOA:B5ZC34"
FT                   /db_xref="InterPro:IPR005679"
FT                   /db_xref="InterPro:IPR006032"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5ZC34"
FT                   /protein_id="ACI59740.1"
FT                   /translation="MPTIAQLIRNKRAPKVKKTKSPALLFTYNSLHKKTTKNPSPLKSG
FT                   VCTRVGTMTPKKPNSALRKYAKVRLSNGFEVLAYIPGEGHNLQEHSVVVIRGGRVKDLP
FT                   GVRYHIVRGAGDASGVEKRRQQRSLYGAKRPKKEASK"
FT   gene            complement(737198..738718)
FT                   /locus_tag="UUR10_0615"
FT   CDS_pept        complement(737198..738718)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0615"
FT                   /product="5'-nucleotidase, lipoprotein e"
FT                   /note="identified by match to protein family HMM PF03767"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0615"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59851"
FT                   /db_xref="GOA:B5ZC35"
FT                   /db_xref="InterPro:IPR005519"
FT                   /db_xref="InterPro:IPR006423"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZC35"
FT                   /protein_id="ACI59851.1"
FT                   /translation="MKLLKSKKFWAISLSSILVGASVVAAATACTNSSIESRVSTTFAK
FT                   TQSGIYAIYEITNWSKLDANEKKSLESLKFTASVIDKDGKAEFTASTGILKKDKVYVKL
FT                   PREPKADDRVVVKPDNANLKIGAVYVTTLNVSSVELNDGSKIDNNTNQKDESKPYNSVE
FT                   SIIYNQRWLANVWNTLSAEKDGMLLTAYNSAKHQFDAMVKQDAFDTNKVKVEKDASGNI
FT                   TKVTVSNPDSGKAIPVVFMDIDETILNNYANQNYQLLNNKAYSPRDWDLFVADKASKRL
FT                   AGAFEFIKYVWEHGGVVMFNSNREQSSHIEPTVENLVSEGLDRALLPKWVFWMQGIDFA
FT                   SDKPWDNVKKDAKGKRVKSTKEDRMNTMNERTQGYDLSAFGSGNAVVLKTVMRVGDNFD
FT                   DFNDNASKGKTNAERVALLKEYGKLFGNFDTKNTKGIKYKKDATSGKIVKSDETWSESY
FT                   VMIGGNSSYGGFESGIAKGYFGLSKEDQVKALREYVKQLYWEPKNQNK"
FT   gene            complement(739004..739153)
FT                   /locus_tag="UUR10_0616"
FT   CDS_pept        complement(739004..739153)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0616"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0616"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60244"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZC36"
FT                   /protein_id="ACI60244.1"
FT                   /translation="MNEEETTKLYNEFTEINGKSRSNKIYINEDVFKEAFASLKLSDKE
FT                   DLYP"
FT   gene            complement(739420..739896)
FT                   /locus_tag="UUR10_0617"
FT   CDS_pept        complement(739420..739896)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0617"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0617"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60353"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZC37"
FT                   /protein_id="ACI60353.1"
FT                   /translation="MFDENNNERVSLDGQYNSGFSSYEIESQSSFFGSNEGSSIHDQYV
FT                   IKTDQDSKKYYLSLRIDHRYHDKYLRAVFEYYDSKTNKYEYLYTTPIKLDFFNKNNNGY
FT                   SVDFEKSKNIAVWKGPERIFKFKGFEYSEDLNSNNWKTFKCKMNANNLGILTIK"
FT   gene            complement(739860..741734)
FT                   /pseudo
FT                   /locus_tag="UUR10_0618"
FT                   /note="conserved hypothetical protein; this region contains
FT                   one or more premature stops and/or frameshifts"
FT   gene            complement(741951..743609)
FT                   /locus_tag="UUR10_0621"
FT   CDS_pept        complement(741951..743609)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0621"
FT                   /product="phosphoglucomutase/phosphomannomutase family
FT                   protein"
FT                   /note="identified by match to protein family HMM PF02878;
FT                   match to protein family HMM PF02879"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0621"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59986"
FT                   /db_xref="GOA:B5ZC38"
FT                   /db_xref="InterPro:IPR005841"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR016066"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZC38"
FT                   /protein_id="ACI59986.1"
FT                   /translation="MENTNKLFNCWLNSPKISQTIKEEYKNKTQEEIDHIFDENYRFKF
FT                   GTSGVRCIYQEGARYLNVITYTQLALGFIKYLETKKSPNKIIVIGRDNRFGSRENLKLI
FT                   AEIFSSFDYTVYVNEDYGMLSTPITSFLVNELQASAGIMITASHNPKNYNGFKVYNANG
FT                   AQPLVDDTNTIESLMPSYIEALNFSFEPKQDSIKFLTQQHLQTYFDAVKAQLIHTNLNT
FT                   KKPFKVVFSGHHGTTTNDMIPFLESLGYDMVSVKEQNFEDPNFSDDPSSNPEEQRSFDL
FT                   SIEYADNANADVMIASDPDGDRMAIAVRHQNYWKFLTGNQTGVLIAHYLLHHKKFTKPP
FT                   YIISTFISTRYPELFAKDFNCDVLYVDVGFKNHGNLVANRKKTHDLVVGFEEAIGSLSS
FT                   DINNDKDSYQAASILLEMVNYYHEQNLDLFTVLKKEIFAKYGNWYSKTAQFVIDGENWK
FT                   QKALAILNNLKNFEFKTITQYTIQNIIFHEQGSYLEWKLDEYSTIKFRLSGTEPKFKVY
FT                   IDLYDFTKDQNRDFYQELKVKVEDILDFLKNYLDL"
FT   gene            complement(743640..744035)
FT                   /gene="cdd"
FT                   /locus_tag="UUR10_0622"
FT   CDS_pept        complement(743640..744035)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="cdd"
FT                   /locus_tag="UUR10_0622"
FT                   /product="cytidine deaminase"
FT                   /EC_number="3.5.4.5"
FT                   /note="identified by match to protein family HMM PF00383;
FT                   match to protein family HMM TIGR01354"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0622"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60252"
FT                   /db_xref="GOA:B5ZC39"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR006262"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZC39"
FT                   /protein_id="ACI60252.1"
FT                   /translation="MKYNDIYKGLIELLKKSYSPYSNYPVAAYVDTDIGLIPGVNVENG
FT                   SLGLTSCAERNAIFNAITNGAKVFKTVYVITKNNGDIGSPCGACRQVVSEFLKKDAKVV
FT                   VFNNDGTYKEYSVEQLLPFGWDPNVSL"
FT   gene            complement(744167..744242)
FT                   /locus_tag="UUR10_0623"
FT   tRNA            complement(744167..744242)
FT                   /locus_tag="UUR10_0623"
FT                   /product="tRNA-Trp"
FT   gene            complement(744255..745328)
FT                   /locus_tag="UUR10_0624"
FT   CDS_pept        complement(744255..745328)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0624"
FT                   /product="peptidase/creatianse family protein"
FT                   /note="identified by match to protein family HMM PF00557;
FT                   match to protein family HMM PF01321"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0624"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59912"
FT                   /db_xref="GOA:B5ZC40"
FT                   /db_xref="InterPro:IPR000587"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001131"
FT                   /db_xref="InterPro:IPR029149"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZC40"
FT                   /protein_id="ACI59912.1"
FT                   /translation="MSDFKLQQVLKTIKEHEAQGVDGMILFCPYNRYWFLEFASSDGFV
FT                   FINKDGKAIYLVDARYYTAASEAVKNAKVILLARTPQKSTFDLLKDAMVELNITNALVE
FT                   ADYVTLNVHEMLQKLVRKTTLFTSAALRAIKTEKELEYLQKAADIAALTCNWIREQDII
FT                   GRTELEVAMLVSKHMLELGGELNSFDPIIASGPNGGSPHHHPGNRVIEDGDMVTVDIGC
FT                   TYKGYCSDITRSFIVGNKANPQMQEIYDKVLESQTAGIDLVSTKVTGQEVDKLCRDIID
FT                   NSKFNGYFTHGTGHGVGLEVHELPNTNAGNPNKLPLNAVVTVEPGIYIPNVGGVRIEDT
FT                   VVVKDGQALVLTRLAYK"
FT   gene            complement(745339..745500)
FT                   /gene="rpmG"
FT                   /locus_tag="UUR10_0625"
FT   CDS_pept        complement(745339..745500)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="rpmG"
FT                   /locus_tag="UUR10_0625"
FT                   /product="ribosomal protein L33"
FT                   /note="identified by match to protein family HMM PF00471;
FT                   match to protein family HMM TIGR01023"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0625"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59787"
FT                   /db_xref="GOA:B5ZC41"
FT                   /db_xref="InterPro:IPR001705"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="InterPro:IPR018264"
FT                   /db_xref="InterPro:IPR038584"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZC41"
FT                   /protein_id="ACI59787.1"
FT                   /translation="MAIKRGVRLQCNESKSINYITTKNAKNNPDKLSLNKFCPKCRKVT
FT                   THVEIKKK"
FT   gene            complement(745561..747303)
FT                   /gene="thrS"
FT                   /locus_tag="UUR10_0626"
FT   CDS_pept        complement(745561..747303)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="thrS"
FT                   /locus_tag="UUR10_0626"
FT                   /product="threonyl-tRNA synthetase"
FT                   /EC_number="6.1.1.3"
FT                   /note="identified by match to protein family HMM PF00587;
FT                   match to protein family HMM PF03129; match to protein
FT                   family HMM PF07973; match to protein family HMM TIGR00418"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0626"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59822"
FT                   /db_xref="GOA:B5ZC42"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002320"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012947"
FT                   /db_xref="InterPro:IPR018163"
FT                   /db_xref="InterPro:IPR033728"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5ZC42"
FT                   /protein_id="ACI59822.1"
FT                   /translation="MYKFDPKLNHSAAHVLAMALTKFYPNLSLAIGPAIDEGFYYDFNL
FT                   NDPNTSITPIDLLKIEKEMKKIAAQALTFDYEQVSYEQAKDLFKNNKYKLDIIEENKNK
FT                   PLSIYHSGKWFDLCKGPHVENTKEIKAIKLLNIAGSYWRGDANNDQLIRIYGVAFNDQA
FT                   QLDAYLVDLQERKERDHRKIGKDLNLFTFNNLAGQGLPIWLPNGTIIKSQVQKFINEVE
FT                   FQFNFDTVITPILGSIDLYKTSGHWDHYKDNIFSPVQIDNEVLILRPMTCPHHTLVYSN
FT                   ELRSYRSLPIRLSEHSILHRYESSGGLTGFERVREMILEDCHVFCRPDQIEHEVINAFK
FT                   MIQEAQEGLGIKTFEIHLSLNDPNDKEKYYDDPQMWEHSQNALRKMLKDHKIPYKEMVG
FT                   EAAFYGPKIDFQVKTVLNRIITVSTIQLDFLLPNRFNLSYINENNEQSTPVMIHIGIIG
FT                   TYERLLAILLEQTKGVLPLWLSPVQVVIIPVNENLHADYAKELNAKLRKHLVRSSLDLR
FT                   NERLSKKIREAQIQKIPYQIVVGDEEIKNDKMVTYRRYGSEETTTVSVDDFIKVLENDI
FT                   RSKK"
FT   gene            747460..748356
FT                   /locus_tag="UUR10_0628"
FT   CDS_pept        747460..748356
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0628"
FT                   /product="EDD domain protein, DegV family"
FT                   /note="identified by match to protein family HMM PF02645;
FT                   match to protein family HMM TIGR00762"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0628"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60036"
FT                   /db_xref="GOA:B5ZC43"
FT                   /db_xref="InterPro:IPR003797"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZC43"
FT                   /protein_id="ACI60036.1"
FT                   /translation="MKKSFLIMTDSSTTLDREWAKNNDVMILPLSILRSDHTLIVDDGI
FT                   ESKPERIYQDIDNGYSFQTSCTPYGVLIEAIEQKLQEYEKIIFIGISSGFSSQFNNAKN
FT                   LEKEYENRLFAVDTEDFGYSLEDLVYKIKSMLANNISFDSVIKMIDEHHNYTSSFLACE
FT                   NITGLVRSGRIPKIIGTMLKLSKVTPIIKAEWKNHRAGMALNIRSAPHKILEGISHVFD
FT                   DQLNDQTIEKVCILQAGLSNERIEELKKAVIDHFHINEEKIVVRSGPPIFLVYVWKGAL
FT                   GIQVMANIPKKHVEKKH"
FT   gene            complement(748353..749078)
FT                   /gene="truA"
FT                   /locus_tag="UUR10_0627"
FT   CDS_pept        complement(748353..749078)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="truA"
FT                   /locus_tag="UUR10_0627"
FT                   /product="tRNA pseudouridine synthase A"
FT                   /EC_number="5.4.99.12"
FT                   /note="identified by match to protein family HMM PF01416;
FT                   match to protein family HMM TIGR00071"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0627"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59955"
FT                   /db_xref="GOA:B5ZC44"
FT                   /db_xref="InterPro:IPR001406"
FT                   /db_xref="InterPro:IPR020095"
FT                   /db_xref="InterPro:IPR020097"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5ZC44"
FT                   /protein_id="ACI59955.1"
FT                   /translation="MNYKISIRYDGSLFYGWAKQPQKRTVQEHLETVFKTIFKINDIKI
FT                   IGSGRTDRGVHAYEQVFSVNHHQLNYEPQVIYQALCSQIDPDVQILKVQSVHDTFHAQH
FT                   DAISKTYQYIINDYEFDLFKHNYEYFIHQKINDQKLLEALELFVGEYDFKSFSTSELPL
FT                   TTRKINWVKITRNTRLEIYINGNGFLKNMVRMIISACIDYVFNKISLTQIKTLLTNPKK
FT                   GASVKLAPPCGLYLYKVYY"
FT   gene            complement(749140..750456)
FT                   /locus_tag="UUR10_0629"
FT   CDS_pept        complement(749140..750456)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0629"
FT                   /product="cobalt transport protein"
FT                   /note="identified by match to protein family HMM PF02361"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0629"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60075"
FT                   /db_xref="GOA:B5ZC45"
FT                   /db_xref="InterPro:IPR003339"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZC45"
FT                   /protein_id="ACI60075.1"
FT                   /translation="MSANAYVFRRSPIHRLNPAIKFISFILLIAMIFLPLGFFAQMIIG
FT                   VFILIIFFVAKLPKKTLWNVFKSVIMLFVILLLINWMTYKDPIAIYNITDQAKVILGDK
FT                   DWINGPINKNLSFSLIYNDISSTHVQNLVSNIWGGEIKNYISPEIIKKLIDKPDYNVAK
FT                   FLSENNITVKKLASTFNALNQDVRLNNYYPIYGDAVLRSGKVEVPLSHLSYYMSTNLWK
FT                   IEGVKYQGLILSGVGDQLGKAETALFYTRSPFALSPVAIQLAIYISIKIFLMITLSSIL
FT                   TATTSSIELTNGLEDLLSPFKILRLPVAEASMMISIALRFIPSLLDESKRILNAQASRG
FT                   VDFNNGGMLQKLKSLISLVVPLFSIAFKKAEDLANAMEARSYNPRYARTRYRAFPLNLT
FT                   DYVLFGILCILVGFLISLAVIKFYFTPFGAFEASALFAK"
FT   gene            complement(750457..751758)
FT                   /locus_tag="UUR10_0630"
FT   CDS_pept        complement(750457..751758)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0630"
FT                   /product="cobalt import ATP-binding protein CbiO 1"
FT                   /EC_number="3.6.3.-"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0630"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59954"
FT                   /db_xref="GOA:B5ZC46"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZC46"
FT                   /protein_id="ACI59954.1"
FT                   /translation="MQKLMDTFFKKKLKVPRPISDDISVRVKNLYAIYDEKQENELVAL
FT                   NNISYDFKKNKIYFIIGNSGSGKSTLVTHFNGLIISRYGFVQVGDIVSGDHYDLEHQLL
FT                   GVIDSYDKKIINLLWKNQLDQWTFLVLYSNEVNVQQARILFEANFKQKPVSLKFIKTKN
FT                   NHELITNPYVRENTKIAVVRVDKNVFLEINDKMDYDELQRFEFIKKEIKTNYHLSKKLK
FT                   RFKELRRRVGFVFQFPEYQLFKDTIEKDIMFGPINLGVKKSEAKKRAKFYLNKLGLGDD
FT                   YLERSPFGLSGGQKRRVAIAGILAIENDILVFDEPTAGLDPAGEHEMMQIILDAKANNK
FT                   TIFVITHTMEHVLEVADEVVVMDEGEIIKTGTPYEIFFDEHIINSTSIQVPRVIAVINE
FT                   LIKKDSKYEVLKQKQPRTIEELADAIVEFKKGGK"
FT   gene            complement(751746..752630)
FT                   /locus_tag="UUR10_0631"
FT   CDS_pept        complement(751746..752630)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0631"
FT                   /product="cobalt import ATP-binding protein CbiO 2"
FT                   /EC_number="3.6.3.-"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0631"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60225"
FT                   /db_xref="GOA:B5ZC47"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR015856"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030947"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZC47"
FT                   /protein_id="ACI60225.1"
FT                   /translation="MSQSDKNTHNYQISSLDKVINDSSVAVEFENVYFAYTEERMILKN
FT                   VSFTINDNEYVCIIGHNGSGKSTISKVLTGLLKPKSGAIKLFGIEISAANLKYLRNNIG
FT                   IVFQNPDNQFVGITAEDDIAFGLENRKVPPNKMWDIINDAAIATGIEDLLKKESLELSG
FT                   GQKQRVAIASVLAINPKVIIFDESTSMLDPKGKNELKDLMVSLRDVAKKTIISITHDME
FT                   EVVKADKVIVMSNGEVQYIGTPQEVFANEERLLKMQLDIPFTLRLAKTLKDKGLKIDLT
FT                   LNNEELIEKICKN"
FT   gene            complement(752773..753462)
FT                   /gene="rplA"
FT                   /locus_tag="UUR10_0632"
FT   CDS_pept        complement(752773..753462)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="rplA"
FT                   /locus_tag="UUR10_0632"
FT                   /product="ribosomal protein L1"
FT                   /note="identified by match to protein family HMM PF00687;
FT                   match to protein family HMM TIGR01169"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0632"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60311"
FT                   /db_xref="GOA:B5ZC48"
FT                   /db_xref="InterPro:IPR002143"
FT                   /db_xref="InterPro:IPR005878"
FT                   /db_xref="InterPro:IPR016095"
FT                   /db_xref="InterPro:IPR023673"
FT                   /db_xref="InterPro:IPR023674"
FT                   /db_xref="InterPro:IPR028364"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5ZC48"
FT                   /protein_id="ACI60311.1"
FT                   /translation="MAKISKKLSAAYEGIDKQKAYPLFDAIKLAQEKSITKFDGSINIA
FT                   VKLNLDTTKVEQQLRGSISLPNGNGKNVRVLVLSEDITKEQAAAVGADYFGGADYIQNI
FT                   EKMLNQIDVIITNQKMMPLLAKLGKVLGPRGLMPNPKIGTVTNDVLKAVEEFKKGRIEY
FT                   RTDTYGNIHMSIGRVSFETAKIEENANALLSLIRSKKPATVKGQYIQNIAISPTMGPGI
FT                   KVIINNN"
FT   gene            complement(753465..753917)
FT                   /gene="rplK"
FT                   /locus_tag="UUR10_0633"
FT   CDS_pept        complement(753465..753917)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="rplK"
FT                   /locus_tag="UUR10_0633"
FT                   /product="ribosomal protein L11"
FT                   /note="identified by match to protein family HMM PF00298;
FT                   match to protein family HMM PF03946; match to protein
FT                   family HMM TIGR01632"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0633"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60213"
FT                   /db_xref="GOA:B5ZC49"
FT                   /db_xref="InterPro:IPR000911"
FT                   /db_xref="InterPro:IPR006519"
FT                   /db_xref="InterPro:IPR020783"
FT                   /db_xref="InterPro:IPR020784"
FT                   /db_xref="InterPro:IPR020785"
FT                   /db_xref="InterPro:IPR036769"
FT                   /db_xref="InterPro:IPR036796"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5ZC49"
FT                   /protein_id="ACI60213.1"
FT                   /translation="MAPKKKEVTRIAKLNLIGGQAKPGPALASVGINMAEFTKSFNDKT
FT                   KDQNGKVIPVIITAYKDKSFDYVVKTTPVTYLLKDAAKIKSGAKDPKKQVVATISKEQA
FT                   LEIARYKLVDMTAYDEEAALRMIAGSAKQMGIAIEGVSAYKEKKGN"
FT   gene            754192..760983
FT                   /locus_tag="UUR10_0634"
FT   CDS_pept        754192..760983
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0634"
FT                   /product="efflux ABC transporter, permease protein"
FT                   /note="identified by match to protein family HMM PF02687"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0634"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59756"
FT                   /db_xref="GOA:B5ZC50"
FT                   /db_xref="InterPro:IPR009849"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZC50"
FT                   /protein_id="ACI59756.1"
FT                   /translation="MKKMFLLMKNMMRLFFKNKALVTQLSILMIVSTVVIVATTITVQR
FT                   LQKSQSDIKKIGLQSDFLVDTKEQDNISFNEIEVSDNLVKHNEKLTQLTIFNQNILKNS
FT                   NNYLQLIDPTFNNHNLYWPTNKNNRQVEVLNLEGNIDWNKINQLKLQTVFWFETRQESN
FT                   QNFANNYEDLVYEYRNFKNQLVGFQNLSGGRILFQSPTLKQTNNNYDSTFKVNAAIVQK
FT                   NTPFKTFFDFNKHEELGFKNKSYFTNPVLIRNIDLNSKQVIQTINDRSNQAIDFKNYQN
FT                   TFQAIVDTLEANTIKKDFYSVNLHVDFSTLSTKYLLFANYLNSEGIDKNRYADELKIDN
FT                   YKQKYLDLFQNQVLIPKELINDPKKFDEVQKIITKAKVLLLTKIREETNIFYENSQKLA
FT                   EENRDQIKDYEAQLKQINIALQNSNYSNFELIQLKNQQKVLAANLDQAKFKRFLYNDLI
FT                   AQDFHSVLNNYDVFYRKHESAIHNDVKSDSNFIVTNVSNPTYAQNGVIAPKNEWIDNMV
FT                   QIDEKNKKSQNPNKKFKRIFIDNHNSNKINDFYNLYSNYIKAIRTLEKSYEKDPNTDKD
FT                   LLVEQRDYSPWVNTSFINIYQLPQFFNVLFNESEWLLSIQYLREMNEYKKYLYQIFEPY
FT                   KDKNWIFNLNHQNWKDDQQVIAIYKNANNPKDQKQYYFNGYIKNHQAYIDVKYDKNLPT
FT                   RLQLVNIVKKDEENQKNTLINVLERDLNDYTNIINFKKGIKDINTNQQAIYDQWALYNP
FT                   QDYAQFKIWMSKIIKRYNFLQLQQSPYGYTIQAQNVLTNVLLLPFTINIINRSSDLAYV
FT                   STSYIKANQKTAKNTNSYKEVGNYEDFLEALKLPYRVINDEPNYREITLADGSKKRIAK
FT                   DYYSWINYVVSPANKVEINGQFFFIIGAVDSPEFLFPAINDSDILINKQKSTVLYVNDS
FT                   GFAKLKTIAASVPILEYYTLKVNTNNFNLLQKNNVYNQIKSELLSAKKGNIYKKTDKDN
FT                   PYRIYVKRTLFLTQLRNLVIAIAVGLIVLILLLGIYFVASSIKNMINKNKVMFGAMQAQ
FT                   GVTRWQAWLSFAPFYTIPSLIVLIIGYSVAYAIQPLIMRLFSSYWLIPIPEQFVSVGWI
FT                   FAIPITLALILGFICWTLIFYILKQPTAETMKGDAGFKINKFIIGTKAIFLKFGAIRVL
FT                   KATYVVANLARMLILLVIASSFSIIASIIATTKNNFSQSASITNAKREYEYAVDLYSPT
FT                   EQGGFYYISKFEEMGVPNEYSPLKQIVQNVKIEVKIKNLINKKVNVVYINNQTKQKVII
FT                   EAIINEKGLINFKTDQLINGSFMFEGIYEQETNRLLIGSQNLSPYLININNQKIGHFSW
FT                   SDHKQYIHLLKSHFSDNDVILDYVDSNNQHTYLKPKIQDQTLVFDLSLLNQKQKYRLVN
FT                   VINTKGNPLVDLSKINDVLKTLDYSKNGRYLYGYYGRLPYLYFNNLPQELINQKVYLTY
FT                   TINQTNEIRICGVVNEQKEVVFDLTKLKINPQQSYQLRDMRIEKTNLLVYDSKQHEFND
FT                   NLIYFDNNYYGLNNHDKNQISIDYLSVNRNLYLTLKSMRNEFNNKNKVPFITTKAIAQL
FT                   VEPNVGILDYNQLEKGYIYQISSATLEGSDTNLYLDNVNAIDKTKDSGLPYSSLKYNNA
FT                   MREIKDLGTDHPVYGKMLSNVYYPSISTQPEILQNIRFFDSKVISKSSLDGNISVKATD
FT                   VNIEFNPWVFAKTFLPITAIARSELNEKHLLDEAFKNFGYEIIDGKKVNKLYDVPNFED
FT                   DGIVRQVSLWTKTGLPPKSENDEDAFFVKINGQWKINEKPGVLTEQGAAEFLPEFLRLI
FT                   TQMYTFKSTRYLQYKAGLKFVNIEDEKTQQPYTYLLGQMQTKTKKFGNEIKILGINYEK
FT                   NKFIDDKPSPTTQLSLINDQGVNLIDLIKDDNVNNEVHNIIINKVVAQKYHLNINDVFE
FT                   YEINNHIKRLSNKFNNTPQVYKTKFKVVGINDSLMDEQLIINQKIANKLIGFDDYRERM
FT                   QVENGHPIIEAREFNGFFTKEKSPIFFNNMASFYSPSGLSPAIDSWPQNLLENIGGNVQ
FT                   NINIYWIFYYSWDLANSILNASFDKNKISWDSFSEVNLDKLLKKMSKIFGKEANLPSFK
FT                   AVDANIENEIFASVIDKTSFTLLLNIIIAIIPSLVIIIILVASTLANESRRLIAIMKVL
FT                   GMRDFKNVNNFMFIYPIVWLLNILIATPLSFGIIHIYKLAIFAAFNIVLVASIPWWIFV
FT                   VSFGFVGLVLLFAWLQMLYKTKKLNLPKALNQFTD"
FT   gene            complement(761184..762617)
FT                   /gene="gatB"
FT                   /locus_tag="UUR10_0635"
FT   CDS_pept        complement(761184..762617)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="gatB"
FT                   /locus_tag="UUR10_0635"
FT                   /product="glutamyl-tRNA(Gln) amidotransferase, B subunit"
FT                   /EC_number="6.3.5.-"
FT                   /note="identified by match to protein family HMM PF02637;
FT                   match to protein family HMM PF02934; match to protein
FT                   family HMM TIGR00133"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0635"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60262"
FT                   /db_xref="GOA:B5ZC51"
FT                   /db_xref="InterPro:IPR003789"
FT                   /db_xref="InterPro:IPR004413"
FT                   /db_xref="InterPro:IPR006075"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR017958"
FT                   /db_xref="InterPro:IPR017959"
FT                   /db_xref="InterPro:IPR018027"
FT                   /db_xref="InterPro:IPR023168"
FT                   /db_xref="InterPro:IPR042114"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5ZC51"
FT                   /protein_id="ACI60262.1"
FT                   /translation="MQNFEVIIGIEVHTALNTKTKMFSNTPTSHKSMANTLINEIDLAL
FT                   PGTLPSVNQEVVHKGLFLANALHMHTNHQFIAFDRKHYYYLDLPKGYQITQNYFPIGQN
FT                   GYIQITDENNNPKKIRIKQIHLEEDTAKQTSVNNQVYLDYNRAGWPLIEIVSEADLRSA
FT                   QETVLFLEELRKILLFNDISDAKMEDGSLRVDVNISIRPRGAKSFGTKVEIKNINSISN
FT                   VAKAINYEYNRQLNLILLNQSVEQQTRRFDDSTNTTVFMRSKNDAINYRYIRELNIAPI
FT                   YLSDEYVSQLLSTKPYSINDLRQELLQKGLVSSAIEQLLGDGPLFKAFKYVNKIVNNPS
FT                   SVYKWLCLEFIGLINKNTQIIEDISMELLQKIGAMIVLFDQTLINGKQTKTILEKIYLT
FT                   NKDPQTLIKELGFEQITDENEITNLWNQILANNQEMLLQYEERPDRVEKFFMGEMMKLT
FT                   KAQANPTISFNILKKILQK"
FT   gene            complement(762620..764053)
FT                   /gene="gatA"
FT                   /locus_tag="UUR10_0636"
FT   CDS_pept        complement(762620..764053)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="gatA"
FT                   /locus_tag="UUR10_0636"
FT                   /product="glutamyl-tRNA(Gln) amidotransferase, A subunit"
FT                   /EC_number="6.3.5.-"
FT                   /note="identified by match to protein family HMM PF01425"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0636"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60113"
FT                   /db_xref="GOA:B5ZC52"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZC52"
FT                   /protein_id="ACI60113.1"
FT                   /translation="MKNKTILTLHEQIKKREIKIYDLVKKTIDHNLKIKNLNASLANNY
FT                   EQALNQASFLDQEISNNDTQIDYLFGIPYSLKDNISTKNIITTGGSLFLENYQPPYDAT
FT                   VKTLLDQNQAILLNKSNLDEFGLGGTGTDSAFGIVVNPLDSTRVCGGSSSGSAVLVQQG
FT                   VVPFAIATDTGDSIRRPASIMGIVGFKPSYGIISRYGVYPFAPSLDHVGIFTNNVLDTQ
FT                   IVFNAIAKRDFKDFTSLDFKTQSLTTLKTNNKYKIGIFKPSFDLLEPKYQQELNNLINK
FT                   LNKDHEVISVDYDINLLKAISPVYKLVAFSEAYSSYSNFTNITFGKHDIEYKNYEDLII
FT                   KARTLYLGTQLKQRFMIGAYVTQEAQFETLLTAAKKMRTLIVQKAKQLFTNCDLILNLA
FT                   VHDVSETIEDVNNQKPTTNLVEDVMQIANFGGFPSIVIPFIKTSLGNLGLNLWADYLND
FT                   NKLLNAAYLISNLLGNEEK"
FT   gene            complement(764043..764327)
FT                   /locus_tag="UUR10_0637"
FT   CDS_pept        complement(764043..764327)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0637"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0637"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60001"
FT                   /db_xref="GOA:B5ZC53"
FT                   /db_xref="InterPro:IPR036113"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZC53"
FT                   /protein_id="ACI60001.1"
FT                   /translation="MSYNLQKLMSSCMFELSDDEIKQVENRLNTLFNEIKVFELFDLQQ
FT                   IAPFEVINNSFDNFLRQDEIDSCATNNSEEVLNNCLEVIDHYGVLKNEK"
FT   gene            complement(764349..765377)
FT                   /locus_tag="UUR10_0638"
FT   CDS_pept        complement(764349..765377)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0638"
FT                   /product="aspartyl/glutamyl-tRNA amidotransferase subunit
FT                   C"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0638"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60176"
FT                   /db_xref="GOA:B5ZC54"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZC54"
FT                   /protein_id="ACI60176.1"
FT                   /translation="MTNITSVLHATNTSQGNGINSWQSILIFLAFLIVFIIFTVIKKIY
FT                   YSIRFQKRFYIIPKTSVKGISNIAMVISISVAVIILLTVLSANTASVIFRAWPGTRVTL
FT                   EGILVKIGGLLFGPILGIFIGAMTDLLSVAMTAGVFHYGYLIAAMAYGLIGGLIRIILT
FT                   TSKKKDLPFAIYSSIATILIGVAIALFLYFAPGIGDKGFNIQLFGFDIKIARTLMIGII
FT                   LGFFLLSIIVVWFSLLIKYLLNHKNKNKAKSNWFIIFAPVLVTILLTEAVVNVLMMPSF
FT                   DAELSSLKYTQWLSIRAVLFVPMVVLNLLIIYPIFKIVVPLIRYDYEDDIIEDKHIPIH
FT                   VD"
FT   gene            complement(765404..766042)
FT                   /gene="ung"
FT                   /locus_tag="UUR10_0639"
FT   CDS_pept        complement(765404..766042)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="ung"
FT                   /locus_tag="UUR10_0639"
FT                   /product="uracil-DNA glycosylase"
FT                   /EC_number="3.2.2.-"
FT                   /note="identified by match to protein family HMM PF03167;
FT                   match to protein family HMM TIGR00628"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0639"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60274"
FT                   /db_xref="GOA:B5ZC55"
FT                   /db_xref="InterPro:IPR002043"
FT                   /db_xref="InterPro:IPR005122"
FT                   /db_xref="InterPro:IPR018085"
FT                   /db_xref="InterPro:IPR036895"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5ZC55"
FT                   /protein_id="ACI60274.1"
FT                   /translation="MKWKEFIINQTKQDYLRNIIQKVNTIENHQVVYPLKKQRFRCFNF
FT                   FDIEQTKVVILGQDPYHTPKMANGLCFSVDLGNNLPGSLVNIFKALEYDLQIKRTNPDL
FT                   SDWAKQGVLLLNTVLTVNAHQANSHKDFGYDQLIKNAFIELKKQKHVVYLLWGKQAMSY
FT                   IDLIDKDHNLILCAPHPSPLSAHRGFLTCKHFSACNDYLIKHFRTPIKW"
FT   gene            complement(766021..767787)
FT                   /locus_tag="UUR10_0640"
FT   CDS_pept        complement(766021..767787)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0640"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0640"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59809"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZC56"
FT                   /protein_id="ACI59809.1"
FT                   /translation="MKKNKSKKLIFSLLGISFIGLVPIIAASCSAAAHPQVNVHYVSAN
FT                   VKTNNIGKVKIRAFEGKDQKHEMVFENENLLDDVYYEAGDLTYTSIKDNKRFDKNNKEI
FT                   DQLGYLIPKKEVWTKAPSNSNKLTPINLSILQNELIRLIGNKLSFDPTSKYANNLEVVD
FT                   EASKQTVFNQKVYTQGELTKINKTVELINSLVISDGLYTYITSMTDQLMKWLGEHAFNN
FT                   HSNKDFELFKGLKNEVAKEFLLALVQGVGAGQHTYKLALYNFSFDWEYVDAITGLSITK
FT                   PSFGTKVSDELLVNPSSKNVFVRLKNIKLQYAWYNSSNKTAGSFMEASSNGSQVNALSS
FT                   INAALSGVDKQIYAKIHEDKKPEIRNLVYDISLKDIVVNFAPSTMRSANVNENATKLLQ
FT                   ENFAKIKNQKTELTETEKKQTTVYNEYYTGTLSKIHAFSVLGKDLKEDLKNEAKANEKE
FT                   YVEDKKIEDWQYYEHDRGLNGVYPYAFLAENNALELKVDDFIKARKFVEAIKASNTSRT
FT                   ILPITDPKNNQVLSKQAYSQLAMIALENKDANIHDLSSFESAKNNLKKYLFDLNDIKSV
FT                   NVNYSKWNEKNL"
FT   gene            complement(767790..769250)
FT                   /locus_tag="UUR10_0641"
FT   CDS_pept        complement(767790..769250)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0641"
FT                   /product="replicative DNA helicase"
FT                   /note="identified by match to protein family HMM PF03796"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0641"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59856"
FT                   /db_xref="GOA:B5ZC57"
FT                   /db_xref="InterPro:IPR007693"
FT                   /db_xref="InterPro:IPR007694"
FT                   /db_xref="InterPro:IPR016136"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036185"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZC57"
FT                   /protein_id="ACI59856.1"
FT                   /translation="MSTKDLNDAILDLFCLVINNNDFWKDVILRLEAKDFPEKVQQNIF
FT                   NTIANLNEQKYKISESNILNGLGNYVIVDEQDQNYLLHKNYLVQILERTDYLVDLKDCI
FT                   EIIKNASIKNKLDLFANEILSTQISLTNAKDQFKEMHEKFLEILASRTEDTIENMELIA
FT                   NRYFEKLNKIGNSGIIPGVIKTKYDNIDKFTNGYKPGELVVIAARPGIGKTTFCLNVMV
FT                   NNVNEIIEYNQNIQPNQKEKIIVMFSLEITKEQILQKFISIKTGISNREVIENKYRIAK
FT                   GYDTRSFAMQAINEIKSWPIFVDDRPNISIVDIEAKLYDLKKRYDIALVVLDYLQLVSA
FT                   GNANKNMTRTQEVGRVSSALKVIAKEINAPVIAIAQLSRKAEERDVSSNANMKNNPLVK
FT                   TIDNSPKLSDLRESGSIEQDADVVAFLHWDRKQRNAMQNDNQETRMRDDLIEAKFIVEK
FT                   NRNGSTGETDIIFSKLNSKFIRATTSKE"
FT   gene            complement(769257..769694)
FT                   /gene="rplI"
FT                   /locus_tag="UUR10_0642"
FT   CDS_pept        complement(769257..769694)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="rplI"
FT                   /locus_tag="UUR10_0642"
FT                   /product="ribosomal protein L9"
FT                   /note="identified by match to protein family HMM PF01281;
FT                   match to protein family HMM PF03948; match to protein
FT                   family HMM TIGR00158"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0642"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60246"
FT                   /db_xref="GOA:B5ZC58"
FT                   /db_xref="InterPro:IPR000244"
FT                   /db_xref="InterPro:IPR009027"
FT                   /db_xref="InterPro:IPR020069"
FT                   /db_xref="InterPro:IPR020070"
FT                   /db_xref="InterPro:IPR020594"
FT                   /db_xref="InterPro:IPR036791"
FT                   /db_xref="InterPro:IPR036935"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5ZC58"
FT                   /protein_id="ACI60246.1"
FT                   /translation="MKVILLEDIANLGKKNDIVDVSDGYAKNFLIRQKKAVALTSKSQE
FT                   VLNKDLAILQAQEQQAILDATLLKDELEQKPLHFFLKTNNLQTFGSISNKQIIDEINKD
FT                   QKLVIKHMITKPHALGIGEHIVEISLHKKVIAKVNVIVSKE"
FT   gene            complement(769779..770018)
FT                   /gene="rpsR"
FT                   /locus_tag="UUR10_0643"
FT   CDS_pept        complement(769779..770018)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="rpsR"
FT                   /locus_tag="UUR10_0643"
FT                   /product="ribosomal protein S18"
FT                   /note="identified by match to protein family HMM PF01084;
FT                   match to protein family HMM TIGR00165"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0643"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60336"
FT                   /db_xref="GOA:B5ZC59"
FT                   /db_xref="InterPro:IPR001648"
FT                   /db_xref="InterPro:IPR036870"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5ZC59"
FT                   /protein_id="ACI60336.1"
FT                   /translation="MAKVINNRNRKPRKKVCILSAKGIEHVDYKDVELLQRFINNNNKI
FT                   ASRRVTGASARMQRRIANAIKRARFVGLLPYVKE"
FT   gene            complement(770027..770533)
FT                   /gene="ssb"
FT                   /locus_tag="UUR10_0644"
FT   CDS_pept        complement(770027..770533)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="ssb"
FT                   /locus_tag="UUR10_0644"
FT                   /product="single-strand binding protein"
FT                   /note="identified by match to protein family HMM PF00436;
FT                   match to protein family HMM TIGR00621"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0644"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59917"
FT                   /db_xref="GOA:B5ZC60"
FT                   /db_xref="InterPro:IPR000424"
FT                   /db_xref="InterPro:IPR011344"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZC60"
FT                   /protein_id="ACI59917.1"
FT                   /translation="MNKVILIGNLVRDPEARQIPSGRLVTNFTVAVNDNIPNANANFIR
FT                   CVAWNNQANFLTTYLKKGDAIAIEGRIVSRSYVDNNGKTNYVTEVYADQVQSLSRRNQN
FT                   ANDHNNDKVNVDTMMGAYASINTDAAFSSNQPQTNFQSTTSNSNKNDDEEDEITSWINL
FT                   DDDLE"
FT   gene            complement(770579..771061)
FT                   /locus_tag="UUR10_0645"
FT   CDS_pept        complement(770579..771061)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0645"
FT                   /product="30S ribosomal protein S6"
FT                   /note="identified by match to protein family HMM PF01250;
FT                   match to protein family HMM TIGR00166"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0645"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59829"
FT                   /db_xref="GOA:B5ZC61"
FT                   /db_xref="InterPro:IPR000529"
FT                   /db_xref="InterPro:IPR014717"
FT                   /db_xref="InterPro:IPR020814"
FT                   /db_xref="InterPro:IPR035980"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5ZC61"
FT                   /protein_id="ACI59829.1"
FT                   /translation="MAKYEIMLVVRGDLDQEQANKVANELKATLKNTEVKENNYEGVQQ
FT                   LAYEINKLKTAYRYVYNFETTDVSLINEFRRLAIINKNVLRHIIINLEKDYGYKATVNA
FT                   KKVQRNEKRAEVYVRQKEEAERRAAERQAAYEAMKAEREAAGLPVKEFVKGANSKR"
FT   gene            771235..771744
FT                   /locus_tag="UUR10_0646"
FT   CDS_pept        771235..771744
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0646"
FT                   /product="acetyltransferase, gnat family"
FT                   /note="identified by match to protein family HMM PF00583"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0646"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59733"
FT                   /db_xref="GOA:B5ZC62"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZC62"
FT                   /protein_id="ACI59733.1"
FT                   /translation="MVSIEKINEQDINAIVAYVVAFRKRLYPEIDHNTLPKELANFKQT
FT                   YIINPLGAWFSVFLEGTHELVGTISCHEYNYRYNDLFCLDKNIKTSEVGKLYIDPSIRR
FT                   QGIATSLFNALREQAKKQGIQCFYLHTHHHLPGAKQFWLKMGFTIQKEMTLEDDGKDII
FT                   HMTLEL"
FT   gene            complement(772370..774199)
FT                   /locus_tag="UUR10_0649"
FT   CDS_pept        complement(772370..774199)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0649"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0649"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59900"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZC63"
FT                   /protein_id="ACI59900.1"
FT                   /translation="MNKKIIKISLPIFVGLLSIPLIISCTKTTKSKTLNFIEDYQFNSS
FT                   KKQFIFKIKNEFFDDKAININQIYKTKGPNTSRHYLNNIDLAYLYNFKTKITTTHYSSI
FT                   NKIDHVDTKIQSPDDMHRKIKIRIIQPNSNKTFFIDGKLYKNAVVFSWNDFEKNQNYIL
FT                   KNIVVNGVDSKDFNFKFSTNTLPSFVYDQSKVFTNNQYSDTFVDELLNYLQKTKAKAFD
FT                   FNFIKQSKNKKFFPLLINWLLYENLTTPISLNASECQQDFWNAFSMLKNFQNFNAINLK
FT                   NDEWKDFLKQEFDNQASVDVLTFPFYNANKNMNFNEFLKAYKKLIKNQMKIQKIVPGNE
FT                   KIRTHFDYYFNFSKLSPYFYRQNYANNFLLLQKKLMQLNPKEQQAIFNALIAPDAKDDY
FT                   SFNKYFAQIPTKYKDSVNQYLMKFNFDSLNQDKDIIKQIYLGNQYLLEEINNEDPWLLV
FT                   DDIQYLMNLNDKQLKANKHYFKLVQMIWNGVDMLDYLKGYSRKKNDKTYRININNLKHE
FT                   LAIKNLNHVIIQDLITKNPQDDSLKSSLVSIQKQIDDLKQKIDSLLENFKKDLLDYDLN
FT                   LDLIQWDSFKQRVIDNQLFTKESINKLARIFNK"
FT   gene            complement(774219..775241)
FT                   /locus_tag="UUR10_0650"
FT   CDS_pept        complement(774219..775241)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0650"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0650"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60024"
FT                   /db_xref="GOA:B5ZC64"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR023828"
FT                   /db_xref="InterPro:IPR036852"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZC64"
FT                   /protein_id="ACI60024.1"
FT                   /translation="MSTGNDGNYVLKLNVKTKNNGERKLSIPLKEVDNKYILNDRFNKN
FT                   SIYVGSINNNYEISSYSNYGNHSSVEENIGGNLFPFLVAPGNIYGVAKINQLDKFDHVN
FT                   NKETISEVLIGGTSFSTPMVTGAVSLLQAYYMANNANKTIPVSHVRSILATSSSMDKIK
FT                   DISTVYKENNHNNVYGFGILNFENIIEAYKNVNDFEINKKYKEKELVKEIDLNIENDSS
FT                   NLNFSLSWLYNSKENIEKSDSQLENDFNTNNYKKPIDQSHYSLVLVDSNSLKGVNYSNI
FT                   DNIKNVIISKSNSNTNVELIRANSLKKGNYKILVYKNSVDQNQYEKFSYSYIVKNSKHY
FT                   "
FT   gene            complement(775250..776731)
FT                   /locus_tag="UUR10_0651"
FT   CDS_pept        complement(775250..776731)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0651"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0651"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60168"
FT                   /db_xref="GOA:B5ZC65"
FT                   /db_xref="InterPro:IPR036852"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZC65"
FT                   /protein_id="ACI60168.1"
FT                   /translation="MNKKNEKEFKNKNIIRITFNNINDKDKFISNIERTKLLMNDKSDI
FT                   KSFKLLPFVDLIIDKNLETSEIKNFILSNKFRSITFNEIKFYSNETPSQENNLNTNNLN
FT                   LDNWFLKDSSYLKSYSTIENNYIVDLIYFDYEFKPISKEEDLVKKDFIKNKFLYIKINK
FT                   KFNHKIGQLVKIDFYNIRDNKQYSVQGKLLVNSDNEQFLKINIDYNLEIKQTYLVSAIK
FT                   FLDENIEYNTRSNYVMVNSNISLEHFSFYVNDYLTDLNKNIYEMIGVNKYRHNLEEIPG
FT                   IKNSNYELRSRPKIGIFEAGNEVDLIPSNLFYSDTNFEHYENYKDKYVKWENDRRVREA
FT                   IITNAKKQLKDYQDKGGNDPDVINNLYKNINDKIDKNLHANNVASIIASNVGINEKSHI
FT                   YSWNVHENEGYYGYFRKFNEFIEKGIKIINHSYGISLPNYFNLELQNHFESIIFDNYDY
FT                   NEIKKEISNFLKKYSNELRYSLKNFLFDYVVIIMA"
FT   gene            complement(777108..777599)
FT                   /locus_tag="UUR10_0652"
FT   CDS_pept        complement(777108..777599)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0652"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0652"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60235"
FT                   /db_xref="GOA:B5ZC66"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZC66"
FT                   /protein_id="ACI60235.1"
FT                   /translation="MDLIFKRLKFVSIQNWALLLFSVALFICVGAWIGHELVRHNLFDA
FT                   HTLSHEKELLNMLSAKDLKNYLTLKEEIQLSIGFFGLFLVLWTLTYLISLTVNIRILVK
FT                   YLNDFNENKTKVKNALIISLIPFIHYASAIFLTIVYDKVFNWNRKKSHTLQEEYISAYA
FT                   "
FT   gene            complement(777608..781000)
FT                   /locus_tag="UUR10_0653"
FT   CDS_pept        complement(777608..781000)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0653"
FT                   /product="bacterial extracellular solute-binding protein,
FT                   family 5"
FT                   /note="identified by match to protein family HMM PF00496"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0653"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59758"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR016880"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZC67"
FT                   /protein_id="ACI59758.1"
FT                   /translation="MKKINKKILFSSLVAISLVPIATIIASCAKTKAKEQNKVSPYLED
FT                   GSNFGLAIDAINTLNYVKFASLRKIVFSLVDGFIKEAPSTNSTIGNLLGISKLYLNQYG
FT                   NPVDAGFNNMTDEQLTNMKIASSYLDLSSFGINGGVLAPTTNSKEPTWVFYNNSNNRIV
FT                   ATKFTTNFGASKWSDGKEVNAQDFIDAIQYILDLNTGSQLRSNLLRFNIKGTNEFNNAQ
FT                   EEYIRKHGVPYKNPFGRAPYILNKQTGEWEEDPNFVPYQNQTFDKNGRPVDDLEIAAIK
FT                   KAAYGIGLSTGQAYTNVSNEQLKEALKLPENKDFKFQESKTLTILNPRYNPKKPDKNIP
FT                   EKIVVNLVENPSFNHRQKLASDDLQTLANSKDLFKFKSLPTTRFELLMEFETYAPKPSF
FT                   NILLTDILANQALLPVNRRFIETHGGIEKFGSTLENFVWSGPFNISEVILGPQGYMTLE
FT                   KNKDYFSANWTISDKIKIYFNSKNEVTSLWFEQGMISSTTVPPSYQLKFWAQSKMRDLM
FT                   KKQGGAGTVALQFNLDRQSRYENYQEYLANPNKDIPILDPDLRRAIAFAINRENVLKLS
FT                   GWTSSFPVTTWTSFQRIKDSKGRNLEYWFDNQRFDSEYIDNVKDPKTQATKKQNRSFLV
FT                   QNNEFSDHVGAKSSTFENVNRKDTGFDVEVAKFYLDKYKQKNPDKKEVVLKFVYPTEPA
FT                   DIGKAVIAIKDLIDRHLGGYVKLELQALPPNTFVSFANSGKFDISYQNFDKYAGSTYDS
FT                   ALGLFLTPDGIDLKNNKSLGYELNPTGDWTPKQFFDRYKTKEELDYALKRLHISQEDAD
FT                   IIRELVTPTNIKTSEVYNPEHLTEKADLRKLKLKDKAIPMFDVSYLEYDAKIINDLQRQ
FT                   IDQLKQKVKDQPTSSSKAQWEKEITSLQTKIDTMQEREFYLSEEFLNQHDPKRENKPFS
FT                   LVLQNNVTGEYSSLQIEPVIDEKTKLYVQATKEDYAKYYHKENIDEISLKKRFKYKFSI
FT                   KTLPVGSYQVINLSYTDVPRPLLTKYLRNENNEASDKVNTEIFMTKLETVVEQRQRIID
FT                   FFSGNRPGWEDDNSIFRTILNLEKILRDEAAIVPIMEIDTNWTISSLGGMKNNYTYYLQ
FT                   YAYDYRRPPRPGLPTSPQAEGEN"
FT   gene            complement(781019..786691)
FT                   /locus_tag="UUR10_0654"
FT   CDS_pept        complement(781019..786691)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0654"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0654"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59875"
FT                   /db_xref="GOA:B5ZC68"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZC68"
FT                   /protein_id="ACI59875.1"
FT                   /translation="MKKRLNLSAKIAIAFASVGAFAGAVVGFMKLYAVSTGGLGRQILQ
FT                   VNSSFDTRIPNRQVNRALLMNQFGKPVAEYDFKAKKGNNTPVTLLVDFGKYKEGQKISY
FT                   IEFLDTFISLNNNNLPNLKLEVGPIVFSNNYINSVSPDEFIEFTNWFFTNVSWGPDLLT
FT                   LKEFKLSRGIQQNGNSITLGLHSGTREKTTIEFFPDAFFGSLPIYNINAGAGNAYDSLA
FT                   RQLNQDGMILEELEKYHQKIPLMIASHNSHSFGGIKLVNALKEAKNTYWFNADKYFDLT
FT                   KDPLNFAGLKGVKAKDRTLNYLFYAENEQQAKQKVQAYLNELQFVKGLIPKDKKFNPSI
FT                   DVKADEIKKIEIKEFLELGGALPSFPGGSVDLESLGGNSVGQKTLLIDALVNNQKQKIK
FT                   YHVFEDEFISRANKSNDSEFIQNDRSILASSLREIITKNFNNYISQKQNFRNVYDTDET
FT                   FVGKSFYIYDANGNGKNPRFYKTKESLLQSELVNYDEKKVSLVTIDKTKVEGPNKLVLT
FT                   TKDKKEIVLESPANNPKGYKYDTSFDDAFNTLKVAANYFDTFTPRLIKQGSKFINGKIV
FT                   KTYTIFVDAYSGLLDKVLNKNRHLLQKINGIHTEVVQNKDGKNTYKVVNGEYEGIYATD
FT                   RIPYLSLVAESDPAFKTTGINYLKYVSTHEYGHHQTLQDMKDISDSDESVVGGGIDSRS
FT                   GVSDESYVNGQALQDYLNARSSGITFRKTDVNYQPTKTGSFLNFSLNNDPKNPIWETEK
FT                   DIFGSATADDPKAFFNNKKRRFLQKFDELQEAAKLRNVKPYDLFIMNSFDHESATVNPS
FT                   FSSEMKDPSRLKAEYFFYNNQENQNQKNDKFNFGSVVEQPGLLRYKGILKDGMGTPIEF
FT                   DKKTGNPIIYKLKDSKKPITKDKVEILVKTKNNTPVIDLSTCLNKNGTVNLTKLKRQAN
FT                   QIINSINSLIVKNYYNGGWDESGNFETSMFNFQTYINHPLFTSTEKRKWAERITNAMFK
FT                   HPDFNISKSLKLPEKTNSTSTSVPYYKKVLSQIIGQDVTNKDFNGFKRVLLDASYKTSK
FT                   LLDNKTDEELKALDPELLEIKKYYNKQLDRWTVKDANVVAQTTMFNYFDSGIEGNNGYK
FT                   YYVKPKDRELYRTILNTKTKESFESIIGIRPSYLTQNKITTYEQLFNNFMINLNQIGTI
FT                   ALVVNKSNGEGKPQKTLDQLTEKEIYPLMILTEAEAKAINFNYLKSNNGAFTTVILDGN
FT                   NGQKFYTIKFKDIPSLIEFMSIDPSKYTIVENALSKNHENVRKWDYDYLKERYDVDKFF
FT                   NEVVKKQEAYKDITLEQFKENLTGLLFDGFTESHDIFKFYKSKDFKATELDKYKQVFDG
FT                   KLGLYGFRSFGNKFDKPASPYGEPIDRYNFAGNPQNVWKAKPNQKNVRTVDSIVKGIQV
FT                   EIERKHRQNNTLNFGQLLQYAFGFTIYTDKPGGSIKDIYGQLGSFFGISQSSEIPNEDG
FT                   TVVSWDYVAINKKRVQEKLNEIFGDYVFNIAEVLTRDYVQTVFVPSQQELDNLPNYLSG
FT                   LSDFNTGNEYVFSGDNTKQWNERLIPVNNFLSADSNTIASNVVFATNDYEKIQSVLANQ
FT                   ASNVYKKNQQLFDNYATKPEDLEENFAKVKNSLLSDNNFLTLSKTHDNDILNDLKSYSS
FT                   LTRLSADANSYIGKTRLTNNGFFKDRWLRKIIDWQIYDDNRESVKDDHLNILELDNKTK
FT                   VKDRARAMWLYMLRSKGIGDRTLAQIYRNKEKDSILMYGFIKKEYKDKVKKIAIKNKNN
FT                   GHISYIDVHTNNTNNLFYLKRQSDISSKWTLEDEGYVSWTTDYAILSNFTNQLIGYDSV
FT                   NAKGSEFELYFVDENLKEVMDLSDPSKPKSLMNLGSRKYVAENGKSYSISPVYARNENT
FT                   PTQNRTIIRISNQFSV"
FT   gene            complement(786710..788029)
FT                   /locus_tag="UUR10_0655"
FT   CDS_pept        complement(786710..788029)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0655"
FT                   /product="oligopeptide transport system permease protein"
FT                   /note="identified by match to protein family HMM PF00005;
FT                   match to protein family HMM PF08352"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0655"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60291"
FT                   /db_xref="GOA:B5ZC69"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZC69"
FT                   /protein_id="ACI60291.1"
FT                   /translation="MSDTNQKKAFFNHKKRFCLPDKITIRPVTEGLLERLNANPEKKRL
FT                   VEVRHLDVTYGHGFKKFRAVKDISFNIYQGEVLGLVGESGSGKSTTGSALIGLARHSFG
FT                   DIIIDGVKLPKQGEKVTKELTDFMVNNVQMIFQDPSNSLNPYVNIETVVSEGLNNIKDL
FT                   KKSFLRLIYKDYLRGLKKELKAKNLANNEQVQTFLEKAQDLKFDYLNETNQQELIQLFN
FT                   ELELANLSLDNNNKKLEKAFNDINTWKSKTRTDITRHLILDVLKSVGLDETVLRRYPLE
FT                   FSGGQQQRIGISRAVALRPKLLIADEPISALDVSIQAQVVNIFKELKAKYDLTILFIAH
FT                   DLRMVEYISDRIAVMNKGVLLEIGPTKEIVKNFLHPYTRSLMEAVPSIDSDKKSLLGYV
FT                   YDANMHGYTHEKQPKWIHLGNDHYILGTEEEVADWKAGKY"
FT   gene            complement(788047..789612)
FT                   /locus_tag="UUR10_0656"
FT   CDS_pept        complement(788047..789612)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0656"
FT                   /product="oligopeptide transport system permease protein"
FT                   /note="identified by match to protein family HMM PF00005;
FT                   match to protein family HMM PF08352; match to protein
FT                   family HMM TIGR01727"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0656"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60209"
FT                   /db_xref="GOA:B5ZC70"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZC70"
FT                   /protein_id="ACI60209.1"
FT                   /translation="MKPKNNRYTYIKYLRSQRAFVQALKPQVLVEPTLNNNVHLNEQQV
FT                   DLLPQLTNLENTNESVVNELVETKSNEEINIQDVINLEQKINYENNNSQNQDLDNEIFA
FT                   TTLINEQASGINEVSEQKQESPKVSKKHKKQTMAFKVANSRKNFDFEKFEKNVKYKTFK
FT                   DGTVKKIAAEIDNVRLTFTNPSKPEDRALVLRNTSVQFYEGEVHAIIGESGSGKSVITS
FT                   LLYGLAGKNANVEEGRILLYNNEVQDFSFKDWEKSRYLGKVISAVFQNPMSTLNPTMKI
FT                   GKQIMEGMLINGIVKTRKEAYKKSIEYLKLTKINNPEEIMELYPHELSGGMIQRVVIAS
FT                   IVSLHPKILVLDEPTTALDPTVQALVLDVIRELQEKFKMCIIFITHDLGVVASIANYIS
FT                   IMYAGQIIEEGQRDEILWNPQHPYTWGLIMSMPDVNKGDRLATIKGSVPSRLNEIVGDA
FT                   FAIRNDYALTRDFEHEPEMYYVSETHRVKSALLDERAEEYTPPQIILDKWNSFKQRQEN
FT                   KNNQ"
FT   gene            complement(789616..790614)
FT                   /locus_tag="UUR10_0657"
FT   CDS_pept        complement(789616..790614)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0657"
FT                   /product="oligopeptide transport system permease protein"
FT                   /note="identified by match to protein family HMM PF00528"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0657"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60361"
FT                   /db_xref="GOA:B5ZC71"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZC71"
FT                   /protein_id="ACI60361.1"
FT                   /translation="MAKFGQYLKEKSKSLASSFVDELASDAPNKFLQPFQHQQWKIIGH
FT                   LIEFRDNTYMGGRPRPFREFANRYGRSFSGLIGLAIIIILFILAIIIPFTTGSPTELRP
FT                   NQRYLDYFTDGFIFGTDNNGRDLWAMLWWGLRYSLGIAIIVTAIELVVGVTLGILMGYF
FT                   EMFDKIMTFIIKILTNVPTIIILMILTIILKPSFGVMIFAISFSGWITMANQMRSQVKR
FT                   ARSFLWVAASKTLGTKAWRIIWNFLPILVPMMITQLVFSIPGAILAESSLAFIGLSLPN
FT                   TPTLGNLIADGSSIITLYPRFTLIPSFLLVCLVASIQLVGGATQDALRRQR"
FT   gene            complement(790619..791764)
FT                   /locus_tag="UUR10_0658"
FT   CDS_pept        complement(790619..791764)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="UUR10_0658"
FT                   /product="oligopeptide transport system permease protein"
FT                   /note="identified by match to protein family HMM PF00528"
FT                   /db_xref="EnsemblGenomes-Gn:UUR10_0658"
FT                   /db_xref="EnsemblGenomes-Tr:ACI60144"
FT                   /db_xref="GOA:B5ZC72"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZC72"
FT                   /protein_id="ACI60144.1"
FT                   /translation="MNQKNSLESNSSQSNYGELPQQSTTLSQKKRVNYSFSNNFVIFGG
FT                   GRSLKTAADRDHVVDPLIDFFTFDSKFMTFITKSLKLIAEFFLLAWIVITITFFLINSV
FT                   PGESALTIGITSPEAKKAILAQYGLDRPLGVRYADYL