(data stored in ACNUC7421 zone)

EMBL: CP001189

ID   CP001189; SV 1; circular; genomic DNA; STD; PRO; 3887492 BP.
XX
AC   CP001189; ABPH01000000-ABPH01000029;
XX
PR   Project:PRJNA21071;
XX
DT   18-OCT-2008 (Rel. 97, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 5)
XX
DE   Gluconacetobacter diazotrophicus PAl 5, complete genome.
XX
KW   .
XX
OS   Gluconacetobacter diazotrophicus PA1 5
OC   Bacteria; Proteobacteria; Alphaproteobacteria; Rhodospirillales;
OC   Acetobacteraceae; Gluconacetobacter.
XX
RN   [1]
RC   Publication Status: Online-Only
RP   1-3887492
RX   DOI; 10.4056/sigs.972221.
RX   PUBMED; 21304715.
RA   Giongo A., Tyler H.L., Zipperer U.N., Triplett E.W.;
RT   "Two genome sequences of the same bacterial strain, Gluconacetobacter
RT   diazotrophicus PAl 5, suggest a new standard in genome sequence
RT   submission";
RL   Stand Genomic Sci 2(3):309-317(2010).
XX
RN   [2]
RP   1-3887492
RG   US DOE Joint Genome Institute
RA   Lucas S., Copeland A., Lapidus A., Glavina del Rio T., Dalin E., Tice H.,
RA   Bruce D., Goodwin L., Pitluck S., Chertkov O., Brettin T., Detter J.C.,
RA   Han C., Larimer F., Land M., Hauser L., Kyrpides N., Ovchinnikova G.,
RA   Triplett E.W.;
RT   ;
RL   Submitted (09-OCT-2008) to the INSDC.
RL   US DOE Joint Genome Institute, 2800 Mitchell Drive B100, Walnut Creek, CA
RL   94598-1698, USA
XX
DR   MD5; 491fc864bb83d2e026f6ff408b9cf23b.
DR   BioSample; SAMN02598444.
DR   EnsemblGenomes-Gn; EBG00001435191.
DR   EnsemblGenomes-Gn; EBG00001435192.
DR   EnsemblGenomes-Gn; EBG00001435193.
DR   EnsemblGenomes-Gn; EBG00001435194.
DR   EnsemblGenomes-Gn; EBG00001435195.
DR   EnsemblGenomes-Gn; EBG00001435196.
DR   EnsemblGenomes-Gn; EBG00001435197.
DR   EnsemblGenomes-Gn; EBG00001435198.
DR   EnsemblGenomes-Gn; EBG00001435199.
DR   EnsemblGenomes-Gn; EBG00001435200.
DR   EnsemblGenomes-Gn; EBG00001435201.
DR   EnsemblGenomes-Gn; EBG00001435202.
DR   EnsemblGenomes-Gn; EBG00001435203.
DR   EnsemblGenomes-Gn; EBG00001435204.
DR   EnsemblGenomes-Gn; EBG00001435205.
DR   EnsemblGenomes-Gn; EBG00001435206.
DR   EnsemblGenomes-Gn; EBG00001435207.
DR   EnsemblGenomes-Gn; EBG00001435208.
DR   EnsemblGenomes-Gn; EBG00001435209.
DR   EnsemblGenomes-Gn; EBG00001435210.
DR   EnsemblGenomes-Gn; EBG00001435211.
DR   EnsemblGenomes-Gn; EBG00001435212.
DR   EnsemblGenomes-Gn; EBG00001435213.
DR   EnsemblGenomes-Gn; EBG00001435214.
DR   EnsemblGenomes-Gn; EBG00001435215.
DR   EnsemblGenomes-Gn; EBG00001435216.
DR   EnsemblGenomes-Gn; EBG00001435217.
DR   EnsemblGenomes-Gn; EBG00001435218.
DR   EnsemblGenomes-Gn; EBG00001435219.
DR   EnsemblGenomes-Gn; EBG00001435220.
DR   EnsemblGenomes-Gn; EBG00001435221.
DR   EnsemblGenomes-Gn; EBG00001435222.
DR   EnsemblGenomes-Gn; EBG00001435223.
DR   EnsemblGenomes-Gn; EBG00001435224.
DR   EnsemblGenomes-Gn; EBG00001435225.
DR   EnsemblGenomes-Gn; EBG00001435226.
DR   EnsemblGenomes-Gn; EBG00001435227.
DR   EnsemblGenomes-Gn; EBG00001435228.
DR   EnsemblGenomes-Gn; EBG00001435229.
DR   EnsemblGenomes-Gn; EBG00001435230.
DR   EnsemblGenomes-Gn; EBG00001435231.
DR   EnsemblGenomes-Gn; EBG00001435232.
DR   EnsemblGenomes-Gn; EBG00001435233.
DR   EnsemblGenomes-Gn; EBG00001435234.
DR   EnsemblGenomes-Gn; EBG00001435235.
DR   EnsemblGenomes-Gn; EBG00001435236.
DR   EnsemblGenomes-Gn; EBG00001435237.
DR   EnsemblGenomes-Gn; EBG00001435238.
DR   EnsemblGenomes-Gn; EBG00001435239.
DR   EnsemblGenomes-Gn; EBG00001435240.
DR   EnsemblGenomes-Gn; EBG00001435241.
DR   EnsemblGenomes-Gn; EBG00001435242.
DR   EnsemblGenomes-Gn; EBG00001435243.
DR   EnsemblGenomes-Gn; EBG00001435244.
DR   EnsemblGenomes-Gn; EBG00001435245.
DR   EnsemblGenomes-Gn; EBG00001435246.
DR   EnsemblGenomes-Gn; EBG00001435247.
DR   EnsemblGenomes-Gn; EBG00001435248.
DR   EnsemblGenomes-Gn; EBG00001435249.
DR   EnsemblGenomes-Gn; EBG00001435250.
DR   EnsemblGenomes-Gn; EBG00001435251.
DR   EnsemblGenomes-Gn; EBG00001435252.
DR   EnsemblGenomes-Gn; EBG00001435253.
DR   EnsemblGenomes-Gn; EBG00001435254.
DR   EnsemblGenomes-Gn; EBG00001435255.
DR   EnsemblGenomes-Gn; EBG00001435256.
DR   EnsemblGenomes-Gn; EBG00001435257.
DR   EnsemblGenomes-Gn; EBG00001435258.
DR   EnsemblGenomes-Gn; EBG00001435259.
DR   EnsemblGenomes-Gn; EBG00001435260.
DR   EnsemblGenomes-Gn; EBG00001435261.
DR   EnsemblGenomes-Gn; EBG00001435262.
DR   EnsemblGenomes-Gn; EBG00001435263.
DR   EnsemblGenomes-Gn; EBG00001435264.
DR   EnsemblGenomes-Gn; EBG00001435265.
DR   EnsemblGenomes-Gn; EBG00001435266.
DR   EnsemblGenomes-Gn; Gdia_R0001.
DR   EnsemblGenomes-Gn; Gdia_R0002.
DR   EnsemblGenomes-Gn; Gdia_R0003.
DR   EnsemblGenomes-Gn; Gdia_R0004.
DR   EnsemblGenomes-Gn; Gdia_R0005.
DR   EnsemblGenomes-Gn; Gdia_R0006.
DR   EnsemblGenomes-Gn; Gdia_R0007.
DR   EnsemblGenomes-Gn; Gdia_R0008.
DR   EnsemblGenomes-Gn; Gdia_R0009.
DR   EnsemblGenomes-Gn; Gdia_R0010.
DR   EnsemblGenomes-Gn; Gdia_R0011.
DR   EnsemblGenomes-Gn; Gdia_R0012.
DR   EnsemblGenomes-Gn; Gdia_R0013.
DR   EnsemblGenomes-Gn; Gdia_R0014.
DR   EnsemblGenomes-Gn; Gdia_R0015.
DR   EnsemblGenomes-Gn; Gdia_R0016.
DR   EnsemblGenomes-Gn; Gdia_R0017.
DR   EnsemblGenomes-Gn; Gdia_R0018.
DR   EnsemblGenomes-Gn; Gdia_R0019.
DR   EnsemblGenomes-Gn; Gdia_R0020.
DR   EnsemblGenomes-Gn; Gdia_R0021.
DR   EnsemblGenomes-Gn; Gdia_R0022.
DR   EnsemblGenomes-Gn; Gdia_R0023.
DR   EnsemblGenomes-Gn; Gdia_R0024.
DR   EnsemblGenomes-Gn; Gdia_R0025.
DR   EnsemblGenomes-Gn; Gdia_R0026.
DR   EnsemblGenomes-Gn; Gdia_R0027.
DR   EnsemblGenomes-Gn; Gdia_R0028.
DR   EnsemblGenomes-Gn; Gdia_R0029.
DR   EnsemblGenomes-Gn; Gdia_R0030.
DR   EnsemblGenomes-Gn; Gdia_R0031.
DR   EnsemblGenomes-Gn; Gdia_R0032.
DR   EnsemblGenomes-Gn; Gdia_R0033.
DR   EnsemblGenomes-Gn; Gdia_R0034.
DR   EnsemblGenomes-Gn; Gdia_R0035.
DR   EnsemblGenomes-Gn; Gdia_R0036.
DR   EnsemblGenomes-Gn; Gdia_R0037.
DR   EnsemblGenomes-Gn; Gdia_R0038.
DR   EnsemblGenomes-Gn; Gdia_R0039.
DR   EnsemblGenomes-Gn; Gdia_R0040.
DR   EnsemblGenomes-Gn; Gdia_R0041.
DR   EnsemblGenomes-Gn; Gdia_R0042.
DR   EnsemblGenomes-Gn; Gdia_R0043.
DR   EnsemblGenomes-Gn; Gdia_R0044.
DR   EnsemblGenomes-Gn; Gdia_R0045.
DR   EnsemblGenomes-Gn; Gdia_R0046.
DR   EnsemblGenomes-Gn; Gdia_R0047.
DR   EnsemblGenomes-Gn; Gdia_R0048.
DR   EnsemblGenomes-Gn; Gdia_R0049.
DR   EnsemblGenomes-Gn; Gdia_R0050.
DR   EnsemblGenomes-Gn; Gdia_R0051.
DR   EnsemblGenomes-Gn; Gdia_R0052.
DR   EnsemblGenomes-Gn; Gdia_R0053.
DR   EnsemblGenomes-Gn; Gdia_R0054.
DR   EnsemblGenomes-Gn; Gdia_R0055.
DR   EnsemblGenomes-Gn; Gdia_R0056.
DR   EnsemblGenomes-Gn; Gdia_R0057.
DR   EnsemblGenomes-Gn; Gdia_R0058.
DR   EnsemblGenomes-Gn; Gdia_R0059.
DR   EnsemblGenomes-Gn; Gdia_R0060.
DR   EnsemblGenomes-Gn; Gdia_R0061.
DR   EnsemblGenomes-Gn; Gdia_R0062.
DR   EnsemblGenomes-Gn; Gdia_R0063.
DR   EnsemblGenomes-Gn; Gdia_R0064.
DR   EnsemblGenomes-Gn; Gdia_R0065.
DR   EnsemblGenomes-Gn; Gdia_R0066.
DR   EnsemblGenomes-Gn; Gdia_R0067.
DR   EnsemblGenomes-Gn; Gdia_R0068.
DR   EnsemblGenomes-Gn; Gdia_R0069.
DR   EnsemblGenomes-Gn; Gdia_R0070.
DR   EnsemblGenomes-Tr; EBT00001813024.
DR   EnsemblGenomes-Tr; EBT00001813025.
DR   EnsemblGenomes-Tr; EBT00001813026.
DR   EnsemblGenomes-Tr; EBT00001813027.
DR   EnsemblGenomes-Tr; EBT00001813028.
DR   EnsemblGenomes-Tr; EBT00001813029.
DR   EnsemblGenomes-Tr; EBT00001813030.
DR   EnsemblGenomes-Tr; EBT00001813031.
DR   EnsemblGenomes-Tr; EBT00001813032.
DR   EnsemblGenomes-Tr; EBT00001813033.
DR   EnsemblGenomes-Tr; EBT00001813034.
DR   EnsemblGenomes-Tr; EBT00001813035.
DR   EnsemblGenomes-Tr; EBT00001813036.
DR   EnsemblGenomes-Tr; EBT00001813037.
DR   EnsemblGenomes-Tr; EBT00001813038.
DR   EnsemblGenomes-Tr; EBT00001813039.
DR   EnsemblGenomes-Tr; EBT00001813040.
DR   EnsemblGenomes-Tr; EBT00001813041.
DR   EnsemblGenomes-Tr; EBT00001813042.
DR   EnsemblGenomes-Tr; EBT00001813043.
DR   EnsemblGenomes-Tr; EBT00001813044.
DR   EnsemblGenomes-Tr; EBT00001813045.
DR   EnsemblGenomes-Tr; EBT00001813046.
DR   EnsemblGenomes-Tr; EBT00001813047.
DR   EnsemblGenomes-Tr; EBT00001813048.
DR   EnsemblGenomes-Tr; EBT00001813049.
DR   EnsemblGenomes-Tr; EBT00001813050.
DR   EnsemblGenomes-Tr; EBT00001813051.
DR   EnsemblGenomes-Tr; EBT00001813052.
DR   EnsemblGenomes-Tr; EBT00001813053.
DR   EnsemblGenomes-Tr; EBT00001813054.
DR   EnsemblGenomes-Tr; EBT00001813055.
DR   EnsemblGenomes-Tr; EBT00001813056.
DR   EnsemblGenomes-Tr; EBT00001813057.
DR   EnsemblGenomes-Tr; EBT00001813058.
DR   EnsemblGenomes-Tr; EBT00001813059.
DR   EnsemblGenomes-Tr; EBT00001813060.
DR   EnsemblGenomes-Tr; EBT00001813061.
DR   EnsemblGenomes-Tr; EBT00001813062.
DR   EnsemblGenomes-Tr; EBT00001813063.
DR   EnsemblGenomes-Tr; EBT00001813064.
DR   EnsemblGenomes-Tr; EBT00001813065.
DR   EnsemblGenomes-Tr; EBT00001813066.
DR   EnsemblGenomes-Tr; EBT00001813067.
DR   EnsemblGenomes-Tr; EBT00001813068.
DR   EnsemblGenomes-Tr; EBT00001813069.
DR   EnsemblGenomes-Tr; EBT00001813070.
DR   EnsemblGenomes-Tr; EBT00001813071.
DR   EnsemblGenomes-Tr; EBT00001813072.
DR   EnsemblGenomes-Tr; EBT00001813073.
DR   EnsemblGenomes-Tr; EBT00001813074.
DR   EnsemblGenomes-Tr; EBT00001813075.
DR   EnsemblGenomes-Tr; EBT00001813076.
DR   EnsemblGenomes-Tr; EBT00001813077.
DR   EnsemblGenomes-Tr; EBT00001813078.
DR   EnsemblGenomes-Tr; EBT00001813079.
DR   EnsemblGenomes-Tr; EBT00001813080.
DR   EnsemblGenomes-Tr; EBT00001813081.
DR   EnsemblGenomes-Tr; EBT00001813082.
DR   EnsemblGenomes-Tr; EBT00001813083.
DR   EnsemblGenomes-Tr; EBT00001813084.
DR   EnsemblGenomes-Tr; EBT00001813085.
DR   EnsemblGenomes-Tr; EBT00001813086.
DR   EnsemblGenomes-Tr; EBT00001813087.
DR   EnsemblGenomes-Tr; EBT00001813088.
DR   EnsemblGenomes-Tr; EBT00001813089.
DR   EnsemblGenomes-Tr; EBT00001813090.
DR   EnsemblGenomes-Tr; EBT00001813091.
DR   EnsemblGenomes-Tr; EBT00001813092.
DR   EnsemblGenomes-Tr; EBT00001813093.
DR   EnsemblGenomes-Tr; EBT00001813094.
DR   EnsemblGenomes-Tr; EBT00001813095.
DR   EnsemblGenomes-Tr; EBT00001813096.
DR   EnsemblGenomes-Tr; EBT00001813097.
DR   EnsemblGenomes-Tr; EBT00001813098.
DR   EnsemblGenomes-Tr; EBT00001813099.
DR   EnsemblGenomes-Tr; Gdia_R0001-1.
DR   EnsemblGenomes-Tr; Gdia_R0002-1.
DR   EnsemblGenomes-Tr; Gdia_R0003-1.
DR   EnsemblGenomes-Tr; Gdia_R0004-1.
DR   EnsemblGenomes-Tr; Gdia_R0005-1.
DR   EnsemblGenomes-Tr; Gdia_R0006-1.
DR   EnsemblGenomes-Tr; Gdia_R0007-1.
DR   EnsemblGenomes-Tr; Gdia_R0008-1.
DR   EnsemblGenomes-Tr; Gdia_R0009-1.
DR   EnsemblGenomes-Tr; Gdia_R0010-1.
DR   EnsemblGenomes-Tr; Gdia_R0011-1.
DR   EnsemblGenomes-Tr; Gdia_R0012-1.
DR   EnsemblGenomes-Tr; Gdia_R0013-1.
DR   EnsemblGenomes-Tr; Gdia_R0014-1.
DR   EnsemblGenomes-Tr; Gdia_R0015-1.
DR   EnsemblGenomes-Tr; Gdia_R0016-1.
DR   EnsemblGenomes-Tr; Gdia_R0017-1.
DR   EnsemblGenomes-Tr; Gdia_R0018-1.
DR   EnsemblGenomes-Tr; Gdia_R0019-1.
DR   EnsemblGenomes-Tr; Gdia_R0020-1.
DR   EnsemblGenomes-Tr; Gdia_R0021-1.
DR   EnsemblGenomes-Tr; Gdia_R0022-1.
DR   EnsemblGenomes-Tr; Gdia_R0023-1.
DR   EnsemblGenomes-Tr; Gdia_R0024-1.
DR   EnsemblGenomes-Tr; Gdia_R0025-1.
DR   EnsemblGenomes-Tr; Gdia_R0026-1.
DR   EnsemblGenomes-Tr; Gdia_R0027-1.
DR   EnsemblGenomes-Tr; Gdia_R0028-1.
DR   EnsemblGenomes-Tr; Gdia_R0029-1.
DR   EnsemblGenomes-Tr; Gdia_R0030-1.
DR   EnsemblGenomes-Tr; Gdia_R0031-1.
DR   EnsemblGenomes-Tr; Gdia_R0032-1.
DR   EnsemblGenomes-Tr; Gdia_R0033-1.
DR   EnsemblGenomes-Tr; Gdia_R0034-1.
DR   EnsemblGenomes-Tr; Gdia_R0035-1.
DR   EnsemblGenomes-Tr; Gdia_R0036-1.
DR   EnsemblGenomes-Tr; Gdia_R0037-1.
DR   EnsemblGenomes-Tr; Gdia_R0038-1.
DR   EnsemblGenomes-Tr; Gdia_R0039-1.
DR   EnsemblGenomes-Tr; Gdia_R0040-1.
DR   EnsemblGenomes-Tr; Gdia_R0041-1.
DR   EnsemblGenomes-Tr; Gdia_R0042-1.
DR   EnsemblGenomes-Tr; Gdia_R0043-1.
DR   EnsemblGenomes-Tr; Gdia_R0044-1.
DR   EnsemblGenomes-Tr; Gdia_R0045-1.
DR   EnsemblGenomes-Tr; Gdia_R0046-1.
DR   EnsemblGenomes-Tr; Gdia_R0047-1.
DR   EnsemblGenomes-Tr; Gdia_R0048-1.
DR   EnsemblGenomes-Tr; Gdia_R0049-1.
DR   EnsemblGenomes-Tr; Gdia_R0050-1.
DR   EnsemblGenomes-Tr; Gdia_R0051-1.
DR   EnsemblGenomes-Tr; Gdia_R0052-1.
DR   EnsemblGenomes-Tr; Gdia_R0053-1.
DR   EnsemblGenomes-Tr; Gdia_R0054-1.
DR   EnsemblGenomes-Tr; Gdia_R0055-1.
DR   EnsemblGenomes-Tr; Gdia_R0056-1.
DR   EnsemblGenomes-Tr; Gdia_R0057-1.
DR   EnsemblGenomes-Tr; Gdia_R0058-1.
DR   EnsemblGenomes-Tr; Gdia_R0059-1.
DR   EnsemblGenomes-Tr; Gdia_R0060-1.
DR   EnsemblGenomes-Tr; Gdia_R0061-1.
DR   EnsemblGenomes-Tr; Gdia_R0062-1.
DR   EnsemblGenomes-Tr; Gdia_R0063-1.
DR   EnsemblGenomes-Tr; Gdia_R0064-1.
DR   EnsemblGenomes-Tr; Gdia_R0065-1.
DR   EnsemblGenomes-Tr; Gdia_R0066-1.
DR   EnsemblGenomes-Tr; Gdia_R0067-1.
DR   EnsemblGenomes-Tr; Gdia_R0068-1.
DR   EnsemblGenomes-Tr; Gdia_R0069-1.
DR   EnsemblGenomes-Tr; Gdia_R0070-1.
DR   EuropePMC; PMC2765452; 19775431.
DR   EuropePMC; PMC2772497; 19767433.
DR   EuropePMC; PMC3035290; 21304715.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00435; ROSE.
DR   RFAM; RF00504; Glycine.
DR   RFAM; RF00519; suhB.
DR   RFAM; RF00521; SAM_alpha.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01497; ALIL.
DR   RFAM; RF01725; SAM-I-IV-variant.
DR   RFAM; RF01734; crcB.
DR   RFAM; RF01849; alpha_tmRNA.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   SILVA-LSU; CP001189.
DR   SILVA-SSU; CP001189.
DR   StrainInfo; 113652; 1.
XX
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 4082943
CC   Source DNA and organism available from Eric W. Triplett
CC   (ewt@ufl.edu)
CC   Contacts: Eric W. Triplett (ewt@ufl.edu)
CC             David Bruce (microbe@cuba.jgi-psf.org)
CC   Annotation done by JGI-ORNL and JGI-PGF
CC   Finishing done by JGI-LANL
CC   Finished microbial genomes have been curated to close all gaps with
CC   greater than 98% coverage of at least two independent clones. Each
CC   base pair has a minimum q (quality) value of 30 and the total error
CC   rate is less than one per 50000.
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. it is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3887492
FT                   /organism="Gluconacetobacter diazotrophicus PA1 5"
FT                   /strain="PAl 5; ATCC 49037"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:272568"
FT                   /culture_collection="ATCC:49037"
FT   gene            5..1438
FT                   /locus_tag="Gdia_0001"
FT   CDS_pept        5..1438
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0001"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /note="KEGG: gdi:GDI1771 putative chromosomal replication
FT                   initiator protein DnaA; TIGRFAM: chromosomal replication
FT                   initiator protein DnaA; PFAM: Chromosomal replication
FT                   initiator DnaA domain; Chromosomal replication initiator
FT                   DnaA; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ACI49803"
FT                   /db_xref="GOA:B5ZJ25"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZJ25"
FT                   /protein_id="ACI49803.1"
FT                   /translation="MTGELSGFDAVAEARSARNVLDIHWSRICSRLQAEVGEVEYRTWL
FT                   KQISIGPVDGDEITLNLPTRFLRDWVRTQYGDRLSALWNAELPAIRRVELQVGRPEGAA
FT                   DGAAPAPADPPVAATPATAAIVGDERVPENRNDLAAPLDPRFTFDTFVVGKPNEFAYAC
FT                   ARRVAERPSSPGFNPLFLYGGVGLGKTHLMHAIGSELVRGGAVSVAYMSAEKFMYRFIA
FT                   AIRSQSTMEFKEQLRSVDVLMIDDLQFLIGKDNTQEEFFHTFNALVDAGRQIVVSADKS
FT                   PSDLSGLEDRLRTRLGCGMVADIHATTFELRISILESKAAASGVAVPAKVLEFLAHKIT
FT                   SNVRELEGALNRLIAHANLFGRPVTLEATQDVLHDILKAHDRRVTIEEIQRKVSEHWNI
FT                   RLTDMSSARRARAVARPRQVAMYLAKQLTSRSLPEIGRKFGNRDHTTVMHAVARVTELM
FT                   ERDTAFAEDVELLRRMLES"
FT   gene            1613..2737
FT                   /locus_tag="Gdia_0002"
FT   CDS_pept        1613..2737
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0002"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="KEGG: gdi:GDI1772 DNA polymerase III subunit beta;
FT                   TIGRFAM: DNA polymerase III, beta subunit; PFAM: DNA
FT                   polymerase III beta chain"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ACI49804"
FT                   /db_xref="GOA:A9HI34"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:A9HI34"
FT                   /protein_id="ACI49804.1"
FT                   /translation="MKLKADRATLLKALAHIQSVAEKRNTIPILANVLINVADGRLTLT
FT                   ATDMEIAVVEEIGAETSRNGAVTAPAAVLYEIARKLPDGVAIELDHTGGDAPLALRAGR
FT                   YATSLNVLDVDDFPSMMAGTLPYHFTMPAAVLRGLIDRTRFAISTEETRYYLNGIYLHV
FT                   AAGDEGSMLRAVATDGHRLARVETEVPPGAEEMPGVIVPRKTVAELRKLLDEGTEDVAV
FT                   GLSDTRIQFTVGTVTLTSKLIDGTFPEYDRVIPRGNDKILRVGKRDFSDAVARVAAISQ
FT                   ERSRPVKLSIGHNLLTLSAVSPDQGTAKEELDDNYVTYDSTPLEIGFQARYLNDITDQI
FT                   DKDVEFAFSDSSAPTIVRDVASPSALYVLMPMRV"
FT   gene            2776..3897
FT                   /locus_tag="Gdia_0003"
FT   CDS_pept        2776..3897
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0003"
FT                   /product="DNA replication and repair protein RecF"
FT                   /note="TIGRFAM: DNA replication and repair protein RecF;
FT                   PFAM: SMC domain protein; KEGG: gdi:GDI1773 putative DNA
FT                   replication and repair protein RecF"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ACI49805"
FT                   /db_xref="GOA:B5ZJ27"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZJ27"
FT                   /protein_id="ACI49805.1"
FT                   /translation="MARLDRLALTDFRNYRHLAWRPEAPVTVVTGENGSGKTNLLEALS
FT                   LLVPGRGLRGARSAEMARHGTTIWGVAARFTGPDGAPFDIATGSDPARPERRVFRRDGE
FT                   TLRSRAALADHLSAVWLTPQMDRLFQDGLPGRRRFLDRLVLALEPGHARELAAHDQAMG
FT                   QRNRLLAAGRADPGWLSALEDSMARHAVAASAARLALVTQLNGEAAHTVPDGFPPARLD
FT                   ILCPIVQQLRDRPALAVEDWLRGRLAAGRAADGARGGAGMGAHRADMALSDQASGRPAA
FT                   QASTGQQKALLLGVVLAHAALMTRSRGEAPMILLDEPLVHLDEARRAALFRSVGAFDAT
FT                   VLMTGTDADQFAPLRGRAGFVSPRNGALDGKPV"
FT   gene            3984..6440
FT                   /locus_tag="Gdia_0004"
FT   CDS_pept        3984..6440
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0004"
FT                   /product="DNA gyrase, B subunit"
FT                   /EC_number="5.99.1.3"
FT                   /note="KEGG: gdi:GDI1774 putative DNA gyrase subunit B;
FT                   TIGRFAM: DNA gyrase, B subunit; PFAM: DNA gyrase subunit B
FT                   domain protein; ATP-binding region ATPase domain protein;
FT                   TOPRIM domain protein; DNA topoisomerase type IIA subunit B
FT                   region 2 domain protein; SMART: DNA topoisomerase II"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ACI49806"
FT                   /db_xref="GOA:B5ZJ28"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZJ28"
FT                   /protein_id="ACI49806.1"
FT                   /translation="MPDADMPNSDATGTLPDDSDYDAASISVLKGLDAVRKRPGMYIGD
FT                   TDDGSGLHHMAFEIIDNAVDEAQAGFATSCIVTLNGDGSVTVRDNGRGIPTDMHAEEGV
FT                   SAAEVVLTKLHAGGKFNQNSYKVSGGLHGVGAAVVNALSEWMEVRIWRNGQEHMIRFRH
FT                   GERDAPLTVVGPSDEPRGTQVTFKPSIGTFTRVEFEFAILERRMRELAFLNSGLQIVLR
FT                   DERHTPTREENFHFQGGLAAFVEWLDRGKSSIVDPPITGSLQNEDNGIKVEFALTWNDS
FT                   FHETMLCFTNNIPQRDGGSHLAGFRQALTRVVGKYAESNASKKDSQSLVGEDMREGMTA
FT                   VLSVKVPDPKFSSQTKDKLVSSEVQPVVHAAASDMIAHWFETHPKEARAIVAKVMDAAA
FT                   AREAARRARELTRRKGVLDVSSLPGKLADCQERDPARSELFIVEGDSAGGTAKQGRDRR
FT                   FQAILPLKGKILNVERARFDRMLGSAEVGTLITALGTGIGRGDVDQGGFSIDKLRYHRV
FT                   VIMTDADVDGSHIRTLLLTFFFRQMPELIERGHLYIAQPPLYRAKRGNDERYLKDDAAL
FT                   EQYLLDKALANASLRYGDGRVVAGADLAADMAFLRDVTRALQRLTLRAPLWILEQAAIA
FT                   GALNADTATVQTRVAALQAQLDEVSLPNERGWKVVASADGLEMARSVRGVGEVYRLDPA
FT                   TLRSAEVRWLAERAERLATDFAGKVELTLDTTTRAADGPASLYERILAQGRRGLSINRF
FT                   KGLGEMNDAQLWETTLDPAMRTLLQVKVGDVENAAQVFSTLMGDVVEPRRDFIVGNALK
FT                   VANLDV"
FT   gene            6494..7306
FT                   /locus_tag="Gdia_0005"
FT   CDS_pept        6494..7306
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0005"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gdi:GDI1775 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ACI49807"
FT                   /db_xref="InterPro:IPR021457"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZJ29"
FT                   /protein_id="ACI49807.1"
FT                   /translation="MPLSMRRLADLSRKLVVGLAAGSLAVGVAPRAMATETPPQIDHTY
FT                   GVYADGLRALTITARYAITPDGYAIRSTMRSAGILGWVVRMNLTSQATGHFVPDGVNPV
FT                   SFDSAGYSRGADRHVVLDYNDGRAHIALETPPEPSREPIPAESLAPAKDTLSALIQMQR
FT                   TVRAHHSCDGSAIVFDGARLLRVQAWTVGQQDMPDDSRQPYHGSALRCDFTDVQIAGFR
FT                   QSDGPGSAARKTIQGKVWFQDVPGDGLTIVRVLFDHPKFGRLAIVMQG"
FT   sig_peptide     6494..6598
FT                   /locus_tag="Gdia_0005"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 35"
FT   gene            complement(7293..7973)
FT                   /locus_tag="Gdia_0006"
FT   CDS_pept        complement(7293..7973)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0006"
FT                   /product="phosphoglycolate phosphatase"
FT                   /note="TIGRFAM: phosphoglycolate phosphatase;
FT                   HAD-superfamily hydrolase, subfamily IA, variant 1; PFAM:
FT                   Haloacid dehalogenase domain protein hydrolase; KEGG:
FT                   gdi:GDI1776 phosphoglycolate phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ACI49808"
FT                   /db_xref="GOA:B5ZJ30"
FT                   /db_xref="InterPro:IPR006346"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZJ30"
FT                   /protein_id="ACI49808.1"
FT                   /translation="MPATPTPRIAVFDMDGTLLDSLPDLAASADRLLTGYGLPGISPDL
FT                   VRGMVGDGVAALVRRLLAHAGTPAAGIDVQQAVDRYMADYTPRATEQSRPFPGTEYALK
FT                   TLRDAGWTLAICTNKPVAAARRIVSELGLTEWFDAIGGGDSFPVRKPDPAHLLGTIGLA
FT                   HGHADRAIMVGDHHNDIFAAKGAHVRSVFARWGYGRPDMEAGATIGADSMTEIPHIAGQ
FT                   LIPA"
FT   gene            8105..9490
FT                   /locus_tag="Gdia_0007"
FT   CDS_pept        8105..9490
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0007"
FT                   /product="UDP-N-acetylglucosamine pyrophosphorylase"
FT                   /note="TIGRFAM: UDP-N-acetylglucosamine pyrophosphorylase;
FT                   PFAM: 4-diphosphocytidyl-2C-methyl-D-erythritol synthase;
FT                   transferase hexapeptide repeat containing protein;
FT                   Nucleotidyl transferase; KEGG: gdi:GDI1777 putative
FT                   bifunctional protein GlmU"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ACI49809"
FT                   /db_xref="GOA:A9HI46"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005882"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR038009"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9HI46"
FT                   /protein_id="ACI49809.1"
FT                   /translation="MNATVPSAAPADLPAHRPATAVILAAGMGTRMKSDRPKVMHPLAG
FT                   QPMLRYLLDNAASVFDRIVVVVGPGMEQVAALAAPHAVVVQQDRLGTAHAAAQAADLFG
FT                   SGDVAVLYGDNPLITVASMRRMLACRAGEGGNEGAGLALMAMRPRDPGRYGRVVTQDGL
FT                   VRRIVEWADASDEERAITLCNAGVLCAGAEDFRRWLGAVRNDNAQGEYYLGDVVAMAVA
FT                   EGRQVRAVEAPEDELRGINSRAELAEAEACVQRRLRAAALDGGATLVAPETVFLAADTV
FT                   LEPDVLVQPHVVFGPGVTVRRGAEIRAFSHLEGCVVGPGALIGPYARLRPGSDVGAAAH
FT                   VGNFVELKATTLGAGAKANHLSYLGDATIGPATNIGAGTITCNYDGVFKHRTEIGAGCF
FT                   VGSNAILVAPVRIGDGALVAAGSVITQDVPPDAMALGRARQTNKDGRGASLQAALRRKK
FT                   EQG"
FT   gene            9490..11313
FT                   /locus_tag="Gdia_0008"
FT   CDS_pept        9490..11313
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0008"
FT                   /product="glucosamine/fructose-6-phosphate
FT                   aminotransferase, isomerizing"
FT                   /note="TIGRFAM: glucosamine/fructose-6-phosphate
FT                   aminotransferase, isomerizing; PFAM: glutamine
FT                   amidotransferase class-II; sugar isomerase (SIS); KEGG:
FT                   gdi:GDI1778 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ACI49810"
FT                   /db_xref="GOA:A9HI49"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR005855"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR035466"
FT                   /db_xref="InterPro:IPR035490"
FT                   /db_xref="UniProtKB/TrEMBL:A9HI49"
FT                   /protein_id="ACI49810.1"
FT                   /translation="MCGIVGVVGCKCATPVIFDALRRLEYRGYDSAGIATLVDGRIERR
FT                   RAAGKLDNLAALLEREPLAGVTGIGHTRWATHGAPTENNAHPHGTERVSVVHNGIIENF
FT                   EELRRELEQAGHVFTTETDSETVAQLVDFHLARGLSPRDAAFAALRRLEGAYALAMLFA
FT                   GHDGLVIGARHGAPLVVGYGEQEMFLGSDSLALAPLTRRIAYLDDGDWVVVTRDGAEFF
FT                   DASGERVERAVRTTALIAGSVGKDGYRHYMEKELHEHPVVIGQTLQRLIDPATRRVVLP
FT                   DLPFDLASVPRAVVTACGSAFYAGMIGRYWLEGIARLPVDIDVASEMRYRDPPLTPGGL
FT                   GLLISQSGETADTLAALRGMRARQQHIVSVLNVEQSTIARESDVVLGTVAGPEISVAST
FT                   KAFTAQLSVLACLAIAAGRLRGTVSAEREQEMVAALLDLPSRASEVFDQAPAIREMAAV
FT                   VANARDVLYLGRGSSFPVALEGALKLKEVSYIHAEAYAAGEMKHGPISLIDQTVPIVAT
FT                   VPSGPLFEKTVSNLQEARARGGRLLVFTDTKGAERLRGLAEIVVAIPTVDEFTSPVLQT
FT                   IPVQMLAYEVALLKGTDVDQPRNLAKSVTVE"
FT   gene            11478..12494
FT                   /locus_tag="Gdia_0009"
FT   CDS_pept        11478..12494
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0009"
FT                   /product="glycine oxidase ThiO"
FT                   /note="TIGRFAM: glycine oxidase ThiO; PFAM: FAD dependent
FT                   oxidoreductase; KEGG: gdi:GDI1779 thiamine biosynthesis
FT                   oxidoreductase ThiO"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ACI49811"
FT                   /db_xref="GOA:B5ZJ33"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR012727"
FT                   /db_xref="InterPro:IPR023209"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZJ33"
FT                   /protein_id="ACI49811.1"
FT                   /translation="MEQAESGARLRVLVRGAGVAGLTSAVTLAERGADVTLLEVSAELG
FT                   AGAASWMAGGMLAPWCEAESAPPEVTRDSLESVDWWASHVPGVVRNGTLVLAPPRDEGD
FT                   IARFGRRTSHFDLVDAARIAELEPDLDGRFNKGLFFPAEGHVDPRLALAALRDRLVALG
FT                   GTVRMNAPAGDVPADLAAGGFDRVVDCTGVAARPHLKGLRAMRGEMLLLRCPDVTLHRP
FT                   VRMLHPRIPVYIVPRADHLFMVGATMVESENAGGMTLRSMVELLTAAYVLHPAFGEAEI
FT                   VETGVGLRPAYPDNVPAVTVQGRTVYVNGMYRHGFLLSPSRARQAADIVFGTAEAAA"
FT   gene            12517..12714
FT                   /locus_tag="Gdia_0010"
FT   CDS_pept        12517..12714
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0010"
FT                   /product="thiamine biosynthesis protein ThiS"
FT                   /note="TIGRFAM: thiamine biosynthesis protein ThiS; PFAM:
FT                   thiamineS protein; KEGG: gdi:GDI1780 putative thiamine
FT                   biosynthesis protein ThiS"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ACI49812"
FT                   /db_xref="InterPro:IPR003749"
FT                   /db_xref="InterPro:IPR010035"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR016155"
FT                   /db_xref="UniProtKB/TrEMBL:A9HI54"
FT                   /protein_id="ACI49812.1"
FT                   /translation="MRILVNEEPREVSTATLAALLDELGYGGARVATAVNGDFVPVSRR
FT                   AALTLDEGARVEILAPMQGG"
FT   gene            12719..13489
FT                   /locus_tag="Gdia_0011"
FT   CDS_pept        12719..13489
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0011"
FT                   /product="thiazole biosynthesis family protein"
FT                   /note="PFAM: thiazole biosynthesis family protein; KEGG:
FT                   gdi:GDI1781 thiazole biosynthesis protein ThiG"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ACI49813"
FT                   /db_xref="GOA:A9HI56"
FT                   /db_xref="InterPro:IPR008867"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR033983"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9HI56"
FT                   /protein_id="ACI49813.1"
FT                   /translation="MLFYGTELKSRLMLGTAQYPSPEILSDAVRAAEAGVVTVSLRRES
FT                   AGQRAGQAFWSMIRDLGVPVLPNTAGCHTVKEAVTTAHMAREVFDTDWIKLEVIGESDT
FT                   LQPDMFGLVEAARILSRDGFKVFPYMTEDLVGAERLLQAGCEVLMPWGAPIGSGKGLNN
FT                   VFGLRALRAHFPDVPLVVDAGIGLPSHAAQAMELGYDAVLINTAVAKAGDPVRMARAFR
FT                   LAVEAGLIAREADPIEERDMAAPSTPVLGRAMLA"
FT   gene            13528..14136
FT                   /locus_tag="Gdia_0012"
FT   CDS_pept        13528..14136
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0012"
FT                   /product="thiamine-phosphate pyrophosphorylase"
FT                   /EC_number="2.5.1.3"
FT                   /note="KEGG: gdi:GDI1782 thiamine-phosphate
FT                   pyrophosphorylase; TIGRFAM: thiamine-phosphate
FT                   pyrophosphorylase; PFAM: thiamine monophosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ACI49814"
FT                   /db_xref="GOA:A9HI58"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022998"
FT                   /db_xref="InterPro:IPR036206"
FT                   /db_xref="UniProtKB/TrEMBL:A9HI58"
FT                   /protein_id="ACI49814.1"
FT                   /translation="MSLASRIYPVVDRADWIDRLGGAGARLIQLRVKDLQGAALLAEIR
FT                   AAKAHAARHGVTLVLNDYWRLALDEGIDFIHLGQEDLDTADVAAIRAGGIRLGVSTHST
FT                   DELDRALSVAPDYVALGPVWPTKLKKMPWAPQGVERLAEWKRLVGPVPLVAIGGITLAR
FT                   AASCIAAGADCVSAVSDFTGQPDPEAQVRAWLAATGDMT"
FT   gene            14442..17066
FT                   /locus_tag="Gdia_0013"
FT   CDS_pept        14442..17066
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0013"
FT                   /product="cyclic nucleotide-regulated Na/H exchanger"
FT                   /note="PFAM: cyclic nucleotide-binding; sodium/hydrogen
FT                   exchanger; KEGG: gdi:GDI1784 putative Na+/H+ antiporter"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ACI49815"
FT                   /db_xref="GOA:B5ZJ37"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018422"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZJ37"
FT                   /protein_id="ACI49815.1"
FT                   /translation="MAVTGLAAVLLAIAVLLVIVSAVQPIARRLELSETVLLAVVGILL
FT                   GGSADLVLRSSYTDLFNGAAETLLDFPLNSEAFLLIFLPALVFQGALAIDVRRLAHETA
FT                   TVLLLAVVAVVVSTATIGLALFPFASLPLSVCLLLGSIVATTDPSAVAGIFRDIGATSR
FT                   LTRLVEGEALLNDAAAISIFSILLTAVTSHHPIAPGAALMDFTLAFSGALVMGVLFGRL
FT                   TLLLITMLGAAPAAEITLTVALPYIVYIVCDEFLGFSGVVATATAGLTLSVYGPSTFRP
FT                   QTWRFLNELWQQLVFWAGSLVFVLASMLVPRLLVGMTRWDCVLILIATGAGLLARGAVV
FT                   FGLLPVLAATRLSPPVPNPFKVTMVWGGLRGAITLALALAVTENEHVATPVAHFIGIIA
FT                   TGFVLITLFVNGTTLRYLVVFLKLDQLSPIDQALRHQVLGIGLGEVRDRTHEMAEELGF
FT                   SRAVAGNVMSMLDRRVAEEEQANTFDTALADRQRVTLALIVVANKERSILLDLFRIQGL
FT                   SRPVMETLLRSAEAMVDGARLEGRFGYVRALRRRLRPSMRFRLAQVIHHRFHFDQPLMS
FT                   CMTERFEMLMISYFVSLSLIRFMRTRMEATLGSRISEIVGEVLERQRKLLNEALQTLRL
FT                   HYHGYSEALESRLLQQVALRLEGEEYDALMSESLISEELHRELSRDVERRRGQLDFKLT
FT                   FNIKAGIEARLRSLPVFHGLPDEALHALAPQMSIHFTSPGERLYHRGRKVRIVYFISAG
FT                   VTETHYAEHDVRFGAGDVLGADEALSGERVHAVSRSLQFGHFLTMSARRFRRLVAEYPV
FT                   IQHNLAELARARETSERSEVQLVPTDGDNTVAPSDEAIALATASLSDALPATMGQDSPP
FT                   SGG"
FT   sig_peptide     14442..14510
FT                   /locus_tag="Gdia_0013"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.993) with cleavage site probability 0.945 at
FT                   residue 23"
FT   gene            17150..17605
FT                   /locus_tag="Gdia_0014"
FT   CDS_pept        17150..17605
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0014"
FT                   /product="(2Fe-2S)-binding domain protein"
FT                   /note="PFAM: ferredoxin; [2Fe-2S]-binding domain protein;
FT                   KEGG: gdi:GDI1785 putative isoquinoline 1-oxidoreductase
FT                   subunit alpha"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ACI49816"
FT                   /db_xref="GOA:A9HI66"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR002888"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR036884"
FT                   /db_xref="UniProtKB/TrEMBL:A9HI66"
FT                   /protein_id="ACI49816.1"
FT                   /translation="MLTLQVNGAAHQVDVPDDMPLLWVLRDVLGLPGTKFGCGIGECGA
FT                   CTVHVDGRPVRACSLPVSLVGARPVTTIEGLSDDPLATGVRQAWLEIDVVQCGYCQTGQ
FT                   IMAAVALLKANPHPTDEEIEQAMAGNICRCGTYRRIRAAIRNAAGAA"
FT   gene            17605..19752
FT                   /locus_tag="Gdia_0015"
FT   CDS_pept        17605..19752
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0015"
FT                   /product="aldehyde oxidase and xanthine dehydrogenase
FT                   molybdopterin binding"
FT                   /note="PFAM: aldehyde oxidase and xanthine dehydrogenase
FT                   molybdopterin binding; KEGG: gdi:GDI1786 putative
FT                   isoquinoline 1-oxidoreductase subunit beta"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ACI49817"
FT                   /db_xref="GOA:A9HI68"
FT                   /db_xref="InterPro:IPR000674"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR008274"
FT                   /db_xref="InterPro:IPR012368"
FT                   /db_xref="InterPro:IPR037165"
FT                   /db_xref="UniProtKB/TrEMBL:A9HI68"
FT                   /protein_id="ACI49817.1"
FT                   /translation="MGRTMLSRRQALAGTGGLLLAAMLPRGAARAATRIVEDQTGPFAP
FT                   NAFVRIAPDGAITLILPNVEMGQGIYTGEAMLIAEELDIGLEQIQIEAAPPDDAYVTRE
FT                   LGTQATGGSTSTIATWKSLREAGAVARTLLVQAAAAQWSVDPASCTTGGGMVRHEATGR
FT                   SLAYGELATAAAALPVPAAPVTLRDPSSFRLVGRSQHRLDAPAKVAGTATFGIDVQVPG
FT                   MRIGTVAACPVMGGVLAHVDDSAARQVPGVRDVLTIGNAVCVVGNHFWAARKGLDALVI
FT                   TWDEGVNAAVSTDTIYRQLHEALDGPAITAHAKGDARAAIAGATTRVEAVYQQPLLAHA
FT                   PMEPINCTVQVTPERCDIWVGSQVPMRARDAAADITGLGKDRVHVHNQYIGGGFGRRLE
FT                   HEYVIQAVQFARQVAYPLKIVWTREEDLTLDRFRPAYVDRLVGGLDRKGNLVGLSHRIV
FT                   GPAVVARWAPEALLPNGVDDDLLAATVETPYAIPAMFLDYARREAPGVVTAWWRGVGGT
FT                   RGVFVVESFIDELAARAGKDAVAFRRQMTGGNPRARAVLDLAAEKASWGEPLPKHVGRG
FT                   IALQYVFGSYLATVMEVDMSDMDTVRVLRAVVAVDCGRMVNPDQVVSQIEGGLIFGISA
FT                   ALFNEVTLRDGRVQETNFHSYRVLRMNESPMIEVHLVNSTEDPGGIGETGTAAAAAALA
FT                   NAMAAATGRRYRRLPLTGPQA"
FT   sig_peptide     17605..17700
FT                   /locus_tag="Gdia_0015"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.958 at
FT                   residue 32"
FT   gene            19749..21011
FT                   /locus_tag="Gdia_0016"
FT   CDS_pept        19749..21011
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0016"
FT                   /product="Gluconate 2-dehydrogenase (acceptor)"
FT                   /EC_number="1.1.99.3"
FT                   /note="KEGG: gdi:GDI1787 alcohol dehydrogenase cytochrome c
FT                   subunit precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ACI49818"
FT                   /db_xref="GOA:B5ZJ40"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR014353"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZJ40"
FT                   /protein_id="ACI49818.1"
FT                   /translation="MRAVRAVLALVTLGVATGGVAQAQDQAQVQAQDSDLVRRGAYLEH
FT                   AADCEVCHTKPGGRPFAGGRAFDLPGIGTIYAPNITPDRETGIGAYTDAQFDSAVRAGV
FT                   APGWTHLYPVMPYASYARMTADDVRAIRAYLATLAPVHATARANRVRFPYSIRLAMVAW
FT                   NLLYRPSSAMMDEPGRSAAWNRGRYLVEAAGHCAECHSPRTMMQATSGARSYAGALTAG
FT                   WEAYNISSDPDSGIGAWTDAQLTAYLSTGHADGRGTAAGPMAEVVGYSLRYLTPQDIAS
FT                   MVTYLRSLPARQSNETVAAIPPQALAHATPTHSNGERLFAGACAGCHLTDGQGRQVDEA
FT                   ALWGARSLGEIQGRNLIQTMVQGSRLDTARGVMTMPAFGPEYRDQDLADLANYTIGHFA
FT                   NRVGHVTAQDIAAVRQPGGAH"
FT   sig_peptide     19749..19820
FT                   /locus_tag="Gdia_0016"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.997 at
FT                   residue 24"
FT   gene            complement(21058..21132)
FT                   /locus_tag="Gdia_R0001"
FT                   /note="tRNA-Met6"
FT   tRNA            complement(21058..21132)
FT                   /locus_tag="Gdia_R0001"
FT                   /product="tRNA-Met"
FT   gene            21308..22486
FT                   /locus_tag="Gdia_0017"
FT   CDS_pept        21308..22486
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0017"
FT                   /product="MscS Mechanosensitive ion channel"
FT                   /note="PFAM: MscS Mechanosensitive ion channel; KEGG:
FT                   gdi:GDI1788 putative mechanosensitive ion channel"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ACI49819"
FT                   /db_xref="GOA:B5ZJ41"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZJ41"
FT                   /protein_id="ACI49819.1"
FT                   /translation="MKDAFIDLLTDIRKSFGWLPGSVASVLVLCAAAVMAELCSRVVTK
FT                   LILRIPGQKRGAFVRTFTLAMQRPARVMLAIIFVGTALPASGLSYETMHRAAHGLLVLF
FT                   VLMVGYAAIVAMRILSDAYLLRINGKEDRDDILSRTHMTQVRVLRRMADILVGLLTVGS
FT                   ALMTFESVREYGLSLFASAGAASVVVGLAARPLLTNLIAGMQIAMTQPIRMEDLIIING
FT                   DWAWVEEITATYVVLRVWDWRRHIVPISWFLENPFQNWTHNSAALIGVVFLYVDFHAPM
FT                   DRIRGRLRDIVQASPLWDGKVFDVQVSDCSTQVMTIRVIASARSAMQSWDLRCEIREKI
FT                   ILFLRDECPEALPRERMAHVSSPAGQDVLGPHGILSPPIDRPPPGAYTGPPG"
FT   sig_peptide     21308..21418
FT                   /locus_tag="Gdia_0017"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.721) with cleavage site probability 0.700 at
FT                   residue 37"
FT   gene            complement(22487..24019)
FT                   /locus_tag="Gdia_0018"
FT   CDS_pept        complement(22487..24019)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0018"
FT                   /product="amino acid permease-associated region"
FT                   /note="PFAM: amino acid permease-associated region; KEGG:
FT                   gdi:GDI1789 putative cationic amino acid transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ACI49820"
FT                   /db_xref="GOA:B5ZJ42"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZJ42"
FT                   /protein_id="ACI49820.1"
FT                   /translation="MSLISFSSKRLRLRKSIQQIESESQNHGLRRTLGPVQLMMLGIGS
FT                   TIGAGIYVMTGTAAATYAGPAILLSFLVAGLACLFTAFSYGELASTMPVSGSAYSYAYV
FT                   SMGEGVAWAVGWLLLLEYGISCAGVAAGFSGYATSLLHDLGVHVPSFLCTTLVQTVPTP
FT                   HGASLLVAPRMDLVGAVSVLVVTGLLVLGVEESARINTLIVFVKVGVLMLFMAFGIRYV
FT                   HLSNLNPFIPPRENGFHYGVPGIFRAASVIFFAYVGFETVSTASAEARNPRRDVPLGII
FT                   GSLLICTLVYICVATVLIGVVPFRQLGVADPLAIAVDAIGQPWLAIMIKVGAVVGLCSV
FT                   ILGLLYGQTRIFFTIARDGLLPPIFCRLHPTFRTPWVGTIVLGVLVAVATATLPIDIIS
FT                   DLVSLGTATAFGIVCFTVIWQRNARPDLHRPFSVPLGGVKVGGVWIGVAPALGILFCLI
FT                   MAGPLFVDMIRALTNGDPLPAILLGSYIVLGVLSYAFYGHSHSRLGREEVAL"
FT   gene            complement(24179..24967)
FT                   /locus_tag="Gdia_0019"
FT   CDS_pept        complement(24179..24967)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0019"
FT                   /product="putative acetylhydrolase"
FT                   /note="KEGG: gdi:GDI1790 putative acetylhydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ACI49821"
FT                   /db_xref="GOA:A9HI78"
FT                   /db_xref="InterPro:IPR013830"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="UniProtKB/TrEMBL:A9HI78"
FT                   /protein_id="ACI49821.1"
FT                   /translation="MIRRLTARSLLALPLLLLAGLGTARATPPNLAVQPVSRMDTPWWR
FT                   QRFADKQAEIAHGRFDLVWLGDSITQNWERTGPEPWRQFAPVWQHYYGDRHAINLGFKG
FT                   DSTCHVLWRLDHGELDFRPPPRLFVVLVGANNFGHVHIDAGHTYPGITRIVDQIHGRFP
FT                   AAQVLLLEVLPSIRTAWITANTQRLNAMLRADIRRDRPWLHLQDVGAALERNGAPDPTR
FT                   FLDPHLTPPDPPLHPSAAAQQDIARMIEPTVAAILGDHPH"
FT   sig_peptide     complement(24887..24967)
FT                   /locus_tag="Gdia_0019"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.975 at
FT                   residue 27"
FT   gene            complement(24982..25824)
FT                   /locus_tag="Gdia_0020"
FT   CDS_pept        complement(24982..25824)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0020"
FT                   /product="Bacitracin resistance protein BacA"
FT                   /note="PFAM: Bacitracin resistance protein BacA; KEGG:
FT                   gdi:GDI1791 putative undecaprenyl-diphosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ACI49822"
FT                   /db_xref="GOA:A9HI81"
FT                   /db_xref="InterPro:IPR003824"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9HI81"
FT                   /protein_id="ACI49822.1"
FT                   /translation="MTLIQAIVIAILQGATELFPVSSLGHAVIVPALLGWAFDPHGEIF
FT                   LPFLVMLHLGTAIALLVYFRNDWAAIFQGLRGRDGSQRQAESIHILALLVVATIPAVII
FT                   GGLLEHWLRALFGTARYAAIFLFLNGLLLLLTERMKSRQPVQGGYAIASLTYADAAIIG
FT                   LWQCLAFLPGISRSGATIIGALFRGLNHEGAARFSFLMAQPVIIAATVREALHMRHVAI
FT                   PPGQMQVATIGAMVAAVTALASTAFLMRYFHNHERWALSPFGYYCVLAGAVSFFILGH"
FT   gene            25939..26406
FT                   /locus_tag="Gdia_0021"
FT   CDS_pept        25939..26406
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0021"
FT                   /product="Mammalian cell entry related domain protein"
FT                   /note="PFAM: Mammalian cell entry related domain protein;
FT                   KEGG: gdi:GDI1792 putative toluene tolerance protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ACI49823"
FT                   /db_xref="InterPro:IPR003399"
FT                   /db_xref="UniProtKB/TrEMBL:A9HI83"
FT                   /protein_id="ACI49823.1"
FT                   /translation="MARENGSAIVFSGLVLLVAGAFYAYARASQVDLGNDRYALSARFI
FT                   SANGLHVGAEVQLAGVPVGRVTAIALDPATAMANVGFTLDRDLSLPADSGVMIGSATMT
FT                   GDDALMVVPGKAPARLPPGAVITNAQEAVSLEQQVSNYIFGNGGLPSDSMQ"
FT   sig_peptide     25939..26019
FT                   /locus_tag="Gdia_0021"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.886 at
FT                   residue 27"
FT   gene            complement(26417..27526)
FT                   /locus_tag="Gdia_0022"
FT   CDS_pept        complement(26417..27526)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0022"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gdi:GDI1793 putative exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ACI49824"
FT                   /db_xref="GOA:A9HI86"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="UniProtKB/TrEMBL:A9HI86"
FT                   /protein_id="ACI49824.1"
FT                   /translation="MNHAPTAASSRAKTGGDAARQPAPLSMFEFWPGWAIYTPVVLYWI
FT                   LLGLWHRDFSLPTAANPRILTGGLCGESKTSILDMAGETARRWIAPYVSVTTGSADDGA
FT                   AALAALDRGGLALPVVVKPDIGCNGAGVKLVTTPDELVAAVALYPPDTPLVMQRLIPFE
FT                   HEAGVFYIRHPDEDRGRISSLTYKEAPVIVGDGRSTVRQLIDADARTRLVPHLYLPRLG
FT                   DRVHEVLPAGMPLRLVFAGNHSKGSIFRNGADDITPALVEQIDRIMQDIPDFHFGRIDL
FT                   KFESIAALRLGRGFEIIEINGVGSEATHIWDSRTTLREAYAAQFTHYRETFRIGAKKKK
FT                   AGWRTSGAFTMLHYWRQQRRLLASYPLND"
FT   gene            complement(27523..28098)
FT                   /locus_tag="Gdia_0023"
FT   CDS_pept        complement(27523..28098)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0023"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gdi:GDI1794 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ACI49825"
FT                   /db_xref="GOA:A9HI87"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="UniProtKB/TrEMBL:A9HI87"
FT                   /protein_id="ACI49825.1"
FT                   /translation="MFPSLPDLLAAAGTSPVIQALAIIIGTFILEDAATILTAMEVQTG
FT                   QIAIPVALVALYVGIVVGDLGLYGLGRLAALWPPARRWVAVPQDGNGQTWFGRNVFRIV
FT                   FVSRFIPGARLPLYTACGFFGASVGRFALAAVLATLIWTTLLFAVSLQVGHFLIDHLGE
FT                   WKWLGMGGFVLTIILVGRIVASVRSPSR"
FT   gene            28394..29386
FT                   /locus_tag="Gdia_0024"
FT   CDS_pept        28394..29386
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0024"
FT                   /product="lytic murein transglycosylase"
FT                   /note="TIGRFAM: lytic murein transglycosylase; KEGG:
FT                   gdi:GDI1795 putative membrane-bound lytic murein
FT                   transglycosylase B precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ACI49826"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR011970"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR031304"
FT                   /db_xref="UniProtKB/TrEMBL:A9HI90"
FT                   /protein_id="ACI49826.1"
FT                   /translation="MIRRRDFLMSASATCAAGGIGMAASARADSAPAASYAAFLAGVRA
FT                   EAVSHGLSAAIVDRALALEAPNARVLQLDQHQPEFTLTWAQYRQRVLTPKKVADGRVAA
FT                   GARRALLAEVGRHFGVDPQPLMGIWGLESAYGTRTGTFQIPDALATLAYDGRRASFFRG
FT                   ELMNALRILDHGDVTPDSMTGSYAGAMGQPQFMPSAYLRYAVDYTGSGRRDIWTSEPDV
FT                   FASIANYLARCGWSAGEPWGQEISVPTRLAQADLGRGRVRTLADWMAQGVRRLDGRRFS
FT                   RPDISGAVIRPDGPGGEAFMVYRNFSVIRRYNPSDFYALAVGLLGHDVT"
FT   sig_peptide     28394..28480
FT                   /locus_tag="Gdia_0024"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.984 at
FT                   residue 29"
FT   gene            29410..30249
FT                   /locus_tag="Gdia_0025"
FT   CDS_pept        29410..30249
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0025"
FT                   /product="Rare lipoprotein A"
FT                   /note="PFAM: Rare lipoprotein A; Sporulation domain
FT                   protein; KEGG: gdi:GDI1796 putative rare lipoprotein A
FT                   precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ACI49827"
FT                   /db_xref="GOA:A9HI92"
FT                   /db_xref="InterPro:IPR007730"
FT                   /db_xref="InterPro:IPR009009"
FT                   /db_xref="InterPro:IPR036680"
FT                   /db_xref="InterPro:IPR036908"
FT                   /db_xref="UniProtKB/TrEMBL:A9HI92"
FT                   /protein_id="ACI49827.1"
FT                   /translation="MAALGLLGCHRAEPGLPPAAPHYVVGAPYQMDGVWYYPHEDFSYQ
FT                   ATGLAVADPDRTPYVTADGEHYSPDALTGRHATLQLPAIVTVRNLENGREITIRVNDRG
FT                   PDSPGRLIGLSPRAAALLGIGSNPVRVAVTGLEAQNEQLAEGLPGTQHLDIAAAPAGQV
FT                   RAESLDHPGSGATIVGAPGGTVGAADISALMGDLPPSVRQGYVVGGLLWVDAGTFSTLR
FT                   YAELSAARTGGRVVPVQEHGRALWRVHVGPFMNATDADRALDQLMGAGVTGARIVVE"
FT   gene            30279..31520
FT                   /locus_tag="Gdia_0026"
FT   CDS_pept        30279..31520
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0026"
FT                   /product="Serine-type D-Ala-D-Ala carboxypeptidase"
FT                   /EC_number="3.4.16.4"
FT                   /note="PFAM: peptidase S11 D-alanyl-D-alanine
FT                   carboxypeptidase 1; Penicillin-binding protein 5 domain
FT                   protein; KEGG: gdi:GDI1797 putative penicillin-binding
FT                   protein 5 precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ACI49828"
FT                   /db_xref="GOA:B5ZJ50"
FT                   /db_xref="InterPro:IPR001967"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR012907"
FT                   /db_xref="InterPro:IPR015956"
FT                   /db_xref="InterPro:IPR018044"
FT                   /db_xref="InterPro:IPR037167"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZJ50"
FT                   /protein_id="ACI49828.1"
FT                   /translation="MAGTASLAATGSLAVAAPRRHHAHGAPSPQPAPTGGANAEDGTDA
FT                   ADAAAPAGPPAATPIGPLDTVARWACILDVTTGSVLLEKAADERMPPSSLTKMMTAYIV
FT                   FGMLKSGRLKLDQMLPVSEKAWRMQGSKMFVPLGQSIAVQDLIQGMVIQSGNDACIVLA
FT                   EGVAGSEEQFVAQMNDMAARIGLSNSHFMNATGWPADNHYMSARDVAQLAVRLIRDFPE
FT                   YYHFFSEKDYRFNKISQGNRNVLVDKGLADGLKTGHTDAGGFGLCASADRGGNRVVLSL
FT                   NGMPSSNARAHEGERLLEWSFANFENATLFRKGDIVEQASVWLGTQPTVPLVATRDIVM
FT                   TLPHGWRSRAHIGVDYQAPVAAPVAAGQVLGDLVISNPGLADIRMPLVAGQGVPRLGLF
FT                   ARASAVLGQKLGRH"
FT   sig_peptide     30279..30329
FT                   /locus_tag="Gdia_0026"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.883) with cleavage site probability 0.492 at
FT                   residue 17"
FT   gene            31526..32173
FT                   /locus_tag="Gdia_0027"
FT   CDS_pept        31526..32173
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0027"
FT                   /product="dTMP kinase"
FT                   /EC_number="2.7.4.9"
FT                   /note="PFAM: thymidylate kinase; KEGG: gdi:GDI1798 putative
FT                   thymidylate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ACI49829"
FT                   /db_xref="GOA:A9HI97"
FT                   /db_xref="InterPro:IPR018094"
FT                   /db_xref="InterPro:IPR018095"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR039430"
FT                   /db_xref="UniProtKB/TrEMBL:A9HI97"
FT                   /protein_id="ACI49829.1"
FT                   /translation="MAGLFITFEGGEGAGKSTQAQRLEAHLRAAGREVVRTREPGGTPG
FT                   AEALRQLLLFGGHDLSLRAEILAHFAARCDHVDQLIRPALARGAVVICDRFIDSTLAYQ
FT                   GYGLGRADPGILHLIAVLGAQVGLAPDLTLVLMLERAGALARLRARGGPADRYEAADEA
FT                   FHARVADGFDTIARAEAGRCVTIAADRPVDVVAGDIARLVDARLETDAPGAA"
FT   gene            32154..33125
FT                   /locus_tag="Gdia_0028"
FT   CDS_pept        32154..33125
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0028"
FT                   /product="DNA-directed DNA polymerase"
FT                   /EC_number="2.7.7.7"
FT                   /note="KEGG: gdi:GDI1799 putative DNA polymerase III delta'
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ACI49830"
FT                   /db_xref="GOA:B5ZJ52"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZJ52"
FT                   /protein_id="ACI49830.1"
FT                   /translation="MPPAPRDAPDLVGQQEARRAFEDALRTGRLHHAWLLTGTEGIGKA
FT                   TMAFWMARLLLKGTDPDSPAARRIAAGSHADLLTIARGVDEKRQRLRAEIVADDVRPIG
FT                   QFLHRTAAEDGWRVVIVDGAEYMNRSAANAILKLLEEPPPRAILILTCATPGRLLPTIR
FT                   SRCRTLKLGPLSPADMHAVLSTVVEDAAPDDIARVVPLAHGSPGRALALLAGDGGALGA
FT                   LVARVMDAPAGPGAMREGEMYEIAEAVLKRENGFSVFFDLLCDAISVRTRAAVRGTIPA
FT                   ERPADRMVDLWRRLVHLRAETEQFNLDKHQAILSGLTLVSGI"
FT   gene            33122..34660
FT                   /locus_tag="Gdia_0029"
FT   CDS_pept        33122..34660
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0029"
FT                   /product="methionyl-tRNA synthetase"
FT                   /note="TIGRFAM: methionyl-tRNA synthetase; PFAM: tRNA
FT                   synthetase class I (M); KEGG: gdi:GDI1800 methionyl-tRNA
FT                   synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ACI49831"
FT                   /db_xref="GOA:A9HIA3"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014758"
FT                   /db_xref="InterPro:IPR015413"
FT                   /db_xref="InterPro:IPR023457"
FT                   /db_xref="InterPro:IPR033911"
FT                   /db_xref="InterPro:IPR041872"
FT                   /db_xref="UniProtKB/TrEMBL:A9HIA3"
FT                   /protein_id="ACI49831.1"
FT                   /translation="MTRRYYVTTPIYYVNGAPHIGHAYTSVAADIVARFKRLAGFDVFF
FT                   LTGTDEHGQKVEQAAQAAGLAPIAFADRVSADFRAMYDVMNVSYDDFIRTTEPRHIAGA
FT                   TALWERIAANGHIYLGAYEGWYALRDESFYNEDELVTQPDGTRVAPTGAPVEWVREPSY
FT                   FFRLSAFADRLLDLYETRPGFVEPASRRNEVASFVRQGLRDLSISRTSFRWGIPVPGDA
FT                   DHVMYVWVDALANYLSAIGFPDARNPRAGFWPANLHLVGKDIVRFHAIYWPALLMAAGL
FT                   DLPDCVFSHGWWTIEGEKMSKSLGNVVDPRDLVAEFGLDPVRFFLMREMPFGGDSDLSR
FT                   KAIINRMNVELANDLGNLAQRTLSQVARNCGGLLPEQGTRTDDDIALLAQADLLPTLMH
FT                   EQIDRRALTDALEEVWRVIRACNAYIDRQAPWALKKTDPDRMAVVLRVLVDALRGIGTM
FT                   LQPYMPGSMDALLTQLGVAEDERDFASLATPLPGGRALPPPQGIFPRYVEAEAQ"
FT   gene            34657..35448
FT                   /locus_tag="Gdia_0030"
FT   CDS_pept        34657..35448
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0030"
FT                   /product="hydrolase, TatD family"
FT                   /note="TIGRFAM: hydrolase, TatD family; PFAM: TatD-related
FT                   deoxyribonuclease; KEGG: gdi:GDI1801 putative
FT                   deoxyribonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ACI49832"
FT                   /db_xref="GOA:A9HIA6"
FT                   /db_xref="InterPro:IPR001130"
FT                   /db_xref="InterPro:IPR015991"
FT                   /db_xref="InterPro:IPR018228"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:A9HIA6"
FT                   /protein_id="ACI49832.1"
FT                   /translation="MTGLIDSHCHLDHFTDDEIPDLLDRARQAGVEGMVTIGTRLSRAA
FT                   QQKDLTRFSRPDLRVWCTVGTHPDHVDECTVADAAGIVALADDPRVVGIGETGLDYFHG
FT                   AESVRPLQQARFRAHIAAARQMDLPLVIHARDADEDVAEILRDEVESHGPFRFLLHCFA
FT                   SGPDLARVGLELGGYVSFSGILTFPKSDALRAVARDIPQDRLLVETDSPYLAPVPQRGR
FT                   KNEPGFVAHTARRLAEVRDMTPESLAEVTTANFHRLFSRAA"
FT   gene            35452..36240
FT                   /locus_tag="Gdia_0031"
FT   CDS_pept        35452..36240
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0031"
FT                   /product="beta-lactamase domain protein"
FT                   /note="PFAM: beta-lactamase domain protein; KEGG:
FT                   gdi:GDI1802 putative beta-lactamase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ACI49833"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZJ55"
FT                   /protein_id="ACI49833.1"
FT                   /translation="MELIVLGCGGSAGVPMIGGPDGAGDWGVCDPAEPRNRRTRASVLL
FT                   RGGDGAVLLDTGPDLRDQLLAQRIDRFDAILYTHAHADHIAGLDEVRAINRVIDRPLPV
FT                   YGTPPVLTDLENRFNYAFRPWSPPGFYRPVVVPHVVHAGQTLEVAGLHLRLFEQIHGRT
FT                   LSLGVRCGTIAYSTDVVELPDEAFAALAGIETWVVDCFQRSAAHSAHAWLDRVLEWRAR
FT                   IAPRRVILTHMGPDMDWAWMRANLPDGVEAAFDGMRVAFH"
FT   gene            36640..38586
FT                   /locus_tag="Gdia_0032"
FT   CDS_pept        36640..38586
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0032"
FT                   /product="putative serine protein kinase, PrkA"
FT                   /note="PFAM: PrkA serine kinase; PrkA AAA domain protein;
FT                   KEGG: gdi:GDI1803 PrkA serine protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ACI49834"
FT                   /db_xref="GOA:B5ZJ56"
FT                   /db_xref="InterPro:IPR010650"
FT                   /db_xref="InterPro:IPR013153"
FT                   /db_xref="InterPro:IPR016230"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZJ56"
FT                   /protein_id="ACI49834.1"
FT                   /translation="MVSDINVFSLATAMRDQRREVEMSLSDYLEQCRTDPSCYATAAER
FT                   MLKAIGEPRTVDTSRDPRLSRIFMNRTLRIYPAFSDFYGMEETIEQIVGFFRHAAQGLE
FT                   ERKQILYLLGPVGGGKSSLGERLKALMEKEPIYVLKAGRHISPVFESPLGVFDPDRMAG
FT                   VLEERYGIPRRLLGGVASPWALKRLEEFDGDLSRFSVVKLHPSRLRQIAIAKTEPGDDN
FT                   NQDVSALVGKVDIRQLEHFSQNDPDAYSFSGGLNRANQGLLEFVEMFKAPIKMLHPLLT
FT                   ATQEGNYVGTENIGSIPFTGVILAHSNEAEWQTFRNNRTNEAFLDRVCVIKVPYCLRVT
FT                   EETRIYEKLVQSSSLAEAPCAPNTLEMLARFAVLSRLKPHPNSAQFAKMRVYDGENIRE
FT                   TDPKARTMQEYRDAAGVDEGMDGISTRFAYKVLSATFNHDSAEISADPVHLMYVLEQAV
FT                   RREQFPPEVEATYLATLKSELAGRYAEFLGHEIQKAYLESYNDYGQNLFDRYLDYADAW
FT                   IEDQDFKDPDTGQMLNRELLNAELTKIEKPAGIANPKDFRNEVVKFSLRARAGNGGRNP
FT                   SWTSYEKIRDVIEKRMFSQVEDLLPVISFGSKKDGETERKHDEFVERMVSRGYTERQVR
FT                   RLVEWYMRVKQSA"
FT   gene            38606..39913
FT                   /locus_tag="Gdia_0033"
FT   CDS_pept        38606..39913
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0033"
FT                   /product="protein of unknown function DUF444"
FT                   /note="PFAM: protein of unknown function DUF444; KEGG:
FT                   gdi:GDI1804 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ACI49835"
FT                   /db_xref="InterPro:IPR006698"
FT                   /db_xref="UniProtKB/TrEMBL:A9HIB4"
FT                   /protein_id="ACI49835.1"
FT                   /translation="MDIIDRRPNPHGKNIENRRRVLQRARAAVQKAVRDSVARGKIREV
FT                   GQGNAVSIPSDALHEPTFHRVFSEGVREIVLTGNREFSRGDRLQRPPGGVGQGGGGEGQ
FT                   GGEKGGGEDSFRFVLSRDEFLDLFFDDLELPDLVKREIAATETSKPTRSGLSNEGAPSH
FT                   LDLGRTMRRSIARRIGLGRPKPDDLREIEARIAELEDRRPLGTEDLDELESLCERRGTL
FT                   RQRLARIPWVDPVDLRFRRYTVVPQPATRAVMFCIMDVSGSMTERMKDLAKQFFLLLHV
FT                   FLERRYKKVEIVFIRHAESAEEVDEETFFHDPRTGGTIVSSALELMSSIQRERFPSGSW
FT                   NIYVAQASDGDNASSDTTRTASLLRDEILPAVQYYAYIEITGSGAVIRGETDLWRSYRT
FT                   IADENDHLAIRQVGDRKEIFPVFRELFSRQHDTAEA"
FT   gene            39913..41481
FT                   /locus_tag="Gdia_0034"
FT   CDS_pept        39913..41481
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0034"
FT                   /product="SpoVR family protein"
FT                   /note="PFAM: SpoVR family protein; KEGG: gdi:GDI1805
FT                   putative stage V sporulation protein R"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ACI49836"
FT                   /db_xref="InterPro:IPR007390"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZJ58"
FT                   /protein_id="ACI49836.1"
FT                   /translation="MNQITPKGGGDGGGARPGGLLYSGNDWNFQILRDCYDAIAEIADK
FT                   ELGLELYANRIEIITSEQMLDVYTSHGMPLGYKHWSFGKRFIGHENAYRRGLMGLAYEV
FT                   VINSDPCINYLMEENSATMQALVIAHAAFGHNHFFRNNRLFREWTDPSEILDYLEFARG
FT                   FIARCEERHGVRAVERILDAAHALQNQGVHRHSGARKLDLKAEQQRARERRAYEDSMFN
FT                   DLWRTLPTEPAGEEGQAEGALARRLLGLPEENLLYFLEKNAPRLASWEREIIRIVRMVA
FT                   QYFYPQPQVKMMNEGCATWVHSYIMRRLHELGRIDDAAYLEVIHSTSNVISQPGFDAGG
FT                   GPSFNPYALGYAMMTDIARICETPTEEDRTWFPDIAGNGDPIGTLRHAWAEYRDESFIQ
FT                   QFLSPKVIRDFRMFRLRDDTSQPYLLVDAIHDEAGYRDIRRSVALTYDPGTFYTEIEIV
FT                   DVDLLGDRTLVLEHRSRTGQMLQPGDARQTLDYLALLWGYGVILKEIDSQTGTVVTTHS
FT                   AKPSA"
FT   gene            41667..42893
FT                   /locus_tag="Gdia_0035"
FT   CDS_pept        41667..42893
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0035"
FT                   /product="Amine dehydrogenase"
FT                   /EC_number="1.4.9.1"
FT                   /note="PFAM: methylamine dehydrogenase heavy subunit; KEGG:
FT                   gdi:GDI1806 putative methylamine dehydrogenase heavy chain
FT                   precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ACI49837"
FT                   /db_xref="GOA:B5ZJ59"
FT                   /db_xref="InterPro:IPR009451"
FT                   /db_xref="InterPro:IPR011044"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZJ59"
FT                   /protein_id="ACI49837.1"
FT                   /translation="MPSERRYGAIRPLAAPLTVAALLGAAILQPLVPPSGARAAEPILQ
FT                   TEESDIVTLPPGGPHRVLVQDGVYRHSKDGRVYVVDLDSGKLLGMVQAAYNANVAADPA
FT                   GRTFYVAETAWERGNRGRRHDMLVAYNPLTLEPTLDIDLPSRALITPKKADMAVSADGH
FT                   YVYVYDTSPTNSVHVFDAARKDVVRTVDVPGCALVYPWGGAGFSSICGDGSLANVALDK
FT                   TATPSLTHTAPFFVPDRDPVFEHSPQVAASGHVWFISYSGLVYDTTLGPQSKIGAPWSI
FT                   QAAAGLKPASDARAPFAVTWRPGGWQLAAVRARDSHLFILMHRGPFWTHKDAGTELWEL
FT                   DLKTRKLVRRIHLAAPSMMVGVTQDAASRIMLTDEAGDLTVLDGATGAPVRTIRNLGEA
FT                   LIFTVAPGE"
FT   sig_peptide     41667..41786
FT                   /locus_tag="Gdia_0035"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.967) with cleavage site probability 0.949 at
FT                   residue 40"
FT   gene            42890..43474
FT                   /locus_tag="Gdia_0036"
FT   CDS_pept        42890..43474
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0036"
FT                   /product="methylamine dehydrogenase light chain"
FT                   /EC_number="1.4.9.1"
FT                   /note="KEGG: gdi:GDI1807 putative methylamine dehydrogenase
FT                   light chain precursor; TIGRFAM: methylamine dehydrogenase
FT                   light chain; PFAM: methylamine dehydrogenase light chain
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ACI49838"
FT                   /db_xref="GOA:A9HIC0"
FT                   /db_xref="InterPro:IPR004229"
FT                   /db_xref="InterPro:IPR013504"
FT                   /db_xref="InterPro:IPR016008"
FT                   /db_xref="InterPro:IPR036560"
FT                   /db_xref="UniProtKB/TrEMBL:A9HIC0"
FT                   /protein_id="ACI49838.1"
FT                   /translation="MTRVTETRNDMERNGFDRLTERLARYLAGRSSRRGALARLGGWAA
FT                   SVPLFPLLPVWRGDARAADAPAAPSAAPSPFAAKAQAKDDTKCDYWRYCAIDGNLCTTC
FT                   GGGVHSCPPGTHPSPTSWIGTCFNPQDRRSYLIAYRDCCGQDACNEQNCLGTDGDLPTY
FT                   RPQANNDIIWCFGTGSLLYNCSTAAIVGTAE"
FT   gene            43471..43932
FT                   /locus_tag="Gdia_0037"
FT   CDS_pept        43471..43932
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0037"
FT                   /product="cytochrome c class I"
FT                   /note="PFAM: cytochrome c class I; KEGG: gdi:GDI1808
FT                   putative cytochrome c-552"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ACI49839"
FT                   /db_xref="GOA:A9HIC3"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:A9HIC3"
FT                   /protein_id="ACI49839.1"
FT                   /translation="MKKILTLAATLSLAGATTAFAAPDGQALYGANCGICHQGGGVGAP
FT                   GQFPPLANRIDKIASTPEGKKYVTQVLVNGLAGSIQAGGATYVGFMPSFKSLPDDQIAA
FT                   ILTYLSSLGSTKPAPVFAAADLAAARAAPMSSSAVAAARKTLNAAHPLP"
FT   sig_peptide     43471..43536
FT                   /locus_tag="Gdia_0037"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 22"
FT   gene            43910..44410
FT                   /locus_tag="Gdia_0038"
FT   CDS_pept        43910..44410
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0038"
FT                   /product="putative cytochrome c-552"
FT                   /note="KEGG: gdi:GDI1809 putative cytochrome c-552"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ACI49840"
FT                   /db_xref="GOA:A9HIC6"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:A9HIC6"
FT                   /protein_id="ACI49840.1"
FT                   /translation="MRRIPFRKSVWPVIAVLAVAGLLPPGPAARALDRTRTTYLTKCGG
FT                   CHGIEGQSGQTYIPTLRDRIGVLTCTAEGRSYLLEVPGVSMSLIRDDALMAQVMNFVLF
FT                   DLGGASTPRGTAPFTAREIHALRGHPLDTTDLPTVRAAVWARATAACAAQAGGHSGGRS
FT                   GTY"
FT   sig_peptide     43910..44005
FT                   /locus_tag="Gdia_0038"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.919 at
FT                   residue 32"
FT   gene            complement(44415..45011)
FT                   /locus_tag="Gdia_0039"
FT   CDS_pept        complement(44415..45011)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0039"
FT                   /product="nucleoside 2-deoxyribosyltransferase"
FT                   /note="PFAM: nucleoside 2-deoxyribosyltransferase; KEGG:
FT                   gdi:GDI1810 putative nucleoside 2-deoxyribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ACI49841"
FT                   /db_xref="GOA:A9HIC9"
FT                   /db_xref="InterPro:IPR007710"
FT                   /db_xref="UniProtKB/TrEMBL:A9HIC9"
FT                   /protein_id="ACI49841.1"
FT                   /translation="MGTNKTVYLAGDLVFRPGAIAIFDRLRVLCRAAGVEGVAPFDGQA
FT                   GIESLPPGPETMLKIVMADRALMDRCAGGIFCIDPFRRAADMDPGTAVEIGYMMAQGKP
FT                   LAGYTTDGRPYPEKVRAYRRAAWGDDLRPRVTHDAPVGSGAVEDSDGILAHSEGMLQNG
FT                   MVEGFIHLSGGHVAVRDDLFDAFRIAIAELARRLP"
FT   gene            45162..46664
FT                   /locus_tag="Gdia_0040"
FT   CDS_pept        45162..46664
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0040"
FT                   /product="inosine-5'-monophosphate dehydrogenase"
FT                   /EC_number="1.1.1.37"
FT                   /note="KEGG: gdi:GDI1811 inosine-5'-monophosphate
FT                   dehydrogenase; TIGRFAM: inosine-5'-monophosphate
FT                   dehydrogenase; PFAM: CBS domain containing protein; IMP
FT                   dehydrogenase/GMP reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ACI49842"
FT                   /db_xref="GOA:A9HID1"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR001093"
FT                   /db_xref="InterPro:IPR005990"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR015875"
FT                   /db_xref="UniProtKB/TrEMBL:A9HID1"
FT                   /protein_id="ACI49842.1"
FT                   /translation="MSSPHNPLSHPRVDDRIREALAFDDVLVVPAESNVLPGQTSTKSR
FT                   LTRRIGLNIPLISSAMDTVTEDAMAIAMAQQGGMGVIHKNLSVEEQAEQVRRVKRFESG
FT                   MVVNPVTVWPDQTLADVNAIMSRHGISGLPVIERETKRLVGMLTNRDVRFATDPALRVD
FT                   SLMTRENLVTVGADVGHDQARQLLHRHRIEKLLVVDDEGRCVGLITVKDIEKAVLHPLA
FT                   NKDEMGRLRCAAATGVGEDGFTRARALIEAGVDVVVVDTAHGHSSGVLDTVARVKAVDD
FT                   RIQVVAGNVATPEAAVALIEAGADCVKIGIGPGSICTTRVVAGVGVPQFSAVLETSAAC
FT                   HELDVPAIADGGIRTSGDIVKAIGAGADVVMIGSLLAGTEEAPGEVFLYEGRSYKSYRG
FT                   MGSLGAMARGSADRYFQQEIKETHKMVPEGIEGRVAYKGGMDAVVHQLVGGLRAGMGYT
FT                   GSATIADLQVRARFRRITGAGLRESHVHDVAITREAPNYRRD"
FT   gene            46675..47964
FT                   /locus_tag="Gdia_0041"
FT   CDS_pept        46675..47964
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0041"
FT                   /product="Fmu (Sun) domain protein"
FT                   /note="PFAM: Fmu (Sun) domain protein; KEGG: gdi:GDI1812
FT                   putative ribosomal RNA small subunit methyltransferase B"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ACI49843"
FT                   /db_xref="GOA:B5ZJ65"
FT                   /db_xref="InterPro:IPR001678"
FT                   /db_xref="InterPro:IPR018314"
FT                   /db_xref="InterPro:IPR023267"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZJ65"
FT                   /protein_id="ACI49843.1"
FT                   /translation="MTPSARLAAAIDLLSAMEATPRRPADAVANAFFRERRYIGGGDRR
FT                   AISARVWTVLRHWRHLAWWLDRAGAAATPRARLIAALALMPQPGEAPQDLFVSQDRYAP
FT                   QPLSAAERDLATRLRGQAMVHPDMPRAVRLEVPDWLLPRLEETFGADLDAEVAALAGEA
FT                   TLDLRVNLLKTTRAEAARLLAADGIMAEPTGLSPWGLRVPGRQPVTATAAFKSGLVEIQ
FT                   DEGSQIVVAAADARPGMRVLDYCAGAAGKTLGMAMTMENRGHIVACDVSEPRLEGAVRR
FT                   LRRAGVHNAERHLLVPGDRWARRRAASFDRVLVDAPCTGTGTWRRNPDARLRLTEQDLA
FT                   ELMAKQADILATASALVRPGGRLVYATCSILREENQDRIASFLRASPHFRRAETVPDLA
FT                   PDLAQDGMIALSPLRHGTDGFFAAILERTA"
FT   gene            48081..49904
FT                   /locus_tag="Gdia_0042"
FT   CDS_pept        48081..49904
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0042"
FT                   /product="sodium/hydrogen exchanger"
FT                   /note="PFAM: sodium/hydrogen exchanger; KEGG: gdi:GDI1813
FT                   putative cell volume regulation protein A"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ACI49844"
FT                   /db_xref="GOA:B5ZJ66"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZJ66"
FT                   /protein_id="ACI49844.1"
FT                   /translation="MQDNLAIGILCVLGGGIGAQWVAWRFRLPAIVLLFALGLLYGPGL
FT                   NLLHPSAAIGGYFHPIVSLAVAFIVFEGGLGLDFRQWRAAGEGVLRLTVVALPINWILG
FT                   ALAAHFVGHLHWGASWLFGAIIVVTGPTVVLPLLRHTKLRPRVAAFLRWEAILNDPVGA
FT                   ILATLVLEFLMIQGNRHSGMFMAEIVPHLLFATMMALGCGVFPAVLVRFLSTRDLIPEI
FT                   LRIPIILTLAMSVFAVCNFVMEGAGLMAATVFGMALTNMHVIGMSELRRIKESLGVLVV
FT                   SCLFVMLTADLHRAVLERLSLPIVAMTLTVLFVVRPVGILLSTIRANLSWQERLFVGWI
FT                   APRGIVAAAVAGVAGLQLQEAGYPSADLVTPGVFALIATTMILHGFSLRPLARALRLTL
FT                   SDEPALAIVGASAWSTDLAGVLHRLGCPVMLVDTYTGALAPASRAGIPILKAELLSDEG
FT                   LESLEERPADYLIAATPDAIYNGLVCARLAPDFGRQRVFQVSPGVARLDLYRGLSRDSR
FT                   GRVLGDPAWNFTLFDTLFERGWRFRSIPFAPPPAGGAAGGTPPPGEPLAEGNRLMIMTV
FT                   RKGVAIWIRSAEDEVPVEPLAGDTIIIMSPP"
FT   gene            complement(50073..50585)
FT                   /locus_tag="Gdia_0043"
FT   CDS_pept        complement(50073..50585)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0043"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gdi:GDI1814 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ACI49845"
FT                   /db_xref="GOA:B5ZJ67"
FT                   /db_xref="InterPro:IPR005490"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZJ67"
FT                   /protein_id="ACI49845.1"
FT                   /translation="MIRAVLKTNTGQDAQLHCMGERIPALIGAAGIRALKQEGDHATPT
FT                   GLLPLRRVLYRADRVPPPACRLPVEPLAPGDGWCDDPAHADYNRPVTLPHPARHERLWR
FT                   DDDVYNIVIVLGYNDAPPVPGRGSAIFLHLQSPDGRPTEGCIALRESDLRRLLAAGLTE
FT                   IEVPEPG"
FT   gene            50772..51488
FT                   /locus_tag="Gdia_0044"
FT   CDS_pept        50772..51488
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0044"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; KEGG: gdi:GDI1815 putative
FT                   DNA-binding response regulator MtrA"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ACI49846"
FT                   /db_xref="GOA:B5ZJ68"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZJ68"
FT                   /protein_id="ACI49846.1"
FT                   /translation="MAGARPILIVDDDQTLRHMLVEQLQLEGEFQAIEADSVADAWDKL
FT                   NAPGARFDAIILDVTLPDGDGRDFCAELRRQGKRIPIIILTGSDDETDVVRGLDAGAND
FT                   YVAKPFRIAELLARLRAQMRIFENSEDAVFSIGPYVFRPSAKLLQEPTRNRRIRLTEKE
FT                   AAILKFLYRAGTRPVPRQVLLNEVWGYNAAVTTHTLETHIYRLRQKIEPDPTNASLLVT
FT                   EGGGYRLDPEGGMRIA"
FT   gene            complement(51623..52435)
FT                   /locus_tag="Gdia_0045"
FT   CDS_pept        complement(51623..52435)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0045"
FT                   /product="exodeoxyribonuclease III Xth"
FT                   /note="TIGRFAM: exodeoxyribonuclease III Xth; PFAM:
FT                   Endonuclease/exonuclease/phosphatase; KEGG: gdi:GDI1816
FT                   putative exodeoxyribonuclease III protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ACI49847"
FT                   /db_xref="GOA:A9HIE6"
FT                   /db_xref="InterPro:IPR004808"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR020847"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="InterPro:IPR037493"
FT                   /db_xref="UniProtKB/TrEMBL:A9HIE6"
FT                   /protein_id="ACI49847.1"
FT                   /translation="MIGNATHMRIVTWNINSLRLRLPLLARLGAELRPDIICLQETKVP
FT                   DDLFPADAIRDLGYVHIQHRGMKSYNGVAILSRVPLTPLDDTPDWCARSDCRHIAASFP
FT                   MGGRPVELHNFYVPAGGDIPDPDANPKFAHKLAFVDEATSWFTGRTSHRTILVGDLNIA
FT                   PLEQDVWSHKQLLNVVSHTPPEVTRLMAWQACGFVDAMRHFVPPDEKLYTWWSYRNRDW
FT                   KASNRGRRLDHVWITPDLTAALKDMTVLREARDWPTTSDHVPVAMDFA"
FT   gene            52770..54659
FT                   /locus_tag="Gdia_0046"
FT   CDS_pept        52770..54659
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0046"
FT                   /product="excinuclease ABC, C subunit"
FT                   /note="TIGRFAM: excinuclease ABC, C subunit; PFAM:
FT                   Excinuclease ABC C subunit domain protein; excinuclease ABC
FT                   C subunit domain protein; UvrB/UvrC protein; KEGG:
FT                   gdi:GDI1818 putative UvrABC system protein C (protein UvrC)
FT                   (excinuclease ABC subunit C)"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ACI49848"
FT                   /db_xref="GOA:B5ZJ70"
FT                   /db_xref="InterPro:IPR000305"
FT                   /db_xref="InterPro:IPR001162"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR004791"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR035901"
FT                   /db_xref="InterPro:IPR036876"
FT                   /db_xref="InterPro:IPR038476"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZJ70"
FT                   /protein_id="ACI49848.1"
FT                   /translation="MDADVVPASSVKGVEAILLALQTMPLSPGVYRMLGEKGEVLYVGK
FT                   ARILKRRVTSYTHLSKLPERLRRMVSETVTMEIVTTHTEAEALLLEANYIKRMKPRFNI
FT                   LLRDDKSYPWIMLTDGAEFPQVTKHRGKPVKGASYWGPFASAWAVNQTLNLIQRVFLLR
FT                   TCSDSVFASRTRPCLLFQIKRCSAPCVARIGQAEYAHLVEQARAFLSGQRGGIREELVR
FT                   EMEAAAASLEFERAATIRDRIRGFAAMQDSSVINPASLDDADIVAIAQAAGHSCIQVFF
FT                   IRGGRNNGNRAFFPAHARDEAAPDIVGAFLAQFYDDKPPPAQILLNCEIAEHDLMADAL
FT                   GIKRGRKVEILVPKRGEKRAVVEHAETNAREALERKLAESTAQARLLEGMADLFGLDAP
FT                   PRRIEIYDNSHIMGTNAYGVMVVAGPEGFDKRSYRKFSIRGPITPGDDFAMMREVLERR
FT                   FSRALRERDDSAGASSPADWPDIVLIDGGAGQYSAVRAVLDELGVTDVTLVAIAKGPDR
FT                   DAGREWFHMADRPPFQLPPRDPVLYYLQRLRDEAHRFAITTHRAGRSKALVKSELDEIP
FT                   GVGAARKRALLNQFGSARGVRQAGLAELEATQGINRETARVVYGHFHPGWTGA"
FT   gene            54767..55363
FT                   /locus_tag="Gdia_0047"
FT   CDS_pept        54767..55363
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0047"
FT                   /product="CDP-diacylglycerol/glycerol-3-phosphate
FT                   3-phosphatidyltransferase"
FT                   /note="TIGRFAM: CDP-diacylglycerol/glycerol-3-phosphate
FT                   3-phosphatidyltransferase; PFAM: CDP-alcohol
FT                   phosphatidyltransferase; KEGG: gdi:GDI1819 putative
FT                   CDP-diacylglycerol--glycerol-3-phosphate
FT                   3-phosphatidyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ACI49849"
FT                   /db_xref="GOA:B5ZJ71"
FT                   /db_xref="InterPro:IPR000462"
FT                   /db_xref="InterPro:IPR004570"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZJ71"
FT                   /protein_id="ACI49849.1"
FT                   /translation="MLTDLPNILTLSRIVAIPVLVALVAIGAPVTDCAACLLFIAAGIT
FT                   DYLDGKLARAWHQYSDLGRMLDPIADKLLVGASLMMLAGCDRLPFGSLYPAIIILAREI
FT                   LISGLREFLASTRISLPVTRLAKWKTGIQMTAIGFLLAGDSTGRLLHLEWMHVGTVGAV
FT                   LLWIAAALTVLTGWDYLLTGLRHVGRNGGVSKIAP"
FT   gene            55381..55992
FT                   /locus_tag="Gdia_0048"
FT   CDS_pept        55381..55992
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0048"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gdi:GDI1820 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ACI49850"
FT                   /db_xref="UniProtKB/TrEMBL:A9HIF7"
FT                   /protein_id="ACI49850.1"
FT                   /translation="MLLEVAVRNGQTSSCRRTGLPRGRGTMRRTAVLSWLVLPLLVPQA
FT                   GCAGFGKLMADDATFPGANPNMPVGDAENLRRARGEAASDQPILPQGGNMWPGPPAPLP
FT                   TLGDASREHAGPDDGLPADATGSELPEGGTLSAGEQAEIRGGVQGISGTPPAVVHDDSA
FT                   RYRSGQAASTIVIPNGDGTSTIIAPDGTVKTVKDPPTVPR"
FT   gene            56012..56269
FT                   /locus_tag="Gdia_0049"
FT   CDS_pept        56012..56269
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0049"
FT                   /product="molybdopterin converting factor, subunit 1"
FT                   /note="TIGRFAM: molybdopterin converting factor, subunit 1;
FT                   PFAM: thiamineS protein; KEGG: gdi:GDI1821 putative
FT                   molybdopterin-converting factor subunit 1"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ACI49851"
FT                   /db_xref="InterPro:IPR003749"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR016155"
FT                   /db_xref="UniProtKB/TrEMBL:A9HIG0"
FT                   /protein_id="ACI49851.1"
FT                   /translation="MVTILYFAWLRDRLGRSGESIALPEGGCSVGELMQRLSVRDAAYG
FT                   QVFGPDGGPIRCAVNQEFASHADHVGPGDELAFFPPVTGG"
FT   gene            56273..56731
FT                   /locus_tag="Gdia_0050"
FT   CDS_pept        56273..56731
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0050"
FT                   /product="molybdopterin biosynthesis MoaE protein"
FT                   /note="PFAM: molybdopterin biosynthesis MoaE protein; KEGG:
FT                   gdi:GDI1822 putative molybdopterin-converting factor
FT                   subunit 2"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ACI49852"
FT                   /db_xref="GOA:A9HIG3"
FT                   /db_xref="InterPro:IPR003448"
FT                   /db_xref="InterPro:IPR036563"
FT                   /db_xref="UniProtKB/TrEMBL:A9HIG3"
FT                   /protein_id="ACI49852.1"
FT                   /translation="MRVDVRVQADPFSLDVETARLTRDGHDIGGMGMFLGVVRGGDGLA
FT                   ALTLEHYPGMTESMIARIVHEAGARFGLLACTVIHRVGRLEVGAPIVLVLCAAAHRGAA
FT                   LEATSFVIDWLKTRAPFWKREDRADGSSAWVEARESDEAAATRWGPVG"
FT   gene            56971..58968
FT                   /locus_tag="Gdia_0051"
FT   CDS_pept        56971..58968
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0051"
FT                   /product="ribonucleoside-diphosphate reductase, alpha
FT                   subunit"
FT                   /EC_number="1.17.4.1"
FT                   /note="KEGG: gdi:GDI1823 ribonucleoside-diphosphate
FT                   reductase large subunit; TIGRFAM:
FT                   ribonucleoside-diphosphate reductase, alpha subunit; PFAM:
FT                   ribonucleotide reductase large subunit; Ribonucleotide
FT                   reductase large subunit domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ACI49853"
FT                   /db_xref="GOA:A9HIG5"
FT                   /db_xref="InterPro:IPR000788"
FT                   /db_xref="InterPro:IPR008926"
FT                   /db_xref="InterPro:IPR013509"
FT                   /db_xref="InterPro:IPR039718"
FT                   /db_xref="UniProtKB/TrEMBL:A9HIG5"
FT                   /protein_id="ACI49853.1"
FT                   /translation="MTLDDVSGTVSDHSAGERDLFQDRDPAQSSGQPSSQQSSTPQSPA
FT                   QMQDMFDDVVQLPGHHPVRVNRSRDALLTPFGKATLDNRYLLEGESYQDLFGRVSSYYG
FT                   ADPGHAQRLYDYMSRHWFMPATPVLSNGGTTRGLPISCFLNEANDSLRGIVDLWNENVW
FT                   LASKGGGIGSYWGNLRSIGENVGRNGKTSGVIPFIRVMDSLTLAISQGSLRRGSAAVYL
FT                   PVWHPEIEEFIELRRPTGGDPNRKALNLHHGVLVSDAFMRAVAEDGEWALLSPKDGAHI
FT                   RKISARSLWIRILTARMEQGEPYIIYSDHVNNARPEHHKMAGLEVKTSNLCAEITLPTG
FT                   MDHHGNERTAVCCLSSLNLETWDEWKDDPRFIEDVMLFLDNVLQDFIDRAPDDMERAKY
FT                   AASRERSVGLGVMGFHSFLQANNIPFESVIAKVWNKRIFKHIREQADLASRKLAELRGP
FT                   CPDAAEYGFMERFSNKLAIAPTASISIIAGNASPGIEPIAANVFLQKTLSGSFTVRNRH
FT                   LLKLLIDKGQNTEEVWSSITLTKGSVQHLDFLTQQEKDVFKTAFELDQRWVVEHAADRA
FT                   GYICQAQSINLFLPADVHKRDLHQIHYLAWKRGVKSLYYCRSLSIQRADTVSNVLGKVD
FT                   VMADEPSAPAPAPASPPASSNNYDECLACQ"
FT   gene            58977..60038
FT                   /locus_tag="Gdia_0052"
FT   CDS_pept        58977..60038
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0052"
FT                   /product="Ribonucleoside-diphosphate reductase"
FT                   /EC_number="1.17.4.1"
FT                   /note="PFAM: ribonucleotide reductase; KEGG: gdi:GDI1824
FT                   putative ribonucleotide reductase small subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ACI49854"
FT                   /db_xref="GOA:A9HIG8"
FT                   /db_xref="InterPro:IPR000358"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012348"
FT                   /db_xref="InterPro:IPR033909"
FT                   /db_xref="UniProtKB/TrEMBL:A9HIG8"
FT                   /protein_id="ACI49854.1"
FT                   /translation="MTDITNATGTAPESAPQPTGVEARLDLLTSNPIYKPFRYPWAYDA
FT                   WLTQQRVHWLPEEVPLADDVKDWHRTLTESEQHLVTQIFRFFTQSDVEVNNCYMKHYSR
FT                   VFKPTEVLMMLSAFSNIETIHIAAYSHLLDTIGMPEMEYSAFLKYKEMKDKYDYMQGFS
FT                   VDSKPEIARTLAAFGAFTEGLQLFASFAILLNFPRFNKLKGMGQIVSWSVRDETLHCLS
FT                   MARLFRVFIQENPEIWTDALRADIVQICRDIVEHEDAFIDLCFEMGPVEGLDGDLVKTY
FT                   IRFIADRRLNLLGLDGIYDVPSNPLPWVDDMLNAVEHTNFFENRSTEYSRASTTGSWEE
FT                   AFEESVFQNGNAG"
FT   gene            complement(60042..60860)
FT                   /locus_tag="Gdia_0053"
FT   CDS_pept        complement(60042..60860)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0053"
FT                   /product="putative methyltransferase"
FT                   /note="KEGG: gdi:GDI1825 putative methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ACI49855"
FT                   /db_xref="GOA:B5ZJ77"
FT                   /db_xref="InterPro:IPR007848"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZJ77"
FT                   /protein_id="ACI49855.1"
FT                   /translation="MTVKPKDTMHEAMPDQPCAPDDANPDALSHGTLLNGRLRYRQFRH
FT                   GYRTGLEPVLMAAYVPARPGARVLEGGCGAGAGLMCLAHRVPAISGVGLERDERTAALA
FT                   QANFADNGFDRLAVVRTALPDLPGPPVFPPDGGGFDHAFANPPWHHNAASASPDARRDL
FT                   ARRVGSPDMIALWIRALGRQVRHRGTLTLALPAGLLDMAVAAMRAHGIGAISLFPFWPK
FT                   AGRAARIMLIQGRVGARGEAVLMPGMTLHRDDGSFTPQAEAVLRDGAPIA"
FT   gene            60919..61995
FT                   /locus_tag="Gdia_0054"
FT   CDS_pept        60919..61995
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0054"
FT                   /product="Polyprenyl synthetase"
FT                   /note="PFAM: Polyprenyl synthetase; KEGG: gdi:GDI1826
FT                   putative octaprenyl-diphosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ACI49856"
FT                   /db_xref="GOA:A9HIH5"
FT                   /db_xref="InterPro:IPR000092"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="InterPro:IPR033749"
FT                   /db_xref="UniProtKB/TrEMBL:A9HIH5"
FT                   /protein_id="ACI49856.1"
FT                   /translation="MGVAVTLPESERTASAKNAESSDPVTESAETALRDLSDYLGDDMA
FT                   ACNRAIVERMDSPVALIPQLAAHLVAAGGKRLRPLLTLAAARLCDYPAGPEHQRHVSLA
FT                   ACVEFIHTATLLHDDVVDESLLRRGLASANAVFGNKASVLVGDFLFARSFQLMTDDGSL
FT                   KVMAILSSASATIAEGEVLQMSTQNDLSTSVEQYLEVIHGKTAALFAAACRVGAVVAER
FT                   PEAEELALESFGTNLGMAFQLVDDALDYAADQAVLGKTVGDDFREGKITLPVLAAYAAG
FT                   DEEERVFWRRVIEQSEQAPEDLDRALALIAKTDAIGVTLDRAALYAQAARDALEIFPDS
FT                   RLRRLLQDTAAYTVSRGR"
FT   gene            complement(62035..62853)
FT                   /locus_tag="Gdia_0055"
FT   CDS_pept        complement(62035..62853)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0055"
FT                   /product="glutamate racemase"
FT                   /EC_number="5.1.1.3"
FT                   /note="KEGG: gdi:GDI1827 putative glutamate racemase;
FT                   TIGRFAM: glutamate racemase; PFAM: Asp/Glu/hydantoin
FT                   racemase"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ACI49857"
FT                   /db_xref="GOA:B5ZJ79"
FT                   /db_xref="InterPro:IPR001920"
FT                   /db_xref="InterPro:IPR004391"
FT                   /db_xref="InterPro:IPR015942"
FT                   /db_xref="InterPro:IPR018187"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZJ79"
FT                   /protein_id="ACI49857.1"
FT                   /translation="MARRILAFDSGIGGFGIVRALRTRLPGVSLDYLADNAVYPYGEQP
FT                   DTDLIRRIVALIGQAIDALDPDLVVIACNTASTLALPALRERYALPFVGCVPPIKWAAE
FT                   LSRTRTIGLLATRATVRRPYLGDLQRRYAPDCTLLAHGARGLADLAECAFRGHAIATDA
FT                   IDRELDALFGQPGGAAIDVVGIGCTHYTFLMDRLRAASPPGTIWLDPAEAVARQAATVL
FT                   GPLGTAAPARPARAFFTAAPAEPERLAAAIAPLGYGAPVLFENVAQGLCP"
FT   gene            complement(62880..63641)
FT                   /locus_tag="Gdia_0056"
FT   CDS_pept        complement(62880..63641)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0056"
FT                   /product="orotate phosphoribosyltransferase"
FT                   /EC_number="2.4.2.10"
FT                   /note="KEGG: gdi:GDI1828 orotate phosphoribosyltransferase;
FT                   TIGRFAM: orotate phosphoribosyltransferase; PFAM:
FT                   phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ACI49858"
FT                   /db_xref="GOA:A9HII0"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR023031"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:A9HII0"
FT                   /protein_id="ACI49858.1"
FT                   /translation="MNDSTGYGTGASSGSTAWDRDAALTTAKLLLEIKAVNFRPEEPYT
FT                   LTSGWKSPVYIDCRRIIFFPRARAKIVELGVEKIGRHIGYESIDAVVGGETAGIPFAAW
FT                   IADRMMAPMAYVRKKPKGFGRNAQIEGDVPEGMRTLLVEDLTTDGSSKIRFARALRDAG
FT                   AIVDHTFVVFFYGVFPGSLRTLADMNISLHALCTWWDVLEACAGQPYFSEKAASEVRRF
FT                   LEDPCEWSGRHGGVSSQEEALAFKGANQTQG"
FT   gene            63885..64124
FT                   /locus_tag="Gdia_0057"
FT   CDS_pept        63885..64124
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0057"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gdi:GDI1829 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ACI49859"
FT                   /db_xref="UniProtKB/TrEMBL:A9HII4"
FT                   /protein_id="ACI49859.1"
FT                   /translation="MALETGGIVRNCERAVVTAYRELREVGTSDVSAFHACTTLYRIHH
FT                   PDASLNEARRLVSEWIDHHVVRRDNGPTPGCDCD"
FT   gene            complement(64254..65552)
FT                   /locus_tag="Gdia_0058"
FT   CDS_pept        complement(64254..65552)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0058"
FT                   /product="citrate synthase I"
FT                   /EC_number="2.3.3.1"
FT                   /note="KEGG: gdi:GDI1830 citrate synthase; TIGRFAM: citrate
FT                   synthase I; PFAM: Citrate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ACI49860"
FT                   /db_xref="GOA:B5ZJ82"
FT                   /db_xref="InterPro:IPR002020"
FT                   /db_xref="InterPro:IPR010953"
FT                   /db_xref="InterPro:IPR016142"
FT                   /db_xref="InterPro:IPR016143"
FT                   /db_xref="InterPro:IPR019810"
FT                   /db_xref="InterPro:IPR024176"
FT                   /db_xref="InterPro:IPR036969"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZJ82"
FT                   /protein_id="ACI49860.1"
FT                   /translation="MTEPGKVATVSLEGKTASLPVLSGTLGPDVLDVRRIAADMGVFTF
FT                   DPGYGETASCESKITFIDGGKGVLLHRGYPIAQLAEQGTFLEVAYLLLNGELPTTAQHE
FT                   AFVSTIKSHTLLHEQIRNFFNGFRRDAHPMAILCGTVGALSAFYHEGTDISNEASRSLS
FT                   AMRLIAKLPTIAAWAYKYTQGEPFVYPRNDLNYAENFLSMMFAHPSEPYVINPVLARAM
FT                   DRILILHADHEQNASTSTVRLAGSTGANPFACIAAGIAALWGPAHGGANEAVLKMLAEI
FT                   GNKDNIPDFIAKVKDKNSGVRLMGFGHRVYKNFDPRAKIMQATCHEVLGELGIKDDPLL
FT                   DLAVELEKIAINDEYFVKRSLYPNVDFYSGIILKAMGIPTSMFTVLFAVARTVGWISQW
FT                   KEMIEEPGQRIGRPRQLYTGAPQRDFTPFAQRG"
FT   gene            complement(65723..66280)
FT                   /locus_tag="Gdia_0059"
FT   CDS_pept        complement(65723..66280)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0059"
FT                   /product="putative phosphohistidine phosphatase, SixA"
FT                   /note="PFAM: Phosphoglycerate mutase; KEGG: gdi:GDI1831
FT                   putative phosphoglycerate mutase"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ACI49861"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:A9HII9"
FT                   /protein_id="ACI49861.1"
FT                   /translation="MPRPPKADGNAAARRTLVLMRHAEAFPARHGDPGPSGDLERPLTP
FT                   SGRRKAHERGTQLREIGFVPDLVLISPARRSGETYAALGPFSTTDAPHVRQEAGLYEAG
FT                   AGSILEILREIPETASNIIVVGHNPDLYHLVLDLAGDAIDDPDKTILNRGFPTASAAWF
FT                   TVEGPWHELARRRVALARVLCT"
FT   gene            complement(66280..66624)
FT                   /locus_tag="Gdia_0060"
FT   CDS_pept        complement(66280..66624)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0060"
FT                   /product="chorismate mutase"
FT                   /note="TIGRFAM: chorismate mutase; PFAM: Chorismate mutase;
FT                   KEGG: gdi:GDI1832 putative chorismate mutase"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ACI49862"
FT                   /db_xref="GOA:B5ZJ84"
FT                   /db_xref="InterPro:IPR002701"
FT                   /db_xref="InterPro:IPR010951"
FT                   /db_xref="InterPro:IPR036263"
FT                   /db_xref="InterPro:IPR036979"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZJ84"
FT                   /protein_id="ACI49862.1"
FT                   /translation="MNDMTAIDRTLATPEAQATLQALRQSIDNIDAALIYMLAERFRHT
FT                   QAVGELKARHDMPPADPAREAQQVSRLRDLAGAARLDPDFAEKFLAFIIKEVIRHHEAI
FT                   ARKTGANGTA"
FT   gene            complement(66666..67520)
FT                   /locus_tag="Gdia_0061"
FT   CDS_pept        complement(66666..67520)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0061"
FT                   /product="metallophosphoesterase"
FT                   /note="PFAM: metallophosphoesterase; KEGG: gdi:GDI1833
FT                   putative phosphoesterases"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ACI49863"
FT                   /db_xref="GOA:A9HIJ4"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:A9HIJ4"
FT                   /protein_id="ACI49863.1"
FT                   /translation="MPLERPHPSGPAWTPPIADARAPDGPYLPPDGHADDHAALDSVTD
FT                   VPAFYDPVAVERLIDGRPIRVVGDVHGDLRAFEHAVATDRFVIQLGDLVDHGPDSAGTF
FT                   RLMQRLLDDGRGLFILGNHDRKLARALAGRKMRQDAPLIQTMRQFQAPENEDVRTRAWQ
FT                   DIAHAPPWIVLGRRIFVHGGFHSRMLNEPPPPGLGTVTPLLSRALFGETTGRMQKDGYP
FT                   ERRLNWIDHIPPGYTVYCGHDRRSTDGRPWIRVGRAGGTSVFTDTGAGKGGHLAWIDLP
FT                   DDA"
FT   gene            complement(67634..67957)
FT                   /locus_tag="Gdia_0062"
FT   CDS_pept        complement(67634..67957)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0062"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gdi:GDI1834 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ACI49864"
FT                   /db_xref="GOA:B5ZJ86"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZJ86"
FT                   /protein_id="ACI49864.1"
FT                   /translation="MAGPLVPDTRRDHDRHVSALLDRLPPRMRAAIEWLRVPSRRPVRL
FT                   VAGGLLCMGGFLFFLPVLGLWMLPLGLLLLSEDVPLLRRFMDRILIHIARKHPDWLEPK
FT                   DEK"
FT   gene            68092..69612
FT                   /locus_tag="Gdia_0063"
FT   CDS_pept        68092..69612
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0063"
FT                   /product="succinate CoA transferase"
FT                   /EC_number="3.1.2.1"
FT                   /note="KEGG: gdi:GDI1836 acetyl-CoA hydrolase; TIGRFAM:
FT                   succinate CoA transferase; PFAM: acetyl-CoA
FT                   hydrolase/transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ACI49865"
FT                   /db_xref="GOA:A9HIK2"
FT                   /db_xref="InterPro:IPR003702"
FT                   /db_xref="InterPro:IPR017821"
FT                   /db_xref="InterPro:IPR026888"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="InterPro:IPR038460"
FT                   /db_xref="UniProtKB/TrEMBL:A9HIK2"
FT                   /protein_id="ACI49865.1"
FT                   /translation="MIDHNRIRNAAFRAKVTTAEEAAYYIRPGSMVGMSGFTGSGYPKA
FT                   VPQALAAIMEAEKAKGNSFRIRLFTGASTGPELDGALAKADGIAFRMPYNSDATLRGRI
FT                   NKGETEYLDMHLSHVAPMVWQGFFGEMDTAVIEAVAIREDGTIVPSSSVGNNKTWLESA
FT                   RQVIIEVNSWQDAALEGMHDIWYGAALPPERQPIPLLRPDDRIGQATLRVDPSKVVAVV
FT                   ETHAPDRNAPFTPPDASAKAIAGHLMEFFRHEVARGRLPQSLLPLQSGVGNVANAVMSG
FT                   LEEGPFEDLTAFTEVIQDGMLGMLESGKMRVASATAFSLSPEAAESLNARMAEFRSKII
FT                   LRPQDISNHPELIRRLGCIAMNGLIESDIYGNVNSTQIMGSRIQNGIGGSGDFARNAYI
FT                   SVFMTPSTAKGGKISAIVPMASHVDHITQDSQVLVTEQGLADLRGLSPKQRAEVIIKNC
FT                   AHPDYRPGLQDYFKRAKEGSYGLQSPHLLTESLSWHQRFIETGSMLPT"
FT   gene            complement(69662..74197)
FT                   /locus_tag="Gdia_0064"
FT   CDS_pept        complement(69662..74197)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0064"
FT                   /product="SMC domain protein"
FT                   /note="PFAM: SMC domain protein; KEGG: gdi:GDI1837 putative
FT                   chromosome segregation protein SMC"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ACI49866"
FT                   /db_xref="GOA:B5ZJ88"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR011890"
FT                   /db_xref="InterPro:IPR024704"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZJ88"
FT                   /protein_id="ACI49866.1"
FT                   /translation="MTARFVRLRIAGFKSFADPVAVDILPGLTGIVGPNGCGKSNVVEA
FT                   LRWAMGESSARSLRGGEMDDLIFAGTAARAARNLAEVTLTLEGTTGIAPPPLHDQDELQ
FT                   ISRRAERGAGSDYRVNSKPIRARDVQTLFADLASGARSSAMVSQGRVSALVNARPEERR
FT                   SILEEAAGITGLHARRHEAELKLRATESNLARADDLRVQLEGHLDNLRGQSQQARRYRE
FT                   ISAALREAEITLLALLHARARLAVERAGQAARQARHAMTQAEEAAETAVVTEFEANRDL
FT                   PALRVRSDETRTVLERQKILAEGIAREEQRAAEAASDAAARLQQAEADHQAAEARHADA
FT                   GENVARLQAEQAALDTRLAALPQDVAQAQADLATAGESVQAQERALEQATSDATAARAR
FT                   AEQVEAAHREAQARHARLCDQHDRLAAELDALRAALPGQADMEAQAAALAASSEHLART
FT                   RAALDHAAQEQSDATLAVTLARNHATEARRRQEEAQRALAQATERATALRAARQALQRR
FT                   QDDTNAHLVAPERREALRTGLAEAQSALAAARAALEQAELDRQAASAAQIEARARLQEG
FT                   VTRRAAIGTALRTAESTQQRAQARLQALQGDLARARAAAIAPDRVDAARAARESAERDL
FT                   AASGLALEGAESGLAAALAARDAATHHLAEVKADLSRLTAEIEGLTQALATGHGESGCR
FT                   PVVDDILVPDGLEAALASALAEGLEASVEPEAPRLWHRLDDLPAPALPGDGTVALSGLV
FT                   TAPPALTRALTAIGLLADGVDGAALQAGLRPGQSLVDRTGALWRWDGYRVAAGLPSRAA
FT                   LLLQQRNRLRETEAARDIRRADLPVAEAALAEAEQARAQAAESVTQARAARTRIETVLR
FT                   QARADEAEIGRLDSAARARLDTVQPQHDQAVQALAEAESALAAARDEATALPDEAQLAQ
FT                   AHEAARRHEQAAQAAEAVARETRRRAEAAQEAARREDDATAARHGEAEARLATIVPELQ
FT                   RITREAEQAEAALGDAETALSALPPVQDAESALAAAEARARDAAQAHDAARQARQQAES
FT                   ALEQAQAAHAARQTAQIETRSALDAQAPRLESLGQERDEAAAHLARVTAERESLPDLEA
FT                   IATHVQQMREAMAAARQAEDAARQQGTALAGEQQAARARLDGLVAALADWTARQAAAAA
FT                   ERDGSIARLEAARADHARLAALPDEVTRTRATTHDALHRAESDHADAARTLAEAEDALA
FT                   RAQTGRRDAEGALAAAREALLRAEGRHEQAEAILTQLLTETPEPPGIVPPDLTEAAESS
FT                   LRRKIARLVREREEMGPVNLRAELEADEAETRIATIRNEKDELESAIARLRGSIGALNR
FT                   EGRERLLAVFTEVDQHFQSLFSRMFNGGRAHLGMVGNDDPLQAGLEIYAQPPGKKLATL
FT                   SLLSGGEQALTALSLIFAVFRCNPAPICVLDEVDAPLDDANVGRFCALLADMVAEAGTR
FT                   FLVVTHHQLTMAHMDRLYGVTMQERGVSRVLSVDLDHAATMAGQSRAETV"
FT   gene            complement(74229..74846)
FT                   /locus_tag="Gdia_0065"
FT   CDS_pept        complement(74229..74846)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0065"
FT                   /product="DSBA oxidoreductase"
FT                   /note="PFAM: DSBA oxidoreductase; KEGG: gdi:GDI1838
FT                   thioredoxin protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ACI49867"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A9HIK8"
FT                   /protein_id="ACI49867.1"
FT                   /translation="MPVTRRTLIATAPALLAPGLAPRAARAADTDPRMSVRAAGNPAAK
FT                   VHVEEWFSLTCTHCARFAGEVFPEIRTRLIETGKVYYIFRDFPLDQLALAAAMIARTLP
FT                   PERYEPFVLSLLSSQDRWAFARDVNPQDELQKMAALAGMPADLFQKTIADDTLRQAIMD
FT                   EENRAQAQYKIEGTPTFRFNDKVQVGQEMTYDDFAQKVASLA"
FT   sig_peptide     complement(74763..74846)
FT                   /locus_tag="Gdia_0065"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.998 at
FT                   residue 28"
FT   gene            complement(74921..75850)
FT                   /locus_tag="Gdia_0066"
FT   CDS_pept        complement(74921..75850)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0066"
FT                   /product="Bile acid:sodium symporter"
FT                   /note="PFAM: Bile acid:sodium symporter; KEGG: gdi:GDI1839
FT                   putative transporter protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ACI49868"
FT                   /db_xref="GOA:A9HIL1"
FT                   /db_xref="InterPro:IPR002657"
FT                   /db_xref="InterPro:IPR004710"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:A9HIL1"
FT                   /protein_id="ACI49868.1"
FT                   /translation="MSVLTRLFPLWAILVSASAIRWPGPFLALSPAITPLLAFVMFTMG
FT                   VTLTVADFRRIARRPAPVLAGIVLHYTIMPLAAWLVARMLGLPPALRVGMILVGSVSSG
FT                   TASNVMIYLARGDVALSVSISTLSTLVGIVATPLLTRLYVSADVAVDTWALLRSIVELV
FT                   ALPVVGGLAVNMLAHRAVRRIEPALPLVAMIAIMAIIGSIVASVRPSLAFAGPIVLLAV
FT                   MLHNGMGLLGGYWGGRLLRLDESACRTLAIEVGMQNSGLAATLGRLYFGPLAALPGAIF
FT                   SIWHNISGSALSAWWAGRPVRDTAPRSS"
FT   gene            complement(75861..76835)
FT                   /locus_tag="Gdia_0067"
FT   CDS_pept        complement(75861..76835)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0067"
FT                   /product="CBS domain containing protein"
FT                   /note="PFAM: CBS domain containing protein;
FT                   transporter-associated region; KEGG: gdi:GDI1840 putative
FT                   magnesium and cobalt efflux protein CorC"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ACI49869"
FT                   /db_xref="GOA:A9HIL4"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR005170"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:A9HIL4"
FT                   /protein_id="ACI49869.1"
FT                   /translation="MNRPLPVSATSDAAPHRTDAPKAETARPPDEVPPSRPRGRGLLSL
FT                   FGRRRVEQGLRHSIAALVQEANDAEGDGADPNSELDRQERALIANVLRLRGITADDVMV
FT                   PRADIVAMPVSLSLDEALALMRRENHSRMPVYREQLDDIVGMIHVKDLIAYVGTSEGFN
FT                   VESLLRQPLMVAPQIPVLDLLLQMRQRRVHLALIIDEYGGIDGLVTIEDLVETIVGDIS
FT                   DEHDEPTAVLIQERPDGTFDVDARLPVEQFESRLGPLLTDAEREAEIETVGGLVFYLAG
FT                   HVPTRGEVLTHDSGLVFRVLDADSLHIRKVRVRPPPPPPAPAA"
FT   gene            complement(76832..77440)
FT                   /locus_tag="Gdia_0068"
FT   CDS_pept        complement(76832..77440)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0068"
FT                   /product="protein of unknown function UPF0054"
FT                   /note="PFAM: protein of unknown function UPF0054; KEGG:
FT                   gdi:GDI1841 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ACI49870"
FT                   /db_xref="GOA:B5ZJ92"
FT                   /db_xref="InterPro:IPR002036"
FT                   /db_xref="InterPro:IPR023091"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZJ92"
FT                   /protein_id="ACI49870.1"
FT                   /translation="MEPRSSQNPAESGGVLTIEPTAGRAVGLPPVPLHEWDVPAGDGGD
FT                   DCDVVVTDARWHGAVPGIAALVRRTARAAWGGDAPGPVTIMLDNDRAIRRLNARHRDRN
FT                   KPTNVLTFDYPGGLPGGDIMIALETVRREAQAAGRPIRHHLMHLVVHGILHLRGHDHHQ
FT                   AGEARRMEMEEARILGRLSVPNPWKYRPGAPSGLMGDGQ"
FT   gene            complement(77424..78515)
FT                   /locus_tag="Gdia_0069"
FT   CDS_pept        complement(77424..78515)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0069"
FT                   /product="PhoH family protein"
FT                   /note="PFAM: PhoH family protein; KEGG: gdi:GDI1842
FT                   putative PhoH-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ACI49871"
FT                   /db_xref="GOA:B5ZJ93"
FT                   /db_xref="InterPro:IPR003714"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZJ93"
FT                   /protein_id="ACI49871.1"
FT                   /translation="MDAMRTITLQFDDNALLARLVGDHDRHLLHLERGFGIRLSCRGNR
FT                   VAVSGTPDRVEIAQAALNSLYRRLEGGTDLDTAEIDAAIRMAAAHHTLPRLPSEGRSAM
FT                   PHDSAHLPQPHRSESHRLSLPELPAIRTRRGAIAPRSAGQATYMEMLAQAEMVFGIGPA
FT                   GTGKTYLAVAQAVAMLQAGQVDRIVLSRPAVEAGERLGFLPGDMKDKIDPYLRPLYDAL
FT                   HDMLPGDQVVRRMATGEIEVAPLAFMRGRTLAHSFVILDEAQNTTSAQMKMFLTRMGSG
FT                   TRMVVTGDLSQVDLPSGVTSGLRDAVDTLEGLPGIGITRFESRDVVRHPLVARIVDAYD
FT                   QRAAAERDMSRSRARRENNGTAK"
FT   gene            complement(78599..80008)
FT                   /locus_tag="Gdia_0070"
FT   CDS_pept        complement(78599..80008)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0070"
FT                   /product="RNA modification enzyme, MiaB family"
FT                   /EC_number="1.3.1.74"
FT                   /note="KEGG: gdi:GDI1843 hypothetical protein; TIGRFAM: RNA
FT                   modification enzyme, MiaB family; tRNA-i(6)A37
FT                   thiotransferase enzyme MiaB; PFAM: deoxyribonuclease/rho
FT                   motif-related TRAM; Radical SAM domain protein; Protein of
FT                   unknown function UPF0004; SMART: Elongator protein
FT                   3/MiaB/NifB"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ACI49872"
FT                   /db_xref="GOA:A9HIM2"
FT                   /db_xref="InterPro:IPR002792"
FT                   /db_xref="InterPro:IPR005839"
FT                   /db_xref="InterPro:IPR006463"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013848"
FT                   /db_xref="InterPro:IPR020612"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR038135"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9HIM2"
FT                   /protein_id="ACI49872.1"
FT                   /translation="MTDQPACPPAMDLAPASGSRGLHVITWGCQMNVYDSARMTDVLRP
FT                   LGYHPVDTPDTADMVILNTCHIRDRAAEKVFSELGRLRLVKEARATEGQQTVLAVAGCV
FT                   AQAEGKEILARAPFVDIVLGPQTYHRLPEMVARAARAAGAVIDTDFPAEQKFDFLPDAQ
FT                   APQSPGGITSFLTIQEGCDKFCSFCVVPYTRGAEASRPVASVLREARRMVECGAREITL
FT                   LGQNVNAYHGEGPDGRVWGLARLAEALAAIPGLARIRYTTSHPRDMDADLIAAHRDLPA
FT                   LMPFLHLPVQSGSDRILDAMNRGHTAADYRDLVLRLRDARPDIALSSDFIVGHPGETDA
FT                   DFEATLQLIRDVGFAQAFSFKYSPRPGTPAAGAPLQVAEDVKDARLQALQALLRTQQDA
FT                   FNDGTVGHVVPVLFTGHGRKAGQLSGRSPYLQPVHVEGPDSLIGQIANVEIRERYTNSL
FT                   SGTLVQERAFA"
FT   gene            80561..82462
FT                   /locus_tag="Gdia_0071"
FT   CDS_pept        80561..82462
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0071"
FT                   /product="surface antigen (D15)"
FT                   /note="PFAM: surface antigen (D15); surface antigen
FT                   variable number repeat protein; KEGG: gdi:GDI1844 putative
FT                   surface antigen"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ACI49873"
FT                   /db_xref="GOA:B5ZJ95"
FT                   /db_xref="InterPro:IPR000184"
FT                   /db_xref="InterPro:IPR010827"
FT                   /db_xref="InterPro:IPR034746"
FT                   /db_xref="InterPro:IPR039910"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZJ95"
FT                   /protein_id="ACI49873.1"
FT                   /translation="MGLVVFVGWMPPPVRGADPQSYVTVIRPTGQGDLDAAISASSSLL
FT                   SLQKTKAVSPFALAGRIRNDYDRLRTALESYGYYAATIRIAVGLRAGGHAAPSAPPATM
FT                   DGQDPRLPEWLLAVPKGQAVQVTITPVRGDIFHLGQVTLKPSPEDGTAPIVLNAPERTA
FT                   LGVASGHPAIASDVLAGGVNLQAELKEEGHALAQVGTPKAWLRPQTHTLDVEYTVRRGP
FT                   IVTIGAIALSGLKRTHPAYIARRITLHPDQLYQPSHIEAARQDLASLGVFSDVQASDAP
FT                   PLTAGRQMPLNFAFTEGKQRMAEVEGGYSTDLGGRGGVSWTHNNIFGNAERLRLTTLVT
FT                   GLGGSAQQGLGYDVYADLLKPDFGDRDQNLSVRVEGIRQLLYSYRQTALLVRAGIVRHL
FT                   GRRWTVSFGGEAEQEHIEQMGMSNDYTIVSLPLSATYDSTGLTNPIDPATHGVRIAASA
FT                   TPSASLISGTSFFTILQATASTYFDLSHVGLSRPGRSVFAFRGVVGSVQGASTFEIPPD
FT                   QRLYAGGSATVRGFRYQGVGPQFPNSKYAIGGTSMDAGTVEFRQRLFRSFGAALFADAG
FT                   QVDTGSSPLHGTLRVGAGAGVRYYTPIGPVRVDVAFPLNRPAQGDTWELYIGLGETF"
FT   gene            82462..86710
FT                   /pseudo
FT                   /locus_tag="Gdia_0072"
FT   gene            complement(86856..88524)
FT                   /pseudo
FT                   /locus_tag="Gdia_0073"
FT   gene            complement(88532..88963)
FT                   /locus_tag="Gdia_0074"
FT   CDS_pept        complement(88532..88963)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0074"
FT                   /product="response regulator receiver protein"
FT                   /note="PFAM: response regulator receiver; KEGG: gdi:GDI1847
FT                   putative two-component response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ACI49874"
FT                   /db_xref="GOA:B5ZJ96"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZJ96"
FT                   /protein_id="ACI49874.1"
FT                   /translation="MTHLTPTHLPDAVPMDKAPILLVEDDFLIRMALAAYLRERGGFTV
FT                   VEADDTATALAAIDAQPCLSILLTDMRIPGPMSGSDVAAAARAKWPDLPVLYVTGTAAR
FT                   GDGSAVSANRDSYVGKPFEPSAVLKQVHAMLDPPHGSAP"
FT   gene            89082..90056
FT                   /locus_tag="Gdia_0075"
FT   CDS_pept        89082..90056
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0075"
FT                   /product="fatty acid hydroxylase"
FT                   /note="PFAM: fatty acid hydroxylase; KEGG: gdi:GDI1848
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ACI49875"
FT                   /db_xref="GOA:B5ZJ97"
FT                   /db_xref="InterPro:IPR006694"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZJ97"
FT                   /protein_id="ACI49875.1"
FT                   /translation="MIDPFTWLAGWIQENWLIPILYRFGWMEWEDTSFLWAMFAIYGVL
FT                   QVVLNLAICMPLERFWPLRTWENRDNVTMDVVYTLIARIGIFPLVTFFGFYEIQTWMNG
FT                   VLTDHGYIPPTLESTFPTLMDWPVATFFLYAVILDFADYWRHRLSHVFAWWYGLHALHH
FT                   AQTQMTFWSDDRNHLVDDVISYVWAIAVGLLIGVPPLQFPLLILVLRLVESLSHANTRV
FT                   GFGWLGERLLVSPQFHRVHHGLRSAGRNSCNYGSVFPWWDMILRTANFSHSVVETGDPK
FT                   AEAALVSGGWLAQQAAGLRLSWRLATRRWRRAGAAGSSSPTAR"
FT   gene            90059..90499
FT                   /locus_tag="Gdia_0076"
FT   CDS_pept        90059..90499
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0076"
FT                   /product="transmembrane pair domain protein"
FT                   /note="PFAM: transmembrane pair domain protein; KEGG:
FT                   gdi:GDI1849 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ACI49876"
FT                   /db_xref="GOA:A9HIN5"
FT                   /db_xref="InterPro:IPR007896"
FT                   /db_xref="UniProtKB/TrEMBL:A9HIN5"
FT                   /protein_id="ACI49876.1"
FT                   /translation="MRTTRDRIRYVLLFETLGLAMVVPGGQAVLGIRAADMGAIGLGST
FT                   SVAVLWNYIFNRGFDRALLALKGTTHKVLADRLAHAVLYQVGLIVMLVPAIALYLGQGL
FT                   LSAFVANISLTLFYLVYNFAFTWAYDIVFPVPAAALPHGGRA"
FT   gene            complement(90557..91147)
FT                   /locus_tag="Gdia_0077"
FT   CDS_pept        complement(90557..91147)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0077"
FT                   /product="transcriptional regulator, CarD family"
FT                   /note="PFAM: transcription factor CarD; KEGG: gdi:GDI1850
FT                   transcriptional regulator, CarD family"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ACI49877"
FT                   /db_xref="InterPro:IPR003711"
FT                   /db_xref="InterPro:IPR036101"
FT                   /db_xref="InterPro:IPR042215"
FT                   /db_xref="UniProtKB/TrEMBL:A9HIN7"
FT                   /protein_id="ACI49877.1"
FT                   /translation="MSMFRTTPKGGVTDAMARTAAAATAAQAKTKVKDEDPFREGDAIV
FT                   YAAHGVGRVDRIGIDEIAGTKLEMIQISFPGNQMTLRIPLAKARKAGLRKIVSREIVDK
FT                   AMAIIKGKPHVSRGMWARRAVAYQEKINSGDLVQIAEVLRDLRRNVDSLDGSFSERKLF
FT                   EAAQERFVAEVAVLEGKEPTAVLEALTAAMKAA"
FT   sig_peptide     complement(91061..91147)
FT                   /locus_tag="Gdia_0077"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.860) with cleavage site probability 0.759 at
FT                   residue 29"
FT   gene            complement(91209..92084)
FT                   /locus_tag="Gdia_0078"
FT   CDS_pept        complement(91209..92084)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0078"
FT                   /product="protein of unknown function UPF0187"
FT                   /note="PFAM: protein of unknown function UPF0187; KEGG:
FT                   gdi:GDI1851 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ACI49878"
FT                   /db_xref="GOA:A9HIN9"
FT                   /db_xref="InterPro:IPR021134"
FT                   /db_xref="UniProtKB/TrEMBL:A9HIN9"
FT                   /protein_id="ACI49878.1"
FT                   /translation="MIVDRRIGLFILMRESLLALAILGAWDVFVVIMFQVYHQDWMEQP
FT                   TLPVSLIGSAVVLFLSVRNTAAYNRWWEARTLWGAITNNCRSFGRQAGSLLGGRPDLAR
FT                   AMAAYPYALRGALGRLDCAEDVERLLPPPMQQAIAGWTNQPNAILYQIGLAVNQEVARQ
FT                   GIDGAVHGQIDRILSDLANAQGGLERIRNTPLAIQFSLIPRLVANVFCVVLPLSMVQTL
FT                   GWITPLGSSLVGLLFVALDKIGSDLQEPFVRSPHAMPMLTMARTIEIDLLQPAGQPVGG
FT                   PIAPVRGVQS"
FT   gene            92314..93429
FT                   /locus_tag="Gdia_0079"
FT   CDS_pept        92314..93429
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0079"
FT                   /product="S-(hydroxymethyl)glutathione dehydrogenase/class
FT                   III alcohol dehydrogenase"
FT                   /note="TIGRFAM: S-(hydroxymethyl)glutathione
FT                   dehydrogenase/class III alcohol dehydrogenase; PFAM:
FT                   Alcohol dehydrogenase zinc-binding domain protein; Alcohol
FT                   dehydrogenase GroES domain protein; KEGG: gdi:GDI1852
FT                   putative alcohol dehydrogenase class 3"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ACI49879"
FT                   /db_xref="GOA:A9HIP1"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR014183"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A9HIP1"
FT                   /protein_id="ACI49879.1"
FT                   /translation="MDVRAAVAFEAGKPLEIETVQLEGPRAGEVLVEIRATGLCHTDKF
FT                   TLSGADPEGLFPAILGHEGAGVVVEVGPGVTHLKPGDHVIPLYTPECRECKSCLSRKTN
FT                   LCTAIRSTQGKGLMPDGTSRFSYKGRPIRHYMGCSTFANYTVLPEIALAKIRPDAPFDK
FT                   VCYIGCGVTTGIGAVLFTAKVETGSTVVVFGLGGIGLNVIQGARMVGADMIVGVDINPA
FT                   REAMARKFGMTHFVNPKDLGPDGDIVGHLVELTGGGADYSFECVGNPTLMRQALECSHR
FT                   GWGLSTIIGVAGAGQEISTRPFQLVTGRRWIGSAFGGARGRTDVPKIVDWYMEGKINID
FT                   DLITHTLPLSRINEGFDLMARGESIRTVVEF"
FT   gene            93434..94282
FT                   /locus_tag="Gdia_0080"
FT   CDS_pept        93434..94282
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0080"
FT                   /product="S-formylglutathione hydrolase"
FT                   /EC_number="3.1.1.1"
FT                   /note="KEGG: gdi:GDI1853 esterase protein; TIGRFAM:
FT                   S-formylglutathione hydrolase; PFAM: putative esterase"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ACI49880"
FT                   /db_xref="GOA:A9HIP3"
FT                   /db_xref="InterPro:IPR000801"
FT                   /db_xref="InterPro:IPR014186"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A9HIP3"
FT                   /protein_id="ACI49880.1"
FT                   /translation="MPITTRETHACCGGTVGYYSHLSDSLGLEARFAVFVPDGASDAAR
FT                   VPVLHVLAGLTCTEETFLIKANAIRFAAEYGIALVATDTSPRGAGIAGEDDSYDFGSGA
FT                   GFYLDATQAPWAAHYRMGRYVAEELPALTEAHFPLDGTRRGIMGHSMGGHGALVHALRA
FT                   PDRWKSVSAFAPIVHPAAVPWGEKAFSGYLGPDRATWAAHDATLLLRAGRTHPTTILVD
FT                   QGEADPFLPEQLQPWHLEEAAKAAGQGLILRRHAGYDHSYWFIQSFIQDHLTHHAAILR
FT                   R"
FT   gene            complement(94287..94706)
FT                   /locus_tag="Gdia_0081"
FT   CDS_pept        complement(94287..94706)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0081"
FT                   /product="protein of unknown function UPF0047"
FT                   /note="PFAM: protein of unknown function UPF0047; KEGG:
FT                   gdi:GDI1854 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ACI49881"
FT                   /db_xref="InterPro:IPR001602"
FT                   /db_xref="InterPro:IPR035917"
FT                   /db_xref="UniProtKB/TrEMBL:A9HIP5"
FT                   /protein_id="ACI49881.1"
FT                   /translation="MRQALHRLSIATHGKGLVMFTRDVLHWVADTGIETGLLTLWCRHT
FT                   SASLTVQENADPTVLEDIKRYFEALVPEAPGRYIHDDEGPDDMPAHLRSMLTQTQLSIP
FT                   VADGRPVLGTWQGLYLFEHRRQPHRREIILHLIGE"
FT   gene            complement(94731..95726)
FT                   /locus_tag="Gdia_0082"
FT   CDS_pept        complement(94731..95726)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0082"
FT                   /product="tryptophanyl-tRNA synthetase"
FT                   /EC_number="6.1.1.2"
FT                   /note="KEGG: gdi:GDI1855 putative tryptophanyl-tRNA
FT                   synthetase; TIGRFAM: tryptophanyl-tRNA synthetase; PFAM:
FT                   aminoacyl-tRNA synthetase class Ib"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ACI49882"
FT                   /db_xref="GOA:A9HIP8"
FT                   /db_xref="InterPro:IPR002305"
FT                   /db_xref="InterPro:IPR002306"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR024109"
FT                   /db_xref="UniProtKB/TrEMBL:A9HIP8"
FT                   /protein_id="ACI49882.1"
FT                   /translation="MQRIFSGIQPTGIPQLGNYLGAIRNWVALQQDHECIFCLVDLHAI
FT                   TVWQDPEALRQQTLAQTAVLLAAGIDPKAHILFNQSAVSAHARLGWIFNCVSRLGWLNR
FT                   MTQFKDKAGKDRENHSAGLYIYPNLMAADILAYKATRVPVGDDQRQHLELANDIAQKFN
FT                   HDYGVDFFPAIEALIPAGAARVMSLRDGTKKMSKSDPSAQSRIEMTDDADAIALKIRRA
FT                   KTDPEPLPTDPADLQSRPEARNLVEIYAVLSGMTVADVLARHGGTGFGPFKAALTDVLV
FT                   AAVTPIGAETRRLLDAPEHLQAVLREGAARANAIAEPIVSEVERLVGFLK"
FT   gene            complement(95791..96288)
FT                   /locus_tag="Gdia_0083"
FT   CDS_pept        complement(95791..96288)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0083"
FT                   /product="peptidylprolyl isomerase FKBP-type"
FT                   /note="PFAM: peptidylprolyl isomerase FKBP-type; KEGG:
FT                   gdi:GDI1856 putative peptidyl-prolyl cis-trans isomerase
FT                   Mip precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ACI49883"
FT                   /db_xref="GOA:A9HIQ1"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="UniProtKB/TrEMBL:A9HIQ1"
FT                   /protein_id="ACI49883.1"
FT                   /translation="MKRLSRFIPLLLASSLALPLAACGGSRPEEYKPEMTPAQFMAKVR
FT                   AEPGVQSLPDGLAYKVLKSGPKDGQSPVPGDVMMVIYEGRLPEGGIFDSSDQHGQGAYM
FT                   QMPLDGVIKGWMEGLPLMHVGDIWMLYVPPELGYGHRSMGIIPADSPLVFKIQLLGVSK
FT                   PQ"
FT   sig_peptide     complement(96214..96288)
FT                   /locus_tag="Gdia_0083"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.680 at
FT                   residue 25"
FT   gene            complement(96337..97566)
FT                   /locus_tag="Gdia_0084"
FT   CDS_pept        complement(96337..97566)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0084"
FT                   /product="Argininosuccinate synthase"
FT                   /EC_number="6.3.4.5"
FT                   /note="PFAM: argininosuccinate synthase; KEGG: gdi:GDI1857
FT                   argininosuccinate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ACI49884"
FT                   /db_xref="GOA:A9HIQ4"
FT                   /db_xref="InterPro:IPR001518"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR018223"
FT                   /db_xref="InterPro:IPR023434"
FT                   /db_xref="InterPro:IPR024074"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9HIQ4"
FT                   /protein_id="ACI49884.1"
FT                   /translation="MAVKDVKKVVLAYSGGLDTSVILRWLQTTYGCEVVTFTADLGQGE
FT                   ELEPARKKAEMFGVKEIFVEDLRETFVKDFVFPMFRANTLYEGQYLLGTSIARPLIAQR
FT                   QIEIAEAVGADAVAHGATGKGNDQVRFELAYYALKPDVTVISPWREWDLTSRTRLLAFA
FT                   EEHQIPIAKDKRGEAPFSVDANLLHSSSEGKLLEDPAVAPDEIVFQRTISPEAAPDVAT
FT                   EIAIDFVSGDPVALNGVTLSPATLLARLNELGKANGIGRLDLVENRFVGMKSRGIYETP
FT                   GGTILLAAHRSMETITLDREAGHLKDSLMPRYAELIYNGFWFSPERRMLQALIDESQHS
FT                   VTGRVRLKLYKGNVICVGRESPHSLYDTRVVTFEDDEGAYNQSDALGFIKLNALRLRLG
FT                   AQIGRRGGAL"
FT   gene            complement(97700..98914)
FT                   /locus_tag="Gdia_0085"
FT   CDS_pept        complement(97700..98914)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0085"
FT                   /product="radical SAM enzyme, Cfr family"
FT                   /note="TIGRFAM: radical SAM enzyme, Cfr family; PFAM:
FT                   Radical SAM domain protein; KEGG: gdi:GDI1858 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ACI49885"
FT                   /db_xref="GOA:A9HIQ6"
FT                   /db_xref="InterPro:IPR004383"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR027492"
FT                   /db_xref="InterPro:IPR040072"
FT                   /db_xref="UniProtKB/TrEMBL:A9HIQ6"
FT                   /protein_id="ACI49885.1"
FT                   /translation="MTAVPAPAQQPAETGLAASMTEVERKRILAKSALFAPPAGVLPDG
FT                   RRELVGLSREELTQALVEIGEKPFRTKQLWHWIYHQGVTDFARMSSIAKPLQAKLAERF
FT                   VVGRPDAAMVQTSTDETRKFLFRFRDGQEAETVYIPDRREDRGAVCISSQVGCTLSCTF
FT                   CHTGTQKLVRNLGAAEIVGQFMAARDSYGEWPSPKGDTPRLLSTIVLMGMGEPLYNYEN
FT                   IAKAMKIIMDGEGIGLSRRRITLSTSGVIPMMDQCGSELGINLAISLHAVRNDLRDEIV
FT                   PLNRKYPIEDLIAACRRYPTASNARRITFEYIMLRGVNDSEAEARELVRLIAGIPAKVN
FT                   LIPFNPWPGSAYKPSTREQLAKFAQIVMDAGFASPIRMPRGRDILAACGQLRTESERER
FT                   RNATA"
FT   gene            complement(98996..99736)
FT                   /locus_tag="Gdia_0086"
FT   CDS_pept        complement(98996..99736)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0086"
FT                   /product="hemolysin A"
FT                   /note="TIGRFAM: hemolysin A; PFAM: ribosomal RNA
FT                   methyltransferase RrmJ/FtsJ; RNA-binding S4 domain protein;
FT                   KEGG: gdi:GDI1859 putative hemolysin A"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ACI49886"
FT                   /db_xref="GOA:A9HIQ8"
FT                   /db_xref="InterPro:IPR002877"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR004538"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:A9HIQ8"
FT                   /protein_id="ACI49886.1"
FT                   /translation="MAKQRADQMLVDRGLVESRTRAQALILAGLVFSGDRRVAKAGDQL
FT                   PEDAPLRLKGQDHPWVSRGGIKLAHALAHFGLSPEGGICLDVGASTGGFTDVLLTHGAA
FT                   KIYAVDVGHGQLAWKLRSDPRVTVLEKCNARALDATTIPDPIDVLVCDASFIGLRTVLP
FT                   AGLALCRPGAGAVALIKPQFEAGRDAVGPKGVVRDPAIHDAVCATIRDWWSAMPGWTVL
FT                   GIEPSPITGPEGNREFLIAARRDG"
FT   gene            complement(99769..101772)
FT                   /locus_tag="Gdia_0087"
FT   CDS_pept        complement(99769..101772)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0087"
FT                   /product="deoxyxylulose-5-phosphate synthase"
FT                   /note="TIGRFAM: deoxyxylulose-5-phosphate synthase; PFAM:
FT                   Transketolase central region; Transketolase domain protein;
FT                   KEGG: gdi:GDI1860 1-deoxy-D-xylulose-5-phosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ACI49887"
FT                   /db_xref="GOA:A9HIR0"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR005477"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/TrEMBL:A9HIR0"
FT                   /protein_id="ACI49887.1"
FT                   /translation="MSEQNTGAQPGGSVPTRGRFPLLDRVAYPEDLRNLSVEQLKQLAE
FT                   ELRAETVDAVSTTGGHLGASLGVVELTVALHAVFDTPADRVIWDVGHQAYPHKILTGRR
FT                   ERIRTLRQPGGLSGFTRRCESEYDPFGAAHSSTSISAGLGMAVAHHLRAEHDPAYRERN
FT                   VVAVIGDGSISAGMAYEAMNNASVAGPGAGRLIVVLNDNEMSIAPPVGAMSNYLSRLMS
FT                   SRQFLGLRDLAGKVARRLPERLERTAKKADEYARGMITGGTLFEELGFYYVGPVDGHDL
FT                   NQLVPILRNLRDADDKGPILLHILTEKGRGYRPAESAGDKYHAVAKFNVVTGEQKKAPP
FT                   GPPSYTSVFSRELVRRAKQDDTIVAVTAAMPSGTGLDAFARACPDRFFDVGIAEQHAVT
FT                   FAAGMATEGLRPFCAIYSTFLQRAYDQVMHDVVLQNLPVRFAIDRAGLVGADGATHAGA
FT                   FDINYLGCLPGMTIMAPSDELELLHMTATACAFDAGPIALRYPRGNGLGLALPEAGEIL
FT                   EIGRGRIIREMGRQSGRETGGIAILSLGTRLAEVLKAADMLAAQGLAPTVADARFAKPL
FT                   DTALIENLARNHAVLLTIEDGAEGGFGAYVMHHLARTGLLDTIRFRPMTLPDRFIDHNT
FT                   QDAQYHQAGLDAPAIAACAMQALGVAASQQTA"
FT   gene            complement(101778..102713)
FT                   /locus_tag="Gdia_0088"
FT   CDS_pept        complement(101778..102713)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0088"
FT                   /product="Polyprenyl synthetase"
FT                   /note="PFAM: Polyprenyl synthetase; KEGG: gdi:GDI1861
FT                   geranyltranstransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ACI49888"
FT                   /db_xref="GOA:A9HIR3"
FT                   /db_xref="InterPro:IPR000092"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="InterPro:IPR033749"
FT                   /db_xref="UniProtKB/TrEMBL:A9HIR3"
FT                   /protein_id="ACI49888.1"
FT                   /translation="MSQTTATAHMENSADRASLLRSSLSNRATAIEAAIDSLLPPVPGA
FT                   EGRVVDAMRYATLGGGKRLRGYLTAEVASLFGVEPARAYRVAASVEMLHAYSLVHDDLP
FT                   AMDNDDLRRGQPSTHRKFDEATAILAGDALQTMAFEILTDTATHPSATIRIGLVAALAA
FT                   ASGAAGMVGGQMIDMDGEGRALSLPEVERLHALKTGCLIRYAAEAGAILGDADLPARAR
FT                   IAAYGRDLGAAFQIADDVLDATASAEELGKTAGKDQAAGKSTYVALLGVDGAAREARRV
FT                   AEQAESHLDVFGAEADRLRNLVQYVVDRRS"
FT   gene            complement(102721..102951)
FT                   /locus_tag="Gdia_0089"
FT   CDS_pept        complement(102721..102951)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0089"
FT                   /product="exodeoxyribonuclease VII, small subunit"
FT                   /note="TIGRFAM: exodeoxyribonuclease VII, small subunit;
FT                   PFAM: Exonuclease VII small subunit; KEGG: gdi:GDI1862
FT                   putative exodeoxyribonuclease VII small subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ACI49889"
FT                   /db_xref="GOA:A9HIR6"
FT                   /db_xref="InterPro:IPR003761"
FT                   /db_xref="InterPro:IPR037004"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9HIR6"
FT                   /protein_id="ACI49889.1"
FT                   /translation="MTEDLSQLSFEDALAQLEEIVRQLEGGQLRLQDAIASYERGAALR
FT                   RYCDTKLNEADARVQAIIQRADGALETKSMD"
FT   gene            complement(103092..103349)
FT                   /locus_tag="Gdia_0090"
FT   CDS_pept        complement(103092..103349)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0090"
FT                   /product="SirA family protein"
FT                   /note="PFAM: SirA family protein; KEGG: gdi:GDI1863
FT                   putative sulfurtransferase TusA"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ACI49890"
FT                   /db_xref="GOA:A9HIR8"
FT                   /db_xref="InterPro:IPR001455"
FT                   /db_xref="InterPro:IPR036868"
FT                   /db_xref="UniProtKB/TrEMBL:A9HIR8"
FT                   /protein_id="ACI49890.1"
FT                   /translation="MSETVLDVKGLSCPLPVLKANRALRGMRPGDRLRVVATDRASVAD
FT                   FQAFCRETGHALIAFGEDAGVLSFVIRRRPEQAPATDPGS"
FT   gene            103478..104401
FT                   /locus_tag="Gdia_0091"
FT   CDS_pept        103478..104401
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0091"
FT                   /product="ROK family protein"
FT                   /note="PFAM: ROK family protein; KEGG: gdi:GDI1864
FT                   glucokinase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ACI49891"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZJB3"
FT                   /protein_id="ACI49891.1"
FT                   /translation="MDMTDYRIGIDFGGTKIEIAALARKDGQELVRRRIVNPGYYDGAI
FT                   TAIRDLVAGVDTELGGQGTVGIGIPGSISPDTGVIKNANATWLNNQPFGRDLTAAVGRE
FT                   VRVENDANCFALSEAVDGAGAGFGVVLGVIIGTGMGAGIIVNGKLLIGAHHIAGEWGHV
FT                   PLPWPRIEEMPLPKCFCGNEGCLERYLSGSALAQDWKGPGNRSTAGIESAAEDGDQTAI
FT                   GALDRYMDRMARACAMAINFLDPDVIVLGGGVSNLQSIYDRVPLLMPRYVITPRCNTPI
FT                   VRNRHGDSSGVRGAAWLWSGDEGVGP"
FT   gene            complement(104542..105336)
FT                   /locus_tag="Gdia_0092"
FT   CDS_pept        complement(104542..105336)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0092"
FT                   /product="ribosomal RNA methyltransferase RrmJ/FtsJ"
FT                   /note="PFAM: ribosomal RNA methyltransferase RrmJ/FtsJ;
FT                   KEGG: gdi:GDI1865 putative ribosomal RNA large subunit
FT                   methyltransferase J"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ACI49892"
FT                   /db_xref="GOA:A9HIS5"
FT                   /db_xref="InterPro:IPR002877"
FT                   /db_xref="InterPro:IPR015507"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A9HIS5"
FT                   /protein_id="ACI49892.1"
FT                   /translation="MKRRPPAGGGKKRVPGKALTSSTTPGGASAQADSGAAQSTRNQAV
FT                   SLRTARGRTTAQQRWLNRQLNDPYVQAARKQGWRSRAAFKLIELDDRFHLIRPGMRVID
FT                   LGAAPGGWTQVAVKRGAAYVVGVDLLPVDPVAGATIIEGDFNDPDMPARLIDLLGGPAD
FT                   LVLSDMAPNTTGHAPTDHLRIIGLAELALDFAVKVLAPGGGFVAKVFQGGSEKQMLAPM
FT                   KQAFATVRHAKPPASRKESSELYVVATGFRPERISQDDVEAP"
FT   sig_peptide     complement(105238..105336)
FT                   /locus_tag="Gdia_0092"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.955) with cleavage site probability 0.848 at
FT                   residue 33"
FT   gene            complement(105333..106466)
FT                   /locus_tag="Gdia_0093"
FT   CDS_pept        complement(105333..106466)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0093"
FT                   /product="Ppx/GppA phosphatase"
FT                   /note="PFAM: Ppx/GppA phosphatase; KEGG: gdi:GDI1866
FT                   exopolyphosphatase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ACI49893"
FT                   /db_xref="InterPro:IPR003695"
FT                   /db_xref="UniProtKB/TrEMBL:A9HIS8"
FT                   /protein_id="ACI49893.1"
FT                   /translation="MDNTMSWRDGQEGPRLPHATGYKANQGVPGMYGAIDLGTNNCRLM
FT                   IAAPHEGGFRVVDSFNRVVRLGEGLQSTGQLSGDAMDRTIEALRICAARMGRRRLRRYR
FT                   AVATEACRRAGNGAAFIARARRETGLDITVISPREEAELVMESCGALLHDDRLSPARTR
FT                   AMLFDIGGGSTEIAWVRTDHRSRRQDLNGYLSLPAGVITLAEQFGDAAFSEDGYQRMVD
FT                   LVTRQLHAFERVHCIGREISRGNVSLMGTSGTVTTLASIALSLTRYSRTAVDGTILQSG
FT                   PALGAIRTLAAMGPMGLRQHPCVGPDRAAYVLPGCAIFEAIHKIWPVSDIVVADRGLRD
FT                   GMLLRMMHDSTAMALPSLPSSLPFAPSSLSSVGVSHP"
FT   gene            106634..106707
FT                   /locus_tag="Gdia_R0002"
FT                   /note="tRNA-Gln1"
FT   tRNA            106634..106707
FT                   /locus_tag="Gdia_R0002"
FT                   /product="tRNA-Gln"
FT   gene            complement(106851..108659)
FT                   /locus_tag="Gdia_0094"
FT   CDS_pept        complement(106851..108659)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0094"
FT                   /product="diguanylate cyclase with PAS/PAC sensor"
FT                   /note="KEGG: gdi:GDI1867 putative signalling protein, GGDEF
FT                   family; TIGRFAM: PAS sensor protein; diguanylate cyclase;
FT                   PFAM: GGDEF domain containing protein; MASE1 domain
FT                   protein; PAS fold-3 domain protein; PAS fold-4 domain
FT                   protein; PAS fold domain protein; SMART: PAS domain
FT                   containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ACI49894"
FT                   /db_xref="GOA:A9HIT0"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR007895"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:A9HIT0"
FT                   /protein_id="ACI49894.1"
FT                   /translation="MTGVFFIRNTLSTLLFCVIWSICALASVTWTRHGGSVSMIWPANA
FT                   ILVMAILRMPAFDHRIYPPLLFVLSSLVNLLDGRGWTTSVGFSVANTVEVMMAAVLVHR
FT                   ISPVSGFFEQVDWAFRFAIAIFVSVACSSVIAGGALFLGEGRDWLGGSAIWMMAHLPGL
FT                   LITVPMLLALMPDGEGREIRRNAPRRLTVLGLMVLVACMSVVVFGQSRFPLQFLLLPPL
FT                   LLATFHLYAKGAAMSVAIITMIGSFFMFTGAGAVTMLHGPAALKVYVFQLDLATIFFCA
FT                   LPLGAVLTQRDQKASLAQQRLQDFHHLADRVGDVLFRVDDAGCWSYLNPAYEQMSGISV
FT                   DKRLGQPMLDAVVIEDRAALAQAQAELQSGSRDDLRQVVSIYRRDGTVRHVEILAHRLG
FT                   EGEGFGGLIRDVTDQLTLDAHNRQIAAAYEQAANTDELTGLPNRRAFFQVLDGQMAAAS
FT                   SVVAAAMLDLDHFKSINDKYGHPIGDIVLRRVATVVRATLRDTDMVARIGGEEFAVLIT
FT                   SESRDRAISLIRRVVRAVSAESIDLPTGVRLQVTISAGIACREAGEDRNALMSRADQAL
FT                   YVAKRTGRNRLTIADASTAATQAATP"
FT   sig_peptide     complement(108579..108659)
FT                   /locus_tag="Gdia_0094"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.997) with cleavage site probability 0.982 at
FT                   residue 27"
FT   gene            complement(108857..109303)
FT                   /locus_tag="Gdia_0095"
FT   CDS_pept        complement(108857..109303)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0095"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gdi:GDI1869 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ACI49895"
FT                   /db_xref="InterPro:IPR030972"
FT                   /db_xref="UniProtKB/TrEMBL:A9HIT5"
FT                   /protein_id="ACI49895.1"
FT                   /translation="MTIPAWMAGATRKECGTIGTPATQRPHRRGVGIGLSLLMGVLPLA
FT                   LPHGTRAQDNAANAERVTVEGEIRRVPVFFHRADVETLWRARHLVTRLDRAALEACGDN
FT                   NAIAEEMRRAIERSDCRRDAVMRAVKDVNAVTLDRAVARYGLPQ"
FT   gene            complement(109518..110234)
FT                   /locus_tag="Gdia_0096"
FT   CDS_pept        complement(109518..110234)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0096"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gdi:GDI1871 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ACI49896"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A9HIU0"
FT                   /protein_id="ACI49896.1"
FT                   /translation="MFGWPKKKNLSRHGTPDGRSKILITGTGRAGTTMLMQLFTALDFH
FT                   TGYTFEQAMKEVDPISHAGLENLDFGPESPYVLKSPNYADLLLPMVQEGQVKIHAAIVP
FT                   MRNLYSAAESRRRVTRDAARTGFDPEIEYPGGLWLTRTHDEQESILAIQFYKIMWGLTL
FT                   FGVRPYMVEFPKFAEKSDYLWTQLEQLMNEHGVTESEFRAAFGRILRKDLIHTFQPVTA
FT                   SPPMEITGELSDKRKT"
FT   gene            complement(110416..110490)
FT                   /locus_tag="Gdia_R0003"
FT                   /note="tRNA-Thr3"
FT   tRNA            complement(110416..110490)
FT                   /locus_tag="Gdia_R0003"
FT                   /product="tRNA-Thr"
FT   gene            110772..110990
FT                   /locus_tag="Gdia_0097"
FT   CDS_pept        110772..110990
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0097"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gdi:GDI1873 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ACI49897"
FT                   /db_xref="GOA:A9HIU5"
FT                   /db_xref="UniProtKB/TrEMBL:A9HIU5"
FT                   /protein_id="ACI49897.1"
FT                   /translation="MMLNSTIIEIDGIFLGTAILVAGSRLLRFYAVHDSVRALHNQVLP
FT                   DLAALRHAVGLHFRRVLKRRGRPDQGC"
FT   gene            complement(111022..112287)
FT                   /locus_tag="Gdia_0098"
FT   CDS_pept        complement(111022..112287)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0098"
FT                   /product="D-isomer specific 2-hydroxyacid dehydrogenase
FT                   NAD-binding"
FT                   /note="PFAM: D-isomer specific 2-hydroxyacid dehydrogenase
FT                   catalytic region; D-isomer specific 2-hydroxyacid
FT                   dehydrogenase NAD-binding; KEGG: gdi:GDI1874
FT                   D-3-phosphoglycerate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ACI49898"
FT                   /db_xref="GOA:B5ZJV9"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR029752"
FT                   /db_xref="InterPro:IPR029753"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZJV9"
FT                   /protein_id="ACI49898.1"
FT                   /translation="MSSETTSHLSLPKDKIRILLLEGIHDSAVALLKANGYENVTRLSK
FT                   ALEGAALRKALEGVHIVGIRSRTQLTEDMIAAADRLIAVGCFCIGTNQVNLPAARAHGI
FT                   PVFNAPFSNTRSVAELVMGEIVMLMRRIFPKSVQCHAGDWNKSAANSWEVRGKTLGIVG
FT                   YGSIGSQLSVLAEAFGMRVIYFDVIDKLVHGNASPVETLNDLLAQSDVVSLHVPQLAST
FT                   ANLIGAEQIRAMKPGSFLINNARGNVVDLEALAAALRDGHLLGAAIDVFPVEPKGAGDK
FT                   FVSPLQGLENVILSPHIGGSTAEAQERIGVEVARKLIEYSDVGSTLGAVNFPTVQLPES
FT                   PRGTRFMHVHSNVPGIMLQINEIFMSENSNITAQYLQTDGELGYVVVEADTGRDIDKDN
FT                   RILGRLRNLKGTIRARLLYQQP"
FT   gene            complement(112402..113226)
FT                   /locus_tag="Gdia_0099"
FT   CDS_pept        complement(112402..113226)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0099"
FT                   /product="inositol monophosphatase"
FT                   /note="PFAM: inositol monophosphatase; KEGG: gdi:GDI1875
FT                   inositol-1-monophosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ACI49899"
FT                   /db_xref="GOA:A9HIV0"
FT                   /db_xref="InterPro:IPR000760"
FT                   /db_xref="InterPro:IPR020583"
FT                   /db_xref="UniProtKB/TrEMBL:A9HIV0"
FT                   /protein_id="ACI49899.1"
FT                   /translation="MSLATPLPPHDADRLVAAAMAAADVAGCVIRPFFRMGVAADDKSD
FT                   QSPVTIADRTAERAIRAVLAERLPDHAVLGEEFGLERGGARYCWVIDPVDGTRAFLTGR
FT                   PIFGTLIALLQDGEPVLGIIDQPVTGERWIGVRGRPTRYESRWPGTAGTRECPEIGLAE
FT                   LSCTSPEMIADAPTPHWDALRRHAKRVTWGGDCYSYGLLALGQVDIIAECTMKIWDWAA
FT                   LVPVIEGAGGRVTDWHGRPLHADSDGTVLAVGDPALLPGVVSLLTTGSPKHA"
FT   gene            complement(113229..113756)
FT                   /locus_tag="Gdia_0100"
FT   CDS_pept        complement(113229..113756)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0100"
FT                   /product="cytochrome c class I"
FT                   /note="PFAM: cytochrome c class I; KEGG: gdi:GDI1876
FT                   putative cytochrome c homolog"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ACI49900"
FT                   /db_xref="GOA:A9HIV3"
FT                   /db_xref="InterPro:IPR002327"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:A9HIV3"
FT                   /protein_id="ACI49900.1"
FT                   /translation="MDSKDVNRIGAAILVAALALGASAWAGYVAIPSGTPGHPAFVLPQ
FT                   PAVAADASGPAAAPPSIADAVAHADPKAGQALAARMCAMCHSFAKDGPAMIGPDLYGVP
FT                   GTAIGDMPGYEFSAALAAHKAERWTDDALSSWLEGPGRFAPGTRMAFPGVADAADRAAI
FT                   IAFLHTLSDGAH"
FT   sig_peptide     complement(113676..113756)
FT                   /locus_tag="Gdia_0100"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.814 at
FT                   residue 27"
FT   gene            113930..114673
FT                   /locus_tag="Gdia_0101"
FT   CDS_pept        113930..114673
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0101"
FT                   /product="3-deoxy-manno-octulosonate cytidylyltransferase"
FT                   /EC_number="2.7.7.38"
FT                   /note="PFAM: acylneuraminate cytidylyltransferase; KEGG:
FT                   gdi:GDI1877 putative 3-deoxy-manno-octulosonate
FT                   cytidylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ACI49901"
FT                   /db_xref="GOA:B5ZJW2"
FT                   /db_xref="InterPro:IPR003329"
FT                   /db_xref="InterPro:IPR004528"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZJW2"
FT                   /protein_id="ACI49901.1"
FT                   /translation="MNPIVVIPARMASTRLPGKPLAMIGKLPMILHVLARARAADIGPV
FT                   IVAVAETELARVVEDAGGTAVLTDPALPSGSDRVWQAVRAADPAGRHDVVVNLQGDLPG
FT                   VAPPTLAASLLPLADPATDIGTLVCPVADAGEAARDSVVKVACAFADDDARTVARALYF
FT                   SRAAVPWGAGALWHHVGIYAYRRAALARFVSLPEAALERRERLEQLRALEAGMTIGCCR
FT                   IGTAPFGVDTPDDLDRARRVMAEAA"
FT   gene            114670..115533
FT                   /locus_tag="Gdia_0102"
FT   CDS_pept        114670..115533
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0102"
FT                   /product="Prephenate dehydratase"
FT                   /EC_number="4.2.1.51"
FT                   /note="PFAM: prephenate dehydratase; amino acid-binding ACT
FT                   domain protein; KEGG: gdi:GDI1878 putative P-protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ACI49902"
FT                   /db_xref="GOA:A9HIV9"
FT                   /db_xref="InterPro:IPR001086"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR008242"
FT                   /db_xref="UniProtKB/TrEMBL:A9HIV9"
FT                   /protein_id="ACI49902.1"
FT                   /translation="MSGVIAFQGRPGAYSDLACRQAYPGWTTLPCETFAGAIAAVHDGQ
FT                   ADLAMLACENSLAGRVPDIHALLPQAGLNIIGEHFQRVEHCLMGVPGSTLAGARRVHTH
FT                   PVAMAQIRGIITELNLTPVVEFDTAGSAELIAQWGNPEDVAVASSLAAELNGLVVLRGN
FT                   VEDAAHNTTRFYVASRTALRPPAGRPGTITTVLFRVRNVAGALYKVLGGFATNGVNMTR
FT                   LESYMLDGSFAATQFLMEVEGHPDDAPLRGALAELAFFSETSTILGVYPGSPFRAEHAQ
FT                   GQTAGQ"
FT   gene            115676..116557
FT                   /locus_tag="Gdia_0103"
FT   CDS_pept        115676..116557
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0103"
FT                   /product="dihydrodipicolinate synthase"
FT                   /EC_number="4.3.3.7"
FT                   /note="KEGG: gdi:GDI1879 dihydrodipicolinate synthase;
FT                   TIGRFAM: dihydrodipicolinate synthase; PFAM:
FT                   dihydrodipicolinate synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ACI49903"
FT                   /db_xref="GOA:A9HIW2"
FT                   /db_xref="InterPro:IPR002220"
FT                   /db_xref="InterPro:IPR005263"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR020624"
FT                   /db_xref="InterPro:IPR020625"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9HIW2"
FT                   /protein_id="ACI49903.1"
FT                   /translation="MFKGSITALITPMNDDGSLDFSGFGRFVDWQVTEGSSGVVPVGTT
FT                   GESPTLTHEEHARIVEYTVQVVAGRIPVIAGAGSNSTAEAVGMARHAKSVGADGVLVVA
FT                   PYYNKPTQEGLYRHFMTVADATDLPLIIYNIPGRSVVDISVETMARMAQHARIVGVKDA
FT                   TANLLRPLQVRRAIRHKPFTQLSGEDGTVVSFLAAGGEGCISVTSNIAPRLCAELHRAW
FT                   QDGRVADAMAIQDRLSAVHDALFCESNPGPVKYAASLLGLAGETCRLPLAPLAEDSRMR
FT                   VREALTGAGLLN"
FT   gene            116562..117050
FT                   /locus_tag="Gdia_0104"
FT   CDS_pept        116562..117050
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0104"
FT                   /product="SsrA-binding protein"
FT                   /note="TIGRFAM: SsrA-binding protein; PFAM: SmpB protein;
FT                   KEGG: gdi:GDI1880 putative SsrA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ACI49904"
FT                   /db_xref="GOA:A9HIW5"
FT                   /db_xref="InterPro:IPR000037"
FT                   /db_xref="InterPro:IPR020081"
FT                   /db_xref="InterPro:IPR023620"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9HIW5"
FT                   /protein_id="ACI49904.1"
FT                   /translation="MAEKKKSGMISTGIAAQNRKGRFNYTILETLEAGMVLKGPEVKSL
FT                   RLGRATINEAYAGDRDGEIWLFNSYIPEYQGGVLSRFETRAPRKLLLHRKQVDKLLGAV
FT                   ARDGVTLVPLDIHFNARGVAKVTLGIGEGRKKADKRQAIADRDWQRDKARLLRNKGRE"
FT   gene            complement(117115..117729)
FT                   /locus_tag="Gdia_0105"
FT   CDS_pept        complement(117115..117729)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0105"
FT                   /product="cold-shock DNA-binding domain protein"
FT                   /note="PFAM: Cold-shock protein DNA-binding; SMART: Cold
FT                   shock protein; KEGG: gdi:GDI1881 cold shock-like protein
FT                   CspE"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ACI49905"
FT                   /db_xref="GOA:B5ZJW6"
FT                   /db_xref="InterPro:IPR002059"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019844"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZJW6"
FT                   /protein_id="ACI49905.1"
FT                   /translation="MSSPSFGDRSGGGAPRRPMGGGAPSQVIASGPEISAAVKWFNSEK
FT                   GFGFVELSDGSGDVFLHANALATSGHDSVSPGTTLVVRIGQGPKGRQVASVVSVDDSTA
FT                   QPERPRGFGAPRAAAGGFGGRPSRPAPDLSQAQEMRGVVKWYNATKGFGFITPESGGKD
FT                   IFVHASALERSGLTGLTEGQTANVQVVQGQKGPEAASISVD"
FT   gene            118178..119227
FT                   /locus_tag="Gdia_0106"
FT   CDS_pept        118178..119227
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0106"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gdi:GDI1883 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ACI49906"
FT                   /db_xref="InterPro:IPR018707"
FT                   /db_xref="InterPro:IPR037107"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZJW7"
FT                   /protein_id="ACI49906.1"
FT                   /translation="MEGKLMSQAKTWKRTGWMVRAGTLAGIGSLAMAAQPARATPLQDP
FT                   YGTWTVQGENDAVSTLNGTSDQYYTSGLRVNWTSGTDNQPAPIETINHAIMGKGVTRIS
FT                   LGVQQLIFTPHDTQLATPSPSDRPYAGLLLGTVNLINDTDLSRSVFGIQFGVMGPDAMG
FT                   RQLQNGFHSAIGDTSNLGWKHQLANQPVFQVQGGRTWRLPMANIYGVEMDMMPATSAAI
FT                   GDYRIYGTVADTFRIGQGLRSDFGIPTIGPGTDGTDAYRLTRPVAWYVFGNVTGSAVAY
FT                   DATLQGNTLRSGSPHVPMNWDVGEIHAGVAIMWHGMRLSYSQVWQTQEFRGARSGLFNY
FT                   GSLALSGKF"
FT   sig_peptide     118178..118297
FT                   /locus_tag="Gdia_0106"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.739 at
FT                   residue 40"
FT   gene            complement(119233..121362)
FT                   /locus_tag="Gdia_0107"
FT   CDS_pept        complement(119233..121362)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0107"
FT                   /product="DEAD/DEAH box helicase domain protein"
FT                   /note="PFAM: helicase domain protein; nucleic acid binding
FT                   OB-fold tRNA/helicase-type; DEAD/DEAH box helicase domain
FT                   protein; SMART: DEAD-like helicases; KEGG: gdi:GDI1884
FT                   putative ATP-dependent DNA helicase RecG"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ACI49907"
FT                   /db_xref="GOA:B5ZJW8"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZJW8"
FT                   /protein_id="ACI49907.1"
FT                   /translation="MKAVEHHVSGIILQDERGDNLGPLLAPLGSLPGVGPALAKLLARA
FT                   VRGQRVIDLLFHLPESVVDRRYRPSLRDAVPGRVATMQVTVRRIDAPARGTRQPWRVLV
FT                   SDGAGTAELVFFSSYQARRMRVGSAVAVSGTLDAFGDRLQMAHPDHIVPGGDIDRIPAL
FT                   EPVWPLTAGLFPRHVRAALHQAFLPFPPLPEWLDSVLVARRHWPNFETALRQLHCPEAF
FT                   PDLLRGDAWQAAGERARQRLACDELLAEQVAMSEARRRNRNRPGRSIVGTGTLRAEALA
FT                   RFGYTPTRAQHRAVREIDSDLAASYPMMRLLQGDVGAGKTLVAMLAMLAAAEAGHQAVL
FT                   MAPTEILARQHLATFQKLAPVPVAFLSGSVKGRARRTVLEDIASGRAPLVVGTHALFQD
FT                   KVVFDDLALAVIDEQHRFGVEQRLLLGEKGDRADILVMTATPIPRTLLLTQWGEMQVSR
FT                   LNEKPAGRLPVRTSLHAMASLGDVLDGIGRAIARGALVFWVCPLVTESEAMDLAAAEAR
FT                   FAALTERFGPIVGLAHGQQDIAVREAAIADFAAGRTKILVATTVIEVGVDIPAATIMVI
FT                   EHAERFGLAQLHQLRGRVGRGRDESFCLLLHDDALGSTARRRLALLRDTEDGFLIADED
FT                   FRLRGGGDVTGRRQSGLPDLRLATGARLDLLLTIAAQDAQRVAEGGASESRRNAIAQLL
FT                   ELFDRHDAARILRSG"
FT   gene            121491..121802
FT                   /locus_tag="Gdia_0108"
FT   CDS_pept        121491..121802
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0108"
FT                   /product="protein of unknown function DUF339"
FT                   /note="PFAM: protein of unknown function DUF339; KEGG:
FT                   gdi:GDI1885 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ACI49908"
FT                   /db_xref="InterPro:IPR005631"
FT                   /db_xref="InterPro:IPR036714"
FT                   /db_xref="UniProtKB/TrEMBL:A9HIX9"
FT                   /protein_id="ACI49908.1"
FT                   /translation="MSIDSPDLTNLDPRRRRLYFRATHRGTHETDILIGGFVAPRLAGL
FT                   TDAEMDALEEVMELPDADLADWLSGRKPVPAEVDGPMMRAIMADANDPARQAAIRGER"
FT   gene            121799..125269
FT                   /locus_tag="Gdia_0109"
FT   CDS_pept        121799..125269
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0109"
FT                   /product="transcription-repair coupling factor"
FT                   /note="KEGG: gdi:GDI1886 putatve transcription-repair
FT                   coupling factor; TIGRFAM: transcription-repair coupling
FT                   factor; PFAM: helicase domain protein; transcription factor
FT                   CarD; TRCF domain protein; DEAD/DEAH box helicase domain
FT                   protein; SMART: DEAD-like helicases"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ACI49909"
FT                   /db_xref="GOA:B5ZJX0"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR003711"
FT                   /db_xref="InterPro:IPR004576"
FT                   /db_xref="InterPro:IPR005118"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036101"
FT                   /db_xref="InterPro:IPR037235"
FT                   /db_xref="InterPro:IPR041471"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZJX0"
FT                   /protein_id="ACI49909.1"
FT                   /translation="MRAPGTEHAGWATIWGAPDGFDAFLVARRAREHDGPVLHVARDDA
FT                   GMARIGELLSFVAPNAEILRFPSWDCLPYDRVSPNPAIVAERVATLTRLLEPATAPRIV
FT                   LTTVGGLVQRVAPRAAFRGQSLTLAAGDSLDQALLIDLLVAAGYNRTDTVMEPGEFATR
FT                   GGIFDIFPSGEAEPVRLDLFGDEVENIRRFDPATQRSSDRLDRFVMRPVADFTLDQASI
FT                   SRFRTGWRDLFGPAAASDPLYEHVSDGRRHAGLEHWLPLFHEHLETLVDYLPGVSIILA
FT                   HQVEDVLAARLEMIADHFEARRQPVREGEVPYRALPPHLMYLDRKGWDGILSGHPVMLF
FT                   SPFARPDNAGGVDAGGRPGILFASVAGGGARENVFAMLDTQVRQWAETGRRAYVSAWTR
FT                   GSRERIATLLREHGMRVETFDGWARAQDLPPGTVGLLTLGLERGFIADNLAFVSEQDLL
FT                   GERISRPPRRRKKADQFIAEASEIAEGDLVVHQDYGIGRYDGLETIGVGTAPHDCLRLI
FT                   YDGNEKLFLPVENIELLSRFGSDQAGVALDKLGGASWQNRKARMKQRIRDMAGELIRTA
FT                   ALRALREAPSMTPAEGMWDEFCARFPFVETEDQSRAIADVLEDMGSGRPMDRLVCGDVG
FT                   FGKTEVALRAAFVAALSGAQVAVVVPTTLLARQHFRTFSARFSGLPITVAQLSRMVTPK
FT                   EATAVRKGLADGTINIVIGTHALLAKGVQFADLELLIIDEEQHFGVAHKEKLKALREDV
FT                   HVLTLSATPLPRTLQLALTGVREMSLIATPPTDRLAVRTFIMPFDSVVIREAIQRERFR
FT                   GGQIFCVVPRIEDLDRMAARLQDIVPDARLVQAHGRLTPTELERVMTEFSDGKYDILLS
FT                   TNIVESGLDMPAVNTLIIHRADMFGLGQLYQLRGRVGRGKQRGYAYLTWPQTHVLSAAA
FT                   EKRLEVMQTLDTLGAGFTLASHDLDLRGAGNLLGDEQSGHIREVGIELYQQMLEDAVAE
FT                   LRVEKGRRKAQDRDWTPNIILGLPVLIPETYVPDLPVRLGLYRRIAGLANDAEIEAMEA
FT                   ELVDRFGTMPDEVRNLLDVVAIKRLCREAGVERLEAGPKGMVIQFRGNSFANPGGLVTW
FT                   IAAHKEGNVRLRPDHKLALVREMTNAQRIRLAKDTVQTLGRLAGQEKAA"
FT   gene            125328..126122
FT                   /locus_tag="Gdia_0110"
FT   CDS_pept        125328..126122
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0110"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   gdi:GDI1887 3-oxoacyl-[acyl-carrier-protein] reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ACI49910"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A9HIY5"
FT                   /protein_id="ACI49910.1"
FT                   /translation="MKIDLAGKSAIVTGSTAGIGLAIAVALAETGAEVIVNGRSQARVD
FT                   EAMAHIRVRMPTARLRGVPGDLGTGEGIDSFIRTIPQADILVNNLGIFEQEDFLKTSDA
FT                   DWQRFFDVNVMSGVRLTRHYLPGMVERKWGRVVFISSESALNIPADMIAYGFTKAAQVA
FT                   IARGIAESVPGTGVTVNSVLPGPTRTEGVMEMFEKAARESGRTVQDVVDEFIPAHRPTS
FT                   LIRRLAEPEEIASMVAYVCSPQASATTGATLRVEGGLLRHPG"
FT   sig_peptide     125328..125414
FT                   /locus_tag="Gdia_0110"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.985) with cleavage site probability 0.954 at
FT                   residue 29"
FT   gene            complement(126137..127060)
FT                   /locus_tag="Gdia_0111"
FT   CDS_pept        complement(126137..127060)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0111"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gdi:GDI1888 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ACI49911"
FT                   /db_xref="UniProtKB/TrEMBL:A9HIY7"
FT                   /protein_id="ACI49911.1"
FT                   /translation="MRILSLSAVLAGLLAAAGPAGATPLPETCAQARTGGLSVSGNVAA
FT                   ARDYVLRFSPGGEAPSLHARMVTVKGGDAAGTDARDILNAASLVLLGALTNHHGAGCPS
FT                   EYFASSVGPLLNGLKAGQGYDVAWTAPVVNNGGARLSFAALHLHLGGAELGGPVVVALD
FT                   VRDAQASGNTVLASLLPQQARSNFSIPAQSLGPLLAATAGHPARSVLVPVTITTLMAQH
FT                   GDLRLNGRGTAMLTGNADANSAAGHLSLSNLPELIATLRAAGQARATTALILANLVGRH
FT                   ADADTSWDVEWQGGVLTINQIPLPLR"
FT   sig_peptide     complement(126992..127060)
FT                   /locus_tag="Gdia_0111"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.997 at
FT                   residue 23"
FT   gene            127178..128164
FT                   /locus_tag="Gdia_0112"
FT   CDS_pept        127178..128164
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0112"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gdi:GDI1889 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ACI49912"
FT                   /db_xref="GOA:B5ZJX3"
FT                   /db_xref="InterPro:IPR016833"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZJX3"
FT                   /protein_id="ACI49912.1"
FT                   /translation="MFKPDPFLLSLICTVLLATIVPCHGAAVPMFQDLAIAVIAVMFFL
FT                   QGARLSRQAVLGGIVNWRLHLAILLCTFALFPLLGMGLHALFPHLLHQSVWLGILFLCC
FT                   LPSTVQSSIAFTSIARGNVPAAVCAATTSNIAGIFITPVLTGLVLERQGAASGHGGVLA
FT                   IMMQLLLPFVLGQVLQPWLGAWAHRNKRLLSMTDRGSILIVVYTAFSEAVVQGLWHKLP
FT                   LSQIGLVMVVDGVLLAAVLLATTMGSRVLGFPREDEIAIVFCGSKKTLASGVPMANVLF
FT                   APATVGLVVLPLMIYHQIQLFVCAVLARRYAAAHDRLAEAEAVVERA"
FT   sig_peptide     127178..127255
FT                   /locus_tag="Gdia_0112"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.997 at
FT                   residue 26"
FT   gene            complement(128161..128964)
FT                   /locus_tag="Gdia_0113"
FT   CDS_pept        complement(128161..128964)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0113"
FT                   /product="putative hydrolase protein"
FT                   /note="KEGG: gdi:GDI1890 putative hydrolase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ACI49913"
FT                   /db_xref="GOA:B5ZJX4"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZJX4"
FT                   /protein_id="ACI49913.1"
FT                   /translation="MFFGQLELMELAWGAGQCRARLGGKGPLLVFLHGQVQSHVAWHAV
FT                   APAFSRTHTVLCPDLPHHFDFSQQARDLLRAAHALGHDRLAIVGHGTGGHVAAHAAAQA
FT                   PHRVTHVAEIECIPSPSHHGRTDLAFELSQYQACWFAQLHPKPESATVTIPEAWTRPEP
FT                   DSAGPFNRSAVADYLDKVPPGQSPGATGHFRIPPYPADLRIGCPVLVAWSRDGRLGGWY
FT                   DPTDLWRPYATGPVTGVELACGYYIPEEAPQALADTLTSFLAPKA"
FT   gene            129092..130534
FT                   /locus_tag="Gdia_0114"
FT   CDS_pept        129092..130534
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0114"
FT                   /product="Pyridoxal-dependent decarboxylase"
FT                   /note="PFAM: Pyridoxal-dependent decarboxylase; KEGG:
FT                   gdi:GDI1891 putative tyrosine decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ACI49914"
FT                   /db_xref="GOA:B5ZJX5"
FT                   /db_xref="InterPro:IPR002129"
FT                   /db_xref="InterPro:IPR010977"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZJX5"
FT                   /protein_id="ACI49914.1"
FT                   /translation="MTGLDPDNWDDLRSLGHRMVDDMIDRLATLRDGPVWRPMPPEIRT
FT                   ALHTDLPAAPTPPEALYDRFRDQIAPYATGNTHPGFMGWVHGGGTGVGMLAELLAGGLN
FT                   ANCGGRDHAPVEIERTVIGWAAEIMGFPADATGVLVTGSSMANMIAVITASRAVADGIT
FT                   LRQRGVGGRQLVGYAAATAHGCIARAFDLAGLGTDALRIIPVDSTHRMDIQALRAAVES
FT                   DRQQGFEPFIVIGTAGTVDTGSIDDLGAIADIAGQEDIWFHVDGAFGALAMLSRTLRPH
FT                   LRGLDRADSLAFDFHKWAQVPYDAGCILVREPGRQAAAFAQSLAYLSREDRGLAGNAPW
FT                   FCDLGPDLSRGFRALKVWMTLGTYGTVRLGQMVDECCAVAAHLARRVDREPLLERLAPV
FT                   GLNIVCFRVRVPDVELDWLNGELVKDLHESGIAAPSTTMVGGVKAIRAAIVNHRTVAAD
FT                   VDLMVDAVLRLAQERQGLGQRA"
FT   gene            complement(130556..132457)
FT                   /locus_tag="Gdia_0115"
FT   CDS_pept        complement(130556..132457)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0115"
FT                   /product="cobalt chelatase, pCobT subunit"
FT                   /EC_number="6.6.1.2"
FT                   /note="KEGG: gdi:GDI1892 putative cobalamin biosynthesis
FT                   protein CobT; TIGRFAM: cobalt chelatase, pCobT subunit;
FT                   PFAM: Cobalt chelatase CobT subunit; SMART: von Willebrand
FT                   factor type A"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ACI49915"
FT                   /db_xref="GOA:A9HIZ8"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR006538"
FT                   /db_xref="InterPro:IPR025861"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:A9HIZ8"
FT                   /protein_id="ACI49915.1"
FT                   /translation="MRDRKDTTQSARLAAAERADVFKRATVGALRALGGRATAEVTFQT
FT                   GPIPPAAAVSGDHVRLPQPALQLAEADIRRVRGAADAVALQLRHHDVTIHNATRPEQAD
FT                   ARLAYDALEQARVESFGARHMAGVAANLRNQAERDYHDRGYDRAQARDQIPVQVALSLL
FT                   ARERMTGEPVPESMRAMAEQWRAHLGPSALRALDDMAAHQDDQMAFSRAAKRLLVACEL
FT                   IEGEAEIEEDEDGDDSAPSDETEEEPGEAPEKPQPQDEDASGQQEDETGLQPQLAQGAG
FT                   AGDDNPDESEPGGTAGSEEAGGPRGTDDQEATDPASLYHAFTTAFDEEIAAEDLCDADE
FT                   LARLRQQLDHQLLSLQGVVSRLANRLQRRLLAQQTRAWEFDLEEGILDAGRLSRVVVNP
FT                   TLSLSYKHERDTDFRDTVVTLLIDNSGSMRGRPISVAAMCGDILARTLERCAVKVEVLG
FT                   FTTRAWKGGQSRERWVAQGKPANPGRLNDLRHIIYKSADMPWRRARKNLGLMLREGLLK
FT                   ENIDGEALLWAWRRLQGRPESRKILMVISDGAPVDDSTLSVNAGSYLETHLRQVIAQIE
FT                   NRSGVELVAIGIGHDVTRYYRRAVTISDAEELGGTMMQKLSELFDEKVAVAGRRRIA"
FT   gene            complement(132473..133504)
FT                   /locus_tag="Gdia_0116"
FT   CDS_pept        complement(132473..133504)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0116"
FT                   /product="cobalt chelatase, pCobS small subunit"
FT                   /EC_number="6.6.1.2"
FT                   /note="KEGG: gdi:GDI1893 putative aerobic cobaltochelatase
FT                   CobS; TIGRFAM: cobalt chelatase, pCobS small subunit; PFAM:
FT                   ATPase associated with various cellular activities AAA_5"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ACI49916"
FT                   /db_xref="GOA:B5ZJX7"
FT                   /db_xref="InterPro:IPR006537"
FT                   /db_xref="InterPro:IPR011704"
FT                   /db_xref="InterPro:IPR025865"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZJX7"
FT                   /protein_id="ACI49916.1"
FT                   /translation="MNDLATLTAGSTAENGDDLPPISVLSAPDRTVSARDVFGIDSDLQ
FT                   VPAFSVRTDHVPDADPTYRFDHDTTLAILAGFAFNRRVMIQGYHGTGKSSHVEQVASRL
FT                   NWPCVRINLDSHISRIDLIGKDAIVLRDGKQVTEFREGLLPWGLQHPCALVFDEYDAGR
FT                   PDVMFVIQRVLEVEGHLTLLDQNRVIRPHPFFRLFATANTVGLGDTTGLYHGTQQINQG
FT                   QMDRWNVVTTLNYLPHAEETAIVVAKMAVDPSDAPARKRIESMVALADLTRSGFIAGDI
FT                   STVMSPRTVISWAENARIFKDLEFAFRVSFLNKCDEAERPTVAEYYQRCFNVDPTGTAP
FT                   RAR"
FT   gene            complement(133657..134187)
FT                   /locus_tag="Gdia_0117"
FT   CDS_pept        complement(133657..134187)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0117"
FT                   /product="heat shock protein DnaJ domain protein"
FT                   /note="PFAM: heat shock protein DnaJ domain protein; KEGG:
FT                   gdi:GDI1894 putative chaperone protein DnaJ"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ACI49917"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:A9HJ04"
FT                   /protein_id="ACI49917.1"
FT                   /translation="MAGCAEAAGYRAPRSRDALNEYFWFCLPHVREYNSRWDFYKGMSP
FT                   GQIEAHIRDDVSWNRPSWRLGQRGAHFSEEDILDPLDLMNGGRRPAARRAASARPEVPE
FT                   ALRQPLDTLGLDWPLSMDELKLRYKDLARRHHPDTNGGDREAEERLKSINVAYTALRTH
FT                   LASARAADLERTA"
FT   gene            134270..134665
FT                   /locus_tag="Gdia_0118"
FT   CDS_pept        134270..134665
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0118"
FT                   /product="BolA family protein"
FT                   /note="PFAM: BolA family protein; KEGG: gdi:GDI1895
FT                   BolA-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ACI49918"
FT                   /db_xref="InterPro:IPR002634"
FT                   /db_xref="InterPro:IPR036065"
FT                   /db_xref="UniProtKB/TrEMBL:A9HJ07"
FT                   /protein_id="ACI49918.1"
FT                   /translation="MRPDRIRARAKRASQEEDRPVSDTERNRATRIGQALHARLTPAIL
FT                   EIEDDSARHAGHAGARHAGRGPETTGETHYNILLVSGAFGGISRVQRSRLVHDLLADEF
FT                   ASGLHALSLTLRTPDEHAALAAGTAGA"
FT   gene            134662..135270
FT                   /locus_tag="Gdia_0119"
FT   CDS_pept        134662..135270
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0119"
FT                   /product="outer membrane lipoprotein carrier protein LolA"
FT                   /note="PFAM: outer membrane lipoprotein carrier protein
FT                   LolA; KEGG: gdi:GDI1896 putative outer membrane lipoprotein
FT                   carrier protein LolA"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ACI49919"
FT                   /db_xref="GOA:B5ZJY0"
FT                   /db_xref="InterPro:IPR004564"
FT                   /db_xref="InterPro:IPR029046"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZJY0"
FT                   /protein_id="ACI49919.1"
FT                   /translation="MIVRNGPTRRLVLTAPLALAACQAAPGPVGGRDVARIERYLNTTR
FT                   GLSAHVAQTWPDGGVGEGTLSYDPGYLRLDYDTPHRMRLVAAGGHLVFRDAVRQSVTRM
FT                   NLSRQPLGLLLATPVHLGGEVTVTAIQHGDHVLQVSLARTANPSQGLLTLGFSDFAGQL
FT                   SLVAIDILDERHNRTRLHLTDQRTGTAFPADFFSLTAEL"
FT   sig_peptide     134662..134736
FT                   /locus_tag="Gdia_0119"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.992) with cleavage site probability 0.949 at
FT                   residue 25"
FT   gene            complement(135273..135971)
FT                   /locus_tag="Gdia_0120"
FT   CDS_pept        complement(135273..135971)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0120"
FT                   /product="lipoate-protein ligase B"
FT                   /note="TIGRFAM: lipoate-protein ligase B; PFAM:
FT                   biotin/lipoate A/B protein ligase; KEGG: gdi:GDI1897
FT                   lipoyltransferase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ACI49920"
FT                   /db_xref="GOA:A9HJ12"
FT                   /db_xref="InterPro:IPR000544"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="InterPro:IPR020605"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9HJ12"
FT                   /protein_id="ACI49920.1"
FT                   /translation="MHDRRAMTEKTILWNSSPGLVPYPDAIAGMEHQVAGIRDGSAPER
FT                   VWLLEHPPTFTAGTSARDEDLFNPHHFPTYAAGRGGQWTYHGPGQRVAYVMLDLTAPHG
FT                   VVPARDLRAYVHTLEEWLIRTLRRFDVTGERRADRIGVWVVDARTGAENKIAALGVRVS
FT                   RWTCWHGVALNVAPNLDDFGGIVPCGIREHGVTSLHALGHKVSLGDVDEALRATWQDLF
FT                   GSVPTPIGTA"
FT   gene            136027..136112
FT                   /locus_tag="Gdia_R0004"
FT                   /note="tRNA-Leu1"
FT   tRNA            136027..136112
FT                   /locus_tag="Gdia_R0004"
FT                   /product="tRNA-Leu"
FT   gene            136436..137308
FT                   /locus_tag="Gdia_0121"
FT   CDS_pept        136436..137308
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0121"
FT                   /product="UTP-glucose-1-phosphate uridylyltransferase"
FT                   /note="TIGRFAM: UTP-glucose-1-phosphate
FT                   uridylyltransferase; PFAM: Nucleotidyl transferase; KEGG:
FT                   gdi:GDI1898 UTP--glucose-1-phosphate uridylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ACI49921"
FT                   /db_xref="GOA:B5ZJY2"
FT                   /db_xref="InterPro:IPR005771"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZJY2"
FT                   /protein_id="ACI49921.1"
FT                   /translation="MIKPLRKAVLPVAGLGTRFLPATKAMPKEMLPVVDRPLIQYAIDE
FT                   ARAAGIEEFCLITGRGKDSLIDYFDVAFELETTLRERNKLDALEALGPTSIEAGALSAV
FT                   RQQEPLGLGHAIWCARSFIGDDPFAILLPDDVVKSDVPCLKQLVDVYNQTGGNVLAVTE
FT                   VPREHTNRYGILKTGEDDGRLVEVKGLVEKPKPEDAPSNLSIIGRYILTADVMPHLSKL
FT                   ERGAGGEVQLTDAMAKVIGHAPFHGLRYEGRRFDCGNKVGYLEAQIAFSIDRPDLGDAV
FT                   RAFLKNYTG"
FT   gene            137314..138723
FT                   /locus_tag="Gdia_0122"
FT   CDS_pept        137314..138723
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0122"
FT                   /product="Phosphomannomutase"
FT                   /EC_number="5.4.2.8"
FT                   /note="PFAM: phosphoglucomutase/phosphomannomutase ;
FT                   phosphoglucomutase/phosphomannomutase alpha/beta/alpha
FT                   domain I; phosphoglucomutase/phosphomannomutase
FT                   alpha/beta/alpha domain II;
FT                   phosphoglucomutase/phosphomannomutase alpha/beta/alpha
FT                   domain III; KEGG: gdi:GDI1899 phosphomannomutase"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ACI49922"
FT                   /db_xref="GOA:B5ZJY3"
FT                   /db_xref="InterPro:IPR005841"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR016066"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZJY3"
FT                   /protein_id="ACI49922.1"
FT                   /translation="MSFTHRFDPTTLREYDIRGIVGRTVRPEDAFAIGRTFGSIVARSG
FT                   GRTVAVGYDGRLSSPMLEEALVRGAAASGLEILRVGRGPTPMLYFAAVTLETDGAIMVT
FT                   GSHNPPDYNGFKMMLSGSPFFGAQIAELGDLAARGDVVAASAGTVRDVDVGRAYVARLM
FT                   ADWDGGGRRLKIVWDNGNGAAGDILADLLARLPGDHVLLNGAVDGTFPDHHPDPTVARN
FT                   LEHLIATVRETGADIGIAFDGDADRIGVVDDTGEIVWADQLLVILARDMLRHHPGATII
FT                   ADVKASQTLFDEITRAGGTPLMWRTGHSLIKSKMAETGSPLGGEMSGHVFFADRWYGFD
FT                   DALYAAIRLLGLVAHMETRLSAVRAALPVTISTRETRFECADTRKFSVIEDVAARLKVD
FT                   GGAVSMIDGVRVTTPDGWWLLRASNTQPALVARAEGNTHAGLDRLKAALVAQLERSGVA
FT                   APDFSGDDAGH"
FT   gene            138809..138994
FT                   /locus_tag="Gdia_0123"
FT   CDS_pept        138809..138994
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0123"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gdi:GDI1900 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ACI49923"
FT                   /db_xref="InterPro:IPR021938"
FT                   /db_xref="UniProtKB/TrEMBL:A9HJ22"
FT                   /protein_id="ACI49923.1"
FT                   /translation="MPVIPPFRSFLEPGQFVVHPDHPEWGRGQVQSAVAHRVTVNFEHQ
FT                   GKILIDASVIMLTVIS"
FT   gene            139005..140021
FT                   /locus_tag="Gdia_0124"
FT   CDS_pept        139005..140021
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0124"
FT                   /product="molybdenum cofactor biosynthesis protein A"
FT                   /note="KEGG: gdi:GDI1901 putative molybdenum cofactor
FT                   biosynthesis protein A; TIGRFAM: molybdenum cofactor
FT                   biosynthesis protein A; PFAM: Radical SAM domain protein;
FT                   molybdenum cofactor synthesis domain protein; SMART:
FT                   Elongator protein 3/MiaB/NifB"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ACI49924"
FT                   /db_xref="GOA:B5ZJY5"
FT                   /db_xref="InterPro:IPR000385"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010505"
FT                   /db_xref="InterPro:IPR013483"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZJY5"
FT                   /protein_id="ACI49924.1"
FT                   /translation="MGKPFVDSFGRTVSYLRISVTDRCDMRCVYCMSEAMSFLPKAEIL
FT                   SFEEMERLCAAFIRNGVTRIRVTGGEPLVRRDIDGFFAALGTWLHRTDGDGHLDELTLT
FT                   TNGSHLATHADALARAGVQRVNISLDSLDSERFQRITRRGRLEQTLEGIRAARAAGLAI
FT                   RINTVAMAGVNDDEFDTLLAWCGEIGADLCLIETMPMGDTGEDRSDRYLPLSTVRADLA
FT                   RRWTLEPLTVRTGGPARYLRVGETGCKLGLITPMTHNFCESCNRVRLSCTGQLYTCLGH
FT                   EGATDLRQPLRDGTTDPDLLRLVQAAIQRKPKGHDFLIGRHADDPAAIRRHMSVTGG"
FT   gene            complement(140056..140925)
FT                   /locus_tag="Gdia_0125"
FT   CDS_pept        complement(140056..140925)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0125"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: Methyltransferase type 11; Methyltransferase
FT                   type 12; KEGG: gdi:GDI1902 methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ACI49925"
FT                   /db_xref="GOA:B5ZJY6"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZJY6"
FT                   /protein_id="ACI49925.1"
FT                   /translation="MPSMNDPVIFDRRAVRRHRDRAAPMVHEIAPVLEEVADRLLDRLD
FT                   DTTYRFTAALDIGGRGVVAPRLRARGIGSVVSCDLSPRMARINGGTVLCADEEWLPFGP
FT                   GSFDLVVANLSLHWVNDLPGALAQIRHALKPDGLFLASLPVLPSLSDLRRALTEAEAAL
FT                   TGGATPRVSPFPDLRDCAALLQRAGFALPVADAETVTLAYRSPFRLLQDLRAAGETNAL
FT                   VLRSRQFTQPDLFPAAFAALASAAGDDPLSVPLRLAIMTGWSPDASQPQPLRPGQFTVS
FT                   LEDAIKKI"
FT   gene            141012..141794
FT                   /locus_tag="Gdia_0126"
FT   CDS_pept        141012..141794
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0126"
FT                   /product="putative phosphoribosyltransferase"
FT                   /note="KEGG: gdi:GDI1903 putative
FT                   phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ACI49926"
FT                   /db_xref="GOA:B5ZJY7"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZJY7"
FT                   /protein_id="ACI49926.1"
FT                   /translation="MARRLGSLLLDGLLPPDCPLCHQPVERAGLLCPDCFRHMRFISEP
FT                   CCDACGEPFAGAGFAGSVLGGAGRICASCADRRPPWRAGRAALVYDEWSRALILRLKYA
FT                   DRTELAPLLGRHMARIGQGMLGQADLLVPVPLHRRRLFRRRYNQAALLARAVGRTVGLR
FT                   TLPDALIRPQATPPLARLGPASRRDILHGAIAVRPSRRAAIANRRIVLVDDVMTTGATT
FT                   GECARVLLAAGAASVDVLVAARAPDPGRDPSQDTGQHP"
FT   gene            141857..142117
FT                   /locus_tag="Gdia_0127"
FT   CDS_pept        141857..142117
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0127"
FT                   /product="glutaredoxin 3"
FT                   /note="TIGRFAM: glutaredoxin 3; PFAM: glutaredoxin; KEGG:
FT                   gdi:GDI1904 glutaredoxin-3"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ACI49927"
FT                   /db_xref="GOA:B5ZJY8"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR011767"
FT                   /db_xref="InterPro:IPR011900"
FT                   /db_xref="InterPro:IPR014025"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZJY8"
FT                   /protein_id="ACI49927.1"
FT                   /translation="MPRIEIYTQPGCPYCVRALRLLEQKGTAFTEIRALLGTAERAEAR
FT                   ERSGGRTTVPQIFIDGRHIGGCDDIMALDRAGKLDPLLHAA"
FT   gene            142151..142657
FT                   /locus_tag="Gdia_0128"
FT   CDS_pept        142151..142657
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0128"
FT                   /product="protein of unknown function DUF1178"
FT                   /note="PFAM: protein of unknown function DUF1178; KEGG:
FT                   gdi:GDI1905 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ACI49928"
FT                   /db_xref="InterPro:IPR009562"
FT                   /db_xref="UniProtKB/TrEMBL:A9HJ36"
FT                   /protein_id="ACI49928.1"
FT                   /translation="MIRYLLRCDAGHEFDGWFPGSAAFDDQVRRDLLSCPQCGTTDVGR
FT                   ALMAPAVRTRPARPPVTQPAGQQVVREQPAAAPAAHMPAGPPPSVQGAGVPAALTAALQ
FT                   TLRRHVEQQCEDVGDRFAEEALKIHHGEAEERGIYGHASDEDYHRLTDEGVEIVTIPWV
FT                   RRADS"
FT   gene            142704..143270
FT                   /locus_tag="Gdia_0129"
FT   CDS_pept        142704..143270
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0129"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gdi:GDI1906 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ACI49929"
FT                   /db_xref="InterPro:IPR019223"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZJZ0"
FT                   /protein_id="ACI49929.1"
FT                   /translation="MKRMHDRTDMHDRTDRPAAFVPSGTGHRHNAARWVSALACLTLLA
FT                   GIAAAPARADAGPDADAGTGTLSVLGMWETREHDGVFRIASCGGQLCGHLVGMRYTGEV
FT                   PKARDGGSECGLLMLTGFTPDSDEPGRWNGHILDPDTNKVYHAQIWSPRDGVLKLRGYV
FT                   GIPLFGETHTWTRYTGTIGQRCQMP"
FT   sig_peptide     142704..142868
FT                   /locus_tag="Gdia_0129"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.816) with cleavage site probability 0.800 at
FT                   residue 55"
FT   gene            143316..144560
FT                   /locus_tag="Gdia_0130"
FT   CDS_pept        143316..144560
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0130"
FT                   /product="putative 6-phosphogluconolactonase"
FT                   /note="KEGG: gdi:GDI1907 putative
FT                   6-phosphogluconolactonase"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ACI49930"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR011048"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR019405"
FT                   /db_xref="UniProtKB/TrEMBL:A9HJ42"
FT                   /protein_id="ACI49930.1"
FT                   /translation="MTMPFSRRNLLLALAASGTAPLASSLTGPRPARAAIPAMSRTLCY
FT                   IGGYNKHAPPGGAGNGQGIAIFEMNRVTGGLIPVSTFMDIASPSFITMSADSRFLYALS
FT                   EIDDFNADHDGSVTAFSVDRTSGELNRLNVVSSGGAVPAHLSVHRAGHHVLVANYVGGS
FT                   VGVLPIRPDGSLGEPTDVVHNTGPHMPERAEDNPPGNFAISDHSGSHVHMVASDPSGRF
FT                   VVACDAGLDRVYVWTLDLASGKLRPAATPFINLIPGSAPRHFAFSKDGRTIYILCEQDS
FT                   KVVVASFDPRTGALVPQQKVSTVTSYFQGSTLAAEILISPNGRYVYASNRLGDSLAIFR
FT                   VGPDGSLTLIDEVWMHADYGRAMVFDPSGTFLYCANQRSDSVTSFRVNPETGALDFNWH
FT                   FTAIGSPTTFAFLQI"
FT   sig_peptide     143316..143420
FT                   /locus_tag="Gdia_0130"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.952 at
FT                   residue 35"
FT   gene            complement(144688..145449)
FT                   /locus_tag="Gdia_0131"
FT   CDS_pept        complement(144688..145449)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0131"
FT                   /product="ubiquinone biosynthesis O-methyltransferase"
FT                   /EC_number="2.1.1.64"
FT                   /note="KEGG: gdi:GDI1908 3-demethylubiquinone-9
FT                   3-methyltransferase; TIGRFAM: ubiquinone biosynthesis
FT                   O-methyltransferase; PFAM: methyltransferase small;
FT                   Methyltransferase type 11; Methyltransferase type 12"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ACI49931"
FT                   /db_xref="GOA:A9HJ43"
FT                   /db_xref="InterPro:IPR010233"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A9HJ43"
FT                   /protein_id="ACI49931.1"
FT                   /translation="MNVNDSSSRAAHPAGHSVAPDEIARFSALADRWWDPSGPMRPLHA
FT                   MNGLRLDWARRHLPAPGTPGEPATRLLDIGCGAGLASEGLARMGYDVTGLDASDAAIAA
FT                   ARAHLADHPLPPDGGSLAYRVGSAEELQAEGARFAAITALEVIEHVTDPAAFLRVLADM
FT                   VAPGGVIIVSTLNRTLRSLATAKIGAEYILRLLPAGTHEWRKFITPAELGAFASQAGLR
FT                   VSDIAGMVPALGGWRESHDLGVNYIASLSAP"
FT   gene            145606..146859
FT                   /locus_tag="Gdia_0132"
FT   CDS_pept        145606..146859
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0132"
FT                   /product="aspartate kinase"
FT                   /EC_number="2.7.2.4"
FT                   /note="KEGG: gdi:GDI1909 aspartokinase protein; TIGRFAM:
FT                   aspartate kinase; aspartate kinase, monofunctional class;
FT                   PFAM: aspartate/glutamate/uridylate kinase; amino
FT                   acid-binding ACT domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ACI49932"
FT                   /db_xref="GOA:B5ZJZ3"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001341"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR005260"
FT                   /db_xref="InterPro:IPR018042"
FT                   /db_xref="InterPro:IPR027795"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR041740"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZJZ3"
FT                   /protein_id="ACI49932.1"
FT                   /translation="MPRTVPRIVMKFGGTSVADLDRIRAVAEKVHKQVAAGCEVAVVVS
FT                   AMSGVTNRLVGYCQSLSPLHDAKEYDAVVATGEQVTSGLLAIALQTLGLEARSWLGWQI
FT                   PLRTDGAHGKARIDSIDGEALITRMRAGQVPVIAGFQGVDPDGRITTLGRGGSDTSAVA
FT                   LAAALQADRCDIYTDVDGIYTTDPRIVARARKLDKITYEEMLELASVGAKVLQTRSVEL
FT                   AMKERVRVQVLSSFSDGPAPSEDNLPGSLVVDEDEIVEKELVAGIAYSRDEAKLSVRRI
FT                   PDRPGIAAAIFGPLTAANVNVDMIVQSTGADGLTNMTFTTGKTDLARAIQALEAARDVI
FT                   QYGEMATDDDVVKISVVGVGMRSHAGVANTMFRTLSDRNINIQVISTSEIKVSVLIAAE
FT                   YTELAVRALHTAYGLDAA"
FT   gene            146879..147937
FT                   /locus_tag="Gdia_0133"
FT   CDS_pept        146879..147937
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0133"
FT                   /product="2-nitropropane dioxygenase NPD"
FT                   /note="PFAM: 2-nitropropane dioxygenase NPD; KEGG:
FT                   gdi:GDI1910 putative 2-nitropropane dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ACI49933"
FT                   /db_xref="GOA:B5ZJZ4"
FT                   /db_xref="InterPro:IPR004136"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZJZ4"
FT                   /protein_id="ACI49933.1"
FT                   /translation="MPLSDDAMFRTAARARLDRLWSAGTAFLGSEVAILGGAMSWVSER
FT                   HLVSAISNAGGFGVLACGAMEPDRLAEEIAATQALTSRPFGVNLITMHPRLDDLIQVCL
FT                   SAGVTHVVLAGGIPPGPAIRAIKDGGARVVAFAPALVLAKRLVRMGVDALVIEGAEAGG
FT                   HVGPVSLTVLAQEVLPHIRSVPVFVAGGLGRGEAILSYLEQGAAGAQLGTRFAASAESI
FT                   AHERFKAAFVRANARDAVTSVQLDERFPVIPVRGLSNEGGRAFLRHQAETIRRYLDGEL
FT                   TREAAQLDIEHFWAGSLRRAVIEGDVEQGSVMAGQSVGMISSVQPVAAIIAELVEQAVD
FT                   ALVRRDMPAGDA"
FT   gene            147934..149148
FT                   /locus_tag="Gdia_0134"
FT   CDS_pept        147934..149148
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0134"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gdi:GDI1911 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ACI49934"
FT                   /db_xref="GOA:A9HJ46"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR025194"
FT                   /db_xref="UniProtKB/TrEMBL:A9HJ46"
FT                   /protein_id="ACI49934.1"
FT                   /translation="MNDTSARNPAADPRGAGAPNGVGPTLRARREQLGWALPDVATWLR
FT                   IRLSYLEAMEDGRVKDLPGNVYTVGFLRTYAQALGLDAESLVARFKAEARDNIDYKPEL
FT                   SFPAPVPGSAVPAGVMALLGGVVIIAAYVGWYRMTGVQSVPPQQVPSVYSAIPGMTRQA
FT                   PTSPQVASVLPSGRPIGPPQPLSNAERSAITDGDVPAPAPLAAPTPAVPPQGTTPQGAV
FT                   TQGTVTQGTLAQGNGTPGVGDAAVPPPAGPSQSAMQPVPQPAPVAAAPPTAPAGQMMLT
FT                   ASAQTWVQVRVAGGPVIYDHILQPGESWSVPPDRTNLLLTVGNAGGLVLSADGVTTQPL
FT                   GRNGAVVRNLSLTPDAIRSGSIVTAASTPAPHAARPHGSGAGAAMPASAPAVPQATPPS
FT                   PTIAH"
FT   gene            149294..150442
FT                   /locus_tag="Gdia_0135"
FT   CDS_pept        149294..150442
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0135"
FT                   /product="1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate
FT                   synthase"
FT                   /EC_number="1.17.7.1"
FT                   /note="KEGG: gdi:GDI1913 4-hydroxy-3-methylbut-2-en-1-yl
FT                   diphosphate synthase; TIGRFAM:
FT                   1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate synthase;
FT                   PFAM: IspG family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ACI49935"
FT                   /db_xref="GOA:A9HJ48"
FT                   /db_xref="InterPro:IPR004588"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="InterPro:IPR016425"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9HJ48"
FT                   /protein_id="ACI49935.1"
FT                   /translation="MSSYRPYQSIERRKSRQIHVGKVPVGGDAPISVQTMTNTLTTDAE
FT                   ATIAQIRRAELAGVDIVRVSCPDEESTAALAEIVREVNVPIVADIHFHYKRAIEAAQAG
FT                   AACLRINPGNIGSAERVREVVKAAREHGCSIRIGVNAGSLEKHLLEKYGEPNPDALVES
FT                   ALEHAKILQDHDFHEFKISVKASDVFLAVAAYQQLAEVCDHPLHIGITEAGSKRAGTVK
FT                   SSIGLGNLLWAGVGDTMRVSLSADPEEEVLVGWDILKSLGLRHRGVKIISCPSCARQGF
FT                   NVIQTVQTLEERLAHIQTPLTLSIIGCVVNGPGEALMTDIGVTGGGSGRHMVYAAGRQD
FT                   HTVPADSMIEHIVELVEKKAEILRAEEAAAKAEAEAALAPAQ"
FT   gene            150523..151770
FT                   /locus_tag="Gdia_0136"
FT   CDS_pept        150523..151770
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0136"
FT                   /product="histidyl-tRNA synthetase"
FT                   /EC_number="6.1.1.21"
FT                   /note="KEGG: gdi:GDI1914 histidyl-tRNA synthetase; TIGRFAM:
FT                   histidyl-tRNA synthetase; PFAM: tRNA synthetase class II (G
FT                   H P and S); Anticodon-binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ACI49936"
FT                   /db_xref="GOA:A9HJ49"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR004516"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR015807"
FT                   /db_xref="InterPro:IPR033656"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="InterPro:IPR041715"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9HJ49"
FT                   /protein_id="ACI49936.1"
FT                   /translation="MSSLQPVRGTHDLIGETQLRHAHVVETARRIAGLYGFDEWATPIF
FT                   EDTRVFARSLGDTSDVVSKEMYSFEDRGGESLTLRPEGTAGVCRALVTNGLTQSLPQKV
FT                   FYAGPMFRYERPQKGRYRQFHQIGAELIGAAEPLADAEAIAMGRDVLKALGIADETILD
FT                   LNTLGDTESRAAWRTALIGYFTECRDQLSDDSRARLERNPLRILDSKAPQDRALVADAP
FT                   RIGAFLTPEAVAFWDGLRSALDLMGVPFRENPGIVRGLDYYGHTAFEFVTERLGAQGTV
FT                   LAGGRYDGLVAEMGGPRTPAIGWAGGIERLSMLLDATPAAPRPVAVVPMGEGAMGAAIL
FT                   LLQALRAGGVRAEIAYRGNTKKRLERANRIGATHAVLIGEDEVARGVAQVKALDDGSQA
FT                   ELALDAVTPYLAGLAG"
FT   gene            151775..152833
FT                   /locus_tag="Gdia_0137"
FT   CDS_pept        151775..152833
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0137"
FT                   /product="peptide chain release factor 1"
FT                   /note="TIGRFAM: peptide chain release factor 1; PFAM: Class
FT                   I peptide chain release factor; PCRF domain protein; KEGG:
FT                   gdi:GDI1915 putative peptide chain release factor 1"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ACI49937"
FT                   /db_xref="GOA:A9HJ50"
FT                   /db_xref="InterPro:IPR000352"
FT                   /db_xref="InterPro:IPR004373"
FT                   /db_xref="InterPro:IPR005139"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9HJ50"
FT                   /protein_id="ACI49937.1"
FT                   /translation="MGLDDRLDRIVARSEELQAALAEGLVGEAFAKASREYAELEPIVD
FT                   RIGELRLAEQEERQSQALLADPEMRELAEAELEDLRARIPVLRQDIRIAMLPRDEADER
FT                   SAILEIRPAAGGDEAALFAAELFDAYRRYAALRGWRFEIMEFDESELGGLREGIANITG
FT                   RGVFARLKYESGVHRVQRVPATESQGRIHTSTVTVAVLPEAGDVDVQINDGDLRIDVYR
FT                   ASGAGGQHVNKTESAVRITHLPTGLVVAMQEEKSQHKNRAKAMKILMARLYERERAAAH
FT                   ATRAADRKSQVGTGDRSERIRTYNFPQGRVTDHRINLTAYKIDRVMMGEFDEFVDALTQ
FT                   DEQASLLAAEGL"
FT   gene            complement(152847..153311)
FT                   /locus_tag="Gdia_0138"
FT   CDS_pept        complement(152847..153311)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0138"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gdi:GDI1916 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ACI49938"
FT                   /db_xref="UniProtKB/TrEMBL:A9HJ51"
FT                   /protein_id="ACI49938.1"
FT                   /translation="MAYQVRSWGILAILVACATVAAPVSRARAGSFIVVDGRADAEISE
FT                   TSRFYIDDQLMATIRLDATVPQRAVRIETPEGRLNHTYVLCGEITVRMPDGRVETHEVN
FT                   GEGVLHHPDGHTLNALGTRNFTEFYLADPEDPTVVEHHPGRSSLCTVPTS"
FT   sig_peptide     complement(153222..153311)
FT                   /locus_tag="Gdia_0138"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.989) with cleavage site probability 0.598 at
FT                   residue 30"
FT   gene            153342..154223
FT                   /locus_tag="Gdia_0139"
FT   CDS_pept        153342..154223
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0139"
FT                   /product="protein-(glutamine-N5) methyltransferase, release
FT                   factor-specific"
FT                   /note="TIGRFAM: modification methylase, HemK family;
FT                   protein-(glutamine-N5) methyltransferase, release
FT                   factor-specific; PFAM: methyltransferase small; KEGG:
FT                   gdi:GDI1917 putative HemK homolog protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ACI49939"
FT                   /db_xref="GOA:A9HJ52"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR004556"
FT                   /db_xref="InterPro:IPR007848"
FT                   /db_xref="InterPro:IPR019874"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR040758"
FT                   /db_xref="UniProtKB/TrEMBL:A9HJ52"
FT                   /protein_id="ACI49939.1"
FT                   /translation="MKRFDAAPPHDPADIASLLAWAAGRLAAAGLDHPRREARLLMAHV
FT                   LRTDLAGLLARSAMDAAEHRSFVALVARRAAHEPMAYITGRAGFWSLDLETAPATLIPR
FT                   ADSETLVEALLAQRPDRGAVRTILDLGTGTGCLLLAALSEYPDAWGLGVDIDPDAAHLA
FT                   ARNARRTGLRDRCAMLAADWSTAIAGRFDVVFSNPPYIPRADLAGLMPDVRDHEPARAL
FT                   DGGTDGLDAYRLLTGALPSLLAHGGIAIFEIGIGQERSMPDLARQAGLDIVGIRTDLGG
FT                   IPRAVLMQQCRV"
FT   gene            154498..154932
FT                   /locus_tag="Gdia_0140"
FT   CDS_pept        154498..154932
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0140"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gox:GOX0029 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ACI49940"
FT                   /db_xref="InterPro:IPR025430"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZK01"
FT                   /protein_id="ACI49940.1"
FT                   /translation="MNMKRMRGRHHRSGGSNGGSIRQQNGQIPLNRNHVFDSNGPDLRI
FT                   RGTAQQLFEKYLQLGRDASGSGDRVMAEAYFQHAEHYFRILNAMTQAAQQNQQDRQERQ
FT                   PRQRPTAVADTNDGEPGDDAPGEEPAEKGKPDVELAPAEA"
FT   gene            complement(154977..156242)
FT                   /locus_tag="Gdia_0141"
FT   CDS_pept        complement(154977..156242)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0141"
FT                   /product="adenosylmethionine-8-amino-7-oxononanoate
FT                   aminotransferase"
FT                   /note="TIGRFAM: adenosylmethionine-8-amino-7-oxononanoate
FT                   aminotransferase; PFAM: aminotransferase class-III; KEGG:
FT                   gdi:GDI1919 putative
FT                   adenosylmethionine-8-amino-7-oxononanoate aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ACI49941"
FT                   /db_xref="GOA:A9HJ55"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR005815"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A9HJ55"
FT                   /protein_id="ACI49941.1"
FT                   /translation="MTGPDWFDAGLPHVWLPYTQMHTASPPLPATATDGCRIRLSDGRE
FT                   LIDGIASWWTACHGYNHPHIRQAATDQLARMPHVMFGGLVHEPALRLARRLTDLLPGDL
FT                   ERVFFSDSGSVAVEVAMKMAVQYWLNRGQSGRTRLVAFRGGYHGDTLATMAVCDPEEGM
FT                   HSLFAGVLPQHVITDLPCDAASCAALDHLMETEGQHVAAILVEPLVQGAGGMLFHDPAT
FT                   LRALREIADRHGVLLILDEIFTGFGRTGSLFACQQAGIVPDIITLSKALSGGTVPLAAT
FT                   VARRHVFQAFLSDDPTHALMHGPTFMANPLACACANASLDLFEREPRLEQVAAIGAQMR
FT                   DELEACRHLPAVRDVRTMGAIGVVELERIRDMNRLKARLVDQGVWVRPFRTIVYLTPAF
FT                   TIAPKELAHLTQAIRTVLSDPP"
FT   gene            156284..157507
FT                   /locus_tag="Gdia_0142"
FT   CDS_pept        156284..157507
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0142"
FT                   /product="8-amino-7-oxononanoate synthase"
FT                   /EC_number="2.3.1.47"
FT                   /note="KEGG: gdi:GDI1920 putative 8-amino-7-oxononanoate
FT                   synthase; TIGRFAM: 8-amino-7-oxononanoate synthase; PFAM:
FT                   aromatic amino acid beta-eliminating lyase/threonine
FT                   aldolase; aminotransferase class I and II; aminotransferase
FT                   class-III"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ACI49942"
FT                   /db_xref="GOA:A9HJ57"
FT                   /db_xref="InterPro:IPR001917"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9HJ57"
FT                   /protein_id="ACI49942.1"
FT                   /translation="MRSGRKLRFMTRFDPFFQTALDDLDRRHLKRVLSPVDRDGPVIVR
FT                   RDGASLLDFSSNDYLGLSHHPALRARAIDWTERFGIGSGASRLVTGTSEQYRQVEARLA
FT                   RFKGTEAALLLASGWQANAAVLPALLRISAAQTGEPALVFTDRLNHASLHHGCQAAGVR
FT                   QIRFAHNDLGHLEHLLAQRQAQRGLRFIVTESVFSMDGDRADVAGLRTLADRYGAFLYL
FT                   DEAHATGVLGPQGRGLSAEAGGVDLAMGTFSKALGGFGAYVAGSRAVCDWLVSTCSGFI
FT                   YTTALPPGVLGAIDAALDLVPTLDAERAHLAGLADRMRAGAGALGWSTGPSSTQIVPVI
FT                   VGAADRALTLARALAARGMLGTAIRPPTVPAGSARIRVALSAAHDETMVDRLLSALEDA
FT                   AREHGIAP"
FT   gene            157497..158165
FT                   /locus_tag="Gdia_0143"
FT   CDS_pept        157497..158165
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0143"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gdi:GDI1921 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ACI49943"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZK04"
FT                   /protein_id="ACI49943.1"
FT                   /translation="MPPEPAFRPGLLFVHGWGFTPDFWQPVQDRLGRQDAVRLDFGFFG
FT                   PACMEARPARPYVAVGHSLGALWLLLHRPAACLGMVLINGFARFGAAADYRQGVPARVI
FT                   DRMVQGLDHNADGVVATFRDRAGIGTPPPGAADPGRLARALAILRDADARPLLASPDAL
FT                   PPVAVLAGRVDPIVSPAMTDACFHDRLAVDWIADGGHLLPLTHPDACAAAITHMMDAAP
FT                   "
FT   gene            158162..159586
FT                   /locus_tag="Gdia_0144"
FT   CDS_pept        158162..159586
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0144"
FT                   /product="dethiobiotin synthase"
FT                   /note="TIGRFAM: dethiobiotin synthase; PFAM:
FT                   Methyltransferase type 11; Methyltransferase type 12; KEGG:
FT                   gdi:GDI1922 putative biotin synthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ACI49944"
FT                   /db_xref="GOA:A9HJ62"
FT                   /db_xref="InterPro:IPR004472"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:A9HJ62"
FT                   /protein_id="ACI49944.1"
FT                   /translation="MNPRKHQIAARFGGADSYDAAARIQASVAARLADRIRAACDAAGG
FT                   LAPARILELGCGTGFLSAHLRRLFPDAILTVTDLAPEMVERARARLTPLGGDVRYAVVD
FT                   AEDPASVGTGFDLICSSLSMQWFTDPAATLDRLAARLAPGGMMALSTLCAGSFAEWRAV
FT                   HRAAGLDCPVPSYPGLEQLQADWPGAGVGSWRHETLIDHPASALDFVRELRQIGASLPR
FT                   DGARPAGPGTMRRLLRDLDNRGGVTATYEIGYGLFRTPSRRGVFVTGTDTEVGKTLAAA
FT                   CLVQAWNASYWKPLQTGIAEDTADSVTIAALCGVDPARIARPAVVLPAPLSPFDAAEQD
FT                   GITLDAARIVLPPARDARPVVVEGAGGVMVPITRDCMMIDLMVRFALPVVVVARSQLGT
FT                   INHTLLTLQALRSRGLAVAGVILNGQPSREARRAITLFGGARVLAEFPHLDQVGPEQVA
FT                   NLAGLLPSYDDLWCYP"
FT   gene            complement(159603..160364)
FT                   /locus_tag="Gdia_0145"
FT   CDS_pept        complement(159603..160364)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0145"
FT                   /product="SOS-response transcriptional repressor, LexA"
FT                   /EC_number="3.4.21.88"
FT                   /note="KEGG: gdi:GDI1923 putative LexA repressor; TIGRFAM:
FT                   LexA repressor; PFAM: LexA DNA-binding domain protein;
FT                   peptidase S24 and S26 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ACI49945"
FT                   /db_xref="GOA:A9HJ64"
FT                   /db_xref="InterPro:IPR006197"
FT                   /db_xref="InterPro:IPR006199"
FT                   /db_xref="InterPro:IPR006200"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR039418"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9HJ64"
FT                   /protein_id="ACI49945.1"
FT                   /translation="MLTRKQHELLLFIDRHLKQTGFSPSFDEMKDALNLRSKSGIHRLI
FT                   SALEERDFLRRRHHRARALEVLRLPETMPAATGKPPLAESGPPPVTAPATDESAAAESF
FT                   VPNVIKGDFANRLAGASVATEAGAIHLPFYGRIAAGQPIEALRETGAQIEVPMNLLGHG
FT                   EHYALEVAGDSMIEAGILDGDTVIIRRGDVAQNGQIVVALIDDQEVTLKRLRRRGSTIA
FT                   LEPANARYEPRIVPSDRVRIQGQLVGLLRRY"
FT   gene            complement(160553..161758)
FT                   /locus_tag="Gdia_0146"
FT   CDS_pept        complement(160553..161758)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0146"
FT                   /product="molybdenum cofactor synthesis domain protein"
FT                   /note="TIGRFAM: molybdenum cofactor synthesis domain
FT                   protein; PFAM: molybdopterin binding domain; MoeA domain
FT                   protein domain I and II; MoeA domain protein domain IV;
FT                   KEGG: gdi:GDI1924 putative molybdopterin biosynthesis
FT                   protein MoeA"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ACI49946"
FT                   /db_xref="GOA:B5ZK07"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR005110"
FT                   /db_xref="InterPro:IPR005111"
FT                   /db_xref="InterPro:IPR036135"
FT                   /db_xref="InterPro:IPR036425"
FT                   /db_xref="InterPro:IPR036688"
FT                   /db_xref="InterPro:IPR038987"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZK07"
FT                   /protein_id="ACI49946.1"
FT                   /translation="MLSVSEAQERILAELIPMGPELVPLAEAWGRVAGAGIAARLDNPP
FT                   ADISAMDGYAVQAAHCRAGTTLPVIGESPAGHPFPGVVTPDGCVRIYTGSVMPNGADSV
FT                   LIQENATESDGRMTASADAQAGRHIRRRGQDFALGQIVVAPGRLLLAREVGLIAAANHA
FT                   WVPVHRKPTVAILATGDEIALPGETIAPGGIANSNAPMLAALVRACGGTPVMLPIARDD
FT                   EAEIARLAQGVESADLLLTVGGASVGRYDLVQRALERIGLSVNFWKIAMRPGKPLMHGR
FT                   IGRVPVLGLPGNPVAAMICAIVFAMPAIRVLAGRSDPMVAYDLATLGGDLPANDHRADH
FT                   LRARLDRAADGSLLATAFPRQDSAMLRTLADSQALILRAPHAPAARTGEPCRIIRLDTL
FT                   SI"
FT   gene            161917..162084
FT                   /locus_tag="Gdia_0147"
FT   CDS_pept        161917..162084
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0147"
FT                   /product="ribosomal protein L33"
FT                   /note="PFAM: ribosomal protein L33; KEGG: gdi:GDI1925
FT                   putative 50S ribosomal protein L33 (RRP-L33)"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ACI49947"
FT                   /db_xref="GOA:A9HJ69"
FT                   /db_xref="InterPro:IPR001705"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="InterPro:IPR018264"
FT                   /db_xref="InterPro:IPR038584"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9HJ69"
FT                   /protein_id="ACI49947.1"
FT                   /translation="MAKSNTIQIKLVSSADTGYFYVTKKNARAQTGKLEMRKYDPVARK
FT                   HVAFREAKIK"
FT   gene            complement(162178..162507)
FT                   /locus_tag="Gdia_0148"
FT   CDS_pept        complement(162178..162507)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0148"
FT                   /product="Septum formation initiator"
FT                   /note="PFAM: Septum formation initiator; KEGG: gdi:GDI1926
FT                   putative septum formation initiator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ACI49948"
FT                   /db_xref="GOA:A9HJ72"
FT                   /db_xref="InterPro:IPR007060"
FT                   /db_xref="UniProtKB/TrEMBL:A9HJ72"
FT                   /protein_id="ACI49948.1"
FT                   /translation="MQIGRMIRRAIRMVIPPALFIGLTAYFGWNVMQGDHGLQSYKAQL
FT                   QLLAEARAAQQDAMAEQQVWVRRVRGLKESALDSDTLDERARAMLNLSRPDELVVPYGA
FT                   HEHLY"
FT   gene            complement(162627..163907)
FT                   /locus_tag="Gdia_0149"
FT   CDS_pept        complement(162627..163907)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0149"
FT                   /product="Phosphopyruvate hydratase"
FT                   /EC_number="4.2.1.11"
FT                   /note="PFAM: enolase; KEGG: gdi:GDI1927 enolase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ACI49949"
FT                   /db_xref="GOA:A9HJ75"
FT                   /db_xref="InterPro:IPR000941"
FT                   /db_xref="InterPro:IPR020809"
FT                   /db_xref="InterPro:IPR020810"
FT                   /db_xref="InterPro:IPR020811"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9HJ75"
FT                   /protein_id="ACI49949.1"
FT                   /translation="MSAIVDIVAREILDSRGNPTVEVDVELASGAKGRAAVPSGASTGA
FT                   HEAVELRDGDKSRFGGKGVLKAVEHVETEILEALQGAESMDQVAIDEAMIDLDGTPNKA
FT                   RLGANAILAVSLAVAKASAEELQIPLYRYVGGVYARTLPVPMMNIVNGGQHADNPIDIQ
FT                   EFMIQPVGAPTLADAVRVGSEIFAQLKKNLSAAGHNTNVGDEGGFAPGLKSADDALGFI
FT                   TKAVEAAGYRPGDDVTFALDCAATEFYRDGLYVMEGEGKTLDSAGMVAYLADLAARYPI
FT                   VSIEDGLAEDDWEGWAVLTATLGKTVQLVGDDLFVTNPDRLRRGIKAGVANSLLVKVNQ
FT                   IGTLSETLEAVETAQRAGYTAVMSHRSGETEDSTIADLAVATNCGQIKTGSLSRSDRTA
FT                   KYNQLIRIENELATAARYAGRTILKTA"
FT   gene            164046..164522
FT                   /locus_tag="Gdia_0150"
FT   CDS_pept        164046..164522
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0150"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gdi:GDI1928 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ACI49950"
FT                   /db_xref="GOA:B5ZK11"
FT                   /db_xref="InterPro:IPR021836"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZK11"
FT                   /protein_id="ACI49950.1"
FT                   /translation="MKRLPLLAIIMGIASPFPAIVCATALLFYPSDRPLPGLTMALVAY
FT                   LALMLAFSGAVHWGLALDRPAVVTASPTTRTDNRRMLTGGVPLPVGWLAILATFLGHAG
FT                   AGLAILLAGFAGLFLAERAAWRRGELPSGYLALRLCMTAVIMTCLAVALLARAI"
FT   sig_peptide     164046..164117
FT                   /locus_tag="Gdia_0150"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.997) with cleavage site probability 0.496 at
FT                   residue 24"
FT   gene            complement(164542..165378)
FT                   /locus_tag="Gdia_0151"
FT   CDS_pept        complement(164542..165378)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0151"
FT                   /product="2-dehydro-3-deoxyphosphooctonate aldolase"
FT                   /note="TIGRFAM: 2-dehydro-3-deoxyphosphooctonate aldolase;
FT                   PFAM: DAHP synthetase I/KDSA; KEGG: gdi:GDI1929 putative
FT                   2-dehydro-3-deoxyphosphooctonate aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ACI49951"
FT                   /db_xref="GOA:A9HJ79"
FT                   /db_xref="InterPro:IPR006218"
FT                   /db_xref="InterPro:IPR006269"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A9HJ79"
FT                   /protein_id="ACI49951.1"
FT                   /translation="MTHPKSVSLGSLTVGNDRPFVLIAGPCQIESEAHAMETADALHGI
FT                   ARETGVGLIYKSSFDKANRTSLGAARGVGMAAGLEILARVRERFGVPVLTDVHAADQCA
FT                   PTAAAVDVLQIPAFLCRQTDLLLAAGETGAAINVKKGQFLAPWDMTNVAAKIASTGNER
FT                   IMLCERGTSFGYNTLVNDMRGLPIMAATGYPVVYDATHSVQQPGGLGGSSGGQREFAPI
FT                   LARGALAIGVAAVFIETHQDPDSAPSDGPNMIPIRDMKALVQRLAQYDRLTKAGTP"
FT   gene            complement(165375..167006)
FT                   /locus_tag="Gdia_0152"
FT   CDS_pept        complement(165375..167006)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0152"
FT                   /product="CTP synthase"
FT                   /EC_number="6.3.4.2"
FT                   /note="KEGG: gdi:GDI1930 CTP synthase; TIGRFAM: CTP
FT                   synthase; PFAM: glutamine amidotransferase class-I; CTP
FT                   synthase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ACI49952"
FT                   /db_xref="GOA:A9HJ81"
FT                   /db_xref="InterPro:IPR004468"
FT                   /db_xref="InterPro:IPR017456"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR033828"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9HJ81"
FT                   /protein_id="ACI49952.1"
FT                   /translation="MTRFVFITGGVVSSLGKGIASAALAALLQARGYRVRLRKLDPYLN
FT                   VDPGTMSPYQHGEVFVTDDGAETDLDLGHYERFTGVHATRADNATTGQIYSDVIARERR
FT                   GDYLGATVQVIPHITDAIKEAVVAGTEDLDFVLVEIGGTVGDIESLPFLEAIRQLRNDL
FT                   GAGQTMFVHLTLLPWIPSAGELKTKPTQHSVKELQNVGIQAQMLLCRSDRPIPDTERRK
FT                   IANFCNVRPEAVIAALDVDTIYACPVSYHAEGMDTEVLRHFGLPHDQEPDLSAWNRVLD
FT                   AMRHPEGEVRIAVVGKYTALLDAYKSLIEALQHGGIANRVRVKLDWVEAEIFEKSETAI
FT                   EALRDAHAILVPGGFGERGSEGKIQAVRFAREHNIPFLGICFGMQMAVIECARNLAGLP
FT                   DASSTEFGPTEEPLVGLMTEWARGNELLRRREGGEMGGTMRLGAYAAKLAEGSRVAEIY
FT                   GKTEIRERHRHRYEVNVHYREVLEKAGLQFSGMSPDDILPEVVEYPNHPWFVAVQYHPE
FT                   LLSKPFDPHPLFSGFVGAAVKKMRLV"
FT   sig_peptide     complement(166929..167006)
FT                   /locus_tag="Gdia_0152"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.956) with cleavage site probability 0.866 at
FT                   residue 26"
FT   gene            complement(167121..167456)
FT                   /locus_tag="Gdia_0153"
FT   CDS_pept        complement(167121..167456)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0153"
FT                   /product="preprotein translocase, SecG subunit"
FT                   /note="TIGRFAM: preprotein translocase, SecG subunit; PFAM:
FT                   Preprotein translocase SecG subunit; KEGG: gdi:GDI1931
FT                   protein translocase subunit SecG"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ACI49953"
FT                   /db_xref="GOA:A9HJ83"
FT                   /db_xref="InterPro:IPR004692"
FT                   /db_xref="UniProtKB/TrEMBL:A9HJ83"
FT                   /protein_id="ACI49953.1"
FT                   /translation="MITVLLFLHLFVTLALIGTVLIQRSEGGGLGIGSSQGMGSFMSGR
FT                   GTANLLTRTTSVLAGIFMILSLTLAVMNRGASTGSGHDILAQPPAPAAPATLPAAPATP
FT                   AAPAPTH"
FT   gene            complement(167508..168251)
FT                   /locus_tag="Gdia_0154"
FT   CDS_pept        complement(167508..168251)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0154"
FT                   /product="Triose-phosphate isomerase"
FT                   /EC_number="5.3.1.1"
FT                   /note="PFAM: triosephosphate isomerase; KEGG: gdi:GDI1932
FT                   putative triosephosphate isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ACI49954"
FT                   /db_xref="GOA:A9HJ86"
FT                   /db_xref="InterPro:IPR000652"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR020861"
FT                   /db_xref="InterPro:IPR022896"
FT                   /db_xref="InterPro:IPR035990"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9HJ86"
FT                   /protein_id="ACI49954.1"
FT                   /translation="MRQMIVGNWKMNGLGAPSRDLVGEIAEGLATIPSPPQVVVCPPFT
FT                   QLAGIGPLLKGSGIALGAQDCHQAASGAHTGDISAAMLADLGVEYVVLGHSERRRDHGE
FT                   LDETVREKTQTALAAGLTPIVCIGETGDQKASGESRDAIGWQIQGSLPDGFSGVVAYEP
FT                   VWAIGSGNPAASQDIADMMGFIRAELVRQFGAAGKTIRILYGGSVNGRDAASILPIAEV
FT                   GGALVGSASLQADTFLPIVRAAVDL"
FT   gene            168512..170443
FT                   /locus_tag="Gdia_0155"
FT   CDS_pept        168512..170443
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0155"
FT                   /product="peptidyl-prolyl cis-trans isomerase D"
FT                   /note="KEGG: gdi:GDI1933 peptidyl-prolyl cis-trans
FT                   isomerase D"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ACI49955"
FT                   /db_xref="GOA:B5ZK16"
FT                   /db_xref="InterPro:IPR000297"
FT                   /db_xref="InterPro:IPR027304"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZK16"
FT                   /protein_id="ACI49955.1"
FT                   /translation="MISFLRHAFVDSWLGRIIAGLLFLAFVGWGVGDVLSNIGSERADV
FT                   VARVGDQTITTDSFLSAVQNELQQLARQMGVGDPSQIPAAARGQAAQQVLQRLVTQSEM
FT                   ILAAGRLGVTVPDDVLRDEVFGLQIFKGPDGRFDRALFDSRLRQIGMTEARLLDIVRTD
FT                   LAVRALVEPLQSGARAPEVMVRRAFDFGAQARTIDLVRIALGDQGTPAPDTATLRRFYD
FT                   NHPWLFRLPEFRHARIVVLSPDTVARSIDIPDAELRRLYDAQQSKYHVPETRSVQIVTA
FT                   PSQARAQAIAAQWQAGADWAKIQSGAKDSAAVGMDNVRESAIPSPGLAKLVFAAPASVL
FT                   QGPVQTDTGWVVFRVTQVTPPHDTDFATARQELRDQMAQTQAADLVGPRVQKLQDAIAG
FT                   GGLDRIPDNLGAVAIAGTLDEQGRTQAGEPAPVPGSDALRRAIVARIFAQAKGANPTLV
FT                   QGPDNAWFAVAVDSVEPGQLRPFDAVPDQGRSAWEDESRRHTANVQATALYLAAKAHGG
FT                   VAAAAGPGQQVLHPAPLGRGQQIEGVPDELARLVFRLGAAGQTVMLDEPDGFYVATLTA
FT                   ITHPDPATQPMQVDRIRTGLSQAIANDIGLSYAATLQQAVKPKTNMGALQSALSSVTGS
FT                   PAAGESSP"
FT   gene            170440..172008
FT                   /locus_tag="Gdia_0156"
FT   CDS_pept        170440..172008
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0156"
FT                   /product="anthranilate synthase component I"
FT                   /EC_number="4.1.3.27"
FT                   /note="KEGG: gdi:GDI1934 anthranilate synthase component 1;
FT                   TIGRFAM: anthranilate synthase component I; PFAM:
FT                   Anthranilate synthase component I domain protein;
FT                   Chorismate binding-like"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ACI49956"
FT                   /db_xref="GOA:A9HJ91"
FT                   /db_xref="InterPro:IPR005256"
FT                   /db_xref="InterPro:IPR005801"
FT                   /db_xref="InterPro:IPR006805"
FT                   /db_xref="InterPro:IPR015890"
FT                   /db_xref="InterPro:IPR019999"
FT                   /db_xref="UniProtKB/TrEMBL:A9HJ91"
FT                   /protein_id="ACI49956.1"
FT                   /translation="MSIPSASAAPVPAGRDDVLATLRQGQGAVVWSIEAADLLTPVAAY
FT                   MRLSRLAGASDTAPPRNAFLLESVEGGVARGRYSVIGLLPDLIWRCHGGAATINTDAAR
FT                   DPAAFVPAGVPPLDSLRAVIRASQMTLPSGLPPMVAGLFGYLGYDMVRQMEHLPDMPAD
FT                   DLDLPEGVMIRPGLFAIFDTVRDELILAAPVRPRSDRTPEAAWQAAQDLLATARRTLSE
FT                   PLQLHEITPDYTGPLEAPRSTFTREGFCAMVRRIQDYIAAGDAFQVVPSQRFSTAFTLP
FT                   PLALYRALRRINPAPFLFNLAFDGFSLVGSSPEILVRLRDGQMTVRPLAGTRPRGRTDE
FT                   EDLALERDLLADPKELAEHLMLIDLGRNDIGRACTVGSVQVTEKFVIERFSHVMHISSN
FT                   VEGQLRPGLEALDALIAGFPAGTLTGAPKIRAMEIIDEVEPTRRATYAGCIGYFGANGA
FT                   MDTCIGLRMAVVKDGQMHVQAGCGVVADSVPDLEYEETRHKARALFRAAEDAVQFARGQ
FT                   NTAGS"
FT   gene            172129..172725
FT                   /locus_tag="Gdia_0157"
FT   CDS_pept        172129..172725
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0157"
FT                   /product="glutamine amidotransferase of anthranilate
FT                   synthase"
FT                   /note="TIGRFAM: glutamine amidotransferase of anthranilate
FT                   synthase; PFAM: glutamine amidotransferase class-I; KEGG:
FT                   gdi:GDI1935 putative mnthranilate synthase component 2"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ACI49957"
FT                   /db_xref="GOA:A9HJ94"
FT                   /db_xref="InterPro:IPR006221"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:A9HJ94"
FT                   /protein_id="ACI49957.1"
FT                   /translation="MILLIDNYDSFTFNLVHYLGDLGEVCDVRRNDALTADQAMDLNPD
FT                   AIVLSPGPGTPDQAGICCELICKAAGRVPVFGVCLGHQAIGQVFGGTVVRAPTPMHGKV
FT                   SPVTHDGSGVFAGLPDPFLATRYHSLTVDPADLPSDLVPVARTEDGVIMGLRHRTLPIF
FT                   GVQFHPESIASEHGHDILANFMAIARGLNTPRKAA"
FT   gene            172733..173863
FT                   /locus_tag="Gdia_0158"
FT   CDS_pept        172733..173863
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0158"
FT                   /product="anthranilate phosphoribosyltransferase"
FT                   /EC_number="2.4.2.18"
FT                   /note="KEGG: gdi:GDI1936 putative anthranilate
FT                   phosphoribosyltransferase; TIGRFAM: anthranilate
FT                   phosphoribosyltransferase; PFAM: glycosyl transferase
FT                   family 3; Glycosyl transferase, family 3-like"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ACI49958"
FT                   /db_xref="GOA:A9HJ97"
FT                   /db_xref="InterPro:IPR000312"
FT                   /db_xref="InterPro:IPR005940"
FT                   /db_xref="InterPro:IPR017459"
FT                   /db_xref="InterPro:IPR035902"
FT                   /db_xref="InterPro:IPR036320"
FT                   /db_xref="UniProtKB/TrEMBL:A9HJ97"
FT                   /protein_id="ACI49958.1"
FT                   /translation="MDGVPSLSADQAGAFRTILNRLARGETLTETEAEDAFGLIMDGGV
FT                   PDTLIAAFLMALRVRGEKRAELLGAVRAVRSRMRAVGPVPPGTIDVCGTGGDGLGTLNI
FT                   STAVAFVLAALGVPVAKHGNRALSSRSGATDVLGALGVDLSDDPSVIAARINDGNLAFM
FT                   AAPAHHPAMRHAGPVRAALGIRTLFNLIGPLCNPAGVTHQLVGVFDPAWLRPVVETLQL
FT                   LGSERVWAVHGYCEGATGGRGVDELTLAGPTAIVALQNGRIYDLTLRPEDAGLRPAPIT
FT                   AIAGGGAEENAAALTALLAGAHGAYRDTVLLNAAACLHVAGRGAALDDDGRLRPASLRA
FT                   LVADAARVLDDGSALAMLNSARRRHMDTPEGITQSL"
FT   gene            173860..174723
FT                   /locus_tag="Gdia_0159"
FT   CDS_pept        173860..174723
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0159"
FT                   /product="Indole-3-glycerol-phosphate synthase"
FT                   /EC_number="4.1.1.48"
FT                   /note="PFAM: Indole-3-glycerol phosphate synthase; KEGG:
FT                   gdi:GDI1937 putative indole-3-glycerol phosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ACI49959"
FT                   /db_xref="GOA:B5ZK20"
FT                   /db_xref="InterPro:IPR001468"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR013798"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZK20"
FT                   /protein_id="ACI49959.1"
FT                   /translation="MMNDMPTSQAPIDCGNTPGQDGIPDVLARICARTRVDVAQRATIT
FT                   PLKDITARAREVDSPTRGFGQALKQRTADRQIGLIAEIKKASPSAGILRPDYDPAGIAV
FT                   QYETAGAACISVLTEGSCFHGCAEDLQRVRKACSLPILRKDFILDPWQVHESRLIGADC
FT                   ILLILAALTDTEASELLDIARGLDMDVLVEVHDEGELNRALALDTSLIGINNRNLKTLK
FT                   TDLETTIQLTPLVPPDRIVVSESGISTHADIVRLSEIGASGFLVGESLLRHDVPGDAAR
FT                   VLLGTV"
FT   gene            174726..175241
FT                   /locus_tag="Gdia_0160"
FT   CDS_pept        174726..175241
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0160"
FT                   /product="molybdenum cofactor biosynthesis protein C"
FT                   /note="TIGRFAM: molybdenum cofactor biosynthesis protein C;
FT                   PFAM: molybdopterin cofactor biosynthesis MoaC region;
FT                   KEGG: gdi:GDI1938 molybdenum cofactor biosynthesis protein
FT                   C"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ACI49960"
FT                   /db_xref="GOA:A9HJA3"
FT                   /db_xref="InterPro:IPR002820"
FT                   /db_xref="InterPro:IPR023045"
FT                   /db_xref="InterPro:IPR036522"
FT                   /db_xref="UniProtKB/TrEMBL:A9HJA3"
FT                   /protein_id="ACI49960.1"
FT                   /translation="MATAGGLSHLDANGHAVMVDVSTKPATARQAVARGRVSMREETLD
FT                   LILSGTIKKGDVLAVSRIAGIMAAKKTADLIPLCHPLPLSSVRVELTASHDRTGVEIEA
FT                   CVGTTGQTGVEMEALTAVSVAALTLYDMCKAVDRGMTIEAVYLARKTGGQSGSYERPEA
FT                   GAAPTPMA"
FT   gene            175354..176364
FT                   /locus_tag="Gdia_0161"
FT   CDS_pept        175354..176364
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0161"
FT                   /product="pyruvate dehydrogenase (acetyl-transferring) E1
FT                   component, alpha subunit"
FT                   /EC_number="1.2.4.1"
FT                   /note="KEGG: gdi:GDI1939 pyruvate dehydrogenase E1
FT                   component subunit alpha; TIGRFAM: pyruvate dehydrogenase
FT                   (acetyl-transferring) E1 component, alpha subunit; PFAM:
FT                   dehydrogenase E1 component"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ACI49961"
FT                   /db_xref="GOA:B5ZK22"
FT                   /db_xref="InterPro:IPR001017"
FT                   /db_xref="InterPro:IPR017597"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZK22"
FT                   /protein_id="ACI49961.1"
FT                   /translation="MGETRKSATEAGRNSPSMSKEDLTRAFHDMVLIRRFEERAGQLYG
FT                   MGLIGGFCHLYIGQEAVVVGVQMELKQGDKIITSYRDHGQMLAAGMDPRGVMAELTGRE
FT                   GGYSRGKGGSMHMFSSEKHFYGGHGIVGAQVSLGIGLAFANKYRGTDEVSIAYFGEGAS
FT                   SQGQVYESFNLAALHKLPCVFVLENNHYGMGTSVERSSASKELWRNGEPWGIPGRQVDG
FT                   MDVEAVRDAAREAIEHCRQGKGPYLLEMTTYRYRGHSMSDPAKYRPRSEVDEMRKNHDP
FT                   IDRVRKELLAMGVGEAELKTIEDKVKEVVVDAADFAQTSPEPDPAELWTDVLVEG"
FT   gene            176368..177714
FT                   /locus_tag="Gdia_0162"
FT   CDS_pept        176368..177714
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0162"
FT                   /product="Transketolase central region"
FT                   /note="PFAM: biotin/lipoyl attachment domain-containing
FT                   protein; Transketolase central region; Transketolase domain
FT                   protein; KEGG: gdi:GDI1940 pyruvate dehydrogenase E1
FT                   component subunit beta"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ACI49962"
FT                   /db_xref="GOA:B5ZK23"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR003016"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR027110"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZK23"
FT                   /protein_id="ACI49962.1"
FT                   /translation="MTQILMPALSPTMTEGKLARWLKTTGDHVAAGDVIAEIETDKATM
FT                   EVEAVDEGTLGDILIPEGTENVPVNTPIATLQSEGGAAAPAAAPAAKAPAPQAAAAPAA
FT                   PQPVSPVAAPVAAPEKDWGETAEITVREALRDAMAAELRRDQDVFLIGEEVAQYQGAYK
FT                   VSQGLLDEFGEKRVIDTPITEQGFTGMAVGAALTGLKPIVEFMTMNFAMQAIDQIINSA
FT                   AKTRYMSGGQMSCPIVFRGPNGAAARVGAQHSQCYASWYGHVPGLKVVAPWSAADAKGM
FT                   LRAAIRDPNPVIVLENEILYGQKFPCPVDEDFILPIGRAKVEREGRDVTIVTFSIMVGT
FT                   ALEAAAILAEQGIEAEVINLRTIRPLDIETIVASVKKTSRLVCVEEGWPFAGIGAEVSM
FT                   QVIEHAFDYLDAPPARVAGADVPMPFAANLEKLALPNPTWVVDAVRKLV"
FT   gene            177727..179001
FT                   /locus_tag="Gdia_0163"
FT   CDS_pept        177727..179001
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0163"
FT                   /product="pyruvate dehydrogenase complex dihydrolipoamide
FT                   acetyltransferase"
FT                   /EC_number="2.3.1.61"
FT                   /note="KEGG: gdi:GDI1941 dihydrolipoamid acetyltransferase
FT                   component of pyruvate dehydrogenase complex; TIGRFAM:
FT                   pyruvate dehydrogenase complex dihydrolipoamide
FT                   acetyltransferase; PFAM: biotin/lipoyl attachment
FT                   domain-containing protein; catalytic domain of components
FT                   of various dehydrogenase complexes; E3 binding domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ACI49963"
FT                   /db_xref="GOA:A9HJB2"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001078"
FT                   /db_xref="InterPro:IPR003016"
FT                   /db_xref="InterPro:IPR004167"
FT                   /db_xref="InterPro:IPR006257"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR036625"
FT                   /db_xref="UniProtKB/TrEMBL:A9HJB2"
FT                   /protein_id="ACI49963.1"
FT                   /translation="MSVNILMPALSPTMTEGKLSRWLKKEGDAIHSGDVIAEIETDKAT
FT                   MEVEAVDDGLLGRILVSEGTEGVKVNAPIAIVVAEGESVPDDAAPVAAAPAAAPVAAAP
FT                   VSEAKAPAIAAAPAVPQGAAPAPAQGTRVFASPLARRIAAQKGIDLSGVKGSGPNGRIV
FT                   RRDVESATAAPVAAPVPSPAPSAPAAAIEAPHTAVPNSTIRKVIARRLTEAKSTIPHFY
FT                   VAMDVELDALLDLRAKLNAASPAEGPGAFKLSVNDMLIKAVAVTLRRVPKVNASYTEDA
FT                   TILYDDVDVSVAVSIADGLITPIVRQADRKSLREISEDAKDLITRARAGKLKPQEFQGG
FT                   SFSISNMGMYGVKEFSAIINPPQAAILAIAAAEKRAVVKDDAIRIATVMTVTLSVDHRV
FT                   VDGALAAEWVSTFRSVVESPLSLVV"
FT   gene            179014..180423
FT                   /locus_tag="Gdia_0164"
FT   CDS_pept        179014..180423
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0164"
FT                   /product="dihydrolipoamide dehydrogenase"
FT                   /note="TIGRFAM: dihydrolipoamide dehydrogenase; PFAM:
FT                   FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; glucose-inhibited division protein A;
FT                   pyridine nucleotide-disulphide oxidoreductase dimerisation
FT                   region; KEGG: gdi:GDI1942 putative dihydrolipoyl
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ACI49964"
FT                   /db_xref="GOA:A9HJB6"
FT                   /db_xref="InterPro:IPR001100"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR006258"
FT                   /db_xref="InterPro:IPR012999"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A9HJB6"
FT                   /protein_id="ACI49964.1"
FT                   /translation="MSKTEFDIVVIGGGPGGYVAAIRAAQLGLSTAVVEANHLGGICLN
FT                   WGCIPTKALLRSSEINHLLHNLGEFGFAADNVRFDLDKVVKRSRKVAGQLSAGVAHLLK
FT                   KNKVPVFDGFGKLAGTSGGRRKIEVTKDGKPVATLSAANVILATGARARVLPGLEPDGK
FT                   LIWSYREAMVPTEMPKRLLVVGSGAIGIEFASFYRNMGAEVTVVEVLDRILPVEDEEIS
FT                   ALAHKAFVKQGFTLLTGAKIGPIRKNGDSVSLSVEAGGKTHDITVDRVISAVGIVGNVE
FT                   NIGLEGTAIQVDRTHIKVDAYCRTGEPGVYAIGDIAGPPWLAHKASHEGVMCVEAIAGR
FT                   HVHPIDPRNIPGCTYCRPQVASVGMTEAAAKAAGHTVRVGRFPFIGNGKAIAMGEPEGL
FT                   VKTVFDAKTGELLGAHMIGAEVTEMIQGYVIARTSELTDAELKETVFPHPTISEAMHEA
FT                   VLAAYDGALHI"
FT   gene            180729..181718
FT                   /locus_tag="Gdia_0165"
FT   CDS_pept        180729..181718
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0165"
FT                   /product="lipoic acid synthetase"
FT                   /note="KEGG: gdi:GDI1943 putative lipoyl synthase; TIGRFAM:
FT                   lipoic acid synthetase; PFAM: Radical SAM domain protein;
FT                   SMART: Elongator protein 3/MiaB/NifB"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ACI49965"
FT                   /db_xref="GOA:B5ZK26"
FT                   /db_xref="InterPro:IPR003698"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZK26"
FT                   /protein_id="ACI49965.1"
FT                   /translation="MPTRLLIDHRKGGVSVRHPEKAHRPDNPIARKPDWIRVRAPNHPV
FT                   YQETRALMREQNLVTVCEEAACPNIGECWSQRHATMMIMGEICTRACAFCNVTTGMPNP
FT                   LDADEPARVGDAVAKLGLRHVVITSVDRDDLPDGGAAHFARVIAAIRAQAPETTIEILT
FT                   PDFLRKRGALEVVVSARPDVFNHNLETVPRLYPGIRPGARYYQSLRLLDDVKRLDPSIF
FT                   TKSGLMVGLGEERAEILQVMDDLRVADVDFITMGQYLQPTVKHAAVRDFVTPDEFADYA
FT                   AMARAKGFLQVSASPLTRSSYHADSDFAELRAAREARLAASRVGTETP"
FT   gene            181718..182212
FT                   /locus_tag="Gdia_0166"
FT   CDS_pept        181718..182212
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0166"
FT                   /product="cyclase/dehydrase"
FT                   /note="PFAM: cyclase/dehydrase; KEGG: gdi:GDI1944
FT                   cyclase/dehydrase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ACI49966"
FT                   /db_xref="InterPro:IPR005031"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:A9HJC0"
FT                   /protein_id="ACI49966.1"
FT                   /translation="MPTHAERRLIAYSVEQLFDLVADVGKYPHFLPWCVNARVRTRTAS
FT                   ELVADLTIGFGPFRETFTSRVDLERPSRIRVRYEKGPFRYLNNVWTFTPDERGCQVDFF
FT                   VDFEFRSRLLQAAIGVVFNEAVRLMVSAFIRRAREVYGPPVTRTTLAQPAHAQPAGTGS
FT                   A"
FT   gene            182266..182592
FT                   /locus_tag="Gdia_0167"
FT   CDS_pept        182266..182592
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0167"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gdi:GDI1945 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ACI49967"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZK28"
FT                   /protein_id="ACI49967.1"
FT                   /translation="MKMSLGAAFLAVVVVATAPAFAATHHHKGRHGEHHADHKMKMNQK
FT                   GSNTTEDLNAKSLDAARAGTPTSPAAPMGGTSAMPSPTVPAGTGVTAPPAAPAPSMPNP
FT                   SNGY"
FT   sig_peptide     182266..182334
FT                   /locus_tag="Gdia_0167"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 23"
FT   gene            complement(182708..182911)
FT                   /locus_tag="Gdia_0168"
FT   CDS_pept        complement(182708..182911)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0168"
FT                   /product="TOBE domain protein"
FT                   /note="PFAM: TOBE domain protein; KEGG: gdi:GDI1946
FT                   putative molybdenum transport protein ModE"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ACI49968"
FT                   /db_xref="GOA:B5ZK29"
FT                   /db_xref="InterPro:IPR004606"
FT                   /db_xref="InterPro:IPR005116"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZK29"
FT                   /protein_id="ACI49968.1"
FT                   /translation="MKISARNQISGKITEIIKGATTSHVGIDIGGKVITASITNEAVAD
FT                   LKLKVGEHATAIIKASDVMVGV"
FT   mobile_element  183008..185254
FT                   /mobile_element_type="insertion sequence:Gdi2"
FT                   /note="interrupted by IS element"
FT   gene            183050..185235
FT                   /pseudo
FT                   /locus_tag="Gdia_0169"
FT   mobile_element  complement(183804..185159)
FT                   /mobile_element_type="insertion sequence:Gdi8"
FT                   /note="family IS256"
FT   gene            complement(183859..185055)
FT                   /locus_tag="Gdia_0170"
FT   CDS_pept        complement(183859..185055)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0170"
FT                   /product="transposase IS256"
FT                   /note="PFAM: transposase mutator type; KEGG: gdi:GDI2780
FT                   putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ACI49969"
FT                   /db_xref="GOA:A9HQE1"
FT                   /db_xref="InterPro:IPR001207"
FT                   /db_xref="UniProtKB/TrEMBL:A9HQE1"
FT                   /protein_id="ACI49969.1"
FT                   /translation="MTDEKMALLELVEQASDGDFVREMLAFAADRMMEMEVEARTGAPL
FT                   GARSASRSTQRNGYRARNWDTRAGTVELAIPKLRKGSYFPTFLEPRKTAEKALLAVIQE
FT                   AYVQGISTRSVDDLVRAMGAGGISKSQVSRLVGEIDERVNSFLSRPIEGEWPYLWIDAT
FT                   YLKLRQGGRIVSIAVIIAVGVNTDGRREVLGVATGPSEAEAFWTDFLRSLADRGLRGVK
FT                   LVVADAHAGLRAAAGRVFNATLQRCRVHWLRNALAHAHAKQRPAISALLRTIFTQETAE
FT                   DASRQWRHVTDKLREGFPKLAEFMKRTEVDVLAYMGFPREHWTQISSTNPIERVNREIK
FT                   RRCDVIGIFPNDAAIIRLVGALMLEQNDEWAVCRRYMTLEGLAAISHNPTISLPAVAA"
FT   mobile_element  complement(185259..186708)
FT                   /mobile_element_type="insertion sequence:Gdi13"
FT                   /note="family IS1182"
FT   gene            complement(185312..186655)
FT                   /locus_tag="Gdia_0171"
FT   CDS_pept        complement(185312..186655)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0171"
FT                   /product="transposase IS1182 family protein"
FT                   /note="PFAM: transposase IS4 family protein; KEGG:
FT                   gdi:GDI3864 putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ACI49970"
FT                   /db_xref="GOA:A9H1J2"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR008490"
FT                   /db_xref="UniProtKB/TrEMBL:A9H1J2"
FT                   /protein_id="ACI49970.1"
FT                   /translation="MSSFIPFDRSQPYLLPPDLKSWLPSDDVAHFIVAAVERVPLRAFS
FT                   VPVRTGGKAQYHPRLMLALLIYAYANGVFSSRRIERATYRDIGMRFVAANLHPDHDTIA
FT                   TFRRGNRTAIEAAFMHVLLLARETGLVRLGTVSIDGTKIDANASKYRSIRYDRAKELRE
FT                   KLATDISTLMERAEAADTTDVDHQALPEELARREALKAKLDEACARLEAEAREQAKTAR
FT                   PEYERKKAAFDAKRGRRGRPPKEPDDEPPPDRQINLTDPDSKLMRRSDAHEYRQAYNAQ
FT                   AVVCAEGSQLILENGVVATTADAPSFAATILGMEERIGLPRTVLADTGFASGKAVETLQ
FT                   ASGVDPLVAIGRPVNRRPYDFRPEPPPREPRRITEPWRLEMKARLQQNPAKALYALRKQ
FT                   TVEPVFGIIKSAMGFTRFHLRGLPNVATEWTLVALAYNCRRITRLTAA"
FT   mobile_element  186713..187642
FT                   /mobile_element_type="insertion sequence:Gdi1"
FT   gene            complement(186733..187569)
FT                   /locus_tag="Gdia_0172"
FT   CDS_pept        complement(186733..187569)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0172"
FT                   /product="transposase IS5 family protein"
FT                   /note="PFAM: transposase IS4 family protein; KEGG:
FT                   gdi:GDI3822 putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ACI49971"
FT                   /db_xref="GOA:A9GZE9"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR025161"
FT                   /db_xref="UniProtKB/TrEMBL:A9GZE9"
FT                   /protein_id="ACI49971.1"
FT                   /translation="MVTWTGIARREHSREGLRYPSDMTDGEWALIMPFVPPAKRGGRPR
FT                   TTDMREVVNAMLYIASAGCAWRLLPKCFPPVSTVRRYFYAWRGAGVFEVMNTVLVMSLR
FT                   EIEGREASPSAGVIDSQSVKTTESGGLSGYDAGKKVKGRKRHIVTDTCGFLIFLLVHAA
FT                   DIQDRDGAVDVLAAIRRRFPWLRHIFADGGYAGDKLRSALASMGKWTLEIIRRSDTAKG
FT                   FQILPRRWVVERTFAWLGRCRRLAKDWEQSIASSTAWTLIASIRMLTRRTARHCHG"
FT   gene            complement(187681..189318)
FT                   /locus_tag="Gdia_0173"
FT   CDS_pept        complement(187681..189318)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0173"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="PFAM: chemotaxis sensory transducer; SMART:
FT                   histidine kinase HAMP region domain protein; KEGG:
FT                   gdi:GDI1947 putative chemoreceptor McpA (methyl-accepting
FT                   chemotaxis protein)"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ACI49972"
FT                   /db_xref="GOA:B5ZK33"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR009050"
FT                   /db_xref="InterPro:IPR012292"
FT                   /db_xref="InterPro:IPR039379"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZK33"
FT                   /protein_id="ACI49972.1"
FT                   /translation="MLEPDTLADRLQFVKLDSKTRQNLRGIKSIIMRALPGALDKFYDQ
FT                   VRSFPKTRHFFSGQAHIDAAKSRQIAHWGTISDARFDQSYMEAATRIGEVHARVGLEPR
FT                   WHIGGYALLIESMLGALLEARWPKAGLAARIGLGGGADVRQVAEEAGALVKAALIDMDY
FT                   AISAYLEASETARQKVEADVLARERGTVVDRVGAGMAALATGDLTFRMSSDVPEEYRKL
FT                   QEDFNGAIESLQTTMQAIDTNAQAVRTGSDEIRQASDDLARRTAQQAASLEQAAATLDG
FT                   ITTTVRRSAEDAGQARHMATVAKTDAERSGDVVRQTVTTMSGIEASSRQIGSIIGIIDE
FT                   IAFLTNLLAVNAGVEAARAGDAGRGFAVVATEVRALAQRSAEAAKEIKELISASGRQVT
FT                   TGVKLVGETGKALDRIVEQVSRLNVLVTDIAISSANQATGLNEVNDAVNQMDQVTQQNA
FT                   AMVEQSAAASRSMANEAEDLARLVEQFQTGHSQAFQTASRTGPAPAASLWQDEESSAYM
FT                   PAASSRSAAGGNVLSFPAAKGADGWDEF"
FT   gene            complement(189656..191974)
FT                   /locus_tag="Gdia_0174"
FT   CDS_pept        complement(189656..191974)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0174"
FT                   /product="TonB-dependent siderophore receptor"
FT                   /note="TIGRFAM: TonB-dependent siderophore receptor; PFAM:
FT                   TonB-dependent receptor; TonB-dependent receptor plug;
FT                   KEGG: gdi:GDI1948 putative TonB-dependent receptor"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ACI49973"
FT                   /db_xref="GOA:B5ZK34"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010105"
FT                   /db_xref="InterPro:IPR010917"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039423"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZK34"
FT                   /protein_id="ACI49973.1"
FT                   /translation="MSRKDRKGGQPFTMAGVGLVLLSSVSQAAESKSTTKPRPVLSGPQ
FT                   QHASAPKSKPAAPATPVPTAQHILVTGRTVSGATADYNKKTAYLGPLGNRSILDTPMSI
FT                   QSVPHDVMVNQQTRNLNDLMGYMSSVQLEVRGDPNTSRPQSRGFEADVIANTRLDGLNI
FT                   VSTTPYAAEMFEDVQVLNGVAGALYGAQNPAGTFAFSTKRPTDTPINRLTVGVDSIGTL
FT                   MENADVSGRIGKNKWFGYRINLLHGDGTTYVQNSWMRRNLVSADFDIHFDPDTVLELDA
FT                   SHYTYVQRGTTPGFNLAYNATSLPPAPDLSKPNLGQDYAGYNMETNLFMAKIKHTINRD
FT                   WSFTLGGNYEDSIRQVFSNTNTLTTGPVGEYTQTIAAAVTANDFRSGANLAYVNGHFHT
FT                   GFITHDIVAGTNGYMMGNYNPTQGETIALGKSNMYSPSVLSGSQPYYHGRYESAYIRNQ
FT                   AMILGDTLHLDRHWSIVGTLTWNWLSQDNRSTKSRTVKDGNTTYSYTTPLGWTSKHIDG
FT                   AFSPMASLVYKPAENQTAYFTYGRAIQAGVQAPASAANANQMTQPFRSEEYEVGYKISY
FT                   QKMLFSVAGFRMNRPYAYQDANGYFGTFGMQTNYGVEVQAQGRITPDLSVLAGMTWLDA
FT                   ELGGTGNAATNNKEVVGAPPVQANILLDYRLPIPHGAFASGLAVNANVHYTGRRAATIT
FT                   NSAYADAYATLDLGIRYPFFAAHHPWAARFGVTNVANTQYWSSLYPASNNGSLNNDTGA
FT                   SSIYAGLPRMFHFTLEADF"
FT   sig_peptide     complement(191888..191974)
FT                   /locus_tag="Gdia_0174"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.994 at
FT                   residue 29"
FT   gene            complement(192510..193016)
FT                   /locus_tag="Gdia_0175"
FT   CDS_pept        complement(192510..193016)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0175"
FT                   /product="CinA domain protein"
FT                   /note="PFAM: CinA domain protein; KEGG: gdi:GDI1950
FT                   putative CinA-like"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ACI49974"
FT                   /db_xref="InterPro:IPR008136"
FT                   /db_xref="InterPro:IPR036653"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZK35"
FT                   /protein_id="ACI49974.1"
FT                   /translation="MTSMLDGTVLTQAAETLDRLRQAGLQVVTAESCTGGLVAAALTHH
FT                   AGSSDMVQGGFITYSNDMKTALLGVAPALLARHGAVSAEVAAAMAEGALSRAPHAAIAV
FT                   SITGIAGPGGGSASKPVGLVWFGTARRGGQTRTLSRHFGGDRTAVRQRAVVQALDLILQ
FT                   RIGTE"
FT   gene            complement(193036..193515)
FT                   /locus_tag="Gdia_0176"
FT   CDS_pept        complement(193036..193515)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0176"
FT                   /product="phosphatidylglycerophosphatase A"
FT                   /note="PFAM: phosphatidylglycerophosphatase A; KEGG:
FT                   gdi:GDI1951 putative phosphatidylglycerophosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ACI49975"
FT                   /db_xref="GOA:B5ZK36"
FT                   /db_xref="InterPro:IPR007686"
FT                   /db_xref="InterPro:IPR026037"
FT                   /db_xref="InterPro:IPR036681"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZK36"
FT                   /protein_id="ACI49975.1"
FT                   /translation="MTPSRLIASFGGCGFSPFAPGTVGSLAALACGLGLLAHPLALAVA
FT                   IVLCCAIGYVATARASGGVDHGWIVIDEVAGMWITMFPLSLPPTPVHPWTPDRIGVLWL
FT                   VLAFALFRLFDITKPGPVGWFDRRHDAVGIMGDDIVAGLIGAFILAAIRCLIVMT"
FT   sig_peptide     complement(193423..193515)
FT                   /locus_tag="Gdia_0176"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.992) with cleavage site probability 0.882 at
FT                   residue 31"
FT   gene            complement(193512..195533)
FT                   /locus_tag="Gdia_0177"
FT   CDS_pept        complement(193512..195533)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0177"
FT                   /product="Lytic transglycosylase catalytic"
FT                   /note="PFAM: Lytic transglycosylase catalytic;
FT                   Tetratricopeptide TPR_4; KEGG: gdi:GDI1952 putative soluble
FT                   lytic murein transglycosylase precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ACI49976"
FT                   /db_xref="GOA:B5ZK37"
FT                   /db_xref="InterPro:IPR000189"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR008939"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZK37"
FT                   /protein_id="ACI49976.1"
FT                   /translation="MRRLLPFFPLPVLACLALLGGSARADSSGLPEPPRSVPSDAVVPP
FT                   AVPDGTSDAVAARVDTYLRLLSPLGGDIDEYLSFLDQTPTWPRRAVMLGRLQRLMAVAA
FT                   PGVPGMAQACATLTLTYAPALAACARQPVPAPDLPARARHAWTEGVDQMEDEAAFLAAF
FT                   APVLTPADQWHRFMRQELTGHLDAAQRQVARVDIGRQALARARLSLRMGWSDTPALLAL
FT                   VPPALSDDPVLVLDRIRWLRRSGQADLAAALWAQSGPAAEQRVADPAFAAAIKAAFWAE
FT                   RDALAHDMMLAGRDKEALALATASDDMAPTDRNAARFLSGWILLQHDHDPHAALARFRP
FT                   LCDASSLLTRSRGLYWTGRALSDLGDRDGARTAWGQAAALPGTFYGQMAASRLAGDTAS
FT                   PLLFPERSGDLVRSRLGAIPGPVWTPDDKARFDASDLVQAARLLAARHDLGHARDFLLL
FT                   QDTRTGGTAGHVLAATLALQLGLPDVAVSIARRAGREGTALLPLGWPVPFSPALSSVPG
FT                   EGLPPGFLMAVIRQESGFDPGIVSPAGAYGLMQLMPAAARDVSRQARLATGPLTGARLT
FT                   DPDLNIRIGSAYLVRLMQKFGGAVPYVLAAYNAGPHRADEWLALLGDPARGTPTADAML
FT                   DWIESIPFAETRSYIQRVEENMAIYQALAASAQAEAAP"
FT   sig_peptide     complement(195456..195533)
FT                   /locus_tag="Gdia_0177"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.989 at
FT                   residue 26"
FT   gene            complement(195574..196188)
FT                   /pseudo
FT                   /locus_tag="Gdia_0178"
FT   gene            196367..197722
FT                   /locus_tag="Gdia_0179"
FT   CDS_pept        196367..197722
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0179"
FT                   /product="adenylosuccinate lyase"
FT                   /note="TIGRFAM: adenylosuccinate lyase; PFAM: fumarate
FT                   lyase; KEGG: gdi:GDI1954 putative adenylosuccinate lyase"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ACI49977"
FT                   /db_xref="GOA:B5ZK38"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR004769"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR019468"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZK38"
FT                   /protein_id="ACI49977.1"
FT                   /translation="MVPRYTRPAMAAIWAPENRYRIWFEIEAMACEAMAQYGAVPAEAA
FT                   KVVREKGDAAMAAFSQADLDRIDEIEAETRHDVIAFLTWLAEKIGPESRFVHLGMTSSD
FT                   VLDTCLSVQLVQATDMLLADLDAVLDALKRRAFEHKYTLTIGRSHAIHAEPTSFGLKLA
FT                   GHYAEFARNRERLVRARAEIATCAISGAVGTYAHVDPRVEEFVAARLGLEPEGVSTQVI
FT                   PRDRHAAYFCALAVIASGIERLAVEVRHLQRSEVREAEEFFHPGQKGSSAMPHKRNPVL
FT                   SENLTGLARLVRAHVIPALENVALWHERDISHSSVERNICPDGTIGLDFALARLAGMMD
FT                   KLVIYPDRMIANLESLGGVVHSGEVLLALARAGILREDAYRIVQRNAMATWTMLGKPGG
FT                   RSFRENLEADPEVAGRVPASVLDAAMNSDSHLGALDHSYTRVFGEAGPGRAG"
FT   gene            197773..198516
FT                   /locus_tag="Gdia_0180"
FT   CDS_pept        197773..198516
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0180"
FT                   /product="protein of unknown function DUF833"
FT                   /note="PFAM: protein of unknown function DUF833; KEGG:
FT                   gdi:GDI1955 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ACI49978"
FT                   /db_xref="InterPro:IPR008551"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZK39"
FT                   /protein_id="ACI49978.1"
FT                   /translation="MCTIVLSLAPGSEWPLLLAANRDERLDRPWDAPGRHWPDRPSVIG
FT                   GRDRLAGGSWLALNDAGVVAGVMNRVGSLGPAAGKRSRGELPLMALEHTTATDAMRALA
FT                   TLDAGAWRSFNMVVADRRCAYFISGLGYATPEILRLEPGCHMAATTGPDDLSIPRIGRH
FT                   LPRFREPARPVPPDWTPWTRILSDRSLPAGSELNIPPRAGFGTCSSSVIGLPAAPDAAP
FT                   SWHFAAGAPDRVGYAPVDLRSGPAA"
FT   gene            198670..199434
FT                   /locus_tag="Gdia_0181"
FT   CDS_pept        198670..199434
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0181"
FT                   /product="phosphoribosylaminoimidazole-succinocarboxamide
FT                   synthase"
FT                   /EC_number="6.3.2.6"
FT                   /note="KEGG: gdi:GDI1956
FT                   phosphoribosylaminoimidazole-succinocarboxamide synthase;
FT                   TIGRFAM: phosphoribosylaminoimidazole-succinocarboxamide
FT                   synthase; PFAM: SAICAR synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ACI49979"
FT                   /db_xref="GOA:A9HJF3"
FT                   /db_xref="InterPro:IPR001636"
FT                   /db_xref="InterPro:IPR018236"
FT                   /db_xref="InterPro:IPR028923"
FT                   /db_xref="InterPro:IPR033934"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9HJF3"
FT                   /protein_id="ACI49979.1"
FT                   /translation="MARRRQLYEGKAKILFEGPEPGTLVQYFKDDATAGNGAKKGIITG
FT                   KGVLNNRISEHLMLRLHDIGIPTHFIRRLNMREQLIREVEIIPLEVVVRNVAAGSLAKR
FT                   LGIPEGTRLPRTIIEYYYKNDSLNDPMVSEEHITAFGWACTHDLDDMVALTMRTNDFLS
FT                   GLFVGIGITLVDFKLEFGRLWEGEDMRIVLADEISPDNCRLWDAKTSEKLDKDRFRRDM
FT                   GRVEEAYQEVAWRLGILPEATNSDMKGPEVMQ"
FT   gene            199431..199673
FT                   /locus_tag="Gdia_0182"
FT   CDS_pept        199431..199673
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0182"
FT                   /product="phosphoribosylformylglycinamidine synthase, purS"
FT                   /note="TIGRFAM: phosphoribosylformylglycinamidine synthase,
FT                   purS; PFAM: phosphoribosylformylglycinamidine synthetase
FT                   PurS; KEGG: gdi:GDI1957 putative
FT                   phosphoribosylformylglycinamidine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ACI49980"
FT                   /db_xref="GOA:A9HJF5"
FT                   /db_xref="InterPro:IPR003850"
FT                   /db_xref="InterPro:IPR036604"
FT                   /db_xref="UniProtKB/TrEMBL:A9HJF5"
FT                   /protein_id="ACI49980.1"
FT                   /translation="MKVRVTVMLKDGVLDPQGKAVAHALHVLGFGGVGEVRIGRVIELE
FT                   LDETDPAAAREKADAMARGLLANLVIEDFVTEVVA"
FT   gene            199670..200065
FT                   /locus_tag="Gdia_0183"
FT   CDS_pept        199670..200065
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0183"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gdi:GDI1958 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ACI49981"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR041238"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZK42"
FT                   /protein_id="ACI49981.1"
FT                   /translation="MTARRSVFLLAAALAAGSAVASLPSSAMAQRVSTLKGGRFLEFCS
FT                   RAPSVAICDAYLSGLADAVALTHVYDKNQGDKTTPTGFCIAPGATSAEMRGHVVTWLHG
FT                   HSDQLSKPVGELVFTALHESYPCGGGK"
FT   sig_peptide     199670..199759
FT                   /locus_tag="Gdia_0183"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.724 at
FT                   residue 30"
FT   gene            200062..200763
FT                   /locus_tag="Gdia_0184"
FT   CDS_pept        200062..200763
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0184"
FT                   /product="phosphoribosylformylglycinamidine synthase I"
FT                   /EC_number="6.3.5.3"
FT                   /note="KEGG: gdi:GDI1959 phosphoribosylformylglycinamidine
FT                   synthase I; TIGRFAM: phosphoribosylformylglycinamidine
FT                   synthase I; PFAM: CobB/CobQ domain protein glutamine
FT                   amidotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ACI49982"
FT                   /db_xref="GOA:B5ZK43"
FT                   /db_xref="InterPro:IPR010075"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZK43"
FT                   /protein_id="ACI49982.1"
FT                   /translation="MKAGIVVFPGTNRERDMAIALRSVTGRAPAMIWHRDTDLPDLDLV
FT                   VLAGGFSYGDYLRCGAMAAHAPIMAAVRRFAEAGGHILGVCNGFQILTETGLLPGALLR
FT                   NAALRFLSQDCHLRVERNDTPFTRRWQVGDVFRTPMAHGDGNYIADDATIHALEDEGRV
FT                   AFRYARPDGRVDAGDRQTNPNGSVNAIAGVFSANLRICGMMPHPEDLVDPLMGGEDGKP
FT                   LFEGLVEALVR"
FT   gene            200760..202973
FT                   /locus_tag="Gdia_0185"
FT   CDS_pept        200760..202973
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0185"
FT                   /product="phosphoribosylformylglycinamidine synthase II"
FT                   /EC_number="6.3.5.3"
FT                   /note="KEGG: gdi:GDI1960 phosphoribosylformylglycinamidine
FT                   synthase II; TIGRFAM: phosphoribosylformylglycinamidine
FT                   synthase II; PFAM: AIR synthase related protein; AIR
FT                   synthase related protein domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ACI49983"
FT                   /db_xref="GOA:B5ZK44"
FT                   /db_xref="InterPro:IPR010074"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="InterPro:IPR041609"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZK44"
FT                   /protein_id="ACI49983.1"
FT                   /translation="MSSEKGQRPVDQDLAKEFGLTAEEYGNVLSIMGRTPSLTELGIFS
FT                   VMWSEHCSYKSSRVWLKTLPTTAPWVIHGPGENAGVVDIGQGLAAIFKMESHNHPSFIE
FT                   PYQGAATGVGGILRDVFTMGARPVANLNALRFGSPENPQTRRIIDGVVRGVGGYGNCVG
FT                   VPTVGGEINFHPSYDGNPLVNAMTVGIARQDRIFLSAAAGVGNPVIYVGSKTGRDGIHG
FT                   ATMSSSEFDEDALAKRPTVQVGDPFVEKLLIEACLELMATDAIVAIQDMGAAGLTSSSV
FT                   EMAGKGGVGIDLDLDAVPQRERGMTAYEMMLSESQERMLIVIRPDRTDVARAIFEKWEL
FT                   DFAVIGHLTETGHIVVRHQGRVEADIPLDPLADQAPIYRRPTAPAPVPAPLGPLTDPVG
FT                   IEQALIRLIGCPDLASRAWVWNQYDSTVGGQTVKRPGGADAAIVKIEDTSLGLALTTDC
FT                   TPRYCRADARLGGAQAVAEAWRNIVATGARPLAVTDNLNFGSPEKPEVMGQFVAAIEGM
FT                   GEACRALDFPVVSGNVSLYNETRAPDGSSVSILPTPAIGGLGVLEDVTKAVGLAMPADC
FT                   ILVLVGTTRGEMGQSLWLREIHGREDGPPPALDLAAERRNGDFVRGQIQDGHVVACHDV
FT                   ADGGLLVTLAEMVMAGDVGCVLSAPQSGIRPEAFWFGEDQSRYVVAVRDADAFTLAATG
FT                   AGVETRVLGRSGGDGLTLPSGATISTARLNAVNSAFFPALMDR"
FT   gene            203000..203236
FT                   /locus_tag="Gdia_0186"
FT   CDS_pept        203000..203236
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0186"
FT                   /product="BolA family protein"
FT                   /note="PFAM: BolA family protein; KEGG: gdi:GDI1961
FT                   putative BolA protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ACI49984"
FT                   /db_xref="InterPro:IPR002634"
FT                   /db_xref="InterPro:IPR036065"
FT                   /db_xref="UniProtKB/TrEMBL:A9HJG6"
FT                   /protein_id="ACI49984.1"
FT                   /translation="MAMTAQEIETYIRTALPDASISIEDLAGDGDHYACTVVSEAFRGL
FT                   SRVRQHQVVYAALQGHMGGKLHALALQTNVPER"
FT   gene            203297..203632
FT                   /locus_tag="Gdia_0187"
FT   CDS_pept        203297..203632
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0187"
FT                   /product="glutaredoxin-like protein"
FT                   /note="TIGRFAM: glutaredoxin-like protein; PFAM:
FT                   glutaredoxin; KEGG: gdi:GDI1962 putative monothiol
FT                   glutaredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ACI49985"
FT                   /db_xref="GOA:B5ZK46"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR004480"
FT                   /db_xref="InterPro:IPR014434"
FT                   /db_xref="InterPro:IPR033658"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZK46"
FT                   /protein_id="ACI49985.1"
FT                   /translation="MADTITQRIQNDIDTNPVMLYMKGTAQFPQCGFSAKVVKILNHLG
FT                   VPFQAANVLEDAELRQGVKDFTNWPTVPQLYVKGEFIGGCDIVSEMFQTGELEKLFVEK
FT                   GIVTASA"
FT   gene            203774..204115
FT                   /locus_tag="Gdia_0188"
FT   CDS_pept        203774..204115
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0188"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gdi:GDI1963 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ACI49986"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZK47"
FT                   /protein_id="ACI49986.1"
FT                   /translation="MFRVAIRKAALSLLGTGMALLAVGTTSAHAQHMVTDIEAGRLTLD
FT                   ALTAPPPPVRHIVYRRAVRTAPVHAYRTALASGTHGLGTHGLVRNVVYHPAHAASSGRH
FT                   VAHKGRHRT"
FT   sig_peptide     203774..203866
FT                   /locus_tag="Gdia_0188"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.961 at
FT                   residue 31"
FT   gene            complement(204143..204526)
FT                   /locus_tag="Gdia_0189"
FT   CDS_pept        complement(204143..204526)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0189"
FT                   /product="protein of unknown function UPF0102"
FT                   /note="PFAM: protein of unknown function UPF0102; KEGG:
FT                   gdi:GDI1964 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ACI49987"
FT                   /db_xref="GOA:A9HJH4"
FT                   /db_xref="InterPro:IPR003509"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011856"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9HJH4"
FT                   /protein_id="ACI49987.1"
FT                   /translation="MMVEPTRRRVRGAASYQRGLQAEQVAGAWLQEHGWTILMHRARTR
FT                   WGEIDLVAQRGAMIVFCEVKCRPHYTAAAESLGRAQMRRLMNAAAWLCAAHPGWIYDEM
FT                   RFDVLLVTAGDAVHHITDAFRME"
FT   gene            204606..206024
FT                   /locus_tag="Gdia_0190"
FT   CDS_pept        204606..206024
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0190"
FT                   /product="phospholipase D/Transphosphatidylase"
FT                   /note="PFAM: phospholipase D/Transphosphatidylase; KEGG:
FT                   gdi:GDI1965 putative cardiolipin synthetase 1"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ACI49988"
FT                   /db_xref="GOA:B5ZK49"
FT                   /db_xref="InterPro:IPR001736"
FT                   /db_xref="InterPro:IPR022924"
FT                   /db_xref="InterPro:IPR025202"
FT                   /db_xref="InterPro:IPR027379"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZK49"
FT                   /protein_id="ACI49988.1"
FT                   /translation="MLLTYWHTVLLLVLLSRVVVALSVAVHVLLNKRDVGAAIGWIGIS
FT                   ILMPFTGGVLYAMFGINRVHRRARKLIGRSSWHSRTLSSRWKRAEQGHFAPLSNMVGKL
FT                   TGRPLMSGNGICMLHDGDQAYPQMLDAIGGATSSVLLSSYIFRGDDAGDRFIAALIGAH
FT                   QRGIAVRVLVDGVGSGYFRCPVTHALHRAGVPVGRFMHSLLPWRMPFINMRNHKKILVV
FT                   DGQLGFMGGLNIGAENVVASHPAHPVSDTHFRVEGPIVHQLTEAFAQDWSFTTGEDLPV
FT                   DPFFPEVSQHGDILARIVTAGPDSDLEKIEFTMLQAITMARHSVRLMTPYFLPGERFLT
FT                   ELALAALRGIEVDIVIPGRSNHTLIDWARSANLPRFLDSGCRVWRASPPFNHSKLMVVD
FT                   QHWAFVGSSNLDVRSLRLNFEINLEAYDDAMAGLIDAFIIRHRHERLTHHDLDRRILPI
FT                   RLRDAGARLFLPYL"
FT   sig_peptide     204606..204671
FT                   /locus_tag="Gdia_0190"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.885) with cleavage site probability 0.581 at
FT                   residue 22"
FT   gene            complement(206015..206722)
FT                   /locus_tag="Gdia_0191"
FT   CDS_pept        complement(206015..206722)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0191"
FT                   /product="Endonuclease/exonuclease/phosphatase"
FT                   /note="PFAM: Endonuclease/exonuclease/phosphatase; KEGG:
FT                   gdi:GDI1966 putative endonuclease/exonuclease/phosphatase
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ACI49989"
FT                   /db_xref="GOA:A9HJH8"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:A9HJH8"
FT                   /protein_id="ACI49989.1"
FT                   /translation="MSIVRPYPPSAPHLRPGQRPRPAHLPANAGGSERKIVSWNLLRLV
FT                   GASPRDVIHLIEQERPDLLLMQEATSDFDALPHLIGGHYARSPLPGRIHGVACWSPSPF
FT                   RRQPLTCTLPSGPLVRRVAQMIECASFAFTVANVHLSHGQIMNRRQLRRLGEILPAHAA
FT                   VLGDFNLVGPTLMPHFRDVGPRAPTHRMVDMVPIRIDRCLVRGLSCTEARVLDNYTSDH
FT                   CPITVRLERSGYK"
FT   gene            complement(206719..207795)
FT                   /locus_tag="Gdia_0192"
FT   CDS_pept        complement(206719..207795)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0192"
FT                   /product="protein of unknown function UPF0118"
FT                   /note="PFAM: protein of unknown function UPF0118; KEGG:
FT                   gdi:GDI1967 putative inner membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ACI49990"
FT                   /db_xref="GOA:A9HJI2"
FT                   /db_xref="InterPro:IPR002549"
FT                   /db_xref="UniProtKB/TrEMBL:A9HJI2"
FT                   /protein_id="ACI49990.1"
FT                   /translation="MAERIMMGLLLGGVAFGCGAILYPFMSALLWAAILTFATWPLFIR
FT                   LRRRTGPVTAAIGMTVLSALVVALPLAVVVSTSIADLPGTFEGLAETLARLIHLPAPPP
FT                   WLARIPHFGPDLAKIWTQWATDLGHAERMLLPYTGSIAQSMLAGLMQVASGLVHLGMAL
FT                   FIAFFFWLGGDSLGGTFSAVIRRIAGSYADRILSIIGRTIRGTVYGILGTAIVQGVLTG
FT                   LGFALTGLPEPVLFGLITACVAVLPIGAPLIWIPGALALILTHHPGWGIFLVVYGVLII
FT                   SGADHIIRPMFISRGAQLPYLLTVLGVLGGVWTFGGLGIFLGPVLLGVGYTLTAEFAAN
FT                   GSGHTGNATPIQENFIEP"
FT   sig_peptide     complement(207697..207795)
FT                   /locus_tag="Gdia_0192"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.994 at
FT                   residue 33"
FT   gene            208005..208859
FT                   /locus_tag="Gdia_0193"
FT   CDS_pept        208005..208859
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0193"
FT                   /product="Rhodanese domain protein"
FT                   /note="PFAM: Rhodanese domain protein; KEGG: gdi:GDI1968
FT                   3-mercaptopyruvate sulfurtransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ACI49991"
FT                   /db_xref="GOA:B5ZKN1"
FT                   /db_xref="InterPro:IPR001307"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZKN1"
FT                   /protein_id="ACI49991.1"
FT                   /translation="MHPLISPAQLQERLAAPDLVVLDATMALPGETFDPARCFAQAHIP
FT                   GARRFDIELFSDPDSPLPHMIPTQARFEHLARGLGLSDGAHVVFYDQGNAASAARGWWL
FT                   AGLFGLDRVQVLDGGLPAWQRAGGPVEQGEEGPAAAGGFRAAPRFARVSGLGDMRAHVG
FT                   RGDRLILDARAQARFAGTAAEPRPGLASGHMPGARNLPFGTLLDANRAFLPPAALRDRF
FT                   AHVGVTDGRPVVTTCGSGVSAAVLSLGLAICGRTGDSLYDGSWAEWGSTPGAPVETGEG
FT                   TSP"
FT   gene            208856..210106
FT                   /locus_tag="Gdia_0194"
FT   CDS_pept        208856..210106
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0194"
FT                   /product="cystathionine beta-lyase"
FT                   /note="TIGRFAM: cystathionine beta-lyase; PFAM: Cys/Met
FT                   metabolism pyridoxal-phosphate-dependent protein; KEGG:
FT                   gdi:GDI1969 putative cystathionine beta-lyase"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ACI49992"
FT                   /db_xref="GOA:A9HJI8"
FT                   /db_xref="InterPro:IPR000277"
FT                   /db_xref="InterPro:IPR006233"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A9HJI8"
FT                   /protein_id="ACI49992.1"
FT                   /translation="MTDRQALHHAVSRGWRHMGTTLVHLARDLPPAAEGTLVNPASTRG
FT                   STVLFPTVADMNRNGTRRYDHELIYGAMGTPIQHQLESAIAALEGARHTQVVSSGLAAC
FT                   STPLLAFLGKNGHCLIPDSVYGPTRRFANTVLRRFGVETTYYPPMIDADGLRAAMRPNT
FT                   QVVFAESPGSHTFEVQDIRMIADIAHEHGARMMLDNTWGIGVFQPFDHGVDISIQALTK
FT                   YPAGHSDSIIGAVSVADEQDWQALRDTSIQLGQVAGPDDCWLTLRGLRTMGARLERQSR
FT                   AAIDIALWLSDRPEVARVLHPALPSCPGHEIWRRDYTGASALFGVVFQPEYDAAAMTAM
FT                   IDSLALFGIGASWGGYESLVLPTTGGITRSCPPGEECGPQTGPACRLHIGLENPEDLIA
FT                   DLSAGLEVLAGGAVYGA"
FT   gene            complement(210408..211274)
FT                   /locus_tag="Gdia_0195"
FT   CDS_pept        complement(210408..211274)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0195"
FT                   /product="Beta-lactamase"
FT                   /EC_number="3.5.2.6"
FT                   /note="PFAM: beta-lactamase; KEGG: gdi:GDI1971 putative
FT                   beta-lactamase precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ACI49993"
FT                   /db_xref="GOA:A9HJJ4"
FT                   /db_xref="InterPro:IPR000871"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR023650"
FT                   /db_xref="UniProtKB/TrEMBL:A9HJJ4"
FT                   /protein_id="ACI49993.1"
FT                   /translation="MKRRHFLWGGSTFLASPSLARPAPPSVISDYENGTGGHIGLYAEN
FT                   VKTGAKLTWRARERFVMCSTVKASLAACVLSRVDRGRDRLEDIIPYSASDIQDWYAPVA
FT                   KANLARGAMSVGDMCQAAVEQSDNTCANILLARIGGPSALTAFWRGIGDRETRLDDPEP
FT                   YLNRTPPGGVRNTTTPASMATIMRSLVLGRVLSDASRAIFTRWLVGCRTGDDRLRAGLP
FT                   PHWVIGDKTGNNGRDAAGDIAVVWPERDVPIILCVYTRGGSPTQQQFRTAFAGIARVVG
FT                   TRLYPGI"
FT   sig_peptide     complement(211212..211274)
FT                   /locus_tag="Gdia_0195"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.999 at
FT                   residue 21"
FT   gene            complement(211281..212792)
FT                   /locus_tag="Gdia_0196"
FT   CDS_pept        complement(211281..212792)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0196"
FT                   /product="Mg chelatase, subunit ChlI"
FT                   /note="KEGG: gdi:GDI1972 putative Mg chelatase-related
FT                   protein; TIGRFAM: Mg chelatase, subunit ChlI; PFAM:
FT                   magnesium chelatase ChlI subunit; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ACI49994"
FT                   /db_xref="GOA:B5ZKN4"
FT                   /db_xref="InterPro:IPR000523"
FT                   /db_xref="InterPro:IPR001208"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004482"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR025158"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZKN4"
FT                   /protein_id="ACI49994.1"
FT                   /translation="MTISCVLGFAFSGIDAIPVRVEVQLASGLPSFLIVGLADKAVAEA
FT                   RERVRAALSAMGLTLPAKRIVVNLAPANIVKEGSHFDLPIALALLTAMGVVPSEESGRF
FT                   AAIGELSLDGRINPVPGVLPAALCAVDQSRGLICGAQQGHEARWAGDGLDILAPDSLLA
FT                   LVNHMTGEQVLPPVELPERLPVESIGTGPDLADVRGMETARRALEIAAAGAHSLLMTGP
FT                   PGAGKSMLAARLPSLLPDLTSTEILEISRIHSISGHLPMGLPVFRPPFRDPHHSTSQIA
FT                   LVGGGNGNRIRPGEVSLAHRGVLFLDELPEFSRAALEALRQPIETGTITVARASAHVTY
FT                   PARFQLVAAMNPCRCGYLGDASQECRKAPRCGEEYLSRISGPMLDRMDMAVHVEPVSPA
FT                   ELAGLPTGENSAAVAARVAVARTRQTARQDGLTNAEAPPDLFPTSTAARDYAVRAADRL
FT                   RLSARGFTRLLRVARTIADLAGDEETGQPHVAEAVSYRLRRPDRR"
FT   gene            213112..213354
FT                   /locus_tag="Gdia_0197"
FT   CDS_pept        213112..213354
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0197"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="PFAM: helix-turn-helix domain protein; KEGG:
FT                   gdi:GDI1973 putative HTH-type transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ACI49995"
FT                   /db_xref="GOA:A9HJJ9"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:A9HJJ9"
FT                   /protein_id="ACI49995.1"
FT                   /translation="MHNRIAMFRAERGLTRRALAEAVEVNPQTIGYLERGDYKPSLELA
FT                   LKICRVLGVEVDMVFSLEPFESVAEQMRRAMRNGS"
FT   gene            213375..213953
FT                   /locus_tag="Gdia_0198"
FT   CDS_pept        213375..213953
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0198"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gdi:GDI1974 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ACI49996"
FT                   /db_xref="GOA:A9HJK1"
FT                   /db_xref="UniProtKB/TrEMBL:A9HJK1"
FT                   /protein_id="ACI49996.1"
FT                   /translation="MVPVNPWSTPDRSIAAFLDVPAKAFAQGMDRIGMPVLADNPDMKR
FT                   DPASVRYRWRPALILLLTIVNLTWLSISPHPSPLLFMYVQIGLSGWLSGLVYKFAQALG
FT                   PVFEWDERQQALAGAAREKGLMGALLLTYTGLGVLLWQLLAAAQRRVDFLLPRLATEII
FT                   LLLTATVIVYQCIRLLYLSWADRSLPDPE"
FT   gene            214033..214563
FT                   /locus_tag="Gdia_0199"
FT   CDS_pept        214033..214563
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0199"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   pfl:PFL_4654 acetyltransferase, GNAT family family"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ACI49997"
FT                   /db_xref="GOA:B5ZKN7"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZKN7"
FT                   /protein_id="ACI49997.1"
FT                   /translation="MEAALYIRRAKPDDCALIFAIHKDSVLGLCASHYSDTQMSAWFEG
FT                   RASDDYTTAVELGSCWIAYKADDPVGFLGLFANRISMIFVQSAASGQGIGTILLHFALD
FT                   RIREAGNSSAILDATLNAQGFYEKYGFRKVADSHLVRPSGMKIETVVMERSIRSPPRGR
FT                   NRDRTVADGRAMS"
FT   gene            complement(214484..215329)
FT                   /locus_tag="Gdia_0200"
FT   CDS_pept        complement(214484..215329)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0200"
FT                   /product="NmrA family protein"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase; 3-beta
FT                   hydroxysteroid dehydrogenase/isomerase;
FT                   dTDP-4-dehydrorhamnose reductase; NmrA family protein;
FT                   KEGG: gdi:GDI1975 putative transcriptional regulator
FT                   NmrA-like"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ACI49998"
FT                   /db_xref="InterPro:IPR008030"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A9HJK4"
FT                   /protein_id="ACI49998.1"
FT                   /translation="MTILVIGGTGTIGSQVLAYLDGQGGEVRVLTRAPDTARLPAGTVP
FT                   VKGDLSDIDSVRAAMDGVDTLFLLAPNAADELTQAMLTLNVAREAGVKGIVYLSVFKGE
FT                   EYADVPHFIGKYAVERMIADCDLPATVLRPAYFFQNDVRQKDALLTQGLYASPVGTKGI
FT                   SMVDTRDIGEAAAPLPRETYELVGPDGLTGAAIAAIWSEILDRPIRYGGDDLDTMEQRL
FT                   RAFAPAWQAYDLKLMFRRYQQDGATATAAQIDRLTTLLGHPPRSYRDFAHAVASEWTAP
FT                   "
FT   mobile_element  complement(215520..216695)
FT                   /mobile_element_type="insertion sequence:Gdi4"
FT   gene            complement(215536..216593)
FT                   /locus_tag="Gdia_0201"
FT                   /note="ribosomal slippage"
FT   CDS_pept        complement(join(215536..216105,216105..216593))
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /ribosomal_slippage
FT                   /locus_tag="Gdia_0201"
FT                   /product="transposase IS630"
FT                   /note="KEGG: gdi:GDI3803 putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ACI49999"
FT                   /db_xref="GOA:B5ZDV9"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR025959"
FT                   /db_xref="InterPro:IPR038717"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZDV9"
FT                   /protein_id="ACI49999.1"
FT                   /translation="MGGALALREDYDAAGLRALARTTRHAGQARRLLALAAIYDGASRG
FT                   DAARLAGTDRQIVRDWVVRFNAEGPDGVRDHHGGGVVPRLTPAMLEALMRRIEDGPIAA
FT                   VHGVVRWRQADLGQWLYEEFGVSLSRSRLSAVIRGLDFRLLTGRPRHHAQDPEAQDVFK
FT                   KSFPDVMAGIRARHPGKAIELWWGDEARVGQKTKLTRRWARRGTRPRAPADQRTRSAWI
FT                   FGAICPALGKGAALVLPWCNLHAMNRHLDEISQAVAPGAHAILIVDQAAWHTSPKLDIP
FT                   ANITILPLPPRSPELNPVENVWQFMRNTWLSNRIFRTYDDIVDICCHAWNQLVDQPWRI
FT                   MSLGLRQWAHGF"
FT   gene            complement(216655..217341)
FT                   /locus_tag="Gdia_0202"
FT   CDS_pept        complement(216655..217341)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0202"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gdi:GDI1976 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50000"
FT                   /db_xref="InterPro:IPR021255"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZKP0"
FT                   /protein_id="ACI50000.1"
FT                   /translation="MIRGIILVAVGGAALSMACFGVASVRGPMGWHVPDLGVLIDDDGD
FT                   APQSPMASRTLDWKGGEALTFELPATIVYTQGPTSSITVSGPKRAIDRVTLDDDVIDLD
FT                   HESTRSWHIHHLRIVVTAPGLKALTVRSAGSLTLQNVAVDHLRLTVEGAADVVGHGRAD
FT                   AITLNVAGAAHADLSDMVVRDADIDIEGAGHVTAGPTGRASIHLSGIGAVELIPTPVRP
FT                   DSYVIA"
FT   sig_peptide     complement(217276..217341)
FT                   /locus_tag="Gdia_0202"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.993) with cleavage site probability 0.551 at
FT                   residue 22"
FT   gene            complement(217408..217974)
FT                   /locus_tag="Gdia_0203"
FT   CDS_pept        complement(217408..217974)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0203"
FT                   /product="protein of unknown function DUF1700"
FT                   /note="PFAM: protein of unknown function DUF1700; KEGG:
FT                   gdi:GDI1977 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50001"
FT                   /db_xref="GOA:A9HJK9"
FT                   /db_xref="InterPro:IPR012963"
FT                   /db_xref="UniProtKB/TrEMBL:A9HJK9"
FT                   /protein_id="ACI50001.1"
FT                   /translation="MNERQTFLRRLKAGLKGMPRPAIDDIMADYEGHFDAGLAAGRSEA
FT                   DVAAALGNPSRLARELRAEAGLRRWEDERSLASALGVIVGVLGLAALDLFIVLPLLVAA
FT                   VTTVFSFFIAGVGICLGGSLALPFAIITNFPGFAGDRLQAVLLSMGLLSGGASLVAFCI
FT                   LFTIGLVNVLARYGRAHYRLIAADA"
FT   gene            complement(217971..218306)
FT                   /locus_tag="Gdia_0204"
FT   CDS_pept        complement(217971..218306)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0204"
FT                   /product="transcriptional regulator, PadR-like family"
FT                   /note="PFAM: transcriptional regulator PadR family protein;
FT                   KEGG: gdi:GDI1978 putative transcriptional regulator,
FT                   PadR-like family"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50002"
FT                   /db_xref="InterPro:IPR005149"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A9HJL2"
FT                   /protein_id="ACI50002.1"
FT                   /translation="MDPNLVQFKKGVLELCVLALLSRADSYGYDIASRLSDAIDMGEGT
FT                   IYPLMRRMQKDGLVSTYLVESSSGPPRKYYRLTEGGRKNLDAQKAAWNDFTRSVAAVLE
FT                   QDQEKTP"
FT   gene            218793..219596
FT                   /locus_tag="Gdia_0205"
FT   CDS_pept        218793..219596
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0205"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gdi:GDI1981 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50003"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZKP3"
FT                   /protein_id="ACI50003.1"
FT                   /translation="MHFISGLPRSGSTLLAAILRQNPRFTASMSSPVCGLVRKLLDGMS
FT                   ANNEFASFITDEQRRRILRGVFENYYGDDFTSRTVFDTNRAWSNCLPLLGDLFPGCRVI
FT                   ACVRDVPWILDSIERLVRRNCLAASGMFNFDSAGSVYTRAEAVARADGMLGYGYNALKE
FT                   AFYGEQTDRLMLVRYETLVQDPRRVLSAVYDFIGETNFAHDLKNIRFDAEAFDRRMGTP
FT                   GLHQIRPAIGWQPRRNLLPPNLIARFADDAFWNHPNANPNGVRVI"
FT   gene            219752..223609
FT                   /locus_tag="Gdia_0206"
FT   CDS_pept        219752..223609
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0206"
FT                   /product="outer membrane autotransporter barrel domain
FT                   protein"
FT                   /note="TIGRFAM: outer membrane autotransporter barrel
FT                   domain protein; autotransporter-associated beta strand
FT                   repeat protein; PFAM: Autotransporter beta- domain protein;
FT                   KEGG: gdi:GDI1982 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50004"
FT                   /db_xref="GOA:B5ZKP4"
FT                   /db_xref="InterPro:IPR005546"
FT                   /db_xref="InterPro:IPR006315"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR036709"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZKP4"
FT                   /protein_id="ACI50004.1"
FT                   /translation="MRVSVSSLAILCALRLALPHQASAQTVVVTSPLTGASNFNAGGAD
FT                   GTSGAGGTGTGVGGGTGGSSSGNNAAGGSVGGSSAGYGGTGFGGGGGGGAGGQIGNQGN
FT                   GAGGGGGLDGSVSNGSAGGGAGGGVGTTVTAGSWTNNSSVSGAYGGNGGNGAPVMNSGG
FT                   GGGGGAGVYASGSGSGSVTLINNAGAAIRGGFGGEYAGFGVNTTGIGGGGGGGTGVAGS
FT                   NFTLTNAGTIAGGGGGYGYTGGSGGNGVGGTNFNLSNSGNVTGGNGYNGSLGGTGVAGS
FT                   GFTLTNSGTIAGGLGGGSGGSGVAGSGFTLTNSGTITGGNGNYFTPTPTGGNGGTGVTG
FT                   SGFSLTNTATVTGGNGSSGFDFDSGNGGNGGSGVAGSSFTLANSGAITGGNGGDGGDGG
FT                   DGGDGGNDSYGQDSHNSNGNGGHGGGGVTGSGFTLTNTGTITGGDGGSGDGDGKGIDGS
FT                   GGVGVTSTGGSTIVTSGQISGGVSAAGVQADAVDLSGGGNTLKLESGYGFTGNVVSTSG
FT                   TTNGGDTLELGGTANGTFNLSQIVTTTPTSWTGTVQYSGFDRFLVTDSAVWTLTGSTNA
FT                   VSIAASMQINNGATLQFDNGAAGISLAGTFTDNGILTIGGSAAAASLAGTGTANLAGIL
FT                   TLTNAADRFSGTIQGTGGLTIAGGNETLTGANTYSGGTTIEAGTLTVGSNTALGTGVLD
FT                   MAQGTALAFGTNGLTLGNAIVLNGDPTVEIDSGTDTLAGTISDGATPGDLVKTGAGTLV
FT                   LAGNSTYSGGTEVAAGTLQVDGAIASPVTVDTAGTLAGAGTIGTTTVSGTLAPGDAGVG
FT                   TLHVNGNLTMAAGSTYQVDVTPAAALGHVAVTGAATLQGGTVAVTAGAGNWTTTRYTIL
FT                   TAGGGVTGQFAGVLTNLAFLTPTLAYDSDDVFLSLRRNTLDFAGVATTRNEVAAGNGLS
FT                   GTTSGALYDALVQTDAATARHALNSLSGELHASARTALVQDSYYVRDAAVERLRGVECA
FT                   PGAASGMKTAAGGKPTDGACQPDRASVWMQDYGSFGHNGGNGNAAGMGHSVGGFVLGAD
FT                   APVLGWQVGGLVGYGHSSFDSGAVSSYGHSSNVSLGLYAGTHWGRLALRTGATYSWNML
FT                   STTRNVGFTGFSNRLNTDYDGGTAQAFGDLGYRLDAGPAMIEPFANVAYVNLHTNGYIE
FT                   HGGPAALAGRAMDTGVTYSTFGARFAGTVRVGGVALTPNATLGYRHAFGLTTPTTREAF
FT                   LAGGNAFDVAGVPLSTDAAVLKAGLQAKLTDRLNVGLSYVGQYGDHSTDSGLTGNVKVT
FT                   F"
FT   sig_peptide     219752..219826
FT                   /locus_tag="Gdia_0206"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 25"
FT   gene            complement(223623..224417)
FT                   /pseudo
FT                   /locus_tag="Gdia_0207"
FT   gene            complement(224428..225093)
FT                   /locus_tag="Gdia_0208"
FT   CDS_pept        complement(224428..225093)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0208"
FT                   /product="DNA repair protein RadC"
FT                   /note="PFAM: DNA repair protein RadC; KEGG: gdi:GDI1985
FT                   putative DNA repair protein RadC"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50005"
FT                   /db_xref="GOA:A9HJN5"
FT                   /db_xref="InterPro:IPR001405"
FT                   /db_xref="InterPro:IPR025657"
FT                   /db_xref="InterPro:IPR037518"
FT                   /db_xref="UniProtKB/TrEMBL:A9HJN5"
FT                   /protein_id="ACI50005.1"
FT                   /translation="MNLPPTDRAGAPGGSPHDAADDTALLASILALALPPGADPADAAR
FT                   ALLARFGTIGAVFAADPAELASAVAGRLQIRVIVPLLREAAIRLMRARIRQGDLLSCHD
FT                   ALMAYLQASLARDTVEQFRVLFLDRGTRLIADEVLAQGTIDQTPVYPREVMRRAIQLKA
FT                   SELILVHNHPGWNPTPSREDIAMTRRLAQIATVLGLTVRDHVIVGNGASISFRQAGLL"
FT   gene            225201..225908
FT                   /locus_tag="Gdia_0209"
FT   CDS_pept        225201..225908
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0209"
FT                   /product="Haloacid dehalogenase domain protein hydrolase"
FT                   /note="PFAM: Haloacid dehalogenase domain protein
FT                   hydrolase; KEGG: gdi:GDI1986 putative phosphoglycolate
FT                   phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50006"
FT                   /db_xref="GOA:B5ZKP6"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZKP6"
FT                   /protein_id="ACI50006.1"
FT                   /translation="MNVLSSLNRHDAVLLDLDGTIVDSRAGIIGSLHDSLRDLGHEPDP
FT                   EEDLTWVVGPPLHDLVARVLQHYGDDRAEEAVRLYRYHYERHGMHRSAVFAGMQDVIET
FT                   VAASGARLFLATSKPVHLARAILDLRGLTKYFTALYGARPDDSGAEKPELIGQLLREHA
FT                   IATGRAVMVGDRRYDISGAHANHVRALGALWGYGGEEELTEAGADALVADPGELLAAIR
FT                   SQLAAAHLHPAAE"
FT   gene            complement(225917..226651)
FT                   /locus_tag="Gdia_0210"
FT   CDS_pept        complement(225917..226651)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0210"
FT                   /product="DNA repair protein RadC"
FT                   /note="PFAM: DNA repair protein RadC; KEGG: gdi:GDI1987
FT                   putative DNA repair protein RadC"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50007"
FT                   /db_xref="InterPro:IPR001405"
FT                   /db_xref="InterPro:IPR025657"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZKP7"
FT                   /protein_id="ACI50007.1"
FT                   /translation="MTRTGGDGGKAPRQSAPFKETGPTGHRARMRARVLASGAGSLADY
FT                   EIIEMLLFSGVPRRDTKPMAKALLNRFGSLGALLSAPADALRAAGLSDRVALPLMLPAS
FT                   VAERLSRPDPLTRTPMRDWDAVLAYCDTVLTGAPPGQLRILFLDSSNHIIADEALDAAL
FT                   DTGELDLVQRHILLRALDLHATAFVGIRIAPVWPPPATLVERDAVLMQAISYHAQNLSL
FT                   TVQDHLILHHGQWLSLRQQRRL"
FT   gene            226699..228981
FT                   /locus_tag="Gdia_0211"
FT   CDS_pept        226699..228981
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0211"
FT                   /product="UvrD/REP helicase"
FT                   /note="PFAM: UvrD/REP helicase; KEGG: gdi:GDI1988 putative
FT                   DNA helicase II"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50008"
FT                   /db_xref="GOA:B5ZKP8"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR013986"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZKP8"
FT                   /protein_id="ACI50008.1"
FT                   /translation="MRAHKLGHNLRTPYTEIVTQTPAPFPERPAADRPDYLQRLNPEQR
FT                   AAIETTDGPLLVLAGAGTGKTRVLTTRFAHILLSGRARPYQILAVTFTNKAAREMRERI
FT                   GALLGEPVEGLWLGTFHALCARMLRRHAEYVGLGSGFTILDTDDQLRLLKQVIEPLRID
FT                   TKRWPPQGILGVIQRWKDRGLTPERVTPAEDCDFAGGQCRPIYAAYQARLVQLNACDFG
FT                   DLMLHVTEILRTRPDVLAQYHRLFRYILVDEYQDTNTIQYLWLRLLAQREGQPANICCV
FT                   GDDDQSIYSWRGAEVENILRFERDFPGAAVVRLERNYRSTAQILGAASGLIAHNDGRLG
FT                   KTLRPGREDASGEKVRVASVWDSDDEARLVGEEVERLRAGGHSLAEIAILVRAGFQTRA
FT                   FEERLITLGLPYRVVGGLRFYERSEIRDAMAYMRVLNQPADDLAFERIINVPRRGIGAA
FT                   AMQKFHVAAREGQMPLAAAVMDLIARGALKGRAREQMTALMACLARGREALPREGHVVV
FT                   VETLLEESGYIDMWKADTSPEAPGRLDNLKELVRALADFESLGGFLEHVALVMENEENA
FT                   GAERLSIMTLHGAKGLEFDTVFLPGWEEGVFPSQRTLDEGGLKGLEEERRLAYVGITRA
FT                   RHRAVISHAASRRIYGNWQSAIPSRFIEELPAEHVTTTGGAAQARSRTFGHAPLSSTAF
FT                   PVMARRPRVTDVGEKGPTAAMAVGTRVFHQKFGYGTISSVEGNRLEVAFEKAGPKRVLD
FT                   TFVEKIP"
FT   gene            228978..229883
FT                   /locus_tag="Gdia_0212"
FT   CDS_pept        228978..229883
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0212"
FT                   /product="ribosomal L11 methyltransferase"
FT                   /note="PFAM: ribosomal L11 methyltransferase; KEGG:
FT                   gdi:GDI1989 putative ribosomal protein L11
FT                   methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50009"
FT                   /db_xref="GOA:A9HJP6"
FT                   /db_xref="InterPro:IPR004498"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A9HJP6"
FT                   /protein_id="ACI50009.1"
FT                   /translation="MTSLTRRHATELETIAVTVPAEAVMAYEDALSVVCTTIGIFELDD
FT                   SQILWRVEGVRDVGYGDSELTGALALAATVTGHAAELERVRTEAEGWLARTYDSFPEQT
FT                   VGRRFVVRGTHLDAPAASRRIAITLDAGMAFGSGEHGSTRGCLRALESVAHRRPQRILD
FT                   MGCGSGILAMAAAALLHRPVLAVDIEPWSVRTTAQNAALNGLSGLVTARLGNGWRTPGL
FT                   KRYAPFDLVFANILARPLCMMARDLALNLAPGGTAILAGLLNSQAGMVLAAHRRQGLVL
FT                   ERRLTEGDWTTLVLRKRTTT"
FT   gene            229880..231670
FT                   /locus_tag="Gdia_0213"
FT   CDS_pept        229880..231670
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0213"
FT                   /product="peptidase M24"
FT                   /note="PFAM: peptidase M24; KEGG: gdi:GDI1990 peptidase
FT                   M24"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50010"
FT                   /db_xref="GOA:B5ZKQ0"
FT                   /db_xref="InterPro:IPR000587"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR029149"
FT                   /db_xref="InterPro:IPR032416"
FT                   /db_xref="InterPro:IPR033740"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZKQ0"
FT                   /protein_id="ACI50010.1"
FT                   /translation="MTAIASRLPALRTVLGQMDVDGFILLRGDEHLGEYVAPCAERLAW
FT                   LTGFTGSAGMAVVLRDGPAAVFSDGRYVTQMDQQVDGAAWSRLHLRDTPPARWLASHAG
FT                   AGQRIGYDPRLVGEAGLQPFLDCGLTMVPMAANPVDRIWTDRPAAPATACMPQPLAFAG
FT                   EDSAAKRARMAAILKADGQDAAVLGDPTAIAWLLNVRGHDVQYTPVCLAFAILHDDARV
FT                   DLFIDPARLPQDTAAWLGPEVTIVEPAGLEAALAALAGRRVRVDPVGTAIWFIQTLEAA
FT                   GATVARGGDPCVLPRARKNDVEQDGARRAHLLDGIALCRFLHWMDTEGVGPDSIRPGEL
FT                   DAANRLDAFRALCPDYREESFPAISGAGPNGAVIHYRVTPESSRTIGTDEVYLIDSGGQ
FT                   YPFGTTDVTRTIWTGAGRGPEDVRHAFTRVLKGHIALARARFPVGTTGHALDGLARYAL
FT                   WQAGMDYDHGTGHGIGSYLSVHEGPCSISPVYRPVAVEAGMILSDEPGYYRPGAFGIRL
FT                   ENLLLARPAPAEPNRSFLEFETLTLAPFDRRLIDASLLTAEETAWIDAYHARVCETLAP
FT                   HLEAAPTAWLHAACAPIGAE"
FT   gene            231910..232938
FT                   /locus_tag="Gdia_0214"
FT   CDS_pept        231910..232938
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0214"
FT                   /product="Isocitrate dehydrogenase (NAD(+))"
FT                   /EC_number="1.1.1.41"
FT                   /note="PFAM: isocitrate/isopropylmalate dehydrogenase;
FT                   KEGG: gdi:GDI1991 isocitrate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50011"
FT                   /db_xref="GOA:A9HJQ1"
FT                   /db_xref="InterPro:IPR019818"
FT                   /db_xref="InterPro:IPR024084"
FT                   /db_xref="UniProtKB/TrEMBL:A9HJQ1"
FT                   /protein_id="ACI50011.1"
FT                   /translation="MSAEKTIPATLIPGDGIGPEITESVTEILAAVGAPFDWDNQLAGM
FT                   AAVDATGNPLPPQTIASIHRTGLALKGPLTTPVGGGFKSINVTLRQEFGLFANLRPTHT
FT                   IVPGGRFDKIDLVLVRENLEGYYAAMESYIPVGDDPHGIATGAGYNSRAECNRIVRFAF
FT                   EYAVKNNRKKVTLVHKANILKLLTGLFLEEGRKVAKEYEGRVECNERIVDACAMQLVID
FT                   PWQFDVIVTTNLFGDILSDLTAGLVGGLGLAPGANIGEKAAVFEAVHGSAPDIAGKNVA
FT                   NPLALLMAANMMLKHVGRADLATRIESAIQSVITEGTVRTRDLGGTAGTRELTAALKQK
FT                   LV"
FT   gene            complement(232980..233858)
FT                   /locus_tag="Gdia_0215"
FT   CDS_pept        complement(232980..233858)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0215"
FT                   /product="OHCU decarboxylase"
FT                   /note="TIGRFAM: hydroxyisourate hydrolase; OHCU
FT                   decarboxylase; PFAM: Transthyretin; KEGG: gdi:GDI1992
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50012"
FT                   /db_xref="GOA:B5ZKQ2"
FT                   /db_xref="InterPro:IPR000895"
FT                   /db_xref="InterPro:IPR014306"
FT                   /db_xref="InterPro:IPR017580"
FT                   /db_xref="InterPro:IPR018020"
FT                   /db_xref="InterPro:IPR023416"
FT                   /db_xref="InterPro:IPR023418"
FT                   /db_xref="InterPro:IPR023419"
FT                   /db_xref="InterPro:IPR036778"
FT                   /db_xref="InterPro:IPR036817"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZKQ2"
FT                   /protein_id="ACI50012.1"
FT                   /translation="MTIGIMDRVNRLDPADFVALFGALYEHSPWVAARAASLRPFPDPD
FT                   AMLAAMNQVLDRATDAEKLALVRAHPELARRAGVDPTLTQASAAEQASAGLDRLSPEEY
FT                   ARFNRLNDAYAARFAMPFVICVRLSDKDFILSEMERRVVHTPEQEVRTAIVEIGKIARL
FT                   RLADALARLEKEAVITLSSHVLDLVSGRPAAGMDITLWSGATRLFSGRTNGDGRCPDLA
FT                   GIGALAPGAYRLEFGVAAYFRGQGVALSDPPFLDIVPIAFGIAPPVDGKGGHYHVPLLV
FT                   SPYGFSTYRGS"
FT   gene            complement(233855..234760)
FT                   /locus_tag="Gdia_0216"
FT   CDS_pept        complement(233855..234760)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0216"
FT                   /product="urate catabolism protein"
FT                   /EC_number="3.5.1.41"
FT                   /note="KEGG: gdi:GDI1993 putative polysaccharide
FT                   deacetylase; TIGRFAM: urate catabolism protein; PFAM:
FT                   polysaccharide deacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50013"
FT                   /db_xref="GOA:B5ZKQ3"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="InterPro:IPR017625"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZKQ3"
FT                   /protein_id="ACI50013.1"
FT                   /translation="MTDPYPRDLVGYAGHPPDPRWPGQARVAVQFVINYEEGGENSVLH
FT                   GDAGSEAFLSEMIGARSVPGARAMAMESLYEYGSRAGFWRLHRLFTERSLPVTVFGVAA
FT                   AMARNPDAVAAMLGAGWDIATHGLRWIDYQDIPEDVERAHIRDCIALHTALTGSRPVGW
FT                   YQGRTSPNTARLVAEEGGFAYDADSYADDLPYYDRRYGRPQLIVPYTLDANDMRFVALN
FT                   GFTEGEQFFRYLRDTFDALYEEGESAPKMMSVGLHCRVAGRPGRARAVARFLDHVMAHD
FT                   RVWVATRLDIARHWLEVHPA"
FT   gene            complement(234757..236004)
FT                   /locus_tag="Gdia_0217"
FT   CDS_pept        complement(234757..236004)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0217"
FT                   /product="Serine--pyruvate transaminase"
FT                   /EC_number="2.6.1.51"
FT                   /note="PFAM: aminotransferase class V; KEGG: gdi:GDI1994
FT                   putative serine-pyruvate aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50014"
FT                   /db_xref="GOA:B5ZKQ4"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR024169"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZKQ4"
FT                   /protein_id="ACI50014.1"
FT                   /translation="MFGQIDPPQRLLMGPGPVNVHPRVLRAMTADMLGQFDPEMTGYMN
FT                   QTMALYRQVFMTENRWTFLVDGTARAGIEAALVSLVEPGARLLILRAGRFGLLLSEIAQ
FT                   RIGAEIRTIDIPWGEVATPEQIEAAIIEHRPQVFATIHGDTSTTMAQPLDGVGAICRRH
FT                   GVLSYVDATATLGGMAVATDAWGVDVVTGGLQKCMGGPPGSAPITISDRAAAHIMARRH
FT                   VEAGIRGADAQDGSRTRIGSNYFDLAMIMEYWSEKRLNHHTEATSMLYAAREAARIMVE
FT                   EGLEARFARHRAASEAMAAGLRAMGLTLYGQDAYRMANVTGVFIPDGVDGERARTRMRD
FT                   EFEIEIGTAFGPLAGRIWRIGAMGYNAMKHKVLITLGALEAVLAAEGHALPRGAGVDAA
FT                   RASYEAMPGAAPGAAS"
FT   gene            complement(236028..237317)
FT                   /locus_tag="Gdia_0218"
FT   CDS_pept        complement(236028..237317)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0218"
FT                   /product="amidase, hydantoinase/carbamoylase family"
FT                   /EC_number="3.5.1.87"
FT                   /note="KEGG: gdi:GDI1995 N-carbamoyl-L-amino acid
FT                   hydrolase; TIGRFAM: amidase, hydantoinase/carbamoylase
FT                   family; PFAM: peptidase M20; peptidase dimerisation domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50015"
FT                   /db_xref="GOA:B5ZKQ5"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR010158"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZKQ5"
FT                   /protein_id="ACI50015.1"
FT                   /translation="MVIPPMRETASGIRAVVRCDELGTAPYSDDPAGLFRPYLGAGHAA
FT                   TLDRIAAWMTEAGMTARIDAAGNILGRYEGQSPDAPALMIGSHVDSVRDAGRYDGMLGV
FT                   MLGIEAVAWFAERRRRFPFAIEVIGFGDEEGSRFPVSMLATRAVAGTLAGQDLDLLDAD
FT                   GTSLATALEIFGLDVARLDHAARPREDVLAYVEAHIEQGPVLEAEDRALGVVSAIAAQF
FT                   RFRATVCGVAGHAGTMAMRLRRDALAAAAEMVLAIERIGGAGTDDLVATVGRMEVRPGV
FT                   PNVVPGAVEFSIDIRAGTGAVRDRAAEAVRAALAGIAGARQVTLDLELQQDLKATPCDP
FT                   GLTRLMEQAVQHAMGIAPRTLVSGAGHDAMVMAGLAPMSMLFIRCAGGISHNPAEAVRV
FT                   EDADLALRAMTDFIERFDARAAASAQQGTQ"
FT   gene            complement(237311..238903)
FT                   /locus_tag="Gdia_0219"
FT   CDS_pept        complement(237311..238903)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0219"
FT                   /product="Gamma-glutamyltransferase"
FT                   /EC_number="2.3.2.2"
FT                   /note="PFAM: gamma-glutamyltranspeptidase; KEGG:
FT                   gdi:GDI1996 putative gamma-glutamyltranspeptidase
FT                   precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50016"
FT                   /db_xref="GOA:B5ZKQ6"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZKQ6"
FT                   /protein_id="ACI50016.1"
FT                   /translation="MLHTPRSQRGMVTSPHHLASQAGLDVLRDGGTAIEAVVATAAALA
FT                   VVYPHMTGIGGDGFWLVLWPDGRTETIDACGAAARRADLDFYRAAGRDAIPWRGPLAAN
FT                   TVAGTISGWDLALSWSHAQQPGLSLHRLLRDAIYYAEQGVPVTEGGAALTQAKMDELAG
FT                   IPGFRDVFLPGGRAPRAGDMLHNPALSQTLRRLASDGLDSFYRGALARDMAQDLRVLGS
FT                   PLDLADLNTHQARARPPLHVDVTGARLFNMAPPTQGVASLLILAIFDRLRADQPDGFDH
FT                   VHGLVEATKQAFRYRDAHVGDPAFMSVDAQAVLDDTLALDGMALAIDPARAAPWPHPSQ
FT                   AGDTVWMGAVDADGVAVSMIQSVYFEYGSGVVLPRTGVLWQNRGASFRLAEDGWNALRP
FT                   GRKPFHTLNPAAARFDDGRTMVYGTMGGEGQPQTQAALFTRYARYGIGLQQAVTAPRWL
FT                   LGRTWGEDSTTLKYEDRFAPEVIARLGEAGHVLEAMPAFTSTMGHAGALVLHPSGLIEG
FT                   ATDPRSDGMVAAW"
FT   gene            complement(238907..240271)
FT                   /locus_tag="Gdia_0220"
FT   CDS_pept        complement(238907..240271)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0220"
FT                   /product="amidohydrolase, AtzE family"
FT                   /note="TIGRFAM: amidohydrolase, AtzE family; PFAM: Amidase;
FT                   KEGG: gdi:GDI1997 putative glutamyl-tRNA(Gln)
FT                   amidotransferase subunit A"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50017"
FT                   /db_xref="GOA:B5ZKQ7"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR014087"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZKQ7"
FT                   /protein_id="ACI50017.1"
FT                   /translation="MSAPVAAGPADALAIAAEIRQGRRNAVSFVTAAIAAIEVRDTRVN
FT                   SVTRIFGPRAVAEAEKIDRRIAAGEDPGPLAGVPFGVKDLFDVEGEVTTAGSVVLREAR
FT                   PAVQDATVIARLRAAGAIPLASLNMDEFAYGFATDNAHYGITRNPHDPARLAGGSSGGS
FT                   AAAVAAGFLPFTLGSDTNGSIRVPASLCGVWGLKPTFGTVPREGAYPFAASLDVVGPFA
FT                   GTLADLRVVHEAMNGAPMPAVPVLSDLRVARLGGWFAENVSAPLAAAIDAVAGHLGHVP
FT                   VVELPEVARARAASFLITAAEGGMLHLPRLRRRALQYDPATRDRLIAGALLPAATVLQA
FT                   HRFRAWFREQIHAAFRTADVLIAPATVGEAPLIDQPTIVVDGQAVSARTNLGLYTQPLS
FT                   LAGVPILSVPLLGTGGLPLGLQLIAAPGGEPALFAVAAALEAAGVAGKVPLPKGR"
FT   gene            complement(240268..240489)
FT                   /locus_tag="Gdia_0221"
FT   CDS_pept        complement(240268..240489)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0221"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gdi:GDI1998 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50018"
FT                   /db_xref="InterPro:IPR025148"
FT                   /db_xref="UniProtKB/TrEMBL:A9HJR9"
FT                   /protein_id="ACI50018.1"
FT                   /translation="MTDNQGDAPPKSAPDTIPDAALVAATAREVGLTIADVCMPGVLAN
FT                   RALLRRYADLVHGFALPDTCEPAFEYRP"
FT   gene            complement(240553..242007)
FT                   /locus_tag="Gdia_0222"
FT   CDS_pept        complement(240553..242007)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0222"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gdi:GDI1999 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50019"
FT                   /db_xref="InterPro:IPR025700"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A9HJS1"
FT                   /protein_id="ACI50019.1"
FT                   /translation="MAADSSALPSEEGLAALTAAVRRDLAVIGYPRHDWTPNFSRNGEP
FT                   VLDVAIIGAGQGGLATAFALQRGNITNVRIFDRAARGGEGPWITYARMITLRTPKYVTG
FT                   PDLGIPNLTPRAWYEATYGVQAWEDLDKIPRGDWQAYLDWYRDTLGLPVENDRSFEHVE
FT                   WVDGLLRLTFRDAAGREYHHLARKLVLATGIEGNGAWNVPAFIRENLPRERFAHTSEDI
FT                   DFAALRGKRIGVLGAGASAFDNAATALEQGAASVALCLRRRVIPSVNPYRWMENTGFLA
FT                   HFPSLPDTLRWQFMRHIYELNQPPPQDTFWRCRRHPTFSYHTGCGWTGAEMDGDEVVVR
FT                   TPDGEKRFDFVIIGTGFATDLNLRPELASFAGSVALWRDRFTPPDGEESALLGAHAYLG
FT                   DAYQFQPRDPRDPLATMLANIHNFTFGATPSMGLSGASISGMRFGVERLARGLGRDLFV
FT                   ADGAWHLDNLLSYVTPELVSLDPPDA"
FT   gene            complement(242199..243125)
FT                   /locus_tag="Gdia_0223"
FT   CDS_pept        complement(242199..243125)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0223"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: gdi:GDI2000 putative
FT                   transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50020"
FT                   /db_xref="GOA:A9HJS3"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A9HJS3"
FT                   /protein_id="ACI50020.1"
FT                   /translation="MRASGRTAHMLRLHARCIVYFNAVRDFGSIREAARRLNVTPSALT
FT                   RQIAQMEDEIGSPLFDRLPGGMVLTAVGEIVARHIITVMQDAVRTDEQIAALAGMRGGR
FT                   VSLMAVEGVAGDLMARLLTRMTETCPDVQLQAETGSPAAIIAALSGGTTDLGIAFSLDP
FT                   PDELRRVAVANFPVGVIMPANHALAGQRRVRIEECIGHKLILPTRSLSLHRVMEPMLRP
FT                   WRDRLDVVLETGSIELTNRMVAAGAGLAFQSRLALEFDIQRGALVHVPLADPRAVTDLG
FT                   VYVRDARWLPPALERLIAEIRATLQAM"
FT   gene            complement(243122..243985)
FT                   /locus_tag="Gdia_0224"
FT   CDS_pept        complement(243122..243985)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0224"
FT                   /product="xanthine dehydrogenase accessory protein XdhC"
FT                   /note="TIGRFAM: xanthine dehydrogenase accessory protein
FT                   XdhC; PFAM: protein of unknown function DUF182; KEGG:
FT                   gdi:GDI2001 putative xanthine dehydrogenase chaperone"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50021"
FT                   /db_xref="InterPro:IPR003777"
FT                   /db_xref="InterPro:IPR014308"
FT                   /db_xref="InterPro:IPR027051"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZKR1"
FT                   /protein_id="ACI50021.1"
FT                   /translation="MDEILAALDLWRPAGQPIARIAIRAARGSTPREAGSFMLVTPDAQ
FT                   AGTIGGGHLEWDSVIRARALLAGQGQAGEHDVPLGPEIGQCCGGVVRVRIERADDALLD
FT                   ALVRDGLAARAARPVLLLFGAGHVGRALARALAPLPLRLVWIDPRAAEFGTVPDSVEIR
FT                   VTADWESAIAAAPPGAGALVLTPSHALDALIVGAALERGDFRYVGLIGSKTKRRRFEAG
FT                   FRSLGLGEDRIETLVCPIGDRGIRDKRPEIIAALVAAEIVERLLHDNAGMEESNGAEGI
FT                   GMRYTA"
FT   gene            complement(243997..246378)
FT                   /locus_tag="Gdia_0225"
FT   CDS_pept        complement(243997..246378)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0225"
FT                   /product="xanthine dehydrogenase, molybdopterin binding
FT                   subunit"
FT                   /EC_number="1.17.1.4"
FT                   /note="KEGG: gdi:GDI2002 putative xanthine
FT                   dehydrogenase/oxidase; TIGRFAM: xanthine dehydrogenase,
FT                   molybdopterin binding subunit; PFAM: aldehyde oxidase and
FT                   xanthine dehydrogenase a/b hammerhead; aldehyde oxidase and
FT                   xanthine dehydrogenase molybdopterin binding"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50022"
FT                   /db_xref="GOA:B5ZKR2"
FT                   /db_xref="InterPro:IPR000674"
FT                   /db_xref="InterPro:IPR008274"
FT                   /db_xref="InterPro:IPR014309"
FT                   /db_xref="InterPro:IPR036856"
FT                   /db_xref="InterPro:IPR037165"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZKR2"
FT                   /protein_id="ACI50022.1"
FT                   /translation="MRDTISAPISGALPDAVPGTVVTGGASHSLRHESAAMHVAGAAAY
FT                   IDDMPEPKGLLHVVPGLSTRAHARIVSMDLDAVRAAPGVVRVLTAADIPGHNQVSPVGR
FT                   NDEPLLATDLVSYYGQPIFAVVAETRLQARHAARLARIEYEDLPAILDIAQARAAGGAM
FT                   VWRPLTMQRGDAPSGLAASPRRVAGRITMGGQEHFYLEGQAAMAQPGEEGEMRVWSSTQ
FT                   HPTETQHMVAHVLDRPSNLVTTEIRRMGGGFGGKETQANTPACLAALAAELTGRAAKIR
FT                   LDRDDDMMMTGKRHDFVVDYDVGFDDDGRIRAVDMVLAARCGWSADLSGPVTDRALFHA
FT                   DNAYYYPDVRLRSEPLKTNTQSNTAYRGFGGPQGIVAAERVIEEIAFATGLDPLDVRLR
FT                   NVYGTGTRDLTPYHMTVEDSISADIMAKLADDCAYRARRAALRAANEGSPHIRRGIALT
FT                   PVKFGISFTATHYNQAGALVHVYTDGSVQVNHGGTEMGQGLHTKMVQIAMREFGLPADR
FT                   VRITATTTGKVPNTSATAASSGADLNGMAVLDAVRRIKDRLVEFAAGHWGVDAAQVRFL
FT                   PDGVHVGATVVPFPDLTRAAYFARVSMSSSGFYKTPKISWNAETGRGRPFFYFAYGAAC
FT                   AEVAIDLLTGETRIEQVDILHDAGQSLNPAIDIGQIEGGFVQGAGWLTTEELVWDASGR
FT                   LRTHAPSTYKVPACSDRPRRFTVKLLDHAPNREDTIFRSKAVGEPPFVHGVAVLHAISD
FT                   ALASIDGYRTCPRLDAPATPETILRTTERMRGLAAPCPVG"
FT   gene            complement(246371..247864)
FT                   /locus_tag="Gdia_0226"
FT   CDS_pept        complement(246371..247864)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0226"
FT                   /product="xanthine dehydrogenase, small subunit"
FT                   /note="TIGRFAM: xanthine dehydrogenase, small subunit;
FT                   PFAM: ferredoxin; molybdopterin dehydrogenase FAD-binding;
FT                   [2Fe-2S]-binding domain protein; CO dehydrogenase
FT                   flavoprotein domain protein; KEGG: gdi:GDI2003 putative
FT                   xanthine dehydrogenase, XdhA"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50023"
FT                   /db_xref="GOA:B5ZKR3"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR002346"
FT                   /db_xref="InterPro:IPR002888"
FT                   /db_xref="InterPro:IPR005107"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR012175"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR014307"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="InterPro:IPR036683"
FT                   /db_xref="InterPro:IPR036884"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZKR3"
FT                   /protein_id="ACI50023.1"
FT                   /translation="MRDHIRFYLGDTLYDLSGFSPTLTVLDWLREQRGRTGTKEGCNEG
FT                   DCGACTVLVARLDGGPPDAPRLAWRAVNACIQFVSMLDGAQLFTVEDLRASDGTLHPVQ
FT                   QAMVDLHGSQCGFCTPGFVMSMVAYRKQPGAVAEDGPIDDALAGNLCRCTGYAPIVRAM
FT                   KQAMAAGSDRFDAQAAAIADRLSALRDGQTVHVSGPAGRLTIPADADALAATLLADPEA
FT                   TIVAGATDVGLWVTKGLRTLPHVVAIGQVPDLKRLDRTADGLRIGAAVTYEDARDALAG
FT                   LLPDAGEIVRRIGSTQVRNAGTVCGNIANGSPIGDGPPVFIAAGATLHLRRGDVRRNMP
FT                   LEDYFLAYGQQDRQPGEFVEGVTIPALRQGQVFRAYKVSKRFDQDISALLGAFALTLDD
FT                   AGTITDARIAFGGMAATPKRARATEEALRGHPWSEATLQAARAAIATDFAPISDMRASD
FT                   WYRRTVAANLLTRLFAETAPGARRPETRLAGRSEAAIHA"
FT   gene            complement(248002..249429)
FT                   /locus_tag="Gdia_0227"
FT   CDS_pept        complement(248002..249429)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0227"
FT                   /product="dihydropyrimidinase"
FT                   /EC_number="3.5.2.2"
FT                   /note="KEGG: gdi:GDI2004 D-hydantoinase protein
FT                   (dihydropyrimidinase) (DHPase); TIGRFAM:
FT                   dihydropyrimidinase; PFAM: amidohydrolase; Amidohydrolase
FT                   3"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50024"
FT                   /db_xref="GOA:B5ZKR4"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR011778"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZKR4"
FT                   /protein_id="ACI50024.1"
FT                   /translation="MLLVRGGTVVTAEWSRRADVLCDDAGRIAAVGPALDVPVGCDVLD
FT                   AGGLLVMPGGIDPHTHMEMPFMGSVSSDDFQTGTAAGVAGGTTTIIDFVIPDPGTSLLG
FT                   AWKDWRAKAEKAVSDYSFHVAVTHWDQRVHDEMGILTRDCGVNSFKHFMAYKGALMVDD
FT                   GVLLRSIGRALELGALCNVHAENGDAVAYLQQDLLTRGVTGPAAHPRSRPPAVEGEAAQ
FT                   RVIAIAGLLGAPVYIVHVSTEEAAAAIAAARARGQRVYGEVLAQHLVIDDGVYADPDWL
FT                   GAARHVMSPPFRPKHHQHALWAGLASGQLQTTATDHCCFCAGQKQQGRDDFSQIPNGTP
FT                   GIEDRMSVLWHHGVRTGRLTPEEFVAVTSANAAKIFNIHPRKGTVTPGADADLVLWDAD
FT                   SSRTVSAATHHQNVDYNVYEGMTLTGLARHTISGGRVVWSDGDLRTVRGAGRYVERPCF
FT                   APDMAAQARRNAVAAGR"
FT   gene            249611..250879
FT                   /locus_tag="Gdia_0228"
FT   CDS_pept        249611..250879
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0228"
FT                   /product="amidase, hydantoinase/carbamoylase family"
FT                   /EC_number="3.5.1.87"
FT                   /note="KEGG: gdi:GDI2005 putative N-carbamoyl-L-amino acid
FT                   amidohydrolase; TIGRFAM: amidase, hydantoinase/carbamoylase
FT                   family; PFAM: peptidase M20; peptidase dimerisation domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50025"
FT                   /db_xref="GOA:B5ZKR5"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR010158"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZKR5"
FT                   /protein_id="ACI50025.1"
FT                   /translation="MSGTGGLRKGDNITVNGAALWDDILHTARFGGTPKGGIRRLTLTE
FT                   EDRLVRAWFEAACRQVGCTVTHDSLGNQFARRPGRDDSLPPITIGSHLDTQPTGGKFDG
FT                   IVGVLGGLAVLRALHASGHETRHPIELINWTNEEGARFAPAMLASGVFAGVFTEQEALD
FT                   KTDRAGIRFEDALVGIGYRGSEPCGQHPVSAYFELHIEQGPILEAQHKTIGIVTGVQGI
FT                   RWYEVTLTGRDSHAGSTPMTMRADALLAAARMIEAVNQVALAFGPDAVGTVGLIESRPN
FT                   SRNVVPGEVFFTIDLRHPDDTVVVRMEEAMRAKVAAIAAESGVGLALDCVWDSPAVHFD
FT                   PACIGAVRRAAESFGYPARDIVSGAGHDAAYLARVTPTTMIFVPCAGGLSHNEAESAEP
FT                   GDVTAGANVLLRAVLDADARLDA"
FT   gene            251031..252344
FT                   /locus_tag="Gdia_0229"
FT   CDS_pept        251031..252344
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0229"
FT                   /product="aminotransferase class-III"
FT                   /note="PFAM: aminotransferase class-III; KEGG: gdi:GDI2006
FT                   omega-amino acid--pyruvate aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50026"
FT                   /db_xref="GOA:A9HJT9"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A9HJT9"
FT                   /protein_id="ACI50026.1"
FT                   /translation="MPPTNHDAFWMPFTANRQFRKTPRMLVAADGMYYTTDDGRKVLDG
FT                   CAGLWCVNAGHNRPRITQAVQKTIATLDFAPTFQMGHPLAFEAADRIAALAPGDLNHVF
FT                   FCNSGSEAMDSALKIALAYHRVRGEGARTRLIGRERGYHGVGFGGISVGGLSGNRKLYG
FT                   SLLTGVDHLPHTLDIERNAFTRGLPAHGAELADNLERIVALHDASTIAAVVVEPMAGST
FT                   GVLPPPVGYLKRLREICDKYGILLIFDEVITGFGRLGGTPFAAEKFGVLPDILACAKGV
FT                   TNGTIPMGAAIARDHVHAAFMTGPETGIELPHGYTYSGHPVACAAAIATLDTYAEENLF
FT                   ERAGDIAPYFEEAVHALRGLPHVIDIRNVGLVAGIELASRPGAVGARAYEVFDRAFHKG
FT                   ILVRYTGDVVAVSPPLIIEKSQIDQVFGTLADIIHAVE"
FT   gene            252364..253824
FT                   /locus_tag="Gdia_0230"
FT   CDS_pept        252364..253824
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0230"
FT                   /product="permease for cytosine/purines uracil thiamine
FT                   allantoin"
FT                   /note="PFAM: permease for cytosine/purines uracil thiamine
FT                   allantoin; KEGG: gdi:GDI2007 putative allantoin permease"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50027"
FT                   /db_xref="GOA:B5ZKR7"
FT                   /db_xref="InterPro:IPR001248"
FT                   /db_xref="InterPro:IPR038271"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZKR7"
FT                   /protein_id="ACI50027.1"
FT                   /translation="MTDTPPPATAAGYDPGLYNADLAPVPAERRDWSWVNMATVWMGMV
FT                   HNIVVYEAASGLMALGLSAWECLEVVAVAYMVLFLAMWFNARAGTRYGIPFCVLIRSAF
FT                   GPYGAQLPVVLRGFCAIFWFSVQAYAAAQAVDAVLSTLSPAWASMTPSLLGMQARMWLA
FT                   MAMVWALHAWIASHGVHRIRNFELVAGPLVIIVGLLATIWGLRVGHGLGPLFAQPSHLH
FT                   GAAFWSTFAMGVTGMIGMWATFAVNIPDLSRFVRSERDQVVGQAIGLPITALVFTPMGI
FT                   ITTSATIILFGHPIWNPVDLLLALNHPVVTVLGGATLVLATLSVNVVANIMPACYDLVN
FT                   LMPRRLDFNRASRLVLVLGVFFMPWLWFNEAAGIYRVLDLISGLLGPVTGIMLADFYIV
FT                   RRQVLDVPALYRHGGRYDGRNGWNVPALAAFAAGGAVASAGHVVPGLAGLNTVAWFVGV
FT                   AIGAGLYLALSPRRDAHPAEDAATLSNA"
FT   gene            complement(253850..254680)
FT                   /locus_tag="Gdia_0231"
FT   CDS_pept        complement(253850..254680)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0231"
FT                   /product="CDP-diacylglycerol diphosphatase"
FT                   /EC_number="3.6.1.26"
FT                   /note="PFAM: CDP-diacylglycerol pyrophosphatase; KEGG:
FT                   gdi:GDI2008 putative CDP-diacylglycerol pyrophosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50028"
FT                   /db_xref="GOA:B5ZKR8"
FT                   /db_xref="InterPro:IPR003763"
FT                   /db_xref="InterPro:IPR036265"
FT                   /db_xref="InterPro:IPR038433"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZKR8"
FT                   /protein_id="ACI50028.1"
FT                   /translation="MKRVLLGAAVPAMLAAGILLTVARASGPARLNNDPNVLWSIVHDR
FT                   CVPNQVGENTPAPCAAVDTDRGYAVLKDRRGLAQYLVIATDRVTGIEDPSILSPAAPDY
FT                   FGAAWHQVDRSLARLGHTMPRETMALAINSQYGRSQNQLHIHIDCLAPNIRVALHWARP
FT                   QIGHGWTRLVLNDHTYRATRIDGNSLDGAYPFRRLAASLADPAREMGEHTLVVVGTVWP
FT                   GGRPGFILLDDMVKPLSGDRAEGEELQDHACRIGHFEPGRAIQEQPYQQAMLPD"
FT   sig_peptide     complement(254603..254680)
FT                   /locus_tag="Gdia_0231"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.930 at
FT                   residue 26"
FT   gene            complement(254677..256173)
FT                   /locus_tag="Gdia_0232"
FT   CDS_pept        complement(254677..256173)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0232"
FT                   /product="Ppx/GppA phosphatase"
FT                   /note="PFAM: Ppx/GppA phosphatase; KEGG: gdi:GDI2009
FT                   putative guanosine-5'-triphosphate,3'-diphosphate
FT                   pyrophosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50029"
FT                   /db_xref="InterPro:IPR003695"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZKR9"
FT                   /protein_id="ACI50029.1"
FT                   /translation="MTRAGSTHRRSAVVDLGSNSVRLVVFDGITRNPIPIFNEKAVLRL
FT                   GRGLNATGRLNEEGVGAAIQVMDRFYAIARGMDADPFEILATAAVRDASNGGEFVETLR
FT                   ARMPGVPIRILSGEEEADYSATGVLCGLPEADGLVADIGGGSLELIRLSGGQKLDACTL
FT                   RLGVIRLNDRSENDLAKARAIADADIAQVGWLDDMQGRPLYLVGGAFRALARLQIARTN
FT                   YPLNIVHLYTMSGDGAKDMADWAASTPRRTLERLPGAPRKRLDDVPFAATVLRRLIRRV
FT                   QPTCVVVSVDGLREGWYMRRVAASVKALDPQEAVAHEMCTRLGRSETLPDRLMTWTAPL
FT                   FADEDPSMRRLRRAACLMSDIGSYDHPEYRAEQTYLRVLRMQGVGFDHPARAFVALTLA
FT                   VRYEAELGQEFLQPSRLLLPPEQYGRAVVLGLALRLAYTVCGGTEELLDGTWVGMSKQG
FT                   LALHLSAGRGVVRGESVRRRLDRLADALSLPARIEEAATA"
FT   gene            complement(256261..258555)
FT                   /locus_tag="Gdia_0233"
FT   CDS_pept        complement(256261..258555)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0233"
FT                   /product="Polyphosphate kinase"
FT                   /EC_number="2.7.4.1"
FT                   /note="PFAM: Polyphosphate kinase; KEGG: gdi:GDI2010
FT                   putative polyphosphate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50030"
FT                   /db_xref="GOA:A9HJU7"
FT                   /db_xref="InterPro:IPR003414"
FT                   /db_xref="InterPro:IPR024953"
FT                   /db_xref="InterPro:IPR025198"
FT                   /db_xref="InterPro:IPR025200"
FT                   /db_xref="InterPro:IPR036830"
FT                   /db_xref="InterPro:IPR036832"
FT                   /db_xref="InterPro:IPR041108"
FT                   /db_xref="UniProtKB/TrEMBL:A9HJU7"
FT                   /protein_id="ACI50030.1"
FT                   /translation="MTRPTRKTPARQPSARPAPKRSVPKRTGTSARRRAPASDTTPPVP
FT                   PPPVDMQSPTRFINRELSWLDFNQRVVEEADNPRNPLLERLRFLSISAGNLDEFYSVRV
FT                   AGLVGQVREGLVTSSPDGLTPVQQLAAVRTRTIRLLREQQRIWKDLRGLLAESGIVVCS
FT                   LDTISDADRDWLDSCFMDRIFPVLTPLAIDPAHPLPFIPHMGLALSLRLMSRDTGRFVM
FT                   SAMILLPAQIERFVRLPANLSPPGVTRFILLENLIALCIDRLFPGMVAGEWGVLRVIRD
FT                   TDVEFEDEAEDLVRSYESALKRRRRGVVIHLDIDSRMPADLGQAVATDLAVPPDEVEIQ
FT                   PGLIGVVDLKQLIVDDRPDLLFPPYTPRFPERVVDFGGDCFAAIRAKDMIVHHPFESFD
FT                   VVIQFLRQAALDPAVVAIKQTLYRTSRDSPIVKALIEAAEAGKSVTAMVELRARFDEEA
FT                   NIRLARALEAAGVQVVFGFADLKTHAKLSLVVRREGGSLRSYAHFGTGNYHPITARIYT
FT                   DLSFFTCDPELARDSARLFNYMTGYALPTRMEAIAFSPVTIRRTLEELIEGEIEHVRAG
FT                   RPGQIWLKMNSLVDPDLIDRLYRASCAGVRIMGVVRGICCLRPGVPGLSENIRIKSIVG
FT                   RFLEHARIFAFGDGHRLPSRQARIYISSADWMVRNMDWRVESMVPMRDPTVHAQVLDQI
FT                   MVTDLKDNLQSWILQQNGVWRRLEPGAKPFSAHDYFMTNPSLSGRGRAAQDSAIRVSTA
FT                   LPRHQDRILDD"
FT   gene            complement(258673..259440)
FT                   /locus_tag="Gdia_0234"
FT   CDS_pept        complement(258673..259440)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0234"
FT                   /product="Chromosomal replication initiator DnaA"
FT                   /note="PFAM: Chromosomal replication initiator DnaA; SMART:
FT                   AAA ATPase; KEGG: gdi:GDI2011 putative DNA replication"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50031"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A9HJU9"
FT                   /protein_id="ACI50031.1"
FT                   /translation="MVERTAQNQDETAPRDSFGQLVLPFAHRTRHARADFVAAPSNGMA
FT                   RAWLLGAPAWPEHRLALWGAAGAGKTHLLDIWAQERGAVLLTGADLTQATLGRLFDDAP
FT                   DMLRAVAVDDADRVEDQRALLHLLNAAREHRVAVVLAARLSPARWPVVLPDLASRLRAT
FT                   MAIELRQPEDTLLRILLLRHLADRQIVVSQPVTEWLLRRLPRTASAIREAAIRLDHAGL
FT                   AAGRRVTRALALSVLHDMLAHDGAPDEADARAR"
FT   gene            259570..260661
FT                   /locus_tag="Gdia_0235"
FT   CDS_pept        259570..260661
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0235"
FT                   /product="phosphoribosylformylglycinamidine cyclo-ligase"
FT                   /EC_number="6.3.3.1"
FT                   /note="KEGG: gdi:GDI2012 putative
FT                   phosphoribosylformylglycinamidine cyclo-ligase; TIGRFAM:
FT                   phosphoribosylformylglycinamidine cyclo-ligase; PFAM: AIR
FT                   synthase related protein; AIR synthase related protein
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50032"
FT                   /db_xref="GOA:B5ZKS2"
FT                   /db_xref="InterPro:IPR004733"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZKS2"
FT                   /protein_id="ACI50032.1"
FT                   /translation="MTSAPPFHPPQPAAGATYRDAGVDIAAGDALVDAIKPAARATDRP
FT                   GTMGGLGGFGALFDLKAAGFTDPVLVSCTDGVGTKLMVAIESGLHETVGIDLVAMCVND
FT                   LVVQGAEPLFFLDYFATGRLAVEDAAKVVRGIAQGCRESGCALVGGETAEMPGMYGPGH
FT                   YDLAGFSVGAAERAALLPADIAAGDTLIGLPASGVHSNGFSLVRAIVARSGLAWDAPCP
FT                   FAPGQTLAQALMAPTRLYVKAVLDLHRQGLIQGAAHITGGGLPGNLPRVLPAGLTALID
FT                   GGAWPIPPVFGWLARTGQVDPDEMLKVFNCGVGMVLIARDGDAALQSLRAAGQDAFVIG
FT                   RLEEGTPGAAAGLRFTTRPDFTG"
FT   gene            260666..261304
FT                   /locus_tag="Gdia_0236"
FT   CDS_pept        260666..261304
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0236"
FT                   /product="phosphoribosylglycinamide formyltransferase"
FT                   /note="TIGRFAM: phosphoribosylglycinamide
FT                   formyltransferase; PFAM: formyl transferase domain protein;
FT                   KEGG: gdi:GDI2013 putative trifunctional purine
FT                   biosynthetic protein adenosine-3"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50033"
FT                   /db_xref="GOA:A9HJV2"
FT                   /db_xref="InterPro:IPR001555"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR004607"
FT                   /db_xref="InterPro:IPR036477"
FT                   /db_xref="UniProtKB/TrEMBL:A9HJV2"
FT                   /protein_id="ACI50033.1"
FT                   /translation="MTHDTHAAARRPIAILISGRGSNMRALIDACAAPDFPARIALVLS
FT                   NRPDAPGLEVARAAGLRAEAIDHRPFRGDRAAHEHAIDATLRAAGVELVCLAGYMRLLT
FT                   PFLTGAWAGRMLNIHPSLLPAFPGLHTHERALQAGVKLHGCTVHLVTEIMDDGPILGQA
FT                   AVPVHADDTPDRLAARVLEQEHRLYPAALRKVLTPDAVPQPDIGSLLFL"
FT   gene            complement(261354..261776)
FT                   /locus_tag="Gdia_0237"
FT   CDS_pept        complement(261354..261776)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0237"
FT                   /product="Nucleoside-diphosphate kinase"
FT                   /EC_number="2.7.4.6"
FT                   /note="PFAM: nucleoside diphosphate kinase; KEGG:
FT                   gdi:GDI2014 nucleoside diphosphate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50034"
FT                   /db_xref="GOA:A9HJV3"
FT                   /db_xref="InterPro:IPR001564"
FT                   /db_xref="InterPro:IPR023005"
FT                   /db_xref="InterPro:IPR034907"
FT                   /db_xref="InterPro:IPR036850"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9HJV3"
FT                   /protein_id="ACI50034.1"
FT                   /translation="MATERTLSIIKPDATRRNLTGKINAVFEDAGLRIVAQKRVQLSEA
FT                   EAGAFYAVHKDRPFYGELVSFMVSGPVVLQVLEGENAVLKHRDVMGATDPKKAAAGTVR
FT                   AQFAESIEANSVHGSDSLENANTEIAFFFAQTEILP"
FT   gene            262017..263894
FT                   /locus_tag="Gdia_0238"
FT   CDS_pept        262017..263894
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0238"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: gdi:GDI2015 putative ABC transporter ATP-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50035"
FT                   /db_xref="GOA:B5ZKS5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032781"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZKS5"
FT                   /protein_id="ACI50035.1"
FT                   /translation="MSLLVISDLTLRIAGRTLLDGASLTVDPGRKIGLVGRNGAGKSTL
FT                   LAAIAGDIAPDGGTIHLSSRARMARIRQEAPSGDANLLDTVLAGDAERTALMAEADQTP
FT                   DPVRLADIHERLRAIGADSAPARAATILSGLGFDADAQARPVSDFSGGWRMRVALATAL
FT                   FLNPDLLLLDEPTNHLDLEATIWLENWLSRFAGAALIVSHDRGLLDRAVDAIAHLDQRK
FT                   LTLTPGGYSEFVRIRTEQALQQARAAERIAAQRAHMQSFVDRFRAKATKARQAQARLKA
FT                   LEKLPVLDTVVEDAPTRFAFPEPAPLPPPMLTLDRVSVGYGGRPILSGLTLRLDMEDRI
FT                   ALLGANGNGKSTFAKLIAGRLAPISGTVAHGPRLRVGYFAQHQAEELVPGETPVDHMTR
FT                   VMPKAPPTAVRAQLARFGLDADRADTVTRDLSGGEKARLLLALATREAPHLLILDEPTN
FT                   HLDLDAREALIRALAEFEGAVLLISHDPHLVELVADRLWLVGDGTVRPFDGDMAEYRTW
FT                   LSERARAATRPATPAAPRRDDRRERAEARKAIAPLRRKARDAEARMSRLADERGRLETR
FT                   LADPALYAAGGADEVTAINTRLAAIGREQEEAEEEWLLAEAAIEESAAE"
FT   gene            complement(263917..265482)
FT                   /locus_tag="Gdia_0239"
FT   CDS_pept        complement(263917..265482)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0239"
FT                   /product="outer membrane efflux protein"
FT                   /note="PFAM: outer membrane efflux protein; KEGG:
FT                   gdi:GDI2016 putative outer membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50036"
FT                   /db_xref="GOA:B5ZKS6"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="InterPro:IPR028351"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZKS6"
FT                   /protein_id="ACI50036.1"
FT                   /translation="MTRPASLATIGFAMLGLAGCATQALHSAPDRPDAPWRPNVSAAGE
FT                   IIPGPCCARGLALPPGYSLPSNRNIQGRPAPPELQGAHPYSLAELIDIAQSTNPDTRRA
FT                   WNTARDAALAVGIARSTYLPHLTATVVGGYNHAHDSGANAAIGNVDIGGTSTRVGNGEV
FT                   QTLGLEWLLFDFGKREATIDAARQSQLATNILFTGAHQKLIYAVTLAFYTHAAATARVT
FT                   LLHQALDNARKVEDAADMRLRRGQGTVVDATQARQATAQAELRLVQAEGGAENTYLDLM
FT                   TAIGIPPGTHVLTQDISDRPLSLADARLTDDMIQRDAARRPDVLAAYATARASRSAVAA
FT                   ARAEFLPKIFVSGNVAYATGRLALSSVPGIGANAAPTLNLSSNNFSSLILGGITVPIFD
FT                   GGMRAAALKQARNRFDSAETNLRQTLDEAVKQLVVAENGVHTSLSAYAASGRLQTAAQT
FT                   SFDATLSAYRNGVGSITQATLAQSGLIDARLERSDAYYAALIAASSLAFAAGALGDASP
FT                   TEQP"
FT   sig_peptide     complement(265399..265482)
FT                   /locus_tag="Gdia_0239"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.899 at
FT                   residue 28"
FT   gene            complement(265479..267281)
FT                   /locus_tag="Gdia_0240"
FT   CDS_pept        complement(265479..267281)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0240"
FT                   /product="putative multidrug resistance protein MdtO"
FT                   /note="KEGG: gdi:GDI2017 putative multidrug resistance
FT                   protein MdtO"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50037"
FT                   /db_xref="GOA:B5ZKS7"
FT                   /db_xref="InterPro:IPR006726"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZKS7"
FT                   /protein_id="ACI50037.1"
FT                   /translation="MAPPVPDRHIADPGRLTLGRAWRLACDPEPGRLGYALRMAAACAT
FT                   TVLVGEIWQVPDLAVPALVTMALWQKDRVTNLVAGLAVNVLILVILAMLYGLIRLTLDH
FT                   PLGIVVGVAILSFCFFFLGSASKLKPLAYMLGLITVYGLIAVDQAPVGEIATRALLYTD
FT                   LFLAIPGLVMIGLGLIICPSPRTVLMRAIAGRLRMAMALLRHPDDATRERAQDMLRQGD
FT                   AGMMANVKMAALERIWNRRDLACLKQAAYSSIGVLALADAAVREGGSPCPSALLETLEE
FT                   MAAMFEAGDYPADIAPPAVPSNEPALAAMAALIAIFTTPAPEEKPPEEKKSGGFFFPDA
FT                   FTNPDHVRFAVKGTAAVMTSYFIFKILDWPGIHTCIITCFIVAQPTMGEMISKLMLRIG
FT                   GALLGAALGIGSIILLMPHLNDITGFLALVFAGAFIAAWVKTGDERIAYAGFQIGLAFF
FT                   LTDIKDYGPTTDMTVARDRVVGIMLGNFITYAMFTSFWPASAWDRIAATLRGVVRALAA
FT                   QRDSITPQARVTHAAEVLGAISASQRTLEFAATEPVHMRADTERMSQCGEALRDASRLA
FT                   EDLLIPERDAQTRARFERLESLAS"
FT   gene            complement(267262..268296)
FT                   /locus_tag="Gdia_0241"
FT   CDS_pept        complement(267262..268296)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0241"
FT                   /product="secretion protein HlyD family protein"
FT                   /note="PFAM: secretion protein HlyD family protein; KEGG:
FT                   gdi:GDI2018 putative secretion protein, HlyD-family"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50038"
FT                   /db_xref="InterPro:IPR039562"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZKS8"
FT                   /protein_id="ACI50038.1"
FT                   /translation="MSGRKPVGLIIAVACVGAAVLLGVHVANEDSAHPSSDSGSIDAEI
FT                   VHMASTVGGRLVDLPVHVNQAVRKGDLLYRLDPEPYELTVRQAQANLALAQAEVENQRR
FT                   LVSVKTADAAVAQAQTARARTNRDLAARTVERLSPLAGHAYIPLQQYDQARVALRDAEI
FT                   SLEQAHRQEAAAQTAIGDLNSTLAARDAAAAALDHARYELRQTTVVAPLDGYVTSLRVK
FT                   PGEILAPAQVLFTLIANDAWYANANIREVDLRPIRPGDCATVHSMIDRHVAIRGHVDSI
FT                   GWGVLSADSAGSARALPVVPREMDWVHVAQRFPVRVKIDRADPNLLRLGATATVEIRHG
FT                   AACP"
FT   sig_peptide     complement(268216..268296)
FT                   /locus_tag="Gdia_0241"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.965) with cleavage site probability 0.516 at
FT                   residue 27"
FT   gene            complement(268314..268586)
FT                   /locus_tag="Gdia_0242"
FT   CDS_pept        complement(268314..268586)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0242"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_B2118 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50039"
FT                   /db_xref="GOA:B5ZKS9"
FT                   /db_xref="InterPro:IPR031381"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZKS9"
FT                   /protein_id="ACI50039.1"
FT                   /translation="MTSHSAPLARVAPVLFLGGCAVRGAPSFPLVGAYFPGWMFCAMVG
FT                   IAAAVGLRVVFIQTGIDAILSFRLFTYVSLGVIAALLAWLIWFGP"
FT   gene            complement(268734..268928)
FT                   /locus_tag="Gdia_0243"
FT   CDS_pept        complement(268734..268928)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0243"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gdi:GDI2019 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50040"
FT                   /db_xref="GOA:A9HJW2"
FT                   /db_xref="UniProtKB/TrEMBL:A9HJW2"
FT                   /protein_id="ACI50040.1"
FT                   /translation="MNAENGQDAPIGYYNAPHGVAAAERALALGAFAIGTGEFAIMGML
FT                   PDMARNRSAGPGRSCRPAA"
FT   gene            269111..270241
FT                   /locus_tag="Gdia_0244"
FT   CDS_pept        269111..270241
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0244"
FT                   /product="protein of unknown function UPF0118"
FT                   /note="PFAM: protein of unknown function UPF0118; KEGG:
FT                   gdi:GDI2020 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50041"
FT                   /db_xref="GOA:B5ZKT1"
FT                   /db_xref="InterPro:IPR002549"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZKT1"
FT                   /protein_id="ACI50041.1"
FT                   /translation="MPTKAVTESRPDTRPIRREPEQDRPEQDPRAVQLARIHHLLQVAI
FT                   LLAVMVLSIWLIGDVLMVVFAATLIAVILHNLAAMVERRTRLPYWLALSLVVVVLLAAI
FT                   GGLGWSSGPAIAEQATRLRIALTTQAHSLRGQLNASTMGRTVLDYLPQSLGGNQAGGGD
FT                   NGMGSRIAGSMTGVLSSAFGAAGTLAVILIAGLYFALSPALYVNGLLRLIPPGHRPAAR
FT                   TLLLVAGRTLWAWTAGQALDMLVVGILSGVGLWFIGVPLALALGVVAGMANFIPYIGAF
FT                   IGAVPAILLGLSQGTREGLLVMALYAAIQFFEGNVMAPLIQRHAVQMPPGLTILSQTVF
FT                   GTILGLPGLVLASPLTAALLAMMDRATPPLDEEDRV"
FT   gene            complement(270243..270824)
FT                   /locus_tag="Gdia_0245"
FT   CDS_pept        complement(270243..270824)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0245"
FT                   /product="HAD-superfamily hydrolase, subfamily IA, variant
FT                   3"
FT                   /note="TIGRFAM: HAD-superfamily hydrolase, subfamily IA,
FT                   variant 3; HAD-superfamily hydrolase, subfamily IA, variant
FT                   1; PFAM: Haloacid dehalogenase domain protein hydrolase;
FT                   KEGG: gdi:GDI2021 putative hydrolase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50042"
FT                   /db_xref="GOA:B5ZKT2"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZKT2"
FT                   /protein_id="ACI50042.1"
FT                   /translation="MIVVPPDTTALIFDCDGTLVDSLPLYLKAWLGAFETVADHRMAPE
FT                   WFHGRGGLSEHMVLDLIEAELGRTLDRAAIVRAARQGVLATMAELREIGIVADLARRYR
FT                   GQLPMAVASSGSREIVTAALSHTGLMTLFDTVVTIDDVARPKPAPDLFLEAARRLDAAP
FT                   RTCLVLEDSNEGLAAAGHAGMRGLDIRPFL"
FT   gene            complement(270821..271312)
FT                   /locus_tag="Gdia_0246"
FT   CDS_pept        complement(270821..271312)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0246"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gdi:GDI2022 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50043"
FT                   /db_xref="UniProtKB/TrEMBL:A9HJW9"
FT                   /protein_id="ACI50043.1"
FT                   /translation="MKRENALLLGILGCLAFAVATATVVWSFAIPNFRPLTIPHMNAGV
FT                   ISVGPMRQQRALSAAEIRTLNDWLQQHRGGWGPLGQTPPSSGDATITLTADRPAGPDGK
FT                   PVPYVITLWTGISAADWNATLFLEDRPGAVIRIERFPEKDFAVLRQMVDQQPYERTAFP
FT                   "
FT   sig_peptide     complement(271244..271312)
FT                   /locus_tag="Gdia_0246"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.438 at
FT                   residue 23"
FT   gene            complement(271332..272474)
FT                   /locus_tag="Gdia_0247"
FT   CDS_pept        complement(271332..272474)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0247"
FT                   /product="DegT/DnrJ/EryC1/StrS aminotransferase"
FT                   /note="PFAM: DegT/DnrJ/EryC1/StrS aminotransferase; KEGG:
FT                   gdi:GDI2023 putative aminotransferase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50044"
FT                   /db_xref="GOA:B5ZKT4"
FT                   /db_xref="InterPro:IPR000653"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZKT4"
FT                   /protein_id="ACI50044.1"
FT                   /translation="MTASPETLSPIAFLDLPAQQARLGDAIRRRVDAVMAHCRFVMGPE
FT                   VAELEQALATYAGARECVGVSSGTDAIQIVMMAEGIGPGDAVFLPAFTYTATAEVPLLL
FT                   HATPVFVDVDPRTFQIDPASLEKRIADVRAAGTLRPRAIVGVDLFGQPAPWPELRAIAA
FT                   REGLFLMDDCAQSFGGALTGRKLGREATATTLSFFPSKPLGGYGDGGAILTDDPERADV
FT                   YRSLRTHGEGKTRYEVLRTGMNGRLDTLQAAVLLAKLEGFDAELARREEIAGAYDAGLA
FT                   HHVTTPARVPDSHSAWAIYAVLVESEAARAALQERLRAKGVPSAIYYPRPLHLQPAYQA
FT                   HHDGTCLPVAEDLSSRILALPIHPELTDADVARVIAAVRG"
FT   gene            complement(272471..274465)
FT                   /locus_tag="Gdia_0248"
FT   CDS_pept        complement(272471..274465)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0248"
FT                   /product="polysaccharide biosynthesis protein CapD"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase;
FT                   short-chain dehydrogenase/reductase SDR; 3-beta
FT                   hydroxysteroid dehydrogenase/isomerase; polysaccharide
FT                   biosynthesis protein CapD; dTDP-4-dehydrorhamnose
FT                   reductase; Male sterility domain; KR domain protein; KEGG:
FT                   gdi:GDI2024 putative capsular polysaccharide biosynthesis
FT                   protein CapD"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50045"
FT                   /db_xref="GOA:B5ZKT5"
FT                   /db_xref="InterPro:IPR003869"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZKT5"
FT                   /protein_id="ACI50045.1"
FT                   /translation="MVGTMASQRPDPPLPADRRRPVNRIAVNVLLDGLLAALSAPLARW
FT                   LADPRGGLLHPLWFVAGGAITLIISGLPFRVQQQYWRFSGVGDLLNIAGASVASAILFA
FT                   LGLHVTGFPIPTPTFPIIHALVLLTLMGGIRIIYRLSYRRTARRQASSQVILVGSDNSA
FT                   DLFIRAVERAPDPAFRVAGIVTQGRRQAGRRIHGIPILGHVEGMDDILARLDGHGGRPE
FT                   RLVITDAAFRGEDLAEIMQVAERRGLTVLRAPVLTDLTPADRLELRPVAIEDLLNRPQV
FT                   GLDHDGMAALLGGRTVLVTGAGGSIGSELARQIAEYEPGRLLLLDHGEFALWQIDVELS
FT                   ERAPRLRRETILADIRDRARIEQVCAQYRPELVFHAAALKHVPMVEANPCEGVLTNVIG
FT                   TRIVADAAARHGARALVMVSTDKAVNPSSLMGASKRAAEMYCQALDVEARTGDESGVMR
FT                   CVTVRFGNVLGSTGSVVPLFRRQLERGGPLTVTHPDMQRYFMTVSEAVGLVLQASVRGT
FT                   IRARAGSGTDTLLRSGGIFVLDMGKPIRIVDLARQMIRLAGLRPDQDVPIRFTGLRPGE
FT                   KLFEELFHGREAPVATDHPGLKMATPRMVDRGAVGLAIDTLEAACRAEDTPAVLALIGS
FT                   LVPEFAHNPTGDVRDRLADPTDAERTMTP"
FT   gene            274521..275555
FT                   /locus_tag="Gdia_0249"
FT   CDS_pept        274521..275555
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0249"
FT                   /product="glycosyl transferase family 4"
FT                   /note="PFAM: glycosyl transferase family 4; KEGG:
FT                   gdi:GDI2025 putative glycosyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50046"
FT                   /db_xref="GOA:A9HJX6"
FT                   /db_xref="InterPro:IPR000715"
FT                   /db_xref="UniProtKB/TrEMBL:A9HJX6"
FT                   /protein_id="ACI50046.1"
FT                   /translation="MNHFVFPPSVPFAFLLFAVWSGAALMVAGAIRLGVLDHPGHRSSH
FT                   TRPTPKGGGIGVVTAFVLAVPAARLLHGLPMLTPAVAGLLAATILLGGVSWLDDVYQWP
FT                   PSLKLAAQFAASILVVATGPHPTGIAMPIGGAVLSVGVLVFMTNAVNFMDGLNGLASGS
FT                   ILLACLVIGGLASGGADRAGLGDMALILAAALAGFLPFNFPAARIFMGDVGSQSCGLLM
FT                   GAFGLAGAAGGTGGGLGLAVPLLMAGLLYDVGYTLLRRWRNGARLVESHREHLYQLATQ
FT                   AGMSPVVVTLVQWAFVLWGGVAALLMQQGRTGPAGALVLVLLPQLGWTGIVRGRIRRMP
FT                   PRDA"
FT   sig_peptide     274521..274610
FT                   /locus_tag="Gdia_0249"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.785) with cleavage site probability 0.343 at
FT                   residue 30"
FT   gene            complement(275602..276063)
FT                   /locus_tag="Gdia_0250"
FT   CDS_pept        complement(275602..276063)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0250"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gdi:GDI2026 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50047"
FT                   /db_xref="UniProtKB/TrEMBL:A9HJX9"
FT                   /protein_id="ACI50047.1"
FT                   /translation="MRLATRVAAAAVLATPFLAASLPGSAARAADDLGTPSGHIRLVAK
FT                   SADVGVGWTWGNGTLTYGHHTYHFTVKGGSIAAVGYSSVVSTGTVYNLKHLHDFDGTYV
FT                   AANGEATLGNGVGGTLMHNGNNVTIRIETLSKGARLAGAAQGLELTLTK"
FT   sig_peptide     complement(275974..276063)
FT                   /locus_tag="Gdia_0250"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.920 at
FT                   residue 30"
FT   gene            complement(276304..276714)
FT                   /locus_tag="Gdia_0251"
FT   CDS_pept        complement(276304..276714)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0251"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="PFAM: regulatory protein MarR; KEGG: gdi:GDI2027
FT                   putative transcriptional regulator, MarR family"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50048"
FT                   /db_xref="GOA:B5ZKT8"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZKT8"
FT                   /protein_id="ACI50048.1"
FT                   /translation="MAQNSSTSDQLISTLRDTVVAMVRRDGPDLSARQLGVFLTCYLQE
FT                   GAHTVRGLASTLNVSKPAITRALDRLGELDLARRKVDPMDRRSVLVQRTLKGAAYLREL
FT                   RSIMNEAAGVPATARTGKVVRGEERAPRRAAG"
FT   gene            complement(276874..278319)
FT                   /locus_tag="Gdia_0252"
FT   CDS_pept        complement(276874..278319)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0252"
FT                   /product="Leucyl aminopeptidase"
FT                   /EC_number="3.4.11.1"
FT                   /note="PFAM: peptidase M17 leucyl aminopeptidase domain
FT                   protein; KEGG: gdi:GDI2028 putative cytosol aminopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50049"
FT                   /db_xref="GOA:A9HJY3"
FT                   /db_xref="InterPro:IPR000819"
FT                   /db_xref="InterPro:IPR011356"
FT                   /db_xref="UniProtKB/TrEMBL:A9HJY3"
FT                   /protein_id="ACI50049.1"
FT                   /translation="MSIEEFPCLLPPTRGRRAGVRTIHALPQAELGTLGERIGATGAAF
FT                   ARDTGFQARPGELALIPGANGVAAAVLGVRTGADGGAADPFQFGGLAGSLPPGAWKIAL
FT                   PDGVAPATAVLGFCLGAYRMPAFGRAEASPPGKDIARLIVPAGGGAGAEVAHAIRLGRD
FT                   LINTPPNLMGPAELARAARHMLNPLGARVETVKGRDLARAYPTIAHVGAGSARAPKVVI
FT                   ARWQGSAAGPDAPLLSLVGKGVCFDTGGYDLKQPSGMLRMKKDMGGAAVMLSLAHLILT
FT                   RDLPIRLELRLGCVENSVSGEAMRPSDVVVTRSGLTVEIGNTDAEGRLVLCDLLTDACA
FT                   AAPDLLIDAATLTGAARVALGPDLPALFSPDDAVAQAILEAGTAQCDPLWRLPLWDGYA
FT                   DWLRSPVADLNNVSAKPMAGSVTAALFLRNFVKTDVRWAHIDLYGWNDHYKPGRPEGGE
FT                   TPILRAVYASLLRILNVADRVSH"
FT   gene            278452..281124
FT                   /locus_tag="Gdia_0253"
FT   CDS_pept        278452..281124
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0253"
FT                   /product="helicase domain protein"
FT                   /note="PFAM: helicase domain protein; KEGG: gdi:GDI2029
FT                   putative helicase"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50050"
FT                   /db_xref="GOA:A9HJY6"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A9HJY6"
FT                   /protein_id="ACI50050.1"
FT                   /translation="MLGVPSGAGPLRAVRRSSNPMTAQRVRAILGPTNTGKTHLAIERL
FT                   LAHSSGIIGFPLRLLARENYERMVAAKGAASVALITGEEKIVPPNARWFSCTVEAMPLD
FT                   QMAEFVAVDEIQLCADPDRGHVFTDRLLHARGLVETMFLGAETIRPLLRRLVPGVEIES
FT                   RPRLSQLTHLGGSKLTRLPPRSAIVAFSATEVYAIAELIRRRRGGCAVVMGQLSPRTRN
FT                   AQVALYQDREVDYLVATDAIGMGLNMDVNHVAFAGLSKFDGARARPLSPAEIAQIAGRA
FT                   GRGMRDGTFGTTGTCPALPDEIAEAVETHRFDPIERLFWRNSDLDFAGPDALLASLNRP
FT                   PPTHGLTAGNEASDVMTLSSLASVPDIRALVRSSRATRLLWDACQIPDFRKLGDETHTR
FT                   LCARIFTHVIRDGHVPEAWMESQIAAFARPEGDIDSLMHRLSGIRVCSYIAARRDWVRD
FT                   AARWQERARVVEDQLSDALHERLTARFVDRRAASLIRRLDESSGDDELLSAVTSRGEVV
FT                   VEGHPVGRVAGLDLLPDPDCDHPDRRLLLRAARRALRSEIPRRVRVLTAADDGEFDFSA
FT                   DGRFLVWDDAPIARLRGGEDMLRPRIEVLDNAFLDGVQRERVRARLAAWLDRQVQDVMA
FT                   PLFAARAAVEQDPALRGVMHRLMEQGGVVADVGPLSPVLRARLKTLGVRVGRHAVLMPA
FT                   LLRPHAMRLRAILLAVRAGRPIPAIPSAGAVSVPVDDPRDLLLAPLGWIVAGPVRLRLD
FT                   IAEKMSAELRWRARNGPVPLPDGLSSRLGVRPEAVAAILKALDIPVRAARPLKDSEYGP
FT                   VAPPMLAVTQDARRRQRQQQQRTRPVPVEMDRPAGPATGFAVADRSRPAPRPGGERRPA
FT                   THVPDGPFAALAVLKQRRS"
FT   gene            281121..281450
FT                   /locus_tag="Gdia_0254"
FT   CDS_pept        281121..281450
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0254"
FT                   /product="RNA-binding S4 domain protein"
FT                   /note="PFAM: RNA-binding S4 domain protein; KEGG:
FT                   gdi:GDI2030 putative RNA-binding S4"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50051"
FT                   /db_xref="GOA:A9HJY8"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:A9HJY8"
FT                   /protein_id="ACI50051.1"
FT                   /translation="MKEDRHPAASGADDAAIAAQRLDLWLWCARFARHRPDCARMAQDG
FT                   LVRINRQRTEKAHALVRRGDVLTLPGAGDHGVMVVRVLGLVPRRGSATLARLLYDIVPE
FT                   QAEAG"
FT   gene            281639..281971
FT                   /locus_tag="Gdia_0255"
FT   CDS_pept        281639..281971
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0255"
FT                   /product="4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein; KEGG: gdi:GDI2031 putative ferredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50052"
FT                   /db_xref="GOA:A9HJZ0"
FT                   /db_xref="InterPro:IPR000813"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR022569"
FT                   /db_xref="UniProtKB/TrEMBL:A9HJZ0"
FT                   /protein_id="ACI50052.1"
FT                   /translation="MTYVVTENCIRCKFMDCVEVCPVDCFYAGENFLVINPDECIDCGV
FT                   CEPECPAEAIVPDSDDRAAAWAEINASYSAKWPNITRKGTAPADAEEWKDKPGKKDLLS
FT                   PEPHKD"
FT   gene            complement(282164..282496)
FT                   /locus_tag="Gdia_0256"
FT   CDS_pept        complement(282164..282496)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0256"
FT                   /product="cytochrome o ubiquinol oxidase subunit IV"
FT                   /note="TIGRFAM: cytochrome o ubiquinol oxidase subunit IV;
FT                   PFAM: cytochrome C oxidase subunit IV; KEGG: gdi:GDI2032
FT                   putative cytochrome o ubiquinol oxidase protein CyoD"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50053"
FT                   /db_xref="GOA:A9HJZ2"
FT                   /db_xref="InterPro:IPR005171"
FT                   /db_xref="InterPro:IPR014210"
FT                   /db_xref="UniProtKB/TrEMBL:A9HJZ2"
FT                   /protein_id="ACI50053.1"
FT                   /translation="MADAHTAHSGSSHGSVGSYLTGFVISVVLTAAAFGVVMAHSFSPS
FT                   GTIAAIAILAAVQVVVHLVFFLHMNTSSEQRWNVMAFVFTVTAVLILIVGTVFIMHDTA
FT                   INMMSR"
FT   gene            complement(282496..283101)
FT                   /locus_tag="Gdia_0257"
FT   CDS_pept        complement(282496..283101)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0257"
FT                   /product="cytochrome o ubiquinol oxidase, subunit III"
FT                   /note="TIGRFAM: cytochrome o ubiquinol oxidase, subunit
FT                   III; PFAM: cytochrome c oxidase subunit III; KEGG:
FT                   gdi:GDI2033 putative cytochrome o ubiquinol oxidase subunit
FT                   3"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50054"
FT                   /db_xref="GOA:A9HJZ5"
FT                   /db_xref="InterPro:IPR000298"
FT                   /db_xref="InterPro:IPR013833"
FT                   /db_xref="InterPro:IPR014206"
FT                   /db_xref="InterPro:IPR024791"
FT                   /db_xref="InterPro:IPR033946"
FT                   /db_xref="InterPro:IPR035973"
FT                   /db_xref="UniProtKB/TrEMBL:A9HJZ5"
FT                   /protein_id="ACI50054.1"
FT                   /translation="MAHDITADAAHAHEEHHESPVVFGFWLYLMTDCLIFGTLFAVFAV
FT                   MRTQFAGGPTGKDLFELNGVGIETALLLVSSITYGFAMINAHKNKLGAMRGWLVLTFLM
FT                   GLGFLFMEIREFSHMVAEGNGPDRSAFLSSFFTLVGTHGLHVTCGLLWMAVLMVQSMGQ
FT                   TVLSERMMNKLTCLSLFWHFLDIVWICVFTFVYLMSVI"
FT   gene            complement(283101..285095)
FT                   /locus_tag="Gdia_0258"
FT   CDS_pept        complement(283101..285095)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0258"
FT                   /product="cytochrome o ubiquinol oxidase, subunit I"
FT                   /EC_number="1.9.3.1"
FT                   /note="KEGG: gdi:GDI2034 ubiquinol oxidase subunit 1;
FT                   TIGRFAM: cytochrome o ubiquinol oxidase, subunit I; PFAM:
FT                   cytochrome c oxidase subunit I"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50055"
FT                   /db_xref="GOA:B5ZKU5"
FT                   /db_xref="InterPro:IPR000883"
FT                   /db_xref="InterPro:IPR014207"
FT                   /db_xref="InterPro:IPR023615"
FT                   /db_xref="InterPro:IPR023616"
FT                   /db_xref="InterPro:IPR036927"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZKU5"
FT                   /protein_id="ACI50055.1"
FT                   /translation="MLGKLSWSDIPFDVPILVGTFAGVAIVGLAVLGLITYYGKWGYLW
FT                   KEWLTSVDHKRLGVMYIVLALLALARGFADAVMMRSQLALAYAGNPGYLPPHHYDQIFS
FT                   AHGTIMIFFMAMAFMSGLMNVIVPLQIGARDVAFPFVNSVSFWMTTISFVLINISLFIG
FT                   EFSQCGWLAYPPLSELQFSPGVGVDYYIWAVQLSGVGTLLTGINFFTTIVKMRAPGMTF
FT                   MKMPVFTWTILCNTVLIMVAFPFLTVALALLGLDRYFGMHFFTNDGGGNQMLYLNLIWA
FT                   WGHPEVYILVLPAFGAFSEITQTFSRKPLFGYNTMVYATCSIMGLSLVVWAHHFFTMGA
FT                   GANVNAFFGIMTMIIAIPTGVKIFNWLFTIYKGRVEFNGIMYWVIGFMVTFSIGGMTGV
FT                   MLAIPAADFVLHNSLFVIAHFHNVIIGGVYFGYVAAMAFWWPKAFGFKMNEAWGKRAFW
FT                   CWLVGFYMAFMPLYVLGFEGMTRRMNHYDNPAWHPWMVMASIGAAIVALGVVCQLTQIY
FT                   VSIRDRNLPESRDLTGDPWNARTLEWSTSSPPPFYNFAVVPTVHELDAFAHDKEAGIDT
FT                   RSAGATYQPIHMPKNTSAGFFIGVFSLILGFAAVWYIWWLAAVGLLGVIGTLIARSSNN
FT                   DVDYYVPAAEVARIENEHTRNLLAAQAAE"
FT   gene            complement(285101..286024)
FT                   /locus_tag="Gdia_0259"
FT   CDS_pept        complement(285101..286024)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0259"
FT                   /product="ubiquinol oxidase, subunit II"
FT                   /note="TIGRFAM: ubiquinol oxidase, subunit II; PFAM:
FT                   cytochrome c oxidase subunit II; COX aromatic rich domain
FT                   protein; KEGG: gdi:GDI2035 ubiquinol oxidase subunit 2
FT                   precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50056"
FT                   /db_xref="GOA:B5ZKU6"
FT                   /db_xref="InterPro:IPR002429"
FT                   /db_xref="InterPro:IPR006333"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR010514"
FT                   /db_xref="InterPro:IPR011759"
FT                   /db_xref="InterPro:IPR034227"
FT                   /db_xref="InterPro:IPR036257"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZKU6"
FT                   /protein_id="ACI50056.1"
FT                   /translation="MKKKILPRLSNLLCLSSAFLLAGCDWVTLNPKGVIGVQEKSLILS
FT                   ATYAMLLVVVPVIVLTLLFAWQYRQSNTSAEYLPKWAHSNKIEVVIWLVPSLIILFLAV
FT                   LTYQTCHSLDPYRPIDDETNVKPIHVDVVALDWKWLFIYPDEGIATVNQMAFPVNTPVD
FT                   FRITSDSVMNSFFIPQLGSQVYAMAGMRTQLHLIANEAGNYLGESANFSGRGFSDMQFR
FT                   ALAMSNDDYNAWVQKVKASSEQLDGSNYPKLAAPSEKNPVEYFSHVSSSFFDGIVAKYN
FT                   NGMIMDEGTGKLKPVQSAMSDMNMKE"
FT   sig_peptide     complement(285941..286024)
FT                   /locus_tag="Gdia_0259"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.991) with cleavage site probability 0.388 at
FT                   residue 28"
FT   gene            complement(286672..287451)
FT                   /locus_tag="Gdia_0260"
FT   CDS_pept        complement(286672..287451)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0260"
FT                   /product="protein of unknown function UPF0005"
FT                   /note="PFAM: protein of unknown function UPF0005; KEGG:
FT                   gdi:GDI2037 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50057"
FT                   /db_xref="GOA:B5ZKU7"
FT                   /db_xref="InterPro:IPR006214"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZKU7"
FT                   /protein_id="ACI50057.1"
FT                   /translation="MAFSPDFRTMTRPAGAGTDAGAIDQGLRAYMLRVYNWMASGLVLT
FT                   GTVAYLVANTSLRAAFFAAVMTPSGVAVRPTGLGMLAMIAPLGFVLVMSLGVNRLSRQA
FT                   VQALFWLFCAVMGASLSSILLTFTGVSVVRVFFVTAGTFSAMSIWGYVTRTDLTRFGSF
FT                   LLMGLFGLVIAGLVNMFLHSSALYMLYSVVGVFIFVGLAAFDTQRIKMTYQQFAYYEGP
FT                   EGAAKRSVYDALTLYLNFINLFQFLLQFMGVRSNQDN"
FT   gene            287655..288194
FT                   /locus_tag="Gdia_0261"
FT   CDS_pept        287655..288194
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0261"
FT                   /product="2'-5' RNA ligase"
FT                   /note="TIGRFAM: 2'-5' RNA ligase; PFAM: Phosphoesterase
FT                   HXTX; KEGG: gdi:GDI2039 putative 2'-5' RNA ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50058"
FT                   /db_xref="GOA:A9HK09"
FT                   /db_xref="InterPro:IPR004175"
FT                   /db_xref="InterPro:IPR009097"
FT                   /db_xref="UniProtKB/TrEMBL:A9HK09"
FT                   /protein_id="ACI50058.1"
FT                   /translation="MRLFVAIEIVPPLRDAIASLRGSLAGVRWTDPLSYHLTLRFIGDV
FT                   RDRARQEDIHHALMAIRAPTCTLSPQGPGVFEQEGGLDRLWIGVARSDPLMHLQRKVDT
FT                   AIRRAAGLQVERRRFLPHVTIGSVARPPPPVMSAWLTQWGTVPPPPADATHFTLFRSLR
FT                   GPDQPLYDPLAEYPLG"
FT   gene            288539..290752
FT                   /locus_tag="Gdia_0262"
FT   CDS_pept        288539..290752
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0262"
FT                   /product="PQQ-dependent dehydrogenase, methanol/ethanol
FT                   family"
FT                   /note="TIGRFAM: PQQ-dependent dehydrogenase,
FT                   methanol/ethanol family; PFAM: Pyrrolo-quinoline quinone;
FT                   KEGG: gdi:GDI2040 alcohol dehydrogenase [acceptor]
FT                   precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50059"
FT                   /db_xref="GOA:B5ZKU9"
FT                   /db_xref="InterPro:IPR001479"
FT                   /db_xref="InterPro:IPR002372"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="InterPro:IPR017512"
FT                   /db_xref="InterPro:IPR018391"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZKU9"
FT                   /protein_id="ACI50059.1"
FT                   /translation="MMRAVYGKRRSLRGTLAVGTICAATFFGYTAATSAAESEFGATGE
FT                   AIIHADDHPGDWLTYGRTYSEQRYSPLDQINRSNVGNLKLAWYYDLDTNRGQEGTPLIV
FT                   DGVMYATTNWSKMKALDAATGKLLWAYDPRVPGNIADKGCCDTVNRGAAYWNGKVYFGT
FT                   FDGRLIALDAKTGKLVWSVNTIPADAALGHQRSYTVDGAPRIAKGRVIIGNGGSEFGAR
FT                   GFVSAFDAETGKLDWRFYTVPNAQNKPDNAPSDAVLMSKAYPTWSPTGAWTTQGGGGTV
FT                   WDSIVYDPVTDLVYLGVGNGSPWNYKFRSDGKGDNLFLGSIVALKPETGEYVWHFQETP
FT                   MDQWDYTSVQQIMTLDLPINGQTRHVIVHAPKNGFFYIIDAKTGEFLSGKNYVYVNWAS
FT                   GLDPKTGRPIYNPDALYTLNGKEWYGIPGDLGGHNFAAMAFSPRTGLVYIPAQQVPFLY
FT                   TSQVGGFKPHPDSWNLGLDMNKVGVMDSPEAKQAFIKDLKGWIVAWDPVKQQEAFRVDH
FT                   KGPWNGGIVATGGDLLFQGLANGEFHAYDATNGADLFHFAAQSGIIAPPVTYMANGKQY
FT                   VAVEVGWGGIYPFFLGGLARTSGWTVNHSRVIAFSLDGAAKLPPQNDKGFLPVKPPAQF
FT                   DGKRTDNGYFEFQTFCAACHGDNAEAGGVLPDLRWSGAIRHQDAFYNVVGRGALTAYGM
FT                   DRFDASMKPEQIEDIRQFLIKRSNDTYQREVDARKNVDGIPAQ"
FT   sig_peptide     288539..288646
FT                   /locus_tag="Gdia_0262"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.834 at
FT                   residue 36"
FT   gene            290798..292210
FT                   /locus_tag="Gdia_0263"
FT   CDS_pept        290798..292210
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0263"
FT                   /product="Gluconate 2-dehydrogenase (acceptor)"
FT                   /EC_number="1.1.99.3"
FT                   /note="PFAM: cytochrome c class I; KEGG: gdi:GDI2041
FT                   putative alcohol dehydrogenase cytochrome c subunit
FT                   precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50060"
FT                   /db_xref="GOA:A9HK15"
FT                   /db_xref="InterPro:IPR008168"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR014353"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:A9HK15"
FT                   /protein_id="ACI50060.1"
FT                   /translation="MVNRMLNRLKVAIGTAAFSLLATSAMAQAPDQALIDKGAYVARLG
FT                   DCAACHTALHGQAYAGGLQIKSPIGTIYSTNITPDPTYGIGQYSFEDFEQAVRHGVRKD
FT                   GTTLYPAMPYPAFSRMTQDDLRALYAYLMHGVKPVANPDRPADISWPLSMRWPLSIWRT
FT                   LFAPAPADFKPAPGQDPVVARGEYLVTGPGHCGACHTPRGFGMEEKALDASGGAVYLSG
FT                   GAPIDNWVAPSLRDDPVTGIGRWSEDDVYYFLKSGRTDHAAVFGGMADVVAWSTQYFTD
FT                   DDLRAMAKYLKSLPSVPASQGTYTYDASTTDMLNSGKTASSPGGDVYLRECAICHRNDG
FT                   GGVARMFPPLAGNPVVVTDDPTSLVNVITNGGVLPPTNWAPSAVAMPAYGKTLSSQQIA
FT                   DVVNFIRTGWGNHAPASVTAADVAKMRDTGAPVSSSGWNTSSSGWLVLHPQPYGAGWTF
FT                   APQTHSGVDQAQ"
FT   sig_peptide     290798..290881
FT                   /locus_tag="Gdia_0263"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 28"
FT   gene            292336..293076
FT                   /locus_tag="Gdia_0264"
FT   CDS_pept        292336..293076
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0264"
FT                   /product="Silent information regulator protein Sir2"
FT                   /note="PFAM: Silent information regulator protein Sir2;
FT                   KEGG: gdi:GDI2042 putative NAD-dependent deacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50061"
FT                   /db_xref="GOA:B5ZKV1"
FT                   /db_xref="InterPro:IPR003000"
FT                   /db_xref="InterPro:IPR026590"
FT                   /db_xref="InterPro:IPR026591"
FT                   /db_xref="InterPro:IPR027546"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZKV1"
FT                   /protein_id="ACI50061.1"
FT                   /translation="MERPLERPLERPWERIVVLTGAGISRESGLETFRDGDGLWSRYAI
FT                   EDVCTPHAFHRDPLLVDRFYNDRRAELWRVRPNDAHLALARLEHAARAGEWDGEILIVT
FT                   QNIDDLHERAGSRNVVHMHGELLRVRCTACGATPDWQENCLPQTPCPICHRPALRPDVV
FT                   WFGEIPLHMERIQAALDRCDRFVSIGTSGTVYPAAGFVAQVRDHADTLDINLEAPAVPT
FT                   AFERSMVGAATRMVPRWVDEVLAG"
FT   gene            293073..293744
FT                   /locus_tag="Gdia_0265"
FT   CDS_pept        293073..293744
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0265"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gdi:GDI2043 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50062"
FT                   /db_xref="InterPro:IPR005122"
FT                   /db_xref="InterPro:IPR036895"
FT                   /db_xref="UniProtKB/TrEMBL:A9HK21"
FT                   /protein_id="ACI50062.1"
FT                   /translation="MTGNEDDLDALLCQVRACRACADSLPLGPRPILHVSSTARLLIAS
FT                   QAPGTRVHETGISFNDASGDRLRGWLEMDRATFYDSSRVALLPMGLCYPGRLPAGGDRP
FT                   PRPECAPLWRARLLALMPCIRLTLLVGSYAQAAVLGPGRVEDRVRNFRALLPHYFPLPH
FT                   PSWRTGAWERRNPWFTAEVIPALRAAIRPLLDPPSGRDGGPDDGQGQSLDPRREDLHPD
FT                   A"
FT   gene            complement(293664..294395)
FT                   /locus_tag="Gdia_0266"
FT   CDS_pept        complement(293664..294395)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0266"
FT                   /product="multiple antibiotic resistance (MarC)-related
FT                   protein"
FT                   /note="PFAM: multiple antibiotic resistance (MarC)-related
FT                   protein; KEGG: gdi:GDI2044 putative multiple antibiotic
FT                   resistance protein MarC"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50063"
FT                   /db_xref="GOA:A9HK24"
FT                   /db_xref="InterPro:IPR002771"
FT                   /db_xref="UniProtKB/TrEMBL:A9HK24"
FT                   /protein_id="ACI50063.1"
FT                   /translation="MPPGLPAAAPPGWGYDLSVFSDTFLLAFPALFSIVNPIGASLIFT
FT                   QVTAGRARAESLALARTVALYSAVLLIASIWIGSAILAFFGITIDSLRIAGGLVVAVRA
FT                   WALLQAPEEAAARKEQQALQGGRTVAVPRWTEMAFFPMTMPFTVGPGTISVAIALSAGR
FT                   PASSGWLVFYVALSLAAIVVAGTIWLAYAYAERLMALLGVTGARIVSRLAALILLCIGV
FT                   QILSAGIKGLALTIVRAAVAS"
FT   gene            complement(294470..296548)
FT                   /locus_tag="Gdia_0267"
FT   CDS_pept        complement(294470..296548)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0267"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gdi:GDI2045 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50064"
FT                   /db_xref="GOA:B5ZKV4"
FT                   /db_xref="InterPro:IPR022791"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZKV4"
FT                   /protein_id="ACI50064.1"
FT                   /translation="MFLNRQDMQGAPPPSPPPGWRRLLRHVPHVLGLGLMVAAIIVVQH
FT                   EVRDLHWDDIRAALRTIPTSTLALGVGCTVLSYFILSFYDCLAVVQVGRRLPFRRTAFA
FT                   AFCSYVLSHNLGFAAISGAAVRFRLYGNWGLCTFDIAQIIAFCSVTYLLGAGTLVGAVL
FT                   VLEPDAVPVIGAHLPRLLLSGIGLLMWAGVGAYILLGLRLTHVRVCRHTVVLPRPAMAL
FT                   AQTLVATAEVAATAGIAYIFLPSGVGLGYGVFLAIYIASYTAGLVASVPGGLGVFDGAM
FT                   MLALGPYLPPSQIISTILIFRLFYYIIPLFLAGLMFAGHELFLRGDAALTRKTVPRAPR
FT                   RGPRDIRPSHVIRESEADFSVVVATGAVSICGALLIALTILDPASWSNAGGLHHMVGVA
FT                   GDYLLSLIGVALIGLAIGLSQRVTLAWKVTLGLLIGASALTLLRGASLAVPGILAMVAI
FT                   LIAPFRSSYYRHARILSEPLAFRTFLSLVLLIGCVLVLVCSGPRDEVGGSWWEVMLFTS
FT                   AHGVAQWTMGLAVVLGLIMIGRLVRPGQIAVLPWNAEGRALYHALDHALDDPAPMAPSG
FT                   LIPGESGMALLPFLRTDAYLIGLGDPAGAWDDCASAIWWLRDLAVQEGRQPAFWRVGAS
FT                   MLDVYNDLGLTSWPVSDMDMARTDDGDDVFLCCVPQSVAGVRAAMRTLAPPAPADGA"
FT   gene            complement(296588..298210)
FT                   /locus_tag="Gdia_0268"
FT   CDS_pept        complement(296588..298210)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0268"
FT                   /product="lysyl-tRNA synthetase"
FT                   /EC_number="6.1.1.6"
FT                   /note="KEGG: gdi:GDI2046 putative lysyl-tRNA synthetase;
FT                   TIGRFAM: lysyl-tRNA synthetase; PFAM: Lysyl-tRNA synthetase
FT                   class 1c"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50065"
FT                   /db_xref="GOA:A9HK29"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002904"
FT                   /db_xref="InterPro:IPR008925"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020751"
FT                   /db_xref="InterPro:IPR023386"
FT                   /db_xref="UniProtKB/TrEMBL:A9HK29"
FT                   /protein_id="ACI50065.1"
FT                   /translation="MSEQNRTDPVSLPKAWPFEEAAKLAAHVEGKAGPADAPALLETGY
FT                   GPSGLPHIGTFGEVARTSWVCQAYTRLTGRPTRLLAFSDDMDALRKVPDNVPNGDMLRQ
FT                   HLGKPLSRIPDPFGTHESFAAHNNARLRSFLDGFGFTYEFASSTDYYTGGLFDAALRRV
FT                   LEVHDEIVAVIAPTLGPDRRATYSPVLPIHPRTGMVMQVRMDAIDPAAGTVRWTDDDGT
FT                   VFETPVTGGHAKMQWKADWAMRWFALGVDYEMSGKDLIDSVKLSGKICRILGGQPPAGL
FT                   TYELFLDENGQKISKSKGNGISVEEWLRYAPPESLGQYMFNAPQRAKRLFFDVIPKAAD
FT                   EYLANVARAQALPDNDPALLSNPAWFIHGGPIGADAGSPLTFGMLLNLASVANAETPDV
FT                   LWKFIRRYDAAASPETCQLLARLVDHAIVYYADFVRPAKTYRQPDARERAALSDLADSL
FT                   RGLADGPSDPDTLQNLVFEIGKRHGFEPLRTWFGCLYEVLLGQTEGPRFGIFIGLYGVA
FT                   ETVALIEAALLRPSVEAPAGGAG"
FT   gene            298342..301350
FT                   /locus_tag="Gdia_0269"
FT   CDS_pept        298342..301350
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0269"
FT                   /product="helicase c2"
FT                   /note="SMART: helicase c2; KEGG: gdi:GDI2047 putative
FT                   helicase"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50066"
FT                   /db_xref="GOA:B5ZKV6"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR006555"
FT                   /db_xref="InterPro:IPR014013"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZKV6"
FT                   /protein_id="ACI50066.1"
FT                   /translation="MAAPLPSPDMPPALVARHGSCSLLTPDGEVLTLAAEEAVRELRAW
FT                   PAPLVVHAPLTARRLGLPPLPQPTPWLDLLELFTFVLPGRTIPPTVRGLAQALDLDDAR
FT                   IGAAEADLLPELADILLDRAAALRMTPAGEDMAALAIRMDRAGWAWGGSVLAALGAAHP
FT                   LPPEALQPGDAIRVWRRLPRWEDTAPRPAPANHPVSAADARRRLGEMLGPQAESRAGQA
FT                   DFAGAASAAFAPRLVRGDPHMVLAEAGTGTGKTLGYVAPASLWAERNGGAVWISTYTRH
FT                   LQRQIEGELSRLYPDPAVRRRHVVLRKGRENYLCLLNMEEAVNMAGSRGGPSGAIIGLS
FT                   LVARWAGATADGDLLGGDLPGWFGDLFGRGLLAGIADRRGECIHGACPHYQRCFVEHSI
FT                   RRAREADLVIANHALVMAQAAWHAMDGESGADEDNIPTRYVFDEGHHVMDAADSAFSTE
FT                   LSGLEAAELRRWLLGAEGARSRARGLKRRLDDLVVGQPRLEAPLEAVLQAAHALPPPGW
FT                   SARLADALHPVLEPVPQAGEDEAMPALAGPVPAAPVLADATLPNPCEWMLHLLARQVLA
FT                   RSRANEPGHTGHRGGAIECDLHPLSDALPAAAAALARALDRLAVALRTLVERLLERLED
FT                   DTGDLDSATRERIEAAVRTLRRRALSRVEGWVAMLRAIGGPEDGPGGMAERGTPQHIDF
FT                   IRLDRREGQRPGEQDVGLHRHWLDPTIPFAAVLAAPAHGILTTSATLRDENGRGDGDEA
FT                   ERAWEAAEARTGASHLPSPALRAAVASPFDYRRQSRAFIVNDVAHDDIGALAGAYRTLF
FT                   QAAGGGGLGLFTAISRLRAVHQRLSRPLEDAGIPLYAQHVDGMDNATLVDIFRSEANSC
FT                   LLGTDAMRDGVDVPGRSLRLVVFERVPWPRPDILHRERRTHLSRGQPGEYDDRIARLRL
FT                   RQAFGRLIRSSSDRGVFVLLDRRAPSRLLSAFPEGVAVRRAGLGEVARDMESFLRGHEN
FT                   GEDGFPPSPSFTS"
FT   gene            complement(301363..301566)
FT                   /locus_tag="Gdia_0270"
FT   CDS_pept        complement(301363..301566)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0270"
FT                   /product="cold-shock DNA-binding domain protein"
FT                   /note="PFAM: Cold-shock protein DNA-binding; SMART: Cold
FT                   shock protein; KEGG: gdi:GDI2048 putative cold-shock
FT                   DNA-binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50067"
FT                   /db_xref="GOA:A9HK34"
FT                   /db_xref="InterPro:IPR002059"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012156"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019844"
FT                   /db_xref="UniProtKB/TrEMBL:A9HK34"
FT                   /protein_id="ACI50067.1"
FT                   /translation="MATGTVKWFNATKGFGFIMPEDGGKDVFVHITAVQAAGLRGLNEN
FT                   QRVSYDVVTERGKAAASNLKPL"
FT   gene            complement(301840..303483)
FT                   /locus_tag="Gdia_0271"
FT   CDS_pept        complement(301840..303483)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0271"
FT                   /product="chaperonin GroEL"
FT                   /note="TIGRFAM: chaperonin GroEL; PFAM: chaperonin
FT                   Cpn60/TCP-1; KEGG: gdi:GDI2049 60 kDa chaperonin"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50068"
FT                   /db_xref="GOA:A9HK37"
FT                   /db_xref="InterPro:IPR001844"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR018370"
FT                   /db_xref="InterPro:IPR027409"
FT                   /db_xref="InterPro:IPR027410"
FT                   /db_xref="InterPro:IPR027413"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9HK37"
FT                   /protein_id="ACI50068.1"
FT                   /translation="MAAKDVKFGGDARQRMLRGVDILADAVKVTLGPKGRNVVLDKSFG
FT                   APRITKDGVSVAKEIELADKFENMGAQMVREVASKTNDVAGDGTTTATVLAQAIVREGA
FT                   KAVAAGMNPMDLKRGIDKAVIAVVEELKKNTKKITTPAETAQVGTISANGEHEIGEMIS
FT                   QAMQKVGSEGVITVEEAKGLHTELDVVEGMQFDRGYISPYFITNAEKMVADLDNPYILI
FT                   HEKKLSSLQPMLPLLESVVQSGRPLLIIAEDVDGEALATLVVNKLRGGLKIAAVKAPGF
FT                   GDRRKAMLEDIAILTGGQVISEDLGIKLETVTLAMLGRAKKVRIEKENTTIVEGAGASD
FT                   DIKGRCGQIRAQIEETTSDYDREKLQERLAKLAGGVAVIRVGGSTEVEVKERKDRVDDA
FT                   LHATRAAVEEGIVPGGGTALARASTALGNLHFHNDDQRVGAEIIRKALQAPLRQIAHNA
FT                   GEDGAVIAGKVLESNDYNYGFDAQIGDYKDLVAAGIIDPTKVVRTALQDASSVAGLLIT
FT                   TEAMVAEKPEKKAPAMPAGGGMGGMGDMDF"
FT   gene            complement(303538..303828)
FT                   /locus_tag="Gdia_0272"
FT   CDS_pept        complement(303538..303828)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0272"
FT                   /product="chaperonin Cpn10"
FT                   /note="PFAM: chaperonin Cpn10; KEGG: gdi:GDI2050 10 kDa
FT                   chaperonin"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50069"
FT                   /db_xref="GOA:A9HK46"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR018369"
FT                   /db_xref="InterPro:IPR020818"
FT                   /db_xref="InterPro:IPR037124"
FT                   /db_xref="UniProtKB/TrEMBL:A9HK46"
FT                   /protein_id="ACI50069.1"
FT                   /translation="MTNFRPLHDRVVVRRLTGEEKTAGGIIIPDTAKEKPMEGEVISAG
FT                   PGARNEQGQIVALDVKAGDKVLFGKWSGTEVKINGEELLIMKESDIMGVIA"
FT   gene            304097..304357
FT                   /locus_tag="Gdia_0273"
FT   CDS_pept        304097..304357
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0273"
FT                   /product="Usg family protein"
FT                   /note="PFAM: Usg family protein; KEGG: gdi:GDI2052 putative
FT                   Usg-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50070"
FT                   /db_xref="InterPro:IPR009354"
FT                   /db_xref="UniProtKB/TrEMBL:A9HK50"
FT                   /protein_id="ACI50070.1"
FT                   /translation="MTLRLQLHDYRLTTAEILYRLPDHPVLLQTYIWQDLDIAPAYPEL
FT                   RRFLDFWTRSIEGRLHSVRVAQQGLIAAPAIRHAGTCLTLH"
FT   gene            complement(304362..304562)
FT                   /locus_tag="Gdia_0274"
FT   CDS_pept        complement(304362..304562)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0274"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gdi:GDI2053 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50071"
FT                   /db_xref="InterPro:IPR025227"
FT                   /db_xref="UniProtKB/TrEMBL:A9HK51"
FT                   /protein_id="ACI50071.1"
FT                   /translation="MAEIVNLRQARKRKARADKARDAAENRALHGRTLSERARRKQEAE
FT                   RAARTLDGARLDPDPGEPGRD"
FT   gene            304606..305268
FT                   /locus_tag="Gdia_0275"
FT   CDS_pept        304606..305268
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0275"
FT                   /product="Carboxymethylenebutenolidase"
FT                   /EC_number="3.1.1.45"
FT                   /note="PFAM: dienelactone hydrolase; KEGG: gdi:GDI2054
FT                   dienelactone hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50072"
FT                   /db_xref="GOA:A9HK54"
FT                   /db_xref="InterPro:IPR002925"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A9HK54"
FT                   /protein_id="ACI50072.1"
FT                   /translation="MGTITSLTASDGHTLSAYLAGPADASRALVVVQEIFGVNTHIRAV
FT                   CDGFAADGYRVIAPALFDRAERDVELAYDSDGVQTGLRLRAAIAPEETLLDLTAAARAL
FT                   GLARIGIIGYCWGGTLAWLAACRTDLFAAAVGWYGAGIAAQKDLTPHCPVELHFGETDG
FT                   SIPMSDIAAIRAAHPEVTIFTYPDAGHGFGCSERDSFNAQAASLARTRSLAFFEKNL"
FT   gene            complement(305275..306192)
FT                   /locus_tag="Gdia_0276"
FT   CDS_pept        complement(305275..306192)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0276"
FT                   /product="methylthioadenosine phosphorylase"
FT                   /note="TIGRFAM: methylthioadenosine phosphorylase; PFAM:
FT                   purine phosphorylase family 2; KEGG: gdi:GDI2055
FT                   5'-methylthioadenosine phosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50073"
FT                   /db_xref="GOA:B5ZKW3"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR010044"
FT                   /db_xref="InterPro:IPR018099"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZKW3"
FT                   /protein_id="ACI50073.1"
FT                   /translation="MSINPAPSPSDADVIEPVIGLIGGSGLYDIDGLEEKEWRTVETPW
FT                   GLPSDQLLFGRLDGVRCVFLPRHGRGHPIPPSRLNYRANIAALKQSGVTDIVSLSAVGS
FT                   LKEELPPGHFVIIDQFIDRSFAREKSFFDTGCVAHVSMADPLCPRIGDALEETARGLGL
FT                   DVTRGGTYLVMEGPQFSTRAESNLYRSWGCSVVGMTNMPEAKLAREAEICYATVAMVTD
FT                   YDCWHPDHDSVTVDAVVKVMLSNADRARALVKSVIPALGSPRGPCRAGCDRALEHALIT
FT                   APDRRDPALLAKLQSVAGRVLARG"
FT   gene            complement(306182..306943)
FT                   /locus_tag="Gdia_0277"
FT   CDS_pept        complement(306182..306943)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0277"
FT                   /product="cytochrome c1"
FT                   /note="PFAM: cytochrome c1; KEGG: gdi:GDI2056 putative
FT                   cytochrome c"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50074"
FT                   /db_xref="GOA:A9HK59"
FT                   /db_xref="InterPro:IPR002326"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:A9HK59"
FT                   /protein_id="ACI50074.1"
FT                   /translation="MKKILVAPLAAALCLAAPAVHAAPHAPAPHQDWSFDGPLGRFDMA
FT                   AVQRGYAVYAQVCSACHSMNAVTYGDLGAMGLTDEQVRQIAAAQSVPGGVDAQGEPVTR
FT                   PATAADHFRNPFPSPEAAAAANNGTPPPDQSRLALVYTGGPDRIYALLTGYRTPPAGYR
FT                   PSHPGAFYNPYAADGEISMPPPLHDGLVDYADGTPATTAQEARDVTTFLAWVAQPHLAE
FT                   RHRLGIQVTLYLLFLAVLAFLLKRRIWSDVH"
FT   sig_peptide     complement(306875..306943)
FT                   /locus_tag="Gdia_0277"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 23"
FT   gene            complement(306940..308193)
FT                   /locus_tag="Gdia_0278"
FT   CDS_pept        complement(306940..308193)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0278"
FT                   /product="Cytochrome b/b6 domain"
FT                   /note="PFAM: Cytochrome b/b6 domain; KEGG: gdi:GDI2057
FT                   putative cytochrome b"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50075"
FT                   /db_xref="GOA:A9HK62"
FT                   /db_xref="InterPro:IPR005797"
FT                   /db_xref="InterPro:IPR005798"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="InterPro:IPR027387"
FT                   /db_xref="InterPro:IPR030689"
FT                   /db_xref="InterPro:IPR036150"
FT                   /db_xref="UniProtKB/TrEMBL:A9HK62"
FT                   /protein_id="ACI50075.1"
FT                   /translation="MTDSGSGDATDQRGGTGVLAWVDARLPVVTGFRHEYIDYRTPRNL
FT                   NGLWNFGAILTVVLLVMLATGIFLAVNYTPTAAGAFASVEAIERQLPSGWLLRSIHVTG
FT                   ASLFLAALYIHLFRGLYYGSYKRPREILWLTGLLLLVMVMFTAFAGYVLPWGQMSYWGA
FT                   DVAGKAVDAIPFVGPWLEHFLQGGDAPGDVSLHRFFVLHFVLAFAVLGVVVLHVAALHV
FT                   TGSNNPLGIEPKGPRDTLTFHPYYTSKDALGMILFALLFAALVFFLPHVVFEAENFRPA
FT                   NPLHTPADIEPEWYFLPFYGMLQSVPSKFGGLLAAVGSILILFLVPWLDRSPIRSARFR
FT                   PFYRVCMVLLVLCFILLGFVGRHHAEGGWMIAGRIALVYYFAHFLVLLPLSARTERHVV
FT                   LPESIAAAQGHHATGHDA"
FT   gene            308333..309235
FT                   /locus_tag="Gdia_0279"
FT   CDS_pept        308333..309235
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0279"
FT                   /product="Coproporphyrinogen oxidase"
FT                   /EC_number="1.3.3.3"
FT                   /note="PFAM: coproporphyrinogen III oxidase; KEGG:
FT                   gdi:GDI2058 putative coproporphyrinogen 3 oxidase, aerobic"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50076"
FT                   /db_xref="GOA:A9HK65"
FT                   /db_xref="InterPro:IPR001260"
FT                   /db_xref="InterPro:IPR018375"
FT                   /db_xref="InterPro:IPR036406"
FT                   /db_xref="UniProtKB/TrEMBL:A9HK65"
FT                   /protein_id="ACI50076.1"
FT                   /translation="MPETRAPVPHDLLKAEASTWFEGLRDRICAAFERIEQDADSVQAL
FT                   PGHAAPGAFQRTAWDRTNDDGTPGGGGVISLMRGRVFEKVGVNVSTVEGTFSPEFRASI
FT                   PGAAEDPRFFATGISLVAHMCNPLVPAAHFNTRLIVTTQGWFGGGGDITPMFPDSAEAQ
FT                   ADAARFHAGFRAACDRHDPTYYPRFKEWCDRYFFLPHRGEARGLGGIFYDRLNSGDEAA
FT                   DFAFTRDVGLAFLETYPAIVRHRMGERWTAHQREAQLVRRGRYVEFNLLHDRGTLFGLK
FT                   TGGNTEAILMSLPPEVRWP"
FT   gene            309396..310490
FT                   /locus_tag="Gdia_0280"
FT   CDS_pept        309396..310490
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0280"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gdi:GDI2059 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50077"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="UniProtKB/TrEMBL:A9HK68"
FT                   /protein_id="ACI50077.1"
FT                   /translation="MTMRRRHFLATAGLALLAGLPPARAARGLTRIADIVPAGGTIADP
FT                   TLLVAGNADSVAGKWGTVLSPALAQGLDAPRPVSMHLTSGQDGVTGANLFDTQTVPDGT
FT                   TALLVPGAALVASLAGDPRAHFDFGRWVPLMLSLVSPVVVGRAELHRTFRDLMRDRPVR
FT                   IAVSADTGVELATVLAMALFGLRPIPVAGFASRQDALAALRDGKVDVVQVSDPMSPQAL
FT                   AAMFDTLGQSGAAPLFTLSDTVRMTAQGHTVPTLAERFAQERGHPPDGLLYEAWKVVAA
FT                   AASLDVALVLPMLTPPAQVAGWRHAMATADAHGAVDTLMNGNGRKLVTGTDCAPHLRDM
FT                   TGETSAVLTLRRWLASHAPNWRLG"
FT   sig_peptide     309396..309473
FT                   /locus_tag="Gdia_0280"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.868 at
FT                   residue 26"
FT   gene            complement(310496..311281)
FT                   /locus_tag="Gdia_0281"
FT   CDS_pept        complement(310496..311281)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0281"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: gdi:GDI2060 putative iron ABC transporter ATP-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50078"
FT                   /db_xref="GOA:A9HK70"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A9HK70"
FT                   /protein_id="ACI50078.1"
FT                   /translation="MSGLTAAHVTVRYGRRTVLDDLSVGPLPAGQVSALLGPNGSGKST
FT                   LLRALAGLERTGATVRCGEAELSRMRPALRARHCVYLPQALPPAVHLQVLESVIAARRA
FT                   AAPAGDWEDDEVSEALDVLARLGVDDLALRYMDELSGGQRQLVGLAQALVRRPAVLLLD
FT                   EPLSALDLHHQFSVMQVVRRETRARNMVTVVVLHDLNIALQQADYVVMLRQGVIVGAGT
FT                   PRHVITTQTLQQVYGVRARVESCSLGRPHVVVDGVEAGP"
FT   gene            complement(311278..312393)
FT                   /locus_tag="Gdia_0282"
FT   CDS_pept        complement(311278..312393)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0282"
FT                   /product="transport system permease protein"
FT                   /note="PFAM: transport system permease protein; KEGG:
FT                   gdi:GDI2061 putative vitamin B12 import system permease
FT                   protein BtuC"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50079"
FT                   /db_xref="GOA:A9HK73"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:A9HK73"
FT                   /protein_id="ACI50079.1"
FT                   /translation="MTDTTLTRPRAVRSGPVDPALLTAERVRHVRDSYRHLLRRRSLIL
FT                   AVLTVLILMSMLLDFALGPSGLSPATLLRVLLHPHDVPAGQSVIVWQIRLPYALMAVCV
FT                   GAALGLSGAEMQTILNNPLASPFTLGVSAAAAFGASLAIVLQWQIPGVPAEWVVSADAF
FT                   AFAIGSAFLLDLVSCLRDASTSTVVLFGIALVFTFHALVSLVQFVASEDALQDLVFWTM
FT                   GSLTRSNWSKVGILASVCAVILPLSFRSAWSLTALRMGEERAASFGVDVRRVRIGSLLR
FT                   ISILSSLAVSFVGTIGFVGLVAPHIARGLLGEDHRFYLPGSVLVGCLIMSLSSVAARNV
FT                   LPGVIVPVGIVTALVGIPFFLAIVLRRRVAS"
FT   gene            complement(312390..313541)
FT                   /locus_tag="Gdia_0283"
FT   CDS_pept        complement(312390..313541)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0283"
FT                   /product="periplasmic binding protein"
FT                   /note="PFAM: periplasmic binding protein; KEGG: gdi:GDI2062
FT                   periplasmic binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50080"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:A9HK76"
FT                   /protein_id="ACI50080.1"
FT                   /translation="MKAKSPRKHGHCRLWRTVAGLAAAVAMMAAGGTRAATITDLAGRS
FT                   VDIPAHVHRIILGEGRLIYALAPLEKSHLFDRIVGWQGEFRDADVQSYDKYVATFPAAA
FT                   KVALIGKTTADTISPEKVLDLRPDLAILSVSGHGPAASSELVAQLQSAHVPVVFVDFRA
FT                   HPLDDTVPSMRILGAVLDRRAEAEAYIAFYQAHLDRIRTRVATLPQSARPTVFLEMLAG
FT                   TRDSCCHTAGNGNMGAFIDAAGGRNIAAPLLPGYIGDIALEQVIAANPDIYIVDGTKGP
FT                   AYQGLGVHMGAETDPASARASVQAVLQRPGISTLSAVKDGHAYGLWHSFYDSPYNILAV
FT                   EVMAKWFHPDLFRDVDPEATRTELYARFLPVPNSGTYWVSDTP"
FT   sig_peptide     complement(313434..313541)
FT                   /locus_tag="Gdia_0283"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.991 at
FT                   residue 36"
FT   gene            complement(313695..314285)
FT                   /locus_tag="Gdia_0284"
FT   CDS_pept        complement(313695..314285)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0284"
FT                   /product="Smr protein/MutS2"
FT                   /note="PFAM: Smr protein/MutS2; KEGG: gdi:GDI2063 putative
FT                   small MutS related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50081"
FT                   /db_xref="InterPro:IPR002625"
FT                   /db_xref="InterPro:IPR036063"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZKX1"
FT                   /protein_id="ACI50081.1"
FT                   /translation="MRRRRTLREDEQALWTAFVRDIKPLARKAAAGNPAGAPEPAPVPD
FT                   VVPSPVRGRRAAPLAAGSPQPAPLQPRVPAYTLHRSQASVEIGERRPGLDDTSWRALVS
FT                   GKLRPTRTLDLHGQNVQAAFQRLHAFLVQARADNLRCVEVITGLGSGRQGGVLRRELPF
FT                   WLGRPDLRPLILAVTHPHAANQGSVRILLRRRG"
FT   gene            complement(314367..315788)
FT                   /locus_tag="Gdia_0285"
FT   CDS_pept        complement(314367..315788)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0285"
FT                   /product="Cytochrome-c peroxidase"
FT                   /EC_number="1.11.1.5"
FT                   /note="PFAM: Di-haem cytochrome c peroxidase; KEGG:
FT                   gdi:GDI2064 putative cytochrome c551 peroxidase precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50082"
FT                   /db_xref="GOA:B5ZKX2"
FT                   /db_xref="InterPro:IPR004852"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR011031"
FT                   /db_xref="InterPro:IPR025992"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZKX2"
FT                   /protein_id="ACI50082.1"
FT                   /translation="MSVRKLVLSVAALGCVAYGGTVGYLTHFDHDTAPTLGTNSPTLAD
FT                   PVASAAFAAIRESRCDYCHARNTDLPFYFHVPVANQLMQRDVDQGLRHFRIEPVLAAFQ
FT                   SGAVPSEEQLARIEEVVRQNRMPPTLYLLLHWHAHLSQAQRDALLTWIAAERRAHYATP
FT                   GVAPRFAAEPVQPVPETLPVDAAKVALGQRLFFDKQLSGDGTLNCASCHALDHGGVDGR
FT                   VTALGIDNRHGPINVPTVYDAAFNQSQFWNGRAATLADQAAGPVMNPLEMGSHDWTGVA
FT                   DKLKQDPTYLTAFQGVFGSDEITRDRITDAIAEYEKTLITPDSRFDRYLKGDDQALNAQ
FT                   EKNGYALFKSVGCSGCHTGVSLGGQAFEAMGLEGDYFAARGGTLTDADKGRYMVTHSDA
FT                   DMERFKVPNLRNIALTAPYFHDGSVKTLDQAVREMARYQTPDHDLSDHDVADIVAFLQT
FT                   LTGTYQGHQLAETTH"
FT   sig_peptide     complement(315729..315788)
FT                   /locus_tag="Gdia_0285"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.978) with cleavage site probability 0.820 at
FT                   residue 20"
FT   gene            complement(315903..316718)
FT                   /locus_tag="Gdia_0286"
FT   CDS_pept        complement(315903..316718)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0286"
FT                   /product="DNA methylase N-4/N-6 domain protein"
FT                   /note="PFAM: DNA methylase N-4/N-6 domain protein; KEGG:
FT                   gdi:GDI2065 putative modification methylase MjaV"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50083"
FT                   /db_xref="GOA:A9HK84"
FT                   /db_xref="InterPro:IPR001091"
FT                   /db_xref="InterPro:IPR002941"
FT                   /db_xref="InterPro:IPR017985"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A9HK84"
FT                   /protein_id="ACI50083.1"
FT                   /translation="MTAARAPRTLRYAIGPHQLVRGDCLRVLRRMDADSVDVVVTSPPY
FT                   NIGLGYRTYSDRMSETQYLDWMMAVARELHRVMRPDGSFFLNIAGSSAQPWIPFELAVR
FT                   LREIFHLQNHISWIKSVSVNEDTFGHFKPVNSARYLHRNHEHLFHLTRSGTVELNRLDI
FT                   GVPYKDKSNIARRGHEQDRRCRGDTWFIPYETVQGKAQKFNHPGTFPVQLPRMCIRLHG
FT                   RPGAVVLDPFMGTGTTLVAAQEEGARAIGIDLDTAYVTVARDRLTQAMK"
FT   gene            complement(316715..317932)
FT                   /locus_tag="Gdia_0287"
FT   CDS_pept        complement(316715..317932)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0287"
FT                   /product="MltA domain protein"
FT                   /note="PFAM: MltA domain protein; 3D domain protein; KEGG:
FT                   gdi:GDI2066 putative membrane-bound lytic murein
FT                   transglycosylase A precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50084"
FT                   /db_xref="GOA:A9HK87"
FT                   /db_xref="InterPro:IPR005300"
FT                   /db_xref="InterPro:IPR010611"
FT                   /db_xref="InterPro:IPR026044"
FT                   /db_xref="InterPro:IPR034654"
FT                   /db_xref="InterPro:IPR036908"
FT                   /db_xref="UniProtKB/TrEMBL:A9HK87"
FT                   /protein_id="ACI50084.1"
FT                   /translation="MSHSFVTKILRGASAGAILLLSACAATDLEGTGQPLAFSDIKGWG
FT                   SDEAVRALPVFLGECRYLGRLPADAGLGADSGRGTHVGDWLPACRAAAALPTGDAPAAR
FT                   QFFETWFQPVLTAGQALFTGYYEPEIRGSLSRGGVYQTPVYGVPDDLVRTRATDGRMVT
FT                   GRWQGSQFMPYWTRAQIDAGALAGRNLELLWVADPADLFFLQIQGSGRVRLPSGQVVRL
FT                   GFGAKNGQEYVPLGRVLVRQGEMDADAVSMQSIRAWLTAHPDQARTVMEDNPNYVFFTV
FT                   LDHVYADQGAPGALGVPLTPGRSVAVDRRSIPLASPVWVETTLPGPAGSSWQRLVFAQD
FT                   TGTDIQGPARADLFMGWGPDAEQTAGAMQQRGRTITFVPRPVVVMEPASMGAAPTAKIV
FT                   GIAGEP"
FT   sig_peptide     complement(317855..317932)
FT                   /locus_tag="Gdia_0287"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.717 at
FT                   residue 26"
FT   gene            complement(317994..318674)
FT                   /locus_tag="Gdia_0288"
FT   CDS_pept        complement(317994..318674)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0288"
FT                   /product="import inner membrane translocase subunit Tim44"
FT                   /note="PFAM: import inner membrane translocase subunit
FT                   Tim44; KEGG: gdi:GDI2067 putative transporter protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50085"
FT                   /db_xref="InterPro:IPR007379"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZKX5"
FT                   /protein_id="ACI50085.1"
FT                   /translation="MDFSFSHFPFDLVLFGLVAAFLALRLRSILGTRVGVEPAPPPSAV
FT                   PRPGPVIEGRAEPPATLTDYDVPAPETRVGQVLAAIAQQERDFVPAQFLKGVEAAFRQI
FT                   VLAFAAGDVAMLRERLTANAFSAFEAAIRSREQSGEIQKAEVRAIASLAIVDAAIEERD
FT                   GATHARIDVRIVSDQISLTSDKDGHPVAGTDAVTEFSDLWTFERPLGVAISGAAWRLAA
FT                   SRSA"
FT   gene            318936..319451
FT                   /locus_tag="Gdia_0289"
FT   CDS_pept        318936..319451
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0289"
FT                   /product="protein export chaperone SecB"
FT                   /note="PFAM: protein export chaperone SecB; KEGG:
FT                   gdi:GDI2068 protein-export protein SecB"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50086"
FT                   /db_xref="GOA:A9HK92"
FT                   /db_xref="InterPro:IPR003708"
FT                   /db_xref="InterPro:IPR035958"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9HK92"
FT                   /protein_id="ACI50086.1"
FT                   /translation="MSDTTQPPADDAQNVPPAMPLTINVQYIKDLSFEVPAGAEIFATL
FT                   RANPQIAVNIDVQANRLQAEHPVFEVVLAIKTEALEAPEKEGAAPGRPVFIAELAYGAV
FT                   VTLTNAPDELVEPILLVEVPRLIFPYVRNIISEVTRDGGFPPVVLQPIDFVALWQAKRS
FT                   FPQTAGNA"
FT   gene            complement(319529..320266)
FT                   /locus_tag="Gdia_0290"
FT   CDS_pept        complement(319529..320266)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0290"
FT                   /product="Uroporphyrinogen III synthase HEM4"
FT                   /note="PFAM: Uroporphyrinogen III synthase HEM4; KEGG:
FT                   gdi:GDI2069 putative uroporphyrinogen III synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50087"
FT                   /db_xref="GOA:B5ZLF8"
FT                   /db_xref="InterPro:IPR003754"
FT                   /db_xref="InterPro:IPR036108"
FT                   /db_xref="InterPro:IPR039793"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZLF8"
FT                   /protein_id="ACI50087.1"
FT                   /translation="MPPDAPPRTGVLVTRPEPGLADTMAAVERLGWQAHAMPALRIEPI
FT                   MDAVLPLARTQAVLLTSGQAIAALAGRVRPDMPILAVGAVTARRMRDAGFTDVTVAAGT
FT                   AADLADLARDRLDPGAGSLLVPTAPTYGQDLAVALRRAGFRVSRRCVYRVRPAGAPDAA
FT                   VRTALAGGVIDAALFYSAETARQFLRHLPAGGHAALRNIRAIAISKSTEAALSTATWRA
FT                   IQVAARPDQAAILDRLGRRPAGE"
FT   gene            complement(320256..321359)
FT                   /locus_tag="Gdia_0291"
FT   CDS_pept        complement(320256..321359)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0291"
FT                   /product="porphobilinogen deaminase"
FT                   /EC_number="2.5.1.61"
FT                   /note="KEGG: gdi:GDI2070 porphobilinogen deaminase;
FT                   TIGRFAM: porphobilinogen deaminase; PFAM: Porphobilinogen
FT                   deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50088"
FT                   /db_xref="GOA:A9HK97"
FT                   /db_xref="InterPro:IPR000860"
FT                   /db_xref="InterPro:IPR022417"
FT                   /db_xref="InterPro:IPR022418"
FT                   /db_xref="InterPro:IPR022419"
FT                   /db_xref="InterPro:IPR036803"
FT                   /db_xref="UniProtKB/TrEMBL:A9HK97"
FT                   /protein_id="ACI50088.1"
FT                   /translation="MVSAPPSVPGPSAAPSSALQKIAAQAAARQKQAATRAALPHRREL
FT                   PLRVGTRASPLALVQTRAFLTMLTRFCPVLRDMGAFQEHQINTTGDQVQNRRLAEIGGK
FT                   GLFAKEIHDALSDGRIDFAVHSLKDLETTLPPGLVLACTLRREDARDALILGPGAGGRH
FT                   DAADAADPYAALPRNALVGCASVRRQAQMLHVRPDLRFGLLRGNVQTRLDKLAARQCDA
FT                   TLLALAGLRRLGMEDRADIVLDPEIMVPAAGQGIVGVTVRESDVELRELLAAIEDYEAR
FT                   AVATAERALLAELDGSCRTPIGGYARLVPGLAGAEASLRLTGLVAREDGSFLLRRTVTG
FT                   LRADAEEMGRELGRSLRMDSPSDVFAA"
FT   gene            321431..322579
FT                   /locus_tag="Gdia_0292"
FT   CDS_pept        321431..322579
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0292"
FT                   /product="metalloendopeptidase, glycoprotease family"
FT                   /EC_number="3.4.24.57"
FT                   /note="KEGG: gdi:GDI2071 putative O-sialoglycoprotein
FT                   endopeptidase; TIGRFAM: metalloendopeptidase, glycoprotease
FT                   family; PFAM: peptidase M22 glycoprotease"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50089"
FT                   /db_xref="GOA:B5ZLG0"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR017860"
FT                   /db_xref="InterPro:IPR017861"
FT                   /db_xref="InterPro:IPR022450"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZLG0"
FT                   /protein_id="ACI50089.1"
FT                   /translation="MIMSVSPATPPDSAETAAQAPVPAPDMAPILAIESSCDDTACAIL
FT                   APDGTILAETVLSQAGHVPFGGVVPEIAARAHLAALPALVRHTLDVAALPAEALGAIAA
FT                   STGPGLIGGLIVGAGMAKGLAVALGRPFVAVNHIEAHALTARLPGLVPGGASFPYLLLL
FT                   VSGGHCQCIAVEGVGRYRKLGGTIDDAAGEAFDKVAKMLGLGWPGGPAVEALAREGDPA
FT                   PWPLPRPLRGRPGCDFSFSGLKTAVAQKLAPFAAGALPRTAAAGIAASFQDAVADIVAD
FT                   RVAHALDMMPQATLLVAAGGVAANTALRTRLTTLATSRALPFAAPPLRLCTDNAVMVGW
FT                   AAIETLRERRRLGLPPTDDLDLLPRPRWPLEQMAERFAHPAP"
FT   gene            322576..323403
FT                   /locus_tag="Gdia_0293"
FT   CDS_pept        322576..323403
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0293"
FT                   /product="protein of unknown function DUF519"
FT                   /note="PFAM: protein of unknown function DUF519; KEGG:
FT                   gdi:GDI2072 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50090"
FT                   /db_xref="GOA:A9HKA3"
FT                   /db_xref="InterPro:IPR007473"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A9HKA3"
FT                   /protein_id="ACI50090.1"
FT                   /translation="MNYRHAFHAGNFADCMKHALLVLLLQALARKPAPFAVLDTHAGIG
FT                   RYDLTGEQAGRTGEWRNGIGRLLETAPDGVPSLYLDLVRRAGAPDIYPGSPLIAAMMLR
FT                   PQDRLICCELHPEDSRLLRAVFAGQPQIAVHARDGYAALRALLPPRDAKRGLVLIDPPF
FT                   EQPDEFHRLAGGIVTAHRRFATGIIAAWYPIKHRAPVRAFLDSLRESGMRDIVALELTL
FT                   RPPLDPSRLNGSGLVVVNPPFGFLDQALPALRALAHLSPDGTGEAAVTRIVEE"
FT   gene            323437..324399
FT                   /locus_tag="Gdia_0294"
FT   CDS_pept        323437..324399
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0294"
FT                   /product="Glycerol-3-phosphate dehydrogenase (NAD(P)(+))"
FT                   /EC_number="1.1.1.94"
FT                   /note="PFAM: NAD-dependent glycerol-3-phosphate
FT                   dehydrogenase domain protein; KEGG: gdi:GDI2073 putative
FT                   glycerol-3-phosphate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50091"
FT                   /db_xref="GOA:A9HKA6"
FT                   /db_xref="InterPro:IPR006109"
FT                   /db_xref="InterPro:IPR006168"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR011128"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A9HKA6"
FT                   /protein_id="ACI50091.1"
FT                   /translation="MNAPRIAVIGAGAWGIALAVQAARAGAQVHLWARKPDSLSDTRTL
FT                   PRLPHVTLPESITVTGDMPARADAVLLAVPMQHLRAVLGHVPPAGPMIACCKGVERDSL
FT                   ALPLEVIASRHPNLPRAVLSGPNFAHEVAQGLPTAAVLACEDPVEARDLADHLTTPEFR
FT                   LYASDDAIGVQIGGAAKNVIAIAAGATIGAGLGENARASLMTRGLAELGRLSRGLGGRA
FT                   ETLSGLAGVGDLILTCTGPSSRNFSLGLALGRGEALSAILGQRTTVAEGVTTAPAILAL
FT                   ARKHDISVPVIETVSLLLAEDIDLAEARDRLLSRPVGTE"
FT   sig_peptide     323437..323505
FT                   /locus_tag="Gdia_0294"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.994) with cleavage site probability 0.508 at
FT                   residue 23"
FT   gene            complement(324442..324891)
FT                   /locus_tag="Gdia_0295"
FT   CDS_pept        complement(324442..324891)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0295"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gdi:GDI2074 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50092"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZLG3"
FT                   /protein_id="ACI50092.1"
FT                   /translation="MTFTRTALLATLMMSGLMSGLHDAEAWDRNNSSGTSQGRARNTMH
FT                   SGGCTGTACGNGGTTTGSNGYGYNPYQQGGGVYVTPGDIWPYGVPNGQQQSSGPVSTTC
FT                   VDNQCNRLATGRGQRGGARDPDAGGTSATCMDGVCNGTPGSGTGN"
FT   sig_peptide     complement(324811..324891)
FT                   /locus_tag="Gdia_0295"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.989) with cleavage site probability 0.723 at
FT                   residue 27"
FT   gene            complement(324933..326174)
FT                   /locus_tag="Gdia_0296"
FT   CDS_pept        complement(324933..326174)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0296"
FT                   /product="Na+ dependent nucleoside transporter domain
FT                   protein"
FT                   /note="PFAM: Na+ dependent nucleoside transporter;
FT                   nucleoside recognition domain protein; Na+ dependent
FT                   nucleoside transporter domain protein; KEGG: gdi:GDI2075
FT                   putative inner membrane transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50093"
FT                   /db_xref="GOA:A9HKB1"
FT                   /db_xref="InterPro:IPR002668"
FT                   /db_xref="InterPro:IPR008276"
FT                   /db_xref="InterPro:IPR011657"
FT                   /db_xref="UniProtKB/TrEMBL:A9HKB1"
FT                   /protein_id="ACI50093.1"
FT                   /translation="MPVLHGILGLAGLIGLAVAFSTDRRAIRPRIVLAAGLMQVALGGM
FT                   VLFVPPGRHALHALSGAVDTVLGYGAQGSLFLFGALVDPRMNTLFPHTGFIFAFRVLPQ
FT                   IVYVSALIAILYHYRVMQRLAALLGGAVRRALGTSTIESFSAVTTIFLGQSEMPVALRP
FT                   YVPLLTRAELFAVMSSGTASVAGSVLAGYAGLGVPMDYLLAASVMAIPGGLLFAKILMP
FT                   AREATRITRLDLEFGHEHPATVFEAVAIGAASGVGVAVAVGSMLIAFIGLIALANGMIH
FT                   GLGGWLGIADLSLERLFGVVFAPLAWLIGVPWHECGVVGAIMGQKLVFNEFVAYVALAP
FT                   HFHDAALDPRALAIASFALCGFANLSSIGILIAGFGSVAPERRADVAKMGLRAVMAGSL
FT                   SNFASATIAGMFVG"
FT   sig_peptide     complement(326115..326174)
FT                   /locus_tag="Gdia_0296"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.753) with cleavage site probability 0.511 at
FT                   residue 20"
FT   gene            326321..326806
FT                   /locus_tag="Gdia_0297"
FT   CDS_pept        326321..326806
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0297"
FT                   /product="glutathione peroxidase"
FT                   /note="PFAM: glutathione peroxidase; KEGG: gdi:GDI2077
FT                   putative glutathione peroxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50094"
FT                   /db_xref="GOA:A9HKB6"
FT                   /db_xref="InterPro:IPR000889"
FT                   /db_xref="InterPro:IPR029759"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A9HKB6"
FT                   /protein_id="ACI50094.1"
FT                   /translation="MTTAYDFTLPSLDGGTIDLGALRGKPILIVNTASKCGFTPQFEGL
FT                   QALWSFYRGNGLTIIGVPSNDFGNQEPGTSTEIATFCARNYSVTFPMAARSHVRGADTL
FT                   PLFRWIAQQGGLMARPRWNFYKYLIGRDGRLANWFVSLTSPESHRMRVAIERAILDT"
FT   gene            326902..328470
FT                   /locus_tag="Gdia_0298"
FT   CDS_pept        326902..328470
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0298"
FT                   /product="integral membrane protein MviN"
FT                   /note="TIGRFAM: integral membrane protein MviN; PFAM:
FT                   virulence factor MVIN family protein; KEGG: gdi:GDI2078
FT                   putative virulence factor MviN"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50095"
FT                   /db_xref="GOA:B5ZLG6"
FT                   /db_xref="InterPro:IPR004268"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZLG6"
FT                   /protein_id="ACI50095.1"
FT                   /translation="MLRGFLTVGGWTMLSRVLGLVRDQLLAAFLGAGPVQDAYQVAFRL
FT                   PNMFRQLFGEGALNTAFVPLFSGMLATEGPDRARRFASETFSVLLTWLTMIAVLGEVFM
FT                   PQVVRVIAAGFPLDGDRYHMAVTLSRITFPYLVLICAAALVSGVLNGLHRFGVAAAAYV
FT                   SFNVVGIASIFLLTPLTGDVARAAAWGVTASGVAQLGLLLLAVRRAGFRLMLLPPRLTA
FT                   RIHTLIRRMAIGCLGSGVSQINLLVDTIIASYLPPGSVSFIYFADRINQLPLGVLGAAA
FT                   GTTLLPVLSRHVAAEDHDGAHGAQNRAIDYAMILTLPAALGMMVLAQPIIATLFQHGAF
FT                   TPRDAMLSAQSLRAFAIGLPAFVLIKVLAPGFFARGDTATPVRVGLFTLTLNFVLNLLL
FT                   MHPLHHAGPPLASSLAAIVNVATLGFLLRRRGILRISTTTLSRVGRMALAALGMAAVLM
FT                   MLDLTALGPLAVQHGPLRIMALGVLVMAGMLAYGAGLQVLGVMELRVAAAMLRARLARR
FT                   RGRPA"
FT   gene            328534..331155
FT                   /locus_tag="Gdia_0299"
FT   CDS_pept        328534..331155
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0299"
FT                   /product="DNA mismatch repair protein MutS"
FT                   /note="TIGRFAM: DNA mismatch repair protein MutS; PFAM: DNA
FT                   mismatch repair protein MutS domain protein; MutS III
FT                   domain protein; MutS II domain protein; MutS IV domain
FT                   protein; KEGG: gdi:GDI2079 DNA mismatch repair protein
FT                   MutS"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50096"
FT                   /db_xref="GOA:B5ZLG7"
FT                   /db_xref="InterPro:IPR000432"
FT                   /db_xref="InterPro:IPR005748"
FT                   /db_xref="InterPro:IPR007695"
FT                   /db_xref="InterPro:IPR007696"
FT                   /db_xref="InterPro:IPR007860"
FT                   /db_xref="InterPro:IPR007861"
FT                   /db_xref="InterPro:IPR016151"
FT                   /db_xref="InterPro:IPR017261"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036187"
FT                   /db_xref="InterPro:IPR036678"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZLG7"
FT                   /protein_id="ACI50096.1"
FT                   /translation="MTLPSPDGATPAMAQWFSLKAEHPEALLFFRMGDFYEMFFSDAEA
FT                   AAGALDIALTARGTHGDIPIPMCGVPVGAASSYLARLIRRGFRVAVAEQTEPPRKPGKG
FT                   GPKGPLARAVVRLVTPGTLTEDELLEAGRQNLLLAVASRGGRGTRGWGVAWIDISTGTF
FT                   ETASVPAEGLMDLLGRLDPAEILAAAEIDLGDFAARRAPATIPPGPEAARRRVAETFHV
FT                   ASLDAFGTFSDEEAVAGAMALDYVRRSQAGQMPRLSRPQAHENGGVLGLDPATRASLDL
FT                   LRTRDGGTEHTLLASVGRTVTAPGSRLLAEWIAAPLTRDAAIAARQDGWSWLIEEGGVR
FT                   AALRQGLRGTPDIARALARLSLGRGLPRDAAAIRDGLAIARRIAQALTDGRTAPPALLA
FT                   DAMRHLGEATDLEARLKQALAEDLPARVEDGGVIAAGFDAELDAERALRDDSRRVIAGL
FT                   QNDYAQKFGLASLKIRHHAQLGYVIEVPAATAPRLRERTDLILRQGTASAARFSTEELV
FT                   SLDRRIAEAAERAATRERRIFAALVREILDEPAPPVIAGALAVLDVLQSCADLAAGGMW
FT                   CRPEVTDDDAFTLTACRHPVVEAALPRSERFTPNDCVLEPAQRVMLLTGPNMAGKSTFL
FT                   RQTALAVILAQAGLPVPAKAARIGVVDRLFSRVGASDDLARGRSTFMVEMTETAAILNQ
FT                   AGPRSLVVVDEIGRGTATLDGLAIAWSVLEAMHSTLRCRSIFATHFHELAELAESLPRL
FT                   SPHTMSVREWKGQVIFQHEVIPGSARRSWGVHVARLAGVPEPVVRRAARLLAGLEKERA
FT                   VGARPLPLFAPADSTPPAEEPDPGVPEPVRRMLEQLDPDELTPRTALDMVYAIKKLMLE
FT                   ES"
FT   gene            331184..334153
FT                   /locus_tag="Gdia_0300"
FT   CDS_pept        331184..334153
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0300"
FT                   /product="UTP-GlnB uridylyltransferase, GlnD"
FT                   /EC_number="2.7.7.59"
FT                   /note="KEGG: gdi:GDI2080 putative uridylyltransferase (PII
FT                   uridylyl transferase) (uridylyl-removing enzyme) (UTase);
FT                   TIGRFAM: protein-P-II uridylyltransferase; PFAM: amino
FT                   acid-binding ACT domain protein; DNA polymerase beta domain
FT                   protein region; metal-dependent phosphohydrolase HD sub
FT                   domain; GlnD PII-uridylyltransferase; SMART:
FT                   metal-dependent phosphohydrolase HD region"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50097"
FT                   /db_xref="GOA:A9HKC5"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR010043"
FT                   /db_xref="InterPro:IPR013546"
FT                   /db_xref="UniProtKB/TrEMBL:A9HKC5"
FT                   /protein_id="ACI50097.1"
FT                   /translation="MEGRPPSGPTPMQEIDPPAMSTPSSPSQASTPSAVRDLTTSLAAS
FT                   LLSPEDGAAVPREQAIALFRRHLARFQASVREEFEAHRLHGTSAAKQLALHTDGMIRTL
FT                   VDFTLDHALAGSIGPGARSLAVTATGGYGRGMLAPFSDIDLLFLTTDEPSADVSRVVEY
FT                   ILYFLWDLGLKVGHATRSIAQCIAEAEADTTVRTTLLDARLLAGDASLFAMFEARYIVA
FT                   CVEAGAARFISDKHKERTARHNRFGDSPYLVEPNVKEGRGGLRDLQTLYWMCRYTFGTR
FT                   HVSDLLAPGFSRLGLLTEQEAKRARRSWDFLWSVRLHLHYISGRAEERLTFDVQPVVGA
FT                   RMGYTRHGRQVGVERFMRHYFLTVREVMRLTHVLEPAVMRQALGPAANAPQADSAMRDA
FT                   GFTVLDGQILPERGTSFDAEPIQMMRLLEWARTRKLPIHPLAMHQLIRWERRAASLRGD
FT                   PEAARIFLELLCGTPPERIGRPPHSAEAENAAGEEVPSFHATAQDRRQGNAYWLHILNE
FT                   TGIMGRLMPDWSRIVGQMQFDTYHVFTVDEHTIEAIRIFGRIEHGAMADEIPQAYDLAR
FT                   NLQSRRALYMAILLHDIAKGRGGDHSELGSEIALDVCPEMGLTGEETETVSWLVLHHLL
FT                   LSHTAFQRDIDDPKTILDLADTIQSPERLRLLLLLTIVDMRAVSPRVWNAWKATLLHEL
FT                   YMRVAEVLEGGLATTERDVRVARAKDAAAEILEDDGFKRADIDHFLGLGYGSYWLSFDQ
FT                   DTHARHAELIREAERHKAPLTVETQPLPARGVTEVTIYTADHPGLFSRMAGALAIAGAS
FT                   IVDARIHTLINGMALDTFWIQDAGGEAFEEPHQLARLSALVEQALSGRVDIPKEIVSAG
FT                   RMRYGRRMRAIHVPPRVVIDNRASNTYTVIEINGRDRPGLLHDVTQAISDHKLQIASAH
FT                   ITTYGVRAVDVFYVKDLFGLKITDERRLGEIREALLHGLRQAEEAMTSEIGPPAESLIA
FT                   "
FT   gene            complement(334202..334627)
FT                   /locus_tag="Gdia_0301"
FT   CDS_pept        complement(334202..334627)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0301"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gdi:GDI2081 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50098"
FT                   /db_xref="UniProtKB/TrEMBL:A9HKC9"
FT                   /protein_id="ACI50098.1"
FT                   /translation="MRVSSTSSIIVHLVQNSSASSQTLLNNSPSTPTTFSDMSPQEMEA
FT                   AREQLTREGKITLHQSGEMALMDGYALEGVNGGKLVSGSSNMYSMIDNLISYQEKNGIG
FT                   DVQGDIASLKSLRSILEEYDKNNQITASMASETALNE"
FT   gene            complement(334709..335416)
FT                   /locus_tag="Gdia_0302"
FT   CDS_pept        complement(334709..335416)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0302"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gdi:GDI2082 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50099"
FT                   /db_xref="UniProtKB/TrEMBL:A9HKD1"
FT                   /protein_id="ACI50099.1"
FT                   /translation="MTRIATTQSDLTYLGPFGTDSDASSTQSSAASAEGGAAPVSSDGD
FT                   SVTLSQEALSRLDQIIQSSRQSVRADAEQRVDRLQAQIRQLMFMKAFLSPKALAQELAQ
FT                   FAHQLAAAVQQYAQNQGTSAGMAEVGDMVISVPQDTQDSSGTVRDGGDVSDPSLSQPAT
FT                   DSTSGQAAGGSGKNGAGTSDSPDFQQTVRKVAAQLEDMLKEAKNRLKKQHNSDIQSAQD
FT                   ALDEVEQDLPKLS"
FT   gene            complement(335457..336365)
FT                   /locus_tag="Gdia_0303"
FT   CDS_pept        complement(335457..336365)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0303"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gdi:GDI2083 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50100"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZLH1"
FT                   /protein_id="ACI50100.1"
FT                   /translation="MGLSITASGASTYNVWAESKKADAPATETSGDRSARDIGLSASAQ
FT                   ALIQADLSKMTSTVVVHVANGVGAQPITASGEMSYGSWVENNELSYMLPTTAERAPKAT
FT                   SETTAMESFGGGASQSAGLSVSTKEYDLSRSDAVMLHVPGGWVAAANEMVNGVDTGYGP
FT                   DAVTGDYQQEVDVSTVSLSALYTAAGKSADEKSDTETASLITQFVQQSSGSQDPVAWKE
FT                   EPDGTVEFATFSSSFTPNGSAATADSTSESDGTAGSAASATAVLDPVATKRADQNNLID
FT                   QLFQISDEKHKPGDKSKLDLT"
FT   gene            complement(336501..338441)
FT                   /locus_tag="Gdia_0304"
FT   CDS_pept        complement(336501..338441)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0304"
FT                   /product="Tetratricopeptide TPR_2 repeat protein"
FT                   /note="PFAM: TPR repeat-containing protein;
FT                   Tetratricopeptide TPR_4; Tetratricopeptide TPR_2 repeat
FT                   protein; SMART: Tetratricopeptide domain protein; KEGG:
FT                   gdi:GDI2084 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50101"
FT                   /db_xref="GOA:B5ZLH2"
FT                   /db_xref="InterPro:IPR002201"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZLH2"
FT                   /protein_id="ACI50101.1"
FT                   /translation="MDKRQAAPDGPDSAARAMALLEAGDRDGALALLHAALSARPACRD
FT                   ADVLHGMACVARAAGRPDLAIGLAGKAVALLPAAHFHITLGCALREQGHVEEARAALAV
FT                   AVLREPRDARAHAALAGALGELGRWAEAEASLRAARALCPGDMALLLEWARACIHGGDH
FT                   AAATAEIVAGADRFAPDHAGALHGLATLLADRGQPAGAEALYRQIVRLLPDDGAAWANH
FT                   GAALFALNRHEDARVALEHAAALAPGVAETQNNLGLVLMALGHLPQARTALERARILAP
FT                   GDARIAVNAATILDELAEGDAAEALYRAVLRDPILAREAEGARAQFNLGTLLLARGAYA
FT                   EGWRHLEARSRLLPPMRGQGVAEWDGASLPRGRVLLYAEQGLGDAIQFLRYLPDCLRRA
FT                   SVVLDVPHSLHRLLQTMPDPDGQIATRCTVLPPGDPLPDDVVARCGLISLPHRLGMTDI
FT                   PPFAPYLLPAPAPDLGERPRVGLCWAGNPSFRFDRRRSIPAHRLAPLADVPGLFFVSLQ
FT                   HGPAAAAPPFALERSAEGDMLDTARIVAGLDLVITVDTAIAHLAGAMGRPVWLLNRFGG
FT                   DWRWSATFDRAEPPRWGDRGSRWYPSLEQFRQHQPDDPDTAWAAPIEAVHAALLRWRVG
FT                   FATGPLADKSA"
FT   gene            338526..340025
FT                   /locus_tag="Gdia_0305"
FT   CDS_pept        338526..340025
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0305"
FT                   /product="Carboxypeptidase Taq"
FT                   /EC_number="3.4.17.19"
FT                   /note="PFAM: peptidase M32 carboxypeptidase Taq
FT                   metallopeptidase; KEGG: gdi:GDI2085 thermostable
FT                   carboxypeptidase 1"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50102"
FT                   /db_xref="GOA:A9HKD9"
FT                   /db_xref="InterPro:IPR001333"
FT                   /db_xref="UniProtKB/TrEMBL:A9HKD9"
FT                   /protein_id="ACI50102.1"
FT                   /translation="MPQHAYTDLTTHFARIGRIRNALGILGWDKDVMMPAGAAESRADS
FT                   IATLDVLCHEILTAPVIAELLDRAEAPAGSWQAANLQEMRRAYLHAASVPADLVDAMSR
FT                   AASRCEMAWRAARREGDFAALLPTLSEVLDRTRDLAVVKGAALGLSPYDALLDQYDPGT
FT                   RRADIDPVFAELRRDLPALIADAQAHQAATPAPVLPTGPFPVPLQEQMGRRMMMALGFD
FT                   MERGRLDVSAHPFCGGAEDDVRITTRYEDDDFLAALMGVIHETGHALYEQGLPHDWRTQ
FT                   PVGQARGMSLHESQSLLMEMQVARSRPFMDWAAPLLRAAFGGAEADPAWSADSLYRAVT
FT                   RVRPGFIRVDADEVTYPAHVLVRYEMETALVDGTLALRDLPEAFNAGIHGLLGLTVPND
FT                   RLGCLQDIHWPSGAWGYFPTYTMGAILAAQLRQAAFRADPAIPSGIAQGDFAPLLGWLR
FT                   THVHSQASRLSTPDIIRAATGAAPSTDAYRAHLRERYCGAE"
FT   gene            340136..342070
FT                   /locus_tag="Gdia_0306"
FT   CDS_pept        340136..342070
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0306"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gdi:GDI2086 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50103"
FT                   /db_xref="InterPro:IPR028992"
FT                   /db_xref="InterPro:IPR036844"
FT                   /db_xref="UniProtKB/TrEMBL:A9HKE2"
FT                   /protein_id="ACI50103.1"
FT                   /translation="MSTTTTYKTASGVTYTVTDTSYLGQNDYDVTITASDGTVLLDQDN
FT                   INRGIDILGVIDLAASGDVITGSTDSTSLVSLASIGTYVSVPGATGNFIVGAGALAANT
FT                   YYIGGTTTISGLANLVTGTTINVVGGTATLSGNSGSTLLGALNGSTVNIEYGGTFNTGA
FT                   ALGSLLEGATVSFGSGGGTLVINGGGTAISLLASGPLSATTIQNYDPSRDTIELQDTVA
FT                   PISGYTISGDTTRTITLYGSDGTQVATYTVNLASGVNLANGTYNAVNSTQGNPLNITYT
FT                   TGNTYIGVCFLADSMIRTPSGDIAVQDIRVGDEILACPDGEWRDGEQGTGERLGTVVWT
FT                   GKAHATVRPGLPDDEAGYPVRILRDAIADGVPYKDMLVTPEHCLFLDGVFIPARMLVNG
FT                   RSIFHDRTITAYDYYHIETERHSVIIADGMPTESYLDTGNRRSFRQDGKIVHIGAGNAR
FT                   SWTEDAAAPLGVTRAVVEPVFRRIEARARDAGIASAIVGPVLTDDTGLHLLTENGQAIR
FT                   RTRDANGYATFLIPPDVGTVRIVSRTSRPSDAIGPFLDDRRRLGVLVGGITLLDSDNMR
FT                   LIDTYLADPALDGWDVQEAGPHRWTNGDAILPLGPRRPDSFGILAIQVLAGGPYPVTAE
FT                   ATEAVAQSA"
FT   gene            342143..343294
FT                   /locus_tag="Gdia_0307"
FT   CDS_pept        342143..343294
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0307"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gdi:GDI2087 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50104"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR017996"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZLH5"
FT                   /protein_id="ACI50104.1"
FT                   /translation="MSRFLPIPSPPLSSGLASGALAVSILFAALPALAAKPAPPLDPSA
FT                   PLVPVAESTARVWNAVAVLPDGRMILEYPAWTGTPGPALTLRDADGTQHPYPDAGWNDP
FT                   AADPAHRFVSVEGLHLTDDGMLWALDSGIGADGHAPQPGSVKLVQVDTRTGAVARTYVL
FT                   DPAVLRPGSHVAGVRVGKGYAFILDSGVPGLIVMDLAHGTQRRLLDHNPSLTAQRTITV
FT                   DGRTLLDTDGRAAIVHANRIEISPDGEWLYYQTLCGPLYRFGTELLTDTSLTDVELDDS
FT                   ATLWYKTPPLGGMTVGRDGTLYFDDVSTGSIFRFTTGRIYQRIVVDPRLRWPAEPYITA
FT                   NGQLYVPTAQIDHTPHFNGGRVDVQWPLTLYRIDVRALPPAKY"
FT   sig_peptide     342143..342247
FT                   /locus_tag="Gdia_0307"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.987 at
FT                   residue 35"
FT   gene            343345..344742
FT                   /locus_tag="Gdia_0308"
FT   CDS_pept        343345..344742
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0308"
FT                   /product="threonine synthase"
FT                   /EC_number="4.2.3.1"
FT                   /note="KEGG: gdi:GDI2088 threonine synthase; TIGRFAM:
FT                   threonine synthase; PFAM: Pyridoxal-5'-phosphate-dependent
FT                   protein beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50105"
FT                   /db_xref="GOA:B5ZLH6"
FT                   /db_xref="InterPro:IPR000634"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR004450"
FT                   /db_xref="InterPro:IPR029144"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="InterPro:IPR037158"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZLH6"
FT                   /protein_id="ACI50105.1"
FT                   /translation="MRYLSTRGQAPVRDFSSVLLAGLAEDGGLYLPETWPVLTADDWRA
FT                   LRGLPYPDLAARIIAPFTAGCIAPDVLQRLCRESYAGFDHAAIVPLTQVEDGLFVQELF
FT                   HGPTLAFKDMAMQLLGRLFDHVLAERDAHVTIVGATSGDTGSAAIEACRGRERVKIVIL
FT                   HPEGRTSDVQRRQMTTVLEPNVTNLAVQGTFDDCQDLVKAMFADAPFRQDMHLSAVNSI
FT                   NWARIAAQIPYYVYAALALGAPDREVSFAVPTGNFGNILAAWAARRMGLPVRALCVGSN
FT                   RNDILTRFLRDNDMSVQGVVPSLSPSMDIQVSSNFERLLFELLNRDAAACARIVTEFRQ
FT                   TGHMAVPDPVWRQASGLFHALALDDQDTKTEIRNLHAASQYLADPHSAIGIAAGRMFRE
FT                   PGIPMVAMATAHPAKFPDAMEQATGIRPALPPALADLFDRPERYEVVAARLDAVEDRVR
FT                   AAVLKNA"
FT   gene            344807..346072
FT                   /locus_tag="Gdia_0309"
FT   CDS_pept        344807..346072
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0309"
FT                   /product="processing peptidase"
FT                   /EC_number="3.4.24.64"
FT                   /note="PFAM: peptidase M16 domain protein; KEGG:
FT                   gdi:GDI2089 peptidase, family M16"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50106"
FT                   /db_xref="GOA:A9HKF0"
FT                   /db_xref="InterPro:IPR001431"
FT                   /db_xref="InterPro:IPR007863"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="InterPro:IPR011765"
FT                   /db_xref="UniProtKB/TrEMBL:A9HKF0"
FT                   /protein_id="ACI50106.1"
FT                   /translation="MTDQINVTRLPSGLTVVTERMERVETVSFGAYVAAGTCNEHAEEN
FT                   GVSHFLEHMAFKGTDSRTAAGIAEEIENVGGHINAYTAREHTAYYVKLLKEDLALGADI
FT                   IGDILTHSSFAPDEVERERGVILQEIGQANDTPDDIIFDHFQETAFPEQPMGRPTLGTE
FT                   PLIQDMSRETLMRYMRTHYTTANTVIAAAGNLHHADVVALAERHFRDLPALDSSTGFDS
FT                   RYLGGEFRKEKELDQAHVVLGFPSVGYGDPDYYPVLLLSTLLGGGMSSRLFQEIREKRG
FT                   LVYSVYSFNAPFRDGGLFGIYAGTGEDQADELIPVTLEELRKVQGHVGQDELNRARAQL
FT                   KSSLLMSLESTGSRCEQLARQLQVFGRLIPTAETVERINAVTIADVRRVATRLFRGKPT
FT                   LASLGPVRNIPGIAAIAEALAA"
FT   gene            346069..347409
FT                   /locus_tag="Gdia_0310"
FT   CDS_pept        346069..347409
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0310"
FT                   /product="peptidase U62 modulator of DNA gyrase"
FT                   /note="PFAM: peptidase U62 modulator of DNA gyrase; KEGG:
FT                   gdi:GDI2090 peptidase U62, modulator of DNA gyrase"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50107"
FT                   /db_xref="GOA:A9HKF2"
FT                   /db_xref="InterPro:IPR002510"
FT                   /db_xref="InterPro:IPR035068"
FT                   /db_xref="InterPro:IPR036059"
FT                   /db_xref="UniProtKB/TrEMBL:A9HKF2"
FT                   /protein_id="ACI50107.1"
FT                   /translation="MSTDPLDLLGTLIGKARAAGADAADAVYMARTTHGVQVRNGRTED
FT                   LERSETSDLGLRVFVGRRSAIVSATSLDPERFDPLVAQALAMARVVPEDPHSGLSPDAV
FT                   QGFVDAAGMDLLDPAQPDTAALLDRARAAEDAAVSVAGVTNSNGGSASSGLSDIILMTS
FT                   AGFSGRYARSSHSVSASVLAGQGTGMQRDYDYHATVHLSDLDDPAKIGRSAGEKAVARL
FT                   NPTRPRTGSMAVVFDPRVSSSLLGHLAGAVNGSAIARGTSFLKDRMGQRIMPAGIHIID
FT                   DPTQSRGLSAHPFDGEGMRAGELVIVQDGVLMNWALDSRSARQVGLPGNGRASRGTTAP
FT                   PGPSLGSLYARPGTVTPAALMADIAEGIYVTELMGSAINGLTGDYSRGASGFMIRGGTL
FT                   AEPVAELTIAGNLNDMFARMVLADDLVFRRGINAPTIRIDDLMIAGS"
FT   gene            347436..348398
FT                   /locus_tag="Gdia_0311"
FT   CDS_pept        347436..348398
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0311"
FT                   /product="import inner membrane translocase subunit Tim44"
FT                   /note="PFAM: import inner membrane translocase subunit
FT                   Tim44; KEGG: gdi:GDI2091 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50108"
FT                   /db_xref="GOA:B5ZLH9"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR007379"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZLH9"
FT                   /protein_id="ACI50108.1"
FT                   /translation="MSTPTTPARPPRPRRAAILLLGTALAALPLLGLPQGADARPGSGL
FT                   SMGSRGSRTYSAPAPTTTSPYGAAPMQQSIMPRSAPGYGGAPSAFPRSPYGVPYGSPYA
FT                   ARPHPFANGFLGGLLGAGLFGVLFGHGIAGGLHGGGSFLGFLIQLVLLFLLVGWLVRRF
FT                   GGGARRTAPMPAAPYGQGPSADQVTITPDDYRAFQRLLLDIQAAWSQRNLPALQHMATP
FT                   EMVGYFNAQLSDLASRGARNVVSDVRFEQGDLSEAWSENGFDYATVAMRYSMVDITTDM
FT                   TGRVIDGSSTERVMVTELWTFVRPTRGGAWLLSAIQQGR"
FT   sig_peptide     347436..347555
FT                   /locus_tag="Gdia_0311"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.997) with cleavage site probability 0.472 at
FT                   residue 40"
FT   mobile_element  complement(348714..349879)
FT                   /mobile_element_type="insertion sequence:Gdi5"
FT   gene            complement(348724..349793)
FT                   /locus_tag="Gdia_0312"
FT                   /note="ribosomal slippage"
FT   CDS_pept        complement(join(348724..349305,349305..349793))
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /ribosomal_slippage
FT                   /locus_tag="Gdia_0312"
FT                   /product="transposase IS630"
FT                   /note="KEGG: gdi:GDI2093 putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50109"
FT                   /db_xref="GOA:B5ZLI0"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR025959"
FT                   /db_xref="InterPro:IPR038717"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZLI0"
FT                   /protein_id="ACI50109.1"
FT                   /translation="MTRAVKLRDDYSASELRRLAARSRQANAARRLLALAAIRDGASRT
FT                   DAARVGGMDRQTLRDWVHRFNAEGPDGLRDHLHAGPACRLSVAQQTELKALVEAGPDRQ
FT                   RDGVVRWRRVDLQRVIEERFGVVYHERHVSTLLKRLGFSYVSARPRHPGQDAGVMEAFK
FT                   KNFPRILNAHTGHLPKGKPIEIWFQDEARIGQKNGIVRQWARRGTRPRQPADQRYENAW
FT                   LFGAICPARGKAAGLALPFIGTASMQLHIEEISRCVVRGAHAVVLLDRAGWHTTDKLKL
FT                   PRNISLIFLPSRAPELNPVENVWQFLRANWLSNTVFDGIDHIIDAACSAWNKLAALPDT
FT                   IRSIGLRKWAHTGQYL"
FT   gene            349977..350498
FT                   /locus_tag="Gdia_0313"
FT   CDS_pept        349977..350498
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0313"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gdi:GDI2094 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50110"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A9HKG2"
FT                   /protein_id="ACI50110.1"
FT                   /translation="MHFISGLPRSGSTLLAAILRQNPRFSASMSSPVCGLVRKLLDGMS
FT                   ANSEFASFITDEQRRRILRGVFENYYGDNFTSRTVFDTNRAWSNCLPLLGDLFPGCRVI
FT                   ACVRDVPWILDSIERLVRRNCLAASGMFNFDSAGSVYTRAEAVARADGMLGYGYNALKE
FT                   AFYGEHVNFC"
FT   mobile_element  complement(350483..352964)
FT                   /mobile_element_type="insertion sequence:Gdi17"
FT                   /note="family 21"
FT   gene            complement(350569..351339)
FT                   /locus_tag="Gdia_0314"
FT   CDS_pept        complement(350569..351339)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0314"
FT                   /product="IstB domain protein ATP-binding protein"
FT                   /note="PFAM: IstB domain protein ATP-binding protein;
FT                   SMART: AAA ATPase; KEGG: gdi:GDI2704 putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50111"
FT                   /db_xref="GOA:B5ZDY1"
FT                   /db_xref="InterPro:IPR002611"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028350"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZDY1"
FT                   /protein_id="ACI50111.1"
FT                   /translation="MRHDPAAGALVVMLRGLRMYGMAQATAELTEQGAPAFEAAIPVLS
FT                   QLLKAELAEREVRSIAYQTKTARFPAYKDLAGFDFSAAEVNEAMVRQLHAGDFIDRADN
FT                   VVLIGGPGTGKTHLATALAVQAIEHHRKKIRFWSTVDLVNALEQEKTANRAGQIAERLL
FT                   RLDLVILDELGYLPFSASGGALLFHLLSRLYERTSVINLSFSEWGEVFGDPKMTTALLD
FT                   RLTHHCHILETGNDSYRFRASSAAPRNRKEKATA"
FT   sig_peptide     complement(351268..351339)
FT                   /locus_tag="Gdia_0314"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.637) with cleavage site probability 0.364 at
FT                   residue 24"
FT   gene            complement(351329..352852)
FT                   /locus_tag="Gdia_0315"
FT   CDS_pept        complement(351329..352852)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0315"
FT                   /product="Integrase catalytic region"
FT                   /note="PFAM: Integrase catalytic region; KEGG: gdi:GDI2705
FT                   putative integrase"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50112"
FT                   /db_xref="GOA:A9HPY4"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR017894"
FT                   /db_xref="UniProtKB/TrEMBL:A9HPY4"
FT                   /protein_id="ACI50112.1"
FT                   /translation="MELLSVIRRWHYRDHVPIREIERRTRLSRNTIRKYLRAETVEPQF
FT                   KVAERPSRLDPFAEKLATWLALETSKSRKQRRTGRRLHVDLVALGYDGSYGRVAAFIRN
FT                   WKAEQQRARQTTGRGVFVPLRFQPGEAFQFDWGEDWAVIGGRRVKLQVAHTKLSYSRAF
FT                   ILRAYPLQTHEMLFDALTEAFRVLGGVPRRGIFDNMKTAVDRVGPGKVRQVNLRFSALV
FT                   SHYLFEAEFCNPAAGWEKGQIEKTVQDARRQIWQEMPHFPDLASLNVWLEARCRERWTI
FT                   LRHVELPGSLAEAHAAEVPHLMVPGRPFDGFVEHTKRVSPTCLVQFESNRYSVPASFAN
FT                   RPVSLRVYPDRLVIAAEGRILCEHPRIVERSHGVPGRTIYDWRHYLAVLQRKPGALRNG
FT                   APFSELPEAFRTLQTHLLRRTGGDREMVEILALVLQHDEQAVLCAVELALEEGVATKTH
FT                   VLNTLHRLTDAKKTGAPRLDAPQALVLEREPQADTGRYDALRGEARHAS"
FT   gene            352967..353191
FT                   /pseudo
FT                   /locus_tag="Gdia_0316"
FT   gene            353245..353922
FT                   /locus_tag="Gdia_0317"
FT   CDS_pept        353245..353922
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0317"
FT                   /product="putative invasion associated locus B (IalB)
FT                   protein"
FT                   /note="KEGG: gdi:GDI2098 putative invasion associated locus
FT                   B (IalB) protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50113"
FT                   /db_xref="InterPro:IPR010642"
FT                   /db_xref="InterPro:IPR038696"
FT                   /db_xref="UniProtKB/TrEMBL:A9HKH3"
FT                   /protein_id="ACI50113.1"
FT                   /translation="MKLFTPVPLVAVIGGAAAALTLGVAYSGHSGPGVAQASTHGAASA
FT                   VPASTPATAAPAAAPAASPAELSQSSGQWTYRCLYAQAPATGPALCTIEQHLIVQNPQK
FT                   KAVQVGDVLFSRSRTAGGSLSATYQLTLQTPLMVSLVRPPTIAIDDGAPVALTWQVCTA
FT                   NGCIARMAPLPDAVLSSARHGKTGHIQIGTVQGGAVTINFELAGLDTAVTTLDSWAHRQ
FT                   SPS"
FT   sig_peptide     353245..353352
FT                   /locus_tag="Gdia_0317"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.997) with cleavage site probability 0.557 at
FT                   residue 36"
FT   gene            complement(353981..354118)
FT                   /locus_tag="Gdia_0318"
FT   CDS_pept        complement(353981..354118)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0318"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gdi:GDI2099 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50114"
FT                   /db_xref="GOA:A9HKH5"
FT                   /db_xref="UniProtKB/TrEMBL:A9HKH5"
FT                   /protein_id="ACI50114.1"
FT                   /translation="MNQPHSLTDAEATEFVRRHRGRIYGVAITLLALAAVFYGLALVRL
FT                   "
FT   gene            complement(354128..355075)
FT                   /locus_tag="Gdia_0319"
FT   CDS_pept        complement(354128..355075)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0319"
FT                   /product="protoheme IX farnesyltransferase"
FT                   /note="TIGRFAM: protoheme IX farnesyltransferase; PFAM:
FT                   UbiA prenyltransferase; KEGG: gdi:GDI2100 putative
FT                   protoheme IX farnesyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50115"
FT                   /db_xref="GOA:A9HKH7"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR006369"
FT                   /db_xref="InterPro:IPR030470"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9HKH7"
FT                   /protein_id="ACI50115.1"
FT                   /translation="MSGAATTEGAVTRFDAALVGTEARDWFALLKPRVISLVVFTGAAG
FT                   LAMAPGPINPLIAAVSILCICMASGAAGAINMWYDRDIDAVMTRTARRPIPDGRIRDDQ
FT                   ALGFGIGLSVASVLLMWLAANALAAFILAFSIFFYAVIYTMWLKRSTPQNIVIGGAAGA
FT                   FPPMIGWAATTGSLGVLPVVMFAIVFLWTPPHFWSLSLYACKDYGRAGIPMLPVVRGAR
FT                   HTRWQILFYTLILSAVSLVPSFLHQAGWLYTGVASLLDAGFVACAVGVLTDRQDEAGVS
FT                   LTGDRPARRAFRYSLAYLFLLFCGLLADHFLIMR"
FT   gene            complement(355072..356436)
FT                   /locus_tag="Gdia_0320"
FT   CDS_pept        complement(355072..356436)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0320"
FT                   /product="Cytochrome-c oxidase"
FT                   /EC_number="1.9.3.1"
FT                   /note="PFAM: cytochrome c oxidase subunit I; KEGG:
FT                   gdi:GDI2101 putative cytochrome c oxidase subunit 1"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50116"
FT                   /db_xref="GOA:B5ZLI7"
FT                   /db_xref="InterPro:IPR000883"
FT                   /db_xref="InterPro:IPR023616"
FT                   /db_xref="InterPro:IPR036927"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZLI7"
FT                   /protein_id="ACI50116.1"
FT                   /translation="MPTDGQVRAGIGTGGFPARWNRACGHKTVGSLYLVLAVLAGLAGG
FT                   GLALLLQVGQAGLDGAASAPWHRMTIDHGALMILFCALPALTGGFGSWFVPLLLGAPDM
FT                   AFRRLNLLCWAGLAVSFALVLSGMATAPGMLLWCAAMLGLSIDMVATVLNMRRPGMALR
FT                   DMPLFAWAQALTGMMMVIVLPVLAASLTRGLLAGTGGRQAELALRAFSGPEIGLLLLPA
FT                   AGIVCQVVETFSGVALRLRGAALGAMVVLSVGGATIWVHDLFADGLAVQSVVRPLIEQA
FT                   TIAVPMLVLLAAWGATVLGGRAAFRVPMLWACAFAVLLVAGPVLALLGGPAAGHAVALP
FT                   AALFATFAGFYYWIGKMTGRACPERAGRLHVALAVGGSILLLAPHQPAFVSTGVVLLGL
FT                   SMLAFVAAIALTLAGRTRPLAANYWGPGARTLEWTVPSPAPRDSFAGILAHGARA"
FT   gene            complement(356589..357326)
FT                   /locus_tag="Gdia_0321"
FT   CDS_pept        complement(356589..357326)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0321"
FT                   /product="Phosphatidylethanolamine N-methyltransferase"
FT                   /EC_number="2.1.1.17"
FT                   /note="PFAM: Methyltransferase type 11; Methyltransferase
FT                   type 12; KEGG: gdi:GDI2102 putative
FT                   phosphatidylethanolamine N-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50117"
FT                   /db_xref="GOA:B5ZLI8"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZLI8"
FT                   /protein_id="ACI50117.1"
FT                   /translation="MSEVLQDAPAETGSAAGIAGGYAPAPRSALDAEAVKAAYRRWAGV
FT                   YDALFGGVSAFGRKRAVAAVNGLPGSAVLEVGVGTGLALPHYRSDKRITGIDLSGDMLD
FT                   RARQRVARMNLRNVDALLEMDAEETRFADGSFDIAVAMFVASVVPNPRRLLCELKRVVR
FT                   PGGHILFVNHFLATGGVRLAVERGMARASHSLGWHPDFAIESLLPPADLAQATIQSVPP
FT                   AGLFTLVTLPRDGAAPSVETMAG"
FT   gene            complement(357459..358463)
FT                   /locus_tag="Gdia_0322"
FT   CDS_pept        complement(357459..358463)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0322"
FT                   /product="glutathione synthetase"
FT                   /EC_number="6.3.2.3"
FT                   /note="KEGG: gdi:GDI2103 glutathione synthetase; TIGRFAM:
FT                   glutathione synthetase; PFAM: glutathione synthetase domain
FT                   protein; glutathione synthetase ATP-binding; RimK domain
FT                   protein ATP-grasp"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50118"
FT                   /db_xref="GOA:A9HKI7"
FT                   /db_xref="InterPro:IPR004215"
FT                   /db_xref="InterPro:IPR004218"
FT                   /db_xref="InterPro:IPR006284"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:A9HKI7"
FT                   /protein_id="ACI50118.1"
FT                   /translation="MSRPLKVAVQMDPLAGIDINGDSTFALMLEAQARGYELFVYHVQG
FT                   LSLREGRTDGHAGGTRTERLTARARPARVQRVAGDHAALGEERVLDLSGMDVILMRQDP
FT                   PFDMAYITATHMLEHVHGTGPGRALVVNDPESVRNAPEKLLVTHYPDLMPPTLVTWDVQ
FT                   AIRDFRAQWRDIIVKPLFGNGGAGVFRIREDDENLNSLLEMHFARSREPLMIQRYEAAV
FT                   RRGDKRIILADGQPIGAINRVPAQGEARSNMHVGGKAAKVELTPRDREICEAIGPMLRE
FT                   KGLIFVGIDVIGDWLTEINVTSPTGLQEIDRFDDINSAGLIWDCILRRLDGGA"
FT   gene            complement(358556..359098)
FT                   /locus_tag="Gdia_0323"
FT   CDS_pept        complement(358556..359098)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0323"
FT                   /product="transcription elongation factor GreB"
FT                   /note="TIGRFAM: transcription elongation factor GreB; PFAM:
FT                   transcription elongation factor GreA/GreB domain protein;
FT                   KEGG: gdi:GDI2104 putative transcription elongation factor
FT                   GreB"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50119"
FT                   /db_xref="GOA:B5ZLJ0"
FT                   /db_xref="InterPro:IPR001437"
FT                   /db_xref="InterPro:IPR006358"
FT                   /db_xref="InterPro:IPR018151"
FT                   /db_xref="InterPro:IPR022691"
FT                   /db_xref="InterPro:IPR023459"
FT                   /db_xref="InterPro:IPR028624"
FT                   /db_xref="InterPro:IPR036805"
FT                   /db_xref="InterPro:IPR036953"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZLJ0"
FT                   /protein_id="ACI50119.1"
FT                   /translation="MSDDDNDDDDAAPRRLEGVSRYVTPAGMAAMRGELNALLRDERPR
FT                   IVDIVSWAAGNGDRSENGDYLYGKKRLREIDRRVRFLTRRIEKAIVVDPAAQTRRDRVF
FT                   FGATVTYVTEDDTERTVVIVGVDESDLAAGQVSLASPVARALLGGRVGDEVRLLTPAGA
FT                   EMIEILRIAYPAPAEMV"
FT   gene            complement(359212..360111)
FT                   /locus_tag="Gdia_0324"
FT   CDS_pept        complement(359212..360111)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0324"
FT                   /product="Aldose 1-epimerase"
FT                   /note="PFAM: Aldose 1-epimerase; KEGG: gdi:GDI2105 putative
FT                   aldose 1-epimerase (mutarotase)"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50120"
FT                   /db_xref="GOA:A9HKJ4"
FT                   /db_xref="InterPro:IPR008183"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR014718"
FT                   /db_xref="UniProtKB/TrEMBL:A9HKJ4"
FT                   /protein_id="ACI50120.1"
FT                   /translation="MIELTAGTGRLGLLPELGGAVAYWKSRDICVLHAVSDANLLAQRG
FT                   RAVSGYPLVPFSNRVANGHFRFEGTEYRMKPNFGGESNTLHGNGWEHPWQLELLADDSA
FT                   TLVLDWHPPYEQVTGQVIGQWPFAYRAQLRFDLREDSLSIGMLIENTDLRSQPVGMGFH
FT                   PYFPRRSGLQLGFAAETVWTNDEHHLPALRVPATGDWSFEHMHAVTTQDIDNCYAGWER
FT                   AAFLRWPNEGLALTIEADDPFRHLVLFTPPDKPFIAVEPVTNMNDAFNHSGVIDRGVHV
FT                   LAPGAKLEGHIRIALMAC"
FT   gene            complement(360161..362392)
FT                   /locus_tag="Gdia_0325"
FT   CDS_pept        complement(360161..362392)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0325"
FT                   /product="excinuclease ABC, B subunit"
FT                   /note="KEGG: gdi:GDI2106 putative UvrABC system protein B;
FT                   TIGRFAM: excinuclease ABC, B subunit; PFAM: helicase domain
FT                   protein; UvrB/UvrC protein; SMART: DEAD-like helicases"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50121"
FT                   /db_xref="GOA:A9HKJ6"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR004807"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR024759"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036876"
FT                   /db_xref="InterPro:IPR041471"
FT                   /db_xref="UniProtKB/TrEMBL:A9HKJ6"
FT                   /protein_id="ACI50121.1"
FT                   /translation="MPAPASKKTRRPDPSDEIVTFQPERQPPKEKTRRLTIQSPYEPAG
FT                   DQPRAIGELVAGVEGGERDQVLLGVTGSGKTFTMAKIIEATQKPTLILAPNKTLAAQLY
FT                   GEMKQFFPDNAVEYFVSYYDYYQPEAYVPRSDTYIEKDSQINEQIDRMRHAATQALLER
FT                   NDVIIVASVSCIYGIGSVETYSRMVVRLEVGGEIDRDRLVKALVDLQYRRNDAAFQRGT
FT                   FRVRGESVDVFPVQNEDRAWRISLFGDEIDAITEFDPLTGDKTGDLQEVSIYANSHYVT
FT                   PRPTLNQAVIGIKHELRQRLNDLTEEGKLLEAERLQQRTTFDLEMIETTGVCKGIENYS
FT                   RYLSGRQPGDPPPTLFEYLPEDALLIVDESHVTVPQIGGMERGDFARKSILSEFGFRLP
FT                   SCLDNRPLKFAEWDLFRPQTIFVSATPGPWEMERVGGVFAEQVIRPTGLIDPVTDIRPV
FT                   ERQVDDLLAECRLTIAAGGRVLVTTLTKRMAEDLTDYMNEAGIRVRYLHSDVDTLERIE
FT                   IIRDLRLGAFDVLIGINLLREGLDIPECSLVAILDADKEGFLRSRTSLVQTIGRAARNV
FT                   DGRVVLYADKMTDSLRYAIEETARRREKQSAWNAAHGITPQSVRKQIGEALSSVFEQDY
FT                   VTVAPTKDGDVAEFVGKDLGSAIAELEKRMRAAAADLEFETAARLRDEIKRLEALELGL
FT                   DPVPVPVSTAGTGRPPRRKAGKGPEPLGPGGGGYDPSKGRGPRRRGGGR"
FT   gene            362505..363314
FT                   /locus_tag="Gdia_0326"
FT   CDS_pept        362505..363314
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0326"
FT                   /product="Exonuclease RNase T and DNA polymerase III"
FT                   /note="PFAM: Exonuclease RNase T and DNA polymerase III;
FT                   SMART: Exonuclease; KEGG: gdi:GDI2107 putative
FT                   exodeoxyribonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50122"
FT                   /db_xref="GOA:A9HKJ8"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:A9HKJ8"
FT                   /protein_id="ACI50122.1"
FT                   /translation="MDGSIPPSGSPPTPFVRVIDLETSGRNAADGGIVEIGWQDVARDA
FT                   DGTWALAGPPGARLTHPGGPITPQTMAIHHITDAHVRDAPPFAEIAPDILHPADRPAAM
FT                   AAHRASFEQGWIRGSLPPALTTGLHWICTYKCALRLWPDEPGHSNQGLRHSRRPAGLER
FT                   ALGDPPHRAGPDAYVTAHHLRDMLALATVEQLLRWSREPALLTRVPHGPLRGRQIRNLA
FT                   TGDLDRLLAEDRRRGPDLAFTLRTERARRAGLNETTLAPPVQQAFRF"
FT   gene            complement(363279..363590)
FT                   /locus_tag="Gdia_0327"
FT   CDS_pept        complement(363279..363590)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0327"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gdi:GDI2108 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50123"
FT                   /db_xref="GOA:A9HKK1"
FT                   /db_xref="UniProtKB/TrEMBL:A9HKK1"
FT                   /protein_id="ACI50123.1"
FT                   /translation="MNETSDADREPLSPPLSRPLSGWTRERRAIVLWSQSGSLIVVSGN
FT                   VVGRHVGDPAGSILFAIGFGCILWALKILIENWTELRRPSAGLTKPSLKAKGLLNRRR"
FT   gene            complement(363596..364960)
FT                   /locus_tag="Gdia_0328"
FT   CDS_pept        complement(363596..364960)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0328"
FT                   /product="ABC-1 domain protein"
FT                   /note="PFAM: ABC-1 domain protein; KEGG: gdi:GDI2109
FT                   putative ubiquinone biosynthesis protein UbiB"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50124"
FT                   /db_xref="InterPro:IPR004147"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR034646"
FT                   /db_xref="UniProtKB/TrEMBL:A9HKK3"
FT                   /protein_id="ACI50124.1"
FT                   /translation="MAEERDLDNTGLFGEFRRMVRTSGAVGGIAARIAGHKMGIRTDRT
FT                   AHAGDLKSILGGLKGPLMKGAQLLSTIPGALPEEYAVELAQLQANAPAMGWSFVRRRMA
FT                   SELGRDWERRFRTFEHEAAAAASLGQVHRAVLPDGRLVACKLQYPDMQATVDSDLRQFR
FT                   MAVGLYYRIDSTIQQDDVLVELEARLREELDYLREAANLRLYRLMLADRPDVSVPAPVE
FT                   DMTTRRLLVMDWLEGRGVQKVLDTNPSQDQRNAMARALFHAWYVPLYRYGVIHGDPHMG
FT                   NFTVRGDYGLNLLDLGAIRIFPARFVQGIIDLYRALERNDEDLAYHAYQAWGFTNMSRE
FT                   TMRILNEWARFIYEPLMQDRVRPIQENDDPQFGRAVAERVYAGLKRTGGVRPPREFVLV
FT                   DRSAIGLGSVFLRLGAKLNWYRLFQELIADFDAAQLAARQAEAIRVAGVPTPIEA"
FT   gene            complement(364962..366809)
FT                   /locus_tag="Gdia_0329"
FT   CDS_pept        complement(364962..366809)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0329"
FT                   /product="oligoendopeptidase, pepF/M3 family"
FT                   /note="TIGRFAM: oligoendopeptidase, pepF/M3 family; PFAM:
FT                   peptidase M3A and M3B thimet/oligopeptidase F;
FT                   Oligopeptidase F; KEGG: gdi:GDI2110 group B oligopeptidase
FT                   PepB"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50125"
FT                   /db_xref="GOA:A9HKK6"
FT                   /db_xref="InterPro:IPR001567"
FT                   /db_xref="InterPro:IPR011977"
FT                   /db_xref="InterPro:IPR013647"
FT                   /db_xref="InterPro:IPR034013"
FT                   /db_xref="UniProtKB/TrEMBL:A9HKK6"
FT                   /protein_id="ACI50125.1"
FT                   /translation="MSGQNLSAWIDGPCGGRCGREAEGGATAGTAGDLPRWDLGDLYDS
FT                   PESDRLRTDLNQAEADAAAFADVWRGRLAGASPAALAEAIAEYQRIDEVLGRAASYAQL
FT                   LFAGDSSDAAIGRFSQSVNERLTDISTHLLFFTLELNRIGDDEMAARLADPALAVWAPF
FT                   LRDLRVFRPHQLSDEIEQVLHEKSVTGAAAWCRLFDETMAGLRIPLDDSRLTVGEALNR
FT                   LSDPDRAVRERAARAIGAVFGDNIRLFSLITNTLAKDKAISDSLRHYPRPGSYRNRSNM
FT                   VEDEVVDALVQAVTTDYPRLSHRYYALKAKWLGLEKLEHWDRNAPLPSADDRIIPWDQA
FT                   TRQVLAAYEAFDPRMGTVARRFFDHAWIDAAPAPGKASGAFAHPTVPSVHPYLLLNYHG
FT                   RTRDVMTLAHELGHGVHQVLAAPHGYLMSGTPLTLAETASVFGEMLTFRALLDAETDPA
FT                   RRRLMLAAKVEDMLNTVVRQIAFYRFETLVHAERKSGELLPERIGAIWRQVQTESLGPA
FT                   FNFTPDYDVYWTYVPHFIHSPFYVYAYAFGDCLVNALYGVFQSGHAGFQDKYLDMLRAG
FT                   GTMRHRELLAPFGLDAADPGFWRKGLDVIAGFIDELERA"
FT   gene            complement(366983..371524)
FT                   /locus_tag="Gdia_0330"
FT   CDS_pept        complement(366983..371524)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0330"
FT                   /product="Glutamate synthase (ferredoxin)"
FT                   /EC_number="1.4.7.1"
FT                   /note="PFAM: glutamine amidotransferase class-II; glutamate
FT                   synthase alpha subunit domain protein; ferredoxin-dependent
FT                   glutamate synthase; glutamate synthase; KEGG: gdi:GDI2111
FT                   putative glutamate synthase [NADPH] large chain precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50126"
FT                   /db_xref="GOA:B5ZLJ7"
FT                   /db_xref="InterPro:IPR002489"
FT                   /db_xref="InterPro:IPR002932"
FT                   /db_xref="InterPro:IPR006982"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR036485"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZLJ7"
FT                   /protein_id="ACI50126.1"
FT                   /translation="MDQFPQQDVTPDRDFVAEWHDNARRIAGLYDSSQEHDACGVGLVA
FT                   SLDGRKRREVVEAGIAALKAVWHRGAVDADGKTGDGAGIHVEIPQDFFADAIHSGGEGC
FT                   VDSQIAVGMVFLPKTDLSAQERCRQIIETEILAFGYGIYGWRQVPIDTACIGEKANATR
FT                   PEIEQIMIRNLLGHDEETFERDLYVIRRRIEKSAIANQVDLYICSMSCRSVIYKGMFLA
FT                   EHLTNFYPDLLDERFVSRFAIYHQRYSTNTFPTWKLAQPFRRLAHNGEINTISGNANWM
FT                   KSHETRLADPVLDPYMEDLKPVVQAGGSDTATLDNVYELLTFAGRDAPMAKALMIPASV
FT                   GENSAMPQKHKDMYAYCNAVMEPWDGPAALCATDGRWVVAGLDRSGLRPLRYTVTANGL
FT                   LIVGSETGMVTVPEADIVRRGRLGPGQTIGLDLQEGKLYGNEALLDLMSARRDFGAWVR
FT                   HIQKIGSVVRADVQEPVLYSRDELRRRQLAVGTTLEELETILHPMVESAAEAIGSMGDD
FT                   APLAVLSSRYRGLAHYFRQAFSQVTNPPIDSLRETRVMSLVTRLGNLGNILEESEAQCD
FT                   LLQLPSPVLTTGEFEALRSFCGDSGFVIDCTFPAADGEAGLRDAIARIRQEAEDRVREG
FT                   CTHLFLTDQAQSADRAYIPMILATAAVHTHLVRHSLRTFTSLNVRSAEALDVHAIAVTI
FT                   GVGATSVNPYLAQESIADRQRRGLFGDMSLREAVERYRKAVDKGLLKVMSKMGISIVSA
FT                   YRGGYNFEAIGLSRALTAEFFPGMPSRISGIGLSGISTNVLSFHQTAWNQAITPLPVGG
FT                   QYKLRRNGEVHAFDGNLIHMLQTAVASDSFSIYRRYADAVRRQPPVALRDLLDFKGGRT
FT                   PIPVEAVESITQLRKRLIAPGISLGALSPEAHETLSIAMNRIGARSDSGEGGEDPARAR
FT                   PRSNGDNASSAIKQIASGRFGVTAQYLNDCREIEIKMAQGAKPGEGGQLPGFKVTGLIA
FT                   KLRHATPGVTLISPPPHHDIYSIEDLAQLIYDLKQINPEATVTVKLVARSGIGTIAAGV
FT                   AKAKADAILISGHSGGTGASPQSSVKYAGLPWELGLAEAHQVLMLNRLRHRVKLRTDGG
FT                   LKTGRDVVIAAMLGAEEFGIGTASLVAMGCIMVRQCHSNTCPVGVCTQDEALREKFEGT
FT                   PEKVINLFSFIAEDVRNILASLGFSTLNEVIGRTDLLRQVSRGADYLDDLDLNSLLAQA
FT                   DPGPHARYCTLEGRNEVPETLDGQMIADARPLFDHGEKMQLHYNVQNTHRAIGTRISSL
FT                   IVRQFGMTRLAPGHLTVRLRGSAGQSLGAFAVQGLKLEVLGDANDYVGKGLSGATIVVR
FT                   QPASSNLVSNENAIIGNTVLYGATSGALYAAGQAGERFAVRNSGAVAVVEGCGSNGCEY
FT                   MTGGTVVILGEAGDNFGAGFTGGMAFVYDEKGTFEQRINPDTLLWERVADPKWEAVLRD
FT                   LVQTHARETHSRYAELLLHKWDQVLPRFWHLVPRDYAKAIGYVPATEAARSA"
FT   gene            complement(371530..372984)
FT                   /locus_tag="Gdia_0331"
FT   CDS_pept        complement(371530..372984)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0331"
FT                   /product="glutamate synthase, small subunit"
FT                   /note="TIGRFAM: glutamate synthase, small subunit; PFAM:
FT                   FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; KEGG: gdi:GDI2112 glutamate synthase
FT                   [NADPH] small chain"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50127"
FT                   /db_xref="GOA:B5ZLJ8"
FT                   /db_xref="InterPro:IPR006006"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR028261"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZLJ8"
FT                   /protein_id="ACI50127.1"
FT                   /translation="MAERMLKFVSVAQSQPDKRPAAERNADFDEIYRAFAVGKAEQQAS
FT                   RCSQCGVPFCSIHCPLGNNIPDWLKMTAEGRLEEAYALSSATNNFPEICGRICPQDRLC
FT                   EGNCVIEKGFESVTIGAVERFITDTAFASGWVEPIRPPVERQTSIGIIGAGPGGLAAAM
FT                   QLREQGHQVHVYDRYDRVGGLMIYGIPGFKLEKDIVARRHLYLEESGVRFHLGQNVADA
FT                   DGEGQVSFATLGARHDAVLIATGVYKSRDIGGPGAGLAGIVKALDYLTVSNRLSLGDDV
FT                   AASESAMLNAKGKSVVVIGGGDTAMDCVRTAIRQGAKSVKCLYRRDRANMPGSIREVKN
FT                   AEEEGVEFVWLAAPEAFLGDGTVTGVRAVRMKLGLPDASGRQSVEPVEDSSFVLEAGLV
FT                   IKALGFDPEPLPTLWGQPDLAVSRWGTLRIDHESFMTSLPGVFAAGDIVRGASLVVWAI
FT                   RDGRDAATQMHRWLENRAAACAQAAE"
FT   gene            complement(373194..374117)
FT                   /locus_tag="Gdia_0332"
FT   CDS_pept        complement(373194..374117)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0332"
FT                   /product="NADH dehydrogenase (ubiquinone)"
FT                   /EC_number="1.6.5.3"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase;
FT                   short-chain dehydrogenase/reductase SDR; 3-beta
FT                   hydroxysteroid dehydrogenase/isomerase;
FT                   dTDP-4-dehydrorhamnose reductase; Male sterility domain;
FT                   KEGG: gdi:GDI2113 putative NAD-dependent
FT                   epimerase/dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50128"
FT                   /db_xref="GOA:A9HKL6"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A9HKL6"
FT                   /protein_id="ACI50128.1"
FT                   /translation="MATRKVAAVIGGSGFLGRYVVRRLAEDGYVVRVAARRADLAAALR
FT                   PLGDVGQIVPLGASILDEDSLVPVVESAQVVVNLVGILAERGRATFQAVHVDGAARVAR
FT                   LAASAGVGRLLHVSAIGASPDSRSAYGRSKAAGEEAVLRNMPEATIVRPSILFGPEDRF
FT                   TNLFAALARYSPVMPVYGAATRIQPVYAADVAEGIRRILAGEGHSGEIYEFGGPAIWTM
FT                   EGVMRWIVATLGRSRLIFPMPGALAWWQAMWLEHLPGRMLTRDQLTMLSVDNVASEGTP
FT                   GLRLLGIDAVPMEMIAPSYLSRYKIT"
FT   gene            374369..374455
FT                   /locus_tag="Gdia_R0005"
FT                   /note="tRNA-Leu2"
FT   tRNA            374369..374455
FT                   /locus_tag="Gdia_R0005"
FT                   /product="tRNA-Leu"
FT   gene            374635..374721
FT                   /locus_tag="Gdia_R0006"
FT                   /note="tRNA-Leu3"
FT   tRNA            374635..374721
FT                   /locus_tag="Gdia_R0006"
FT                   /product="tRNA-Leu"
FT   gene            374949..375581
FT                   /locus_tag="Gdia_0333"
FT   CDS_pept        374949..375581
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0333"
FT                   /product="3'-5' exonuclease"
FT                   /note="PFAM: 3'-5' exonuclease; KEGG: gdi:GDI2114 putative
FT                   ribonuclease D"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50129"
FT                   /db_xref="GOA:B5ZLK0"
FT                   /db_xref="InterPro:IPR002562"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZLK0"
FT                   /protein_id="ACI50129.1"
FT                   /translation="MTAPATPSILLHRGDLADDVVFHGSIAVDTEAMGLNPHRDRLCLV
FT                   QISAGDGSAHLVQILPGTPSPNLARLMADPSITKLMHFARFDVAILQHSLGVTVAPVIC
FT                   TKIASKLVRTFTERHGLAQLCRELLGVDLSKQQQTSDWGAPELTPEQKAYAASDVLHLH
FT                   ALWTKLEALLHREGRRDLAQACYDFLPTRARLDLLGYEDPDIFAHRA"
FT   gene            375652..376713
FT                   /locus_tag="Gdia_0334"
FT   CDS_pept        375652..376713
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0334"
FT                   /product="KpsF/GutQ family protein"
FT                   /EC_number="5.3.1.13"
FT                   /note="KEGG: gdi:GDI2115 putative arabinose 5-phosphate
FT                   isomerase; TIGRFAM: KpsF/GutQ family protein; PFAM: CBS
FT                   domain containing protein; sugar isomerase (SIS)"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50130"
FT                   /db_xref="GOA:B5ZLK1"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR004800"
FT                   /db_xref="InterPro:IPR035474"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZLK1"
FT                   /protein_id="ACI50130.1"
FT                   /translation="MTQPAFHDDAGAPADEARIQSDITAACRVLARESDGLARLAAALR
FT                   APAVSDEPEGITPLGTAFARAVDAFSTLAGRVIVTGIGKSGHVGRKIQSTLASTGTPSV
FT                   FVHPSEASHGDLGMIQRGDAVLALSNSGETAELADIVAHARRYGLLLAAITAAPDSTLA
FT                   RAADIALIVPKAPEACPMGLAPTTSTTMQMALGDALAVVLLERRNFSATDFGVFHPGGR
FT                   LGTRLRRVSDLMHRGAAMPLGTPDIAMRQVIMEMTRKAFGCIGVVSPDGRLRGLITDGD
FT                   LRRALDRDLDSTLAADIMNPTPLTTGPDVLAAEALRLMNARARPITSLFVVDAAGLPVG
FT                   ILHIHDLLRAGVA"
FT   gene            376710..377519
FT                   /locus_tag="Gdia_0335"
FT   CDS_pept        376710..377519
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0335"
FT                   /product="protein of unknown function DUF1239"
FT                   /note="PFAM: protein of unknown function DUF1239; KEGG:
FT                   gdi:GDI2116 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50131"
FT                   /db_xref="GOA:B5ZLK2"
FT                   /db_xref="InterPro:IPR010664"
FT                   /db_xref="InterPro:IPR026265"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZLK2"
FT                   /protein_id="ACI50131.1"
FT                   /translation="MSASPPPPSRDPTAPRREDFARSADDVARQRTVLHHRTTRARHLP
FT                   NPDDIARRRMLVRWAKWVLPAAALALLGSIAAWPAIDRLVNAQRNALHEMENLRIESGN
FT                   MLGATYRGLDDHNRPYMITADQAQQVTPDRINLTGPVADTFTQGNDWLTIRSDQGVYMQ
FT                   HEQLLDLTRNVVLYRADGVIMTGVTADMDLKQGIVASDQWVHAEGPFGVLDAQGFILSQ
FT                   HEGIGLFRGPGRLILNDDSHAHPPAATPSSAAPPASSTPPARTEPTR"
FT   gene            377516..378604
FT                   /locus_tag="Gdia_0336"
FT   CDS_pept        377516..378604
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0336"
FT                   /product="OstA family protein"
FT                   /note="PFAM: OstA family protein; KEGG: gdi:GDI2117 organic
FT                   solvent tolerance protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50132"
FT                   /db_xref="InterPro:IPR005653"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZLK3"
FT                   /protein_id="ACI50132.1"
FT                   /translation="MTAFPKVATALLLGGVAACVAPMGARGQALDLSHGGQITVTAAGG
FT                   FDWDQKSQTVTAYDQAQAVRGNVTVTGDRLIAFYRKKAAAGAAQGGAPNNGAAAPASPP
FT                   PAAQAPAPQAPATQSTGNGTDSGSNEVYRLNAIGHVHIFTDTDQAWGDKAIYDIDQSVM
FT                   IMTGKAMKMVTPQDVLTARDSMEYYSQTRISIGRGNATVTTNDGRQIRADVLVGYSAPA
FT                   QPATQSPAQPPPSPPPGTQPGAAPGTGKDPLTSSGKLEKVNAFGHVFVRTQTETVTGDR
FT                   GVYVPDTGIARIVGNVHITRGQNQINGAAAIVNMHTGIATMTERAGSRVSGLIVPNEAN
FT                   SSPGGARPTQAGTKPGPAGKTP"
FT   sig_peptide     377516..377599
FT                   /locus_tag="Gdia_0336"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.899 at
FT                   residue 28"
FT   gene            378601..379392
FT                   /locus_tag="Gdia_0337"
FT   CDS_pept        378601..379392
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0337"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: gdi:GDI2118 putative ABC transporter ATP-binding
FT                   protein in RpoN region"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50133"
FT                   /db_xref="GOA:B5ZLK4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030921"
FT                   /db_xref="InterPro:IPR032823"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZLK4"
FT                   /protein_id="ACI50133.1"
FT                   /translation="MNEIPYELAGDMQGTAIAHGLPAADGLIANGIGKTYKKRPVVRNV
FT                   SIQVHRGEAVGLLGPNGAGKTTSFYMIVGLVQPDTGAITLDGTDITQLPMYRRARLGIG
FT                   YLPQEASIFRGLNVEQNIMAALEVVEADPERREAMLDGLLGEFGISHLRRAPSLALSGG
FT                   ERRRLEIARALASQPHYILLDEPLAGIDPIAVGEIRDLVSHLKDRGIGVLITDHNVRET
FT                   LEVIDRAYIMHSGQVLMEGRPEEIVANEDVRRVYLGENFSL"
FT   gene            379403..380779
FT                   /locus_tag="Gdia_0338"
FT   CDS_pept        379403..380779
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0338"
FT                   /product="RNA polymerase, sigma 54 subunit, RpoN"
FT                   /note="TIGRFAM: RNA polymerase sigma-54 factor, RpoN; PFAM:
FT                   sigma-54 factor; sigma-54 factor core-binding region;
FT                   sigma-54 DNA-binding domain protein; KEGG: gdi:GDI2119
FT                   putative RNA polymerase sigma-54 factor 1"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50134"
FT                   /db_xref="GOA:B5ZLK5"
FT                   /db_xref="InterPro:IPR000394"
FT                   /db_xref="InterPro:IPR007046"
FT                   /db_xref="InterPro:IPR007634"
FT                   /db_xref="InterPro:IPR038709"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZLK5"
FT                   /protein_id="ACI50134.1"
FT                   /translation="MTIGPRLALRQAQTLVMTPQLRQAIHLLQLSNLDACSFIEQELER
FT                   NPLLERANLAGLEELRPKVVAHGARHDPRLERVPDQDWAATTGTLPGPAPSLHERLAQQ
FT                   VRLSWRDAGDRLVGAYLITLLDADGRLVPPTAVIAQSLGTTFDHVERVRQTMMQFEPTG
FT                   LFAHDLGECLAAQLRERDRLDPAMAVLLRHLDLLARRDLRRLQGLCGVDAEDLADMIAE
FT                   VRTLSPRPARDFGDPAACSVIPDVLLQPAPDGDWMLELNPETMPSVVVNSALSTRVALR
FT                   ARREDRPFLNERLASANWLVRALQQRADTIIRVATAIMRRQRGFLDHGIGHLRPLVLRD
FT                   IAETVGLHESTVSRVTANKYIATPRGLFELKYFFTTAIPGRAGGADHSAEAIRHRIKTL
FT                   ISQESDGKILSDDAIVTRLRKEGIDISRRTVAKYRDALRIPNSAQRKRDKALIGLKPEA
FT                   "
FT   gene            380874..381461
FT                   /locus_tag="Gdia_0339"
FT   CDS_pept        380874..381461
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0339"
FT                   /product="sigma 54 modulation protein/ribosomal protein
FT                   S30EA"
FT                   /note="TIGRFAM: ribosomal subunit interface protein; PFAM:
FT                   sigma 54 modulation protein/ribosomal protein S30EA; KEGG:
FT                   gdi:GDI2120 sigma(54) modulation protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50135"
FT                   /db_xref="GOA:A9HKN3"
FT                   /db_xref="InterPro:IPR003489"
FT                   /db_xref="InterPro:IPR032528"
FT                   /db_xref="InterPro:IPR034694"
FT                   /db_xref="InterPro:IPR036567"
FT                   /db_xref="InterPro:IPR038416"
FT                   /db_xref="UniProtKB/TrEMBL:A9HKN3"
FT                   /protein_id="ACI50135.1"
FT                   /translation="MQISVAGKQIDLSDALKHRVTAHLDRLADKFFDRALDAQVTFSRA
FT                   RSFFTCDINLHAARGLTLRGEGEAADAHGAFDDAAEHIARRLRRYRERVNDHIRTLPRR
FT                   KTPEVGRSYILRPAESDGRVRGEAMHDTGPYATIVAERAAEIATLSVSEAVMRLDLAAS
FT                   TLLMFRNSTSDQINVIYRRQDGNIGWLDPSPA"
FT   gene            complement(381532..381795)
FT                   /locus_tag="Gdia_0340"
FT   CDS_pept        complement(381532..381795)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0340"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gdi:GDI2121 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50136"
FT                   /db_xref="InterPro:IPR009531"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZLK7"
FT                   /protein_id="ACI50136.1"
FT                   /translation="MRITTQNGRVVLQADQTSLPADVHHLTDTQLLSLGVSRMAYIKAV
FT                   VIEGQDVFAIHAADGTPMALTEDEATAIEAILQHEMVPALVH"
FT   gene            complement(381909..382397)
FT                   /locus_tag="Gdia_0341"
FT   CDS_pept        complement(381909..382397)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0341"
FT                   /product="heat shock protein Hsp20"
FT                   /note="PFAM: heat shock protein Hsp20; KEGG: gdi:GDI2122
FT                   putative small heat shock protein IbpA"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50137"
FT                   /db_xref="InterPro:IPR002068"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="InterPro:IPR037913"
FT                   /db_xref="UniProtKB/TrEMBL:A9HKN9"
FT                   /protein_id="ACI50137.1"
FT                   /translation="MSGRLFASPMFLGFDHLEQMLERASKGTADGYPPYNIEQISPTAL
FT                   RITLAVAGFVMEDLQITQEDNQLVIRGRQTDDSQGRVFLHRGIAARQFQKAFVLAEGIE
FT                   VGNAWLDNGLLHIDLLRPQPEVRVRRIEITQGRASAPPAEIDLPKVRAQRVVRVIEED"
FT   gene            382737..385748
FT                   /locus_tag="Gdia_0342"
FT   CDS_pept        382737..385748
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0342"
FT                   /product="CRISPR-associated protein, Csn1 family"
FT                   /note="TIGRFAM: CRISPR-associated protein, Csn1 family;
FT                   KEGG: gdi:GDI2123 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50138"
FT                   /db_xref="GOA:B5ZLK9"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="InterPro:IPR028629"
FT                   /db_xref="InterPro:IPR033114"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR040619"
FT                   /db_xref="InterPro:IPR041383"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZLK9"
FT                   /protein_id="ACI50138.1"
FT                   /translation="MIDESLTFGIDLGIGSCGWAVLRRPSAFGRKGVIEGMGSWCFDVP
FT                   ETSKERTPTNQIRRSNRLLRRVIRRRRNRMAAIRRLLHAAGLLPSTDSDALKRPGHDPW
FT                   ELRARGLDKPLKPVEFAVVLGHIAKRRGFKSAAKRKATNISSDDKKMLTALEATRERLG
FT                   RYRTVGEMFARDPDFASRRRNREGKYDRTTARDDLEHEVHALFAAQRRLGQGFASPELE
FT                   EAFTASAFHQRPMQDSERLVGFCPFERTEKRAAKLTPSFERFRLLARLLNLRITTPDGE
FT                   RPLTVDEIALVTRDLGKTAKLSIKRVRTLIGLEDNQRFTTIRPEDEDRDIVARTGGAMT
FT                   GTATLRKALGEALWTDMQERPEQLDAIVQVLSFFEANETITEKLREIGLTLAVLDVLLT
FT                   ALDAGVFAKFKGAAHISTKAARNLLPHLEQGRRYDEACTMAGYDHAASRLSHHGQIVAK
FT                   TQFNALVTEIGESIANPIARKALIEGLKQIWAMRNHWGLPGSIHVELARDVGNSIEKRR
FT                   EIEKHIEKNTALRARERREVHDLLDLEDVNGDTLLRYRLWKEQGGKCLYTGKAIHIRQI
FT                   AATDNSVQVDHILPWSRFGDDSFNNKTLCLASANQQKKRSTPYEWLSGQTGDAWNAFVQ
FT                   RIETNKELRGFKKRNYLLKNAKEAEEKFRSRNLNDTRYAARLFAEAVKLLYAFGERQEK
FT                   GGNRRVFTRPGALTAALRQAWGVESLKKQDGKRINDDRHHALDALTVAAVDEAEIQRLT
FT                   KSFHEWEQQGLGRPLRRVEPPWESFRADVEATYPEVFVARPERRRARGEGHAATIRQVK
FT                   ERECTPIVFERKAVSSLKEADLERIKDGERNEAIVEAIRSWIATGRPADAPPRSPRGDI
FT                   ITKIRLATTIKAAVPVRGGTAGRGEMVRADVFSKPNRRGKDEWYLVPVYPHQIMNRKAW
FT                   PKPPMRSIVANKDEDEWTEVGPEHQFRFSLYPRSNIEIIRPSGEVIEGYFVGLHRNTGA
FT                   LIPTPVGPDSYVIA"
FT   mobile_element  385708..386883
FT                   /mobile_element_type="insertion sequence:Gdi4"
FT   gene            385810..386867
FT                   /locus_tag="Gdia_0343"
FT                   /note="ribosomal slippage"
FT   CDS_pept        join(385810..386298,386298..386867)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /ribosomal_slippage
FT                   /locus_tag="Gdia_0343"
FT                   /product="transposase IS630"
FT                   /note="KEGG: gdi:GDI3803 putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50139"
FT                   /db_xref="GOA:B5ZDV9"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR025959"
FT                   /db_xref="InterPro:IPR038717"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZDV9"
FT                   /protein_id="ACI50139.1"
FT                   /translation="MGGALALREDYDAAGLRALARTTRHAGQARRLLALAAIYDGASRG
FT                   DAARLAGTDRQIVRDWVVRFNAEGPDGVRDHHGGGVVPRLTPAMLEALMRRIEDGPIAA
FT                   VHGVVRWRQADLGQWLYEEFGVSLSRSRLSAVIRGLDFRLLTGRPRHHAQDPEAQDVFK
FT                   KSFPDVMAGIRARHPGKAIELWWGDEARVGQKTKLTRRWARRGTRPRAPADQRTRSAWI
FT                   FGAICPALGKGAALVLPWCNLHAMNRHLDEISQAVAPGAHAILIVDQAAWHTSPKLDIP
FT                   ANITILPLPPRSPELNPVENVWQFMRNTWLSNRIFRTYDDIVDICCHAWNQLVDQPWRI
FT                   MSLGLRQWAHGF"
FT   gene            387014..387907
FT                   /locus_tag="Gdia_0344"
FT   CDS_pept        387014..387907
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0344"
FT                   /product="CRISPR-associated protein Cas1"
FT                   /note="TIGRFAM: CRISPR-associated protein Cas1; KEGG:
FT                   gdi:GDI2124 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50140"
FT                   /db_xref="GOA:B5ZLL1"
FT                   /db_xref="InterPro:IPR002729"
FT                   /db_xref="InterPro:IPR019855"
FT                   /db_xref="InterPro:IPR042206"
FT                   /db_xref="InterPro:IPR042211"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZLL1"
FT                   /protein_id="ACI50140.1"
FT                   /translation="MAWRGVHISHPSRLTHRNRQLVVAQDGGEVSLAVEDIACLILDTR
FT                   QVSITGSLLSALAENGVAMIVPDARHHPAGILLPFHQHHAQAHIAHAQISISQPLKKRL
FT                   WQTLVVAKIRNQAALLDQLGRPQGQTIAAMAGRVASGDPGNVEAQAARAYWASLFSDFT
FT                   RANENDRRNALLNYGYAIMRAAIARACVALGLLPAFGVHHASKTNAFNLVDDLIEPFRP
FT                   FVDRMAHDRALEHVGDTLSIEDRRQMSTILNDNAAIGRERMTVLAATEAVAMSVVRAIE
FT                   HGSAALLSTPTLKARD"
FT   gene            387917..388246
FT                   /locus_tag="Gdia_0345"
FT   CDS_pept        387917..388246
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0345"
FT                   /product="CRISPR-associated protein Cas2"
FT                   /note="TIGRFAM: CRISPR-associated protein Cas2; KEGG:
FT                   gdi:GDI2125 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50141"
FT                   /db_xref="GOA:A9HKP7"
FT                   /db_xref="InterPro:IPR019199"
FT                   /db_xref="InterPro:IPR021127"
FT                   /db_xref="UniProtKB/TrEMBL:A9HKP7"
FT                   /protein_id="ACI50141.1"
FT                   /translation="MKAEDIRFMWLLVFFDLPVRTKEQRRRASRFRHFLKDDGFLMLQF
FT                   SVYARICRGQDAVEKHVRRVRSNLPKEGSVRTLQITDRQYGRMELMLGLAPKTERIGPS
FT                   QMVLL"
FT   repeat_region   388303..388602
FT                   /rpt_unit_range=388303..388338
FT                   /note="CRISPR Recognition Tool, Bland et al. 2007"
FT   gene            388735..389274
FT                   /locus_tag="Gdia_0346"
FT   CDS_pept        388735..389274
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0346"
FT                   /product="peptide deformylase"
FT                   /EC_number="3.5.1.88"
FT                   /note="KEGG: gdi:GDI2127 peptide deformylase; TIGRFAM:
FT                   peptide deformylase; PFAM: formylmethionine deformylase"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50142"
FT                   /db_xref="GOA:A9HKQ2"
FT                   /db_xref="InterPro:IPR023635"
FT                   /db_xref="InterPro:IPR036821"
FT                   /db_xref="UniProtKB/TrEMBL:A9HKQ2"
FT                   /protein_id="ACI50142.1"
FT                   /translation="MIDRDAIAAAIPMPILVAPQAILRQKARPVRPEDAAGVRDALPRM
FT                   FAAMYQAPGIGLAAPQVGMGLRFAIVDLGEEGERQPLILINPDVIAESDSLASREEGCL
FT                   SLPNQYAEVIRPDRVRVRYRTLDGTEEELEADGLLATCIQHEIDHLEGILFVDHLSTLK
FT                   RNMIMRRLAKEQRQKR"
FT   gene            389320..390237
FT                   /locus_tag="Gdia_0347"
FT   CDS_pept        389320..390237
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0347"
FT                   /product="methionyl-tRNA formyltransferase"
FT                   /note="TIGRFAM: methionyl-tRNA formyltransferase; PFAM:
FT                   formyl transferase domain protein; KEGG: gdi:GDI2128
FT                   methionyl-tRNA formyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50143"
FT                   /db_xref="GOA:A9HKQ4"
FT                   /db_xref="InterPro:IPR001555"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR005793"
FT                   /db_xref="InterPro:IPR005794"
FT                   /db_xref="InterPro:IPR011034"
FT                   /db_xref="InterPro:IPR036477"
FT                   /db_xref="InterPro:IPR037022"
FT                   /db_xref="InterPro:IPR041711"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9HKQ4"
FT                   /protein_id="ACI50143.1"
FT                   /translation="MRLAFMGTPDFAVPALHALHEAGHEIAVVYSQPPRPAGRGQAVRP
FT                   QPVHLAAEALGIPVRVPTRLRANHDEHAFFRALDLDAAVVAAYGLILPGAMLDAPRRGC
FT                   LNVHASLLPRWRGAAPIQAAILAGDDESGVTIMQMDEGLDTGAMLLTGRVALTPATTAS
FT                   TLHDDLAAMGGRLIVAALANSETAAIPQPAEGATYAARLTREDGRIDWTRDAVDIDRQV
FT                   RALTPWPGTFTTLDGTVLKIGAATPIDGPRDAVPGTVLDDRLTVACGQGTLRLTRIQRP
FT                   GRGMMEADAFLRGQPVPVGTRLGS"
FT   gene            390234..391010
FT                   /locus_tag="Gdia_0348"
FT   CDS_pept        390234..391010
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0348"
FT                   /product="tRNA pseudouridine synthase A"
FT                   /EC_number="5.4.99.12"
FT                   /note="KEGG: gdi:GDI2129 putative tRNA pseudouridine
FT                   synthase A; TIGRFAM: tRNA pseudouridine synthase A; PFAM:
FT                   tRNA pseudouridine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50144"
FT                   /db_xref="GOA:A9HKQ8"
FT                   /db_xref="InterPro:IPR001406"
FT                   /db_xref="InterPro:IPR020095"
FT                   /db_xref="InterPro:IPR020097"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/TrEMBL:A9HKQ8"
FT                   /protein_id="ACI50144.1"
FT                   /translation="MTAPSLQRWAVRIEYDGRPFVGWQRQITGLSVQQVLEEAASRLAS
FT                   GRVVPSITAGRTDAGVHATGQAAHLDFPGDVRLNDSTVRDALNFHMKPYPVAVLRACPV
FT                   DTEWSARFSAIRRSYRYRILNRRSRPTLDDGRVWLVKRTLDEAAMARAARLLLGRHDFT
FT                   SFRASACQARSPLRTLDRLGVVRQGEEIVIEAEARSFLHHQVRNMVGTLKLVGEGLWAP
FT                   DRVAAALAACDRRAAGPTAPPDGLYLTGVGYDPDPF"
FT   gene            complement(391017..391655)
FT                   /locus_tag="Gdia_0349"
FT   CDS_pept        complement(391017..391655)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0349"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gdi:GDI2130 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50145"
FT                   /db_xref="GOA:B5ZLL6"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZLL6"
FT                   /protein_id="ACI50145.1"
FT                   /translation="MMQGRGVPQGPLPNSAGGIFRGMMLLGRGRREGLNCFGATQDSVL
FT                   TALAPRVALWLVGALLTLVQAPTGLSGTKILFSLCLVLTPIIVTHQLARLWGREALWPR
FT                   YMTAALWCDWLVLFVMLIAVAVVAMVLPAGLNAVHSALILNGIVFAYNLWLTWFIARVG
FT                   LALGVWRAILVVLAVAAAILVLGEAAAVLPPHYAPWQDFLALPSAHAPQ"
FT   gene            complement(391652..392809)
FT                   /locus_tag="Gdia_0350"
FT   CDS_pept        complement(391652..392809)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0350"
FT                   /product="succinyl-diaminopimelate desuccinylase"
FT                   /note="TIGRFAM: succinyl-diaminopimelate desuccinylase;
FT                   PFAM: peptidase M20; peptidase dimerisation domain protein;
FT                   KEGG: gdi:GDI2131 putative succinyl-diaminopimelate
FT                   desuccinylase"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50146"
FT                   /db_xref="GOA:A9HKR2"
FT                   /db_xref="InterPro:IPR001261"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR005941"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9HKR2"
FT                   /protein_id="ACI50146.1"
FT                   /translation="MTGALTPASTPALTLARDLIRAPSVTPDDGGAIGVLTAALRGLGF
FT                   DVTDLPFGEGPARTPNLFARLGRSGPHLCFAGHTDVVPPGDGGWTSGPFEAALRDGRLY
FT                   GRGACDMKGGIAAFVGAVARILESGRTLRGSVSLLITGDEEGPATFGTVKVLEWMAAHG
FT                   QVPDFCVVGEPTNPDHLGDVIKIGRRGSLNARIVVPGIQGHVAYPHRADNPVHRLLAIL
FT                   SDLTARPLDQGTEWFEPSSLQVTTVDVGNEATNVIPGRATARLNIRFNDLHTGQGLADW
FT                   IRGVAHVHAPGAEVTVQISGEAFRTEPTPELDMLAASIQAVTGRAPRLDTGGGTSDARF
FT                   ISRYCPVAEFGLVGASMHKVDEHVPVADLLALTDIYAAFLERLMG"
FT   gene            complement(392806..393651)
FT                   /locus_tag="Gdia_0351"
FT   CDS_pept        complement(392806..393651)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0351"
FT                   /product="2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
FT                   N-succinyltransferase"
FT                   /EC_number="2.3.1.117"
FT                   /note="TIGRFAM:
FT                   2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
FT                   N-succinyltransferase; KEGG: gdi:GDI2132
FT                   2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
FT                   N-succinyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50147"
FT                   /db_xref="GOA:B5ZLL8"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005664"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR023180"
FT                   /db_xref="InterPro:IPR037133"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZLL8"
FT                   /protein_id="ACI50147.1"
FT                   /translation="MNDEHALRTHIEAAWERRDTLSSATKGADREAVEHALAGLDSGAL
FT                   RVATPTDAGWVVNEWLKKAVLLSFRLNDSHVMPAAPAPFFDKVPLKFQGWDEAQFGQAA
FT                   FRAVPGAIVRRSAYIAPGVVLMPSFVNAGARVESGTMVDTWVTIGSCAQIGRNCHISGG
FT                   VGIGGVLEPLQAAPVIIEDDCFIGARSEVAEGVIVERGSVLSMGVFLSASTKIVDRTTG
FT                   EVFVGRVPAYSVVVPGTLPPRTPHAADGTPLPALACAVIVKRVDERTRSKTSINELLRD
FT                   "
FT   gene            complement(393778..394719)
FT                   /locus_tag="Gdia_0352"
FT   CDS_pept        complement(393778..394719)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0352"
FT                   /product="acetylglutamate kinase"
FT                   /note="TIGRFAM: acetylglutamate kinase; PFAM:
FT                   aspartate/glutamate/uridylate kinase; KEGG: gdi:GDI2133
FT                   putative acetylglutamate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50148"
FT                   /db_xref="GOA:A9HKR8"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001057"
FT                   /db_xref="InterPro:IPR004662"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR037528"
FT                   /db_xref="InterPro:IPR041727"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9HKR8"
FT                   /protein_id="ACI50148.1"
FT                   /translation="MSESQSEFPGGGTTGDIVRTMQEAQERAAVLAQALPFLRRYAGDT
FT                   IVVKYGGHAMVDDSLSNAFGHDIALLKLVGVNPVIVHGGGPQISAMLTRLQIPSTFVDG
FT                   LRVTDAAMVDVIEMVLAGKVNKQVAGLINQAGALAVGISGKDGGLITARRLQRTTRDAS
FT                   GQERALDLGFVGEPTHIDPRVLYALSGSGLIPVVAPVGIGEAGETYNINADTAAGAIAG
FT                   AVHATRLLMLTDVPGVLDETGALIPELTAEEARRGIASGMISGGMIPKVETCLEAVRSG
FT                   ARAAVILDGRVPHACLLELFTEAGPGTLIRGE"
FT   gene            complement(394760..395431)
FT                   /locus_tag="Gdia_0353"
FT   CDS_pept        complement(394760..395431)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0353"
FT                   /product="GTP-binding protein HSR1-related"
FT                   /note="PFAM: GTP-binding protein HSR1-related; KEGG:
FT                   gdi:GDI2134 GTP-binding protein EngB"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50149"
FT                   /db_xref="GOA:A9HKS1"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR019987"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030393"
FT                   /db_xref="UniProtKB/TrEMBL:A9HKS1"
FT                   /protein_id="ACI50149.1"
FT                   /translation="MSDFNATPRTPDEEERLLEAGRLLFAGPCDFFFGAQKLEQLPPPG
FT                   APEIAFAGRSNVGKSSLINALTGRRALARASSEPGRTKQLNFFDLGGRLTLVDMPGYGY
FT                   ARAAKDVKEDWQGMMFAYLRGRPTLQRVILLLDSRIELKASDREIMTLLDRAAVTFQIV
FT                   LTKCDAPRPGALEAKRSQAADLARQHPAAYPGTFATSSDTGLGIPELRAELAALALPQA
FT                   G"
FT   gene            complement(395445..397214)
FT                   /locus_tag="Gdia_0354"
FT   CDS_pept        complement(395445..397214)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0354"
FT                   /product="60 kDa inner membrane insertion protein"
FT                   /note="PFAM: 60 kDa inner membrane insertion protein; KEGG:
FT                   gdi:GDI2135 putative inner membrane protein OxaA"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50150"
FT                   /db_xref="GOA:B5ZLM1"
FT                   /db_xref="InterPro:IPR001708"
FT                   /db_xref="InterPro:IPR019998"
FT                   /db_xref="InterPro:IPR028053"
FT                   /db_xref="InterPro:IPR028055"
FT                   /db_xref="InterPro:IPR038210"
FT                   /db_xref="InterPro:IPR038221"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZLM1"
FT                   /protein_id="ACI50150.1"
FT                   /translation="MDTKRFIVATLLSAMVLVGFEYFMPKQAHHEVAQQAAQTSRQTPP
FT                   TDAARAPAPVAGASSQPVSTPAPQAETRLAIDAPKVAGSIDLLGARLDDMVLRDYHETV
FT                   AKGSPQVRILEPGHDQQPNYVEIGWMNLPGGQVRVPDATTVWSADAPKLTSDRPVTLSW
FT                   DNGAGVTFQIVVSIDAHYMFGIEQRIVNRSAQPVSLYPYARVDRAYTPTETGGYLVHEG
FT                   PISVIDGRLDESSYKSLRTGATPPGNLSWTKGGQGGWAGITDKYWLTAVIPQQGTAVTG
FT                   SYGYQANGGAGVYQVGFIAQAATVVAPGTTGATVSHVFAGAKEVNLLEQYQSSLHIPDF
FT                   WKAVDFGWFAFLTRPIFYVLDWLNTLLGNFGLALMAFTLLVKALFFPLATRQFRSMAKM
FT                   RQLQPKVQELRERYKSDQMALNQNMMALYKAEGVNPAAGCLPMVVQIPVFWSLYKDLYI
FT                   TIEMRHAPFFGWIHDLSAPDLTNLFNLFGLIPWDPNVLSPYLQLGVWPILFGATMFLQQ
FT                   KLNPAPTDPAQQRMFQMMPVLFTFFMARQPAGLVIYYCWNNLLTVAQQMVIQRRMKSAV
FT                   DKVGAIPAAAGRK"
FT   gene            complement(397236..397475)
FT                   /locus_tag="Gdia_0355"
FT   CDS_pept        complement(397236..397475)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0355"
FT                   /product="protein of unknown function DUF37"
FT                   /note="PFAM: protein of unknown function DUF37; KEGG:
FT                   pap:PSPA7_3242 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50151"
FT                   /db_xref="GOA:B5ZLM2"
FT                   /db_xref="InterPro:IPR002696"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZLM2"
FT                   /protein_id="ACI50151.1"
FT                   /translation="MIGAIRVYQWVLSPVLGPNCRFVPSCSNYAVEAVRRHGPFRGAIL
FT                   AAWRILRCNPWNIGGYDPVPSRERARRSCCSSHR"
FT   gene            complement(397496..397846)
FT                   /locus_tag="Gdia_0356"
FT   CDS_pept        complement(397496..397846)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0356"
FT                   /product="ribonuclease P protein component"
FT                   /note="TIGRFAM: ribonuclease P protein component; PFAM:
FT                   ribonuclease P protein; KEGG: gdi:GDI2137 ribonuclease P
FT                   protein component"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50152"
FT                   /db_xref="GOA:A9HKS8"
FT                   /db_xref="InterPro:IPR000100"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9HKS8"
FT                   /protein_id="ACI50152.1"
FT                   /translation="MADRAHRLKKRAEFLKVASRGRKVPSPGLVLQALGRDDSDPARIG
FT                   FTVTKKVGNAVVRNRTRRRLREAVRVVEREEPLNGVDLVLIGRDGTRGRTFAALVGDLR
FT                   RTLRKAGVRGAE"
FT   gene            complement(397911..398045)
FT                   /locus_tag="Gdia_0357"
FT   CDS_pept        complement(397911..398045)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0357"
FT                   /product="ribosomal protein L34"
FT                   /note="PFAM: ribosomal protein L34; KEGG:
FT                   gbe:GbCGDNIH1_0723 LSU ribosomal protein L34P"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50153"
FT                   /db_xref="GOA:B5ZLM4"
FT                   /db_xref="InterPro:IPR000271"
FT                   /db_xref="InterPro:IPR020939"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZLM4"
FT                   /protein_id="ACI50153.1"
FT                   /translation="MKRTYQPSKLVRKRRHGFRARMETVGGRKVIANRRAKGRKRLSA"
FT   gene            398134..398340
FT                   /locus_tag="Gdia_0358"
FT   CDS_pept        398134..398340
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0358"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gdi:GDI2138 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50154"
FT                   /db_xref="UniProtKB/TrEMBL:A9HKT1"
FT                   /protein_id="ACI50154.1"
FT                   /translation="MTGPESDEKTRRVAATLHDVRGLLSPAMLSADGLTLHADPQVRAA
FT                   AEQIIQSIEQAVSRLKALGQPKK"
FT   gene            complement(398349..398738)
FT                   /locus_tag="Gdia_0359"
FT   CDS_pept        complement(398349..398738)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0359"
FT                   /product="lactoylglutathione lyase"
FT                   /EC_number="4.4.1.5"
FT                   /note="KEGG: gdi:GDI2139 putative lactoylglutathione lyase;
FT                   TIGRFAM: lactoylglutathione lyase; PFAM:
FT                   Glyoxalase/bleomycin resistance protein/dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50155"
FT                   /db_xref="GOA:A9HKT4"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR004361"
FT                   /db_xref="InterPro:IPR018146"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:A9HKT4"
FT                   /protein_id="ACI50155.1"
FT                   /translation="MGSYLHTMVRVRNLDASIAFYKLLGMHELRRREVPEGKYTLVFIG
FT                   YADNAAGQAEIELTYNWGQDDGYEVGTGFGHFAVGVPDVAAVAEAVRAGGGKVTREAGP
FT                   VKFGTTIIAFVEDPDGYKIELIQRP"
FT   gene            complement(398748..399596)
FT                   /locus_tag="Gdia_0360"
FT   CDS_pept        complement(398748..399596)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0360"
FT                   /product="protein of unknown function DUF1009"
FT                   /note="PFAM: protein of unknown function DUF1009; KEGG:
FT                   gdi:GDI2140 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50156"
FT                   /db_xref="InterPro:IPR010415"
FT                   /db_xref="InterPro:IPR041255"
FT                   /db_xref="UniProtKB/TrEMBL:A9HKT7"
FT                   /protein_id="ACI50156.1"
FT                   /translation="MSGRKNGPALSGECVGILAGGGPLPGQVARAAVAMGLRVFIVGFQ
FT                   DFAEPAIIEPWPHRYIRLAAAGEILSCLRAEQCRDLVLIGPVRRPSFSDLRPDATGARI
FT                   MARIGRALFSGDDGLLAAIVRVLAEEGFTIHGAHEFLSGSVGRRGVLGRVQPDAQAQAD
FT                   IGRGRAVVDAIGRLDIGQGCVVQDGLVLAVEAMEGTDRMLLRAGECRQPGRPGGVLVKM
FT                   LKPGQDRRADLPTIGPDTVRRAAQAGLRGIAFQAGATLLTDPDGCVAAANEAGLFLAGI
FT                   E"
FT   gene            complement(399597..400472)
FT                   /locus_tag="Gdia_0361"
FT   CDS_pept        complement(399597..400472)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0361"
FT                   /product="acyl-(acyl-carrier-protein)--UDP-N-acetylglucosamine
FT                   O-acyltransferase"
FT                   /EC_number="2.3.1.129"
FT                   /note="TIGRFAM:
FT                   acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine
FT                   O-acyltransferase; KEGG: gdi:GDI2141
FT                   acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine
FT                   O-acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50157"
FT                   /db_xref="GOA:B5ZLM8"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR010137"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR029098"
FT                   /db_xref="InterPro:IPR037157"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZLM8"
FT                   /protein_id="ACI50157.1"
FT                   /translation="MLTDLAGLDAETRAAEIHPSSIVASGARIGHGVRIGPWCSIGPDV
FT                   TIEDGVHLIANVIIDGHTHIGPGVVCFPFTTIGMAPQDLKYRGEPTRCTIGARTVIREN
FT                   VTIHRGTATGSGVTRVGDDCLIMANSHVAHDCTLGNGVIIVNNVVMGGHVTIGDHARIM
FT                   GAAALHQFVRIGRAALVGGVCGVEADVIPYGSVLGNRARLVGLHWIWLKRNGVQPDELH
FT                   LLRRAFRALYPRAMDEESTAFSRRLASVRADYGSDPKVAEILAFIEAPSHRGLVRVAGG
FT                   GAASIESDGV"
FT   gene            complement(400514..400999)
FT                   /locus_tag="Gdia_0362"
FT   CDS_pept        complement(400514..400999)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0362"
FT                   /product="beta-hydroxyacyl-(acyl-carrier-protein)
FT                   dehydratase FabZ"
FT                   /note="TIGRFAM: beta-hydroxyacyl-(acyl-carrier-protein)
FT                   dehydratase FabZ; PFAM:
FT                   Beta-hydroxyacyl-(acyl-carrier-protein) dehydratase
FT                   FabA/FabZ; KEGG: gdi:GDI2142 (3R)-hydroxymyristoyl-[acyl
FT                   carrier protein] dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50158"
FT                   /db_xref="GOA:A9HKU2"
FT                   /db_xref="InterPro:IPR010084"
FT                   /db_xref="InterPro:IPR013114"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9HKU2"
FT                   /protein_id="ACI50158.1"
FT                   /translation="MDKEVEVPPAGDSPTCIEAIDVMRIMEAIPHRYPFLLIDRMVDIV
FT                   LGSSAVGIKNVTASEPHFQGHFPARPVMPGVLIIEAMAQTAATLVVLTLGPAFEGKLVY
FT                   FMTIDGAKFRRPVGPGDQLRIHVEKERSRANVWKFKGIARVDGVSVAEATFSAMIMG"
FT   gene            complement(401104..402174)
FT                   /locus_tag="Gdia_0363"
FT   CDS_pept        complement(401104..402174)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0363"
FT                   /product="UDP-3-O-(3-hydroxymyristoyl) glucosamine
FT                   N-acyltransferase"
FT                   /note="TIGRFAM: UDP-3-O-[3-hydroxymyristoyl] glucosamine
FT                   N-acyltransferase; PFAM: transferase hexapeptide repeat
FT                   containing protein; UDP-3-O-[3-hydroxymyristoyl]
FT                   glucosamine N-acyltransferase LpxD; KEGG: gdi:GDI2143
FT                   putative UDP-3-O-[3-hydroxymyristoyl] glucosamine
FT                   N-acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50159"
FT                   /db_xref="GOA:A9HKU5"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR007691"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR020573"
FT                   /db_xref="UniProtKB/TrEMBL:A9HKU5"
FT                   /protein_id="ACI50159.1"
FT                   /translation="MERQDAALPGDRRFFERNGPFSLRALAECAGARVEGGDEADDAPR
FT                   YVGIAPLQSAGPQEVSFLDNRRYAPLLEQTRAGVVILAPAFVDRLPKGTVGLVCSTPYL
FT                   AWARVAGLFHPVPAAIPGIHPTAIVGAGADIDPSAQIGPFVTIGAGAQVGAGSRIDAYA
FT                   LIGDGVRIGAHCRIGSHASVSHALLGDRVTLLSGARIGQEGFGFAVGPDGFETVPQLGR
FT                   VVLEDGVEVGANSTIDRGSSQDTVIGAGSRLDNLVQIGHNARLGRCCIVVSQAGISGST
FT                   ELGDFVTIAAQAGLIGHIRVGTKARIGAQCGVMSDVEAGADVIGSPAMPFREFFRNVAV
FT                   LRRLAKKATQNGGGET"
FT   gene            complement(402189..403073)
FT                   /locus_tag="Gdia_0364"
FT   CDS_pept        complement(402189..403073)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0364"
FT                   /product="outer membrane chaperone Skp (OmpH)"
FT                   /note="PFAM: outer membrane chaperone Skp (OmpH); KEGG:
FT                   gdi:GDI2144 outer membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50160"
FT                   /db_xref="GOA:B5ZLN1"
FT                   /db_xref="InterPro:IPR005632"
FT                   /db_xref="InterPro:IPR024930"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZLN1"
FT                   /protein_id="ACI50160.1"
FT                   /translation="MLRSRGVSALVAAVVMSCAGLPSTAALAQGAAASGGNAGWFVPKS
FT                   AQPAAGTAAPRGPARTAPVPLPAAPADSDDAQSQTPPVLPMPPVPASPDIPRGVAPPVP
FT                   VIGVISVPDVMRLSSAAQQAERVLGARRDELARDAQKEQGGWRDEQQKLQAQAKNMASD
FT                   QIQLRERRLQERVIAAQRDFRNRNRIIQEAAQVSLNQIERELVQILRQVAGSRGMNLVL
FT                   HREQVALSQDGLDITQQVADQLNKVLPTVFIPAANVDPEELAKSGTMPTTADAGRQAAP
FT                   APTPAPVAATARH"
FT   sig_peptide     complement(402987..403073)
FT                   /locus_tag="Gdia_0364"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.941 at
FT                   residue 29"
FT   gene            complement(403081..405495)
FT                   /locus_tag="Gdia_0365"
FT   CDS_pept        complement(403081..405495)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0365"
FT                   /product="outer membrane protein assembly complex, YaeT
FT                   protein"
FT                   /note="TIGRFAM: outer membrane protein assembly complex,
FT                   YaeT protein; PFAM: surface antigen (D15); surface antigen
FT                   variable number repeat protein; KEGG: gdi:GDI2145 outer
FT                   membrane protein assembly factor YaeT precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50161"
FT                   /db_xref="GOA:B5ZLN2"
FT                   /db_xref="InterPro:IPR000184"
FT                   /db_xref="InterPro:IPR010827"
FT                   /db_xref="InterPro:IPR023707"
FT                   /db_xref="InterPro:IPR034746"
FT                   /db_xref="InterPro:IPR039910"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZLN2"
FT                   /protein_id="ACI50161.1"
FT                   /translation="MPTKRSTLLASVCLIPLFFAGAAEARQGVATRGPVAHTPTGGVIE
FT                   SIDISGNDRIETNTVLSYMVVQPGDPFNQDQLDRSLKTLYATGLFRDVTLHRAGNVLQV
FT                   HLVENPIVNRIVFEGNHAAKDEDLRKVIALRPRAVFSTQTTAADRQKILGVYAEKARYA
FT                   ATVTPQIIRLSHNRVDVVFQINEATQTLIKKISFVGNRAFSEARLAQVVSSKETAWYRF
FT                   FASSDEYNPERLRYDGELLRRFYLRNGFVDFQVKNATGELSPDRKSFYVTFTVDEGLRY
FT                   RLGRVNIRSSLKHVPAASLRKYIELFANQWYDGSAVQHNATDMEEILQGQGHPFAMVRP
FT                   EIARNPEKRTVDLLFDVSEGPRVYVERIDINGNTITEDKVIRRNLPMAEGDPYTPSERK
FT                   YAKAMLQDLGYFSSVSIDQSPGSAPDKINVAANLVEKPTGEFSLGGGYSTDVGILGNIG
FT                   LKQHNLLGSGVDAGISGTMAYYQRQADISVSDPYFLNRNMVAGVDIFAIQNNYQTYQNY
FT                   SEGRYGISFRMGYSYNNHLSQSFSYSLTDRDIDNAYSDASWYVLKQTGWSLLSQLSTTL
FT                   TYDTRDNRMNPHSGYVVRLAGDFAGIGGNERYLRGKLDAAYYIPLDDLMGNHDWTVALT
FT                   AGAGDIVNWGGGRSDIIDNFYLGGSTLRGFMDGGAGPRTMGIPAYTWQGVTYPMHSQED
FT                   FLGGRFMYTGSATVNFPMPLAADMGIKGRYFVDMGGLDGLRIPRRYTAYPQDMPYYTPV
FT                   YSDTIKPRVSTGVGFSWKSPFGLINIDLGIPVLKEKHDRTRLFRFGFGQQF"
FT   sig_peptide     complement(405418..405495)
FT                   /locus_tag="Gdia_0365"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.714 at
FT                   residue 26"
FT   gene            complement(405651..406754)
FT                   /locus_tag="Gdia_0366"
FT   CDS_pept        complement(405651..406754)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0366"
FT                   /product="membrane-associated zinc metalloprotease"
FT                   /note="KEGG: gdi:GDI2146 putative metalloprotease MmpA;
FT                   TIGRFAM: membrane-associated zinc metalloprotease; PFAM:
FT                   peptidase M50; SMART: PDZ/DHR/GLGF domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50162"
FT                   /db_xref="GOA:A9HKV2"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR004387"
FT                   /db_xref="InterPro:IPR008915"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="InterPro:IPR041489"
FT                   /db_xref="UniProtKB/TrEMBL:A9HKV2"
FT                   /protein_id="ACI50162.1"
FT                   /translation="MPDLLRTVLAFALVLGVLVFIHELGHYLAARWRGVHVEVFSIGFG
FT                   RPLLRWHDKVGTEWRICPLPLGGYVKPHGFEGPEEATPEQMAAWQPGRTFHDKPVLSRA
FT                   IVIVAGPVFNFLLAIVLFAGLFATVGRPEIRNVVGQVLPGSAAASAGVKPNDAIVRIGD
FT                   HVVADVADIQARISAEPGEKTVLTVRRAGQDVTLPVTVGSVTDSSGSHAGQLGVMFTAT
FT                   VGKPMALPAAIVAAGQETWHLVVQTLAGLWQMLTGQHSAKDLGGPLRIAQMSGQVAQYG
FT                   VASLVSFMALLSINLGLINLFPIPVLDGGRLVFYALEAVLGRPVSRRVRDISFQAGFAV
FT                   IAGLFLFSTFNDLSHFGLFRWVASLAG"
FT   gene            complement(406818..407975)
FT                   /locus_tag="Gdia_0367"
FT   CDS_pept        complement(406818..407975)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0367"
FT                   /product="1-deoxy-D-xylulose 5-phosphate reductoisomerase"
FT                   /EC_number="1.1.1.267"
FT                   /note="KEGG: gdi:GDI2147 putative 1-deoxy-D-xylulose
FT                   5-phosphate reductoisomerase; TIGRFAM: 1-deoxy-D-xylulose
FT                   5-phosphate reductoisomerase; PFAM: 1-deoxy-D-xylulose
FT                   5-phosphate reductoisomerase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50163"
FT                   /db_xref="GOA:A9HKV5"
FT                   /db_xref="InterPro:IPR003821"
FT                   /db_xref="InterPro:IPR013512"
FT                   /db_xref="InterPro:IPR013644"
FT                   /db_xref="InterPro:IPR026877"
FT                   /db_xref="InterPro:IPR036169"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A9HKV5"
FT                   /protein_id="ACI50163.1"
FT                   /translation="MKSVTVLGSTGSIGCSTVDLLLQAPERFRVAALVGGSNAPRLAEQ
FT                   ARALRASHAVIADESRLPELRALLADDGIAVSGGRQAVIDAASQPVDWTMAAITGAIGL
FT                   EPTLAAVRNGGSVALANKEALVCAGDVMLRAVQQAGATLLPVDSEHNAIFQSMADRQAD
FT                   QVEKIVLTASGGPFRRASLAEMEKATPEAALRHPTWTMGAKITIDSATMFNKGLEVIEA
FT                   ARLFSLTEDRIGVVVHPQSVVHGLVQYTDGSIVAQMGSADMRIPIAHTLAWPCRMATTS
FT                   PRLDLAALGRMEFEEPDEVRFPALRLARESLRAGGAAPTILSAANEIAVEAFLGCGIGF
FT                   LDIARVVESVMQAIGHQPADTLEAVLHWDQEARRAARLRTASLAA"
FT   gene            complement(408058..408942)
FT                   /locus_tag="Gdia_0368"
FT   CDS_pept        complement(408058..408942)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0368"
FT                   /product="phosphatidate cytidylyltransferase"
FT                   /note="PFAM: phosphatidate cytidylyltransferase; KEGG:
FT                   gdi:GDI2148 putative phosphatidate cytidylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50164"
FT                   /db_xref="GOA:B5ZLN5"
FT                   /db_xref="InterPro:IPR000374"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZLN5"
FT                   /protein_id="ACI50164.1"
FT                   /translation="MPVPPSDPVSGGRPTQGKPGRNWKDLRARLLSAAVLVPVAALCVW
FT                   AGGAPYAALIVLATAGMAIEWGRMFGLRTASWRGVLYLLWPVAAMAAALGGQWRGAFMV
FT                   MGGAFVFGPSLWAGQVVIGCAGLALLWLRMMTVPGAGVVLFVVTCVAVSDSGAYLVGRL
FT                   LGGPKLAPAISPAKTWSGSLGGLACAMVAGGGVCSLVSGPGNWARGMAFGALMAVAAQI
FT                   GDLAESALKRARGVKDSGAIIPGHGGLLDRFDGLLVAAPLAALLSLGAAGGAAFWYVTQ
FT                   AGLMSALLGARGN"
FT   gene            complement(408923..409687)
FT                   /locus_tag="Gdia_0369"
FT   CDS_pept        complement(408923..409687)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0369"
FT                   /product="undecaprenyl diphosphate synthase"
FT                   /EC_number="2.5.1.31"
FT                   /note="KEGG: gdi:GDI2149 putative undecaprenyl
FT                   pyrophosphate synthetase; TIGRFAM: undecaprenyl diphosphate
FT                   synthase; PFAM: Di-trans-poly-cis-decaprenylcistransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50165"
FT                   /db_xref="GOA:A9HKW3"
FT                   /db_xref="InterPro:IPR001441"
FT                   /db_xref="InterPro:IPR018520"
FT                   /db_xref="InterPro:IPR036424"
FT                   /db_xref="UniProtKB/TrEMBL:A9HKW3"
FT                   /protein_id="ACI50165.1"
FT                   /translation="MTTSGSTAPVSGLDRGRGAPALPAHVAVIMDGNGRWAAARGLPRV
FT                   AGHRAGAEAVRRCIRAAITRGVGCLTLYAFSSENWRRTPDEVADLTALLRYYLRHKVAE
FT                   LCREGVRIRIIGDLSRFDADVRDEARRAEDMTAANTRLTLVLALSYGGRADIVQAAARV
FT                   AFAARSGTIDPAELDEALFSRFLLTADVPDPDLIVRTSGECRLSNFLLWQSAYAELVFI
FT                   ETLWPDFDEHHFDAALDMFARRERRFGARPAL"
FT   gene            complement(409782..410348)
FT                   /locus_tag="Gdia_0370"
FT   CDS_pept        complement(409782..410348)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0370"
FT                   /product="ribosome recycling factor"
FT                   /note="PFAM: ribosome recycling factor; KEGG: gdi:GDI2150
FT                   ribosome recycling factor"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50166"
FT                   /db_xref="GOA:A9HKW6"
FT                   /db_xref="InterPro:IPR002661"
FT                   /db_xref="InterPro:IPR023584"
FT                   /db_xref="InterPro:IPR036191"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9HKW6"
FT                   /protein_id="ACI50166.1"
FT                   /translation="MAADQKTLLDDLTRRMDGALESLRRDFAGLRSGRASPALIEPVRV
FT                   EAYGGEVPLTQVGSIAVPEARMLTVQVWDRSLVGAVERAIRDSGLGLNPAADGQTVRVP
FT                   IPQLTEERRGELARTAGKYSENAKIAVRGVRRDGMDQTKAQEKKGDISQDDVKVWSDAI
FT                   QKLTDQYVKRIDEMLAEKEREIKQV"
FT   gene            complement(410426..411166)
FT                   /locus_tag="Gdia_0371"
FT   CDS_pept        complement(410426..411166)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0371"
FT                   /product="uridylate kinase"
FT                   /note="TIGRFAM: uridylate kinase; PFAM:
FT                   aspartate/glutamate/uridylate kinase; KEGG: gdi:GDI2151
FT                   uridylate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50167"
FT                   /db_xref="GOA:A9HKW8"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR011817"
FT                   /db_xref="InterPro:IPR015963"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="UniProtKB/TrEMBL:A9HKW8"
FT                   /protein_id="ACI50167.1"
FT                   /translation="MTDQATEKTIGFQRVLLKVSGEALMGEGSYGIDPVMVDTIATDIA
FT                   EVARTGVEICLVIGGGNIFRGVAAAARGMDRAQGDYAGMLATVINALMVQNALERHGVP
FT                   TRVMSAIQMSSVAEPYIRRRAVRHMEKGRVVIFAGGTGNPFFTTDTAAALRAAEMDCNA
FT                   LLKGTQVDGVYSADPRKVKDATRFEQLTYLDVLAKDLHVMDAAAISLARENRLPIVVFN
FT                   IHAPGAFPKVMRGEGLYTRIVETA"
FT   gene            complement(411291..412184)
FT                   /locus_tag="Gdia_0372"
FT   CDS_pept        complement(411291..412184)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0372"
FT                   /product="GTP-binding protein Era"
FT                   /note="TIGRFAM: small GTP-binding protein; GTP-binding
FT                   protein Era; PFAM: GTP-binding protein HSR1-related; KH
FT                   type 2 domain protein; Miro domain protein; KEGG:
FT                   gdi:GDI2152 putative GTP-binding protein era homolog"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50168"
FT                   /db_xref="GOA:B5ZLN9"
FT                   /db_xref="InterPro:IPR004044"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005662"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030388"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZLN9"
FT                   /protein_id="ACI50168.1"
FT                   /translation="MTTRCGFVAIVGAPNAGKSTLLNRMAGAKLSIVSPKAQTTRFRVL
FT                   GILMRGESQILLVDTPGIFQPRRKLDRAMVAAAWTGAEDADITLLLVDARRGLSESVRA
FT                   IVERLAQSRRRVWLVLNKTDLVDRQALLPLTAELSALLDVEHVYMVSARSGDGVEDLLS
FT                   ALAASLPEGPYLYPEDDLTDLPDRLLAAELVREQIFLQTHEEVPYAATAETESFRELPD
FT                   GSVRIEVTIYVARAGHKAILIGEKGSRIRSIGERARKDLSRLLDRTCHLFLNVKERAGW
FT                   DEERARLRAIGLDDTP"
FT   gene            complement(412224..412973)
FT                   /locus_tag="Gdia_0373"
FT   CDS_pept        complement(412224..412973)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0373"
FT                   /product="Ribonuclease III"
FT                   /EC_number="3.1.26.3"
FT                   /note="PFAM: ribonuclease III; double-stranded RNA binding
FT                   domain protein; KEGG: gdi:GDI2153 putative ribonuclease
FT                   III"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50169"
FT                   /db_xref="GOA:A9HKX5"
FT                   /db_xref="InterPro:IPR000999"
FT                   /db_xref="InterPro:IPR011907"
FT                   /db_xref="InterPro:IPR014720"
FT                   /db_xref="InterPro:IPR036389"
FT                   /db_xref="UniProtKB/TrEMBL:A9HKX5"
FT                   /protein_id="ACI50169.1"
FT                   /translation="MTASESGGADGVVASVEARVGYRFRRPDLLREALTHRSAAHQRNG
FT                   GGARRSRQPAARRGAGSNERLEFIGDRVLGLVMAEWLLERFPDEQEGALGPRHAHLVSR
FT                   PVLAAIAGTMNLQQALDVAEHEARAGVRQVANVLADAVEAILGAIYLDGGLEPARRFVR
FT                   AAWNEAIVAQAQPPKDPKTALQEWVLARGLPLPAYRTVQMDGPSHAPRFVIAVTAAGQS
FT                   AEGIAGSKRAAESAAAADLLRLVDERQ"
FT   gene            complement(412970..413782)
FT                   /locus_tag="Gdia_0374"
FT   CDS_pept        complement(412970..413782)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0374"
FT                   /product="signal peptidase I"
FT                   /EC_number="3.4.21.89"
FT                   /note="KEGG: gdi:GDI2154 putative signal peptidase I;
FT                   TIGRFAM: signal peptidase I; PFAM: peptidase S24 and S26
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50170"
FT                   /db_xref="GOA:B5ZLP1"
FT                   /db_xref="InterPro:IPR000223"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR019756"
FT                   /db_xref="InterPro:IPR019757"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZLP1"
FT                   /protein_id="ACI50170.1"
FT                   /translation="MDDPNKTHSSSLPSAGAVPALRGLWDLIRTILIAGLLAVGVRTVL
FT                   FEPFNIPSGSMIPTLQVGDYLWVAKYSYGYSHFSLPRSPDLFDGRIFGSLPHRGDVAVF
FT                   RFTRDTSIDYIKRIVGLPGDRVQVRGGELYINDTLVPREARGNYVAVDEHRTRMEGQRY
FT                   SESLPGSGGRPPVTHDILKLTNEGFQNDTPVYVVPSGYFFAMGDNRDDSADSRFMGDDP
FT                   EDLGFVPMENLIGQAKWIFLSIDARYPAWEFWMWPVEIRWDRLFQGVR"
FT   gene            complement(413939..414349)
FT                   /locus_tag="Gdia_0375"
FT   CDS_pept        complement(413939..414349)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0375"
FT                   /product="holo-acyl-carrier-protein synthase"
FT                   /EC_number="2.7.8.7"
FT                   /note="KEGG: gdi:GDI2155 putative
FT                   holo-[acyl-carrier-protein] synthase; TIGRFAM:
FT                   holo-acyl-carrier-protein synthase; PFAM:
FT                   4'-phosphopantetheinyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50171"
FT                   /db_xref="GOA:A9HKX9"
FT                   /db_xref="InterPro:IPR002582"
FT                   /db_xref="InterPro:IPR004568"
FT                   /db_xref="InterPro:IPR008278"
FT                   /db_xref="InterPro:IPR037143"
FT                   /db_xref="UniProtKB/TrEMBL:A9HKX9"
FT                   /protein_id="ACI50171.1"
FT                   /translation="MSLIGIGSDLCDIRRIERVLARHGERFLVRVFTDAERRRAERRHG
FT                   QARLGAYAKRWAAKEACAKALGTGFSHGVFHHDLGVDNLPGGQPVMVLTGGAKTRLHVL
FT                   TPPGSTARILLSMTDEYPYAFAQVMIETGPLP"
FT   gene            complement(414346..416577)
FT                   /locus_tag="Gdia_0376"
FT   CDS_pept        complement(414346..416577)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0376"
FT                   /product="(p)ppGpp synthetase I, SpoT/RelA"
FT                   /EC_number="2.7.6.5"
FT                   /note="KEGG: gdi:GDI2156 putative
FT                   guanosine-3',5'-bis(diphosphate) 3'-pyrophosphohydrolase;
FT                   TIGRFAM: RelA/SpoT family protein; PFAM: TGS domain
FT                   protein; metal-dependent phosphohydrolase HD sub domain;
FT                   RelA/SpoT domain protein; SMART: metal-dependent
FT                   phosphohydrolase HD region"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50172"
FT                   /db_xref="GOA:B5ZLP3"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR004095"
FT                   /db_xref="InterPro:IPR004811"
FT                   /db_xref="InterPro:IPR007685"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="InterPro:IPR033655"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZLP3"
FT                   /protein_id="ACI50172.1"
FT                   /translation="MPSDPDAPPAPARVISCEGLLRRIRSYDPDADLDLIRRAFAVAQA
FT                   AHAGQVRDNGDPYITHPLAVASILAGFHLDPSSIATALLHDTIEDTGVTHDRLRAEFGP
FT                   TIADLVDGVTKLTRLELQSDRTKQAENFRKLVLAMSKDIRVLIVKLADRLHNMRTLHYV
FT                   QRLDRRQRIARETMEIYAPLAGRIGMDKVKTELQNLSFAELEPEANATIRARLNYLRGQ
FT                   GADVIEEVRRELAHLCREAGLGEVEVTGREKSPFSIWEKMQNRNVAFEQLSDIMAFRIL
FT                   VPTREACYIALGAVHAAYPVIVGRFKDYISTPKANGYQSLHTGVTLRQPRNQKIEVQIR
FT                   TAEMHDIAENGVASHWLYKQLPGAGEDAARTVTGLRWVQDLLDILEDSAAPDEFLENTK
FT                   LELYQDQVFCFTPKGQLISLPRGATPVDFAYAVHSQVGDSCVGARINGRLMPLRHELQN
FT                   GDQVEIMTARGGTPSPSWERFVVTGKARARIRRHVAAQQREAHVDGGRAALAKAFRQEG
FT                   VDGSEKVLDSILPDLKLVSVEDLYVAVGNGNISPRDVVHAAYPELRQTPRAPRMVPGIP
FT                   MRAPSRVASRPKPGGGMALAGIGPGIAVHFAGCCHPLPGDKIVGIVATGKGITIHMAGC
FT                   QTLESFAATPERFMDVDWDYDIIGRGATEPHIGRLSVIAANEPSVLATLTNTASKHDGT
FT                   VVNLRIVNRQLDFMEILADIEVRDLRHLSSVIAALRAANGVVQVERAKG"
FT   gene            complement(416687..417085)
FT                   /locus_tag="Gdia_0377"
FT   CDS_pept        complement(416687..417085)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0377"
FT                   /product="DNA-directed RNA polymerase, omega subunit"
FT                   /note="TIGRFAM: DNA-directed RNA polymerase, omega subunit;
FT                   PFAM: RNA polymerase Rpb6; KEGG: gdi:GDI2157 DNA-directed
FT                   RNA polymerase omega chain"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50173"
FT                   /db_xref="GOA:A9HKY5"
FT                   /db_xref="InterPro:IPR003716"
FT                   /db_xref="InterPro:IPR006110"
FT                   /db_xref="InterPro:IPR012293"
FT                   /db_xref="InterPro:IPR036161"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9HKY5"
FT                   /protein_id="ACI50173.1"
FT                   /translation="MARVTVEDCVERVPNRFELVLLAAQRARGLSRGEELTVDRDNDKN
FT                   PVVALREIADQTIVLEQIRSDLVRSLARAPEPEPADEEVMDLIPTEQNIFGLQDVSAEE
FT                   EASHGTAGMSAEELEAAIEAELGGRARR"
FT   gene            complement(417166..417663)
FT                   /locus_tag="Gdia_0378"
FT   CDS_pept        complement(417166..417663)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0378"
FT                   /product="2-amino-4-hydroxy-6-hydroxymethyldihydropteridine
FT                   pyrophosphokinase"
FT                   /note="TIGRFAM:
FT                   2-amino-4-hydroxy-6-hydroxymethyldihydropteridine
FT                   pyrophosphokinase; PFAM:
FT                   78-dihydro-6-hydroxymethylpterin-pyrophosphokinase HPPK;
FT                   KEGG: gdi:GDI2158 putative
FT                   2-amino-4-hydroxy-6-hydroxymethyldihydropteridine
FT                   pyrophosphokinase"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50174"
FT                   /db_xref="GOA:B5ZLP5"
FT                   /db_xref="InterPro:IPR000550"
FT                   /db_xref="InterPro:IPR035907"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZLP5"
FT                   /protein_id="ACI50174.1"
FT                   /translation="MILIAIGANLPRAEGSTPLETCRWAVEHIASIPGVRVVAVSAWYE
FT                   SAPIPPSGQPPYVNGVVAATGELDPAVLLAALQGIEARAGRRRTVANAARPLDLDIIAM
FT                   GDLVRDAPDPILPHPRADARAFVLLPLRDVAPGWRDPRSGRTVDALVADLPDQQIRRLE
FT                   AD"
FT   gene            417890..418501
FT                   /locus_tag="Gdia_0379"
FT   CDS_pept        417890..418501
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0379"
FT                   /product="protein of unknown function DUF88"
FT                   /note="PFAM: protein of unknown function DUF88; KEGG:
FT                   gdi:GDI2159 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50175"
FT                   /db_xref="InterPro:IPR021139"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZLP6"
FT                   /protein_id="ACI50175.1"
FT                   /translation="MFFQPNERVCLFIDGASLYSASRHLGFDVDYRNLLTFFRSKCHVI
FT                   RAYYYSAILESEEYSPLKPLTDWLVYNGYFLVTKTAREFVDHNGRRRVKGNMDIELAVD
FT                   MMEMAPRIDHAVLFSGDADFRRLLETVQRQGVRTSVISSIRTSPPLIGDELRRQADQFI
FT                   ELADIAPQFTRRQAEARPQRQQQAPVRHPADQISELDHGD"
FT   gene            418501..419199
FT                   /locus_tag="Gdia_0380"
FT   CDS_pept        418501..419199
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0380"
FT                   /product="Uracil-DNA glycosylase superfamily"
FT                   /note="PFAM: Uracil-DNA glycosylase superfamily; KEGG:
FT                   gdi:GDI2160 putative uracil DNA glycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50176"
FT                   /db_xref="InterPro:IPR005122"
FT                   /db_xref="InterPro:IPR036895"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZLP7"
FT                   /protein_id="ACI50176.1"
FT                   /translation="MPPRSRALARPAAPSVSTSPGPDIPPRECPACPRLVEYRLANQAA
FT                   HPDWWNAPVPPWGESSASLLIVGLAPGVKGANRTGRPFTGDYAGTLLYETLIEYGFATG
FT                   RYGADPADGLVLNDCRIVNAVRCVPPANLPQTSEVRTCNHFLRSELTSMPNLKAVLTLG
FT                   VVAHNATVAACGIPMSRIRFTHGQVQTLPNGLVLTDSYHVSRYNTNTGVLTTDMFRAVV
FT                   ARLRALIDAA"
FT   gene            complement(419238..420734)
FT                   /locus_tag="Gdia_0381"
FT   CDS_pept        complement(419238..420734)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0381"
FT                   /product="malate/quinone oxidoreductase"
FT                   /EC_number="1.1.5.4"
FT                   /note="KEGG: gdi:GDI2161 putative malate:quinone
FT                   oxidoreductase; TIGRFAM: malate/quinone oxidoreductase;
FT                   PFAM: FAD dependent oxidoreductase;
FT                   Malate:quinone-oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50177"
FT                   /db_xref="GOA:A9HKZ6"
FT                   /db_xref="InterPro:IPR006231"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A9HKZ6"
FT                   /protein_id="ACI50177.1"
FT                   /translation="MTSNSTRTDSAYDVVLIGGGVMSATLGALLKLLQPDWSIGLFGRL
FT                   DDVAQESSNAWNNAGTGHSALCELNYTPERADGSIDISKAVGVNEAFQVSRQFWAYLVE
FT                   SGVISSPRDFLNPIPHMSFVWGDENCDYLRRRYEALKDHPLFSGMRFSTDPAQLKQWMP
FT                   LVMEGRKAGTPLAATWIASGTDVNFGALTHLLVDFLSQQSGFDLKLGHEVQDLKRDEAG
FT                   TWQVSVRDLATNHALKVAARFVFIGAGGGALPLLQKTGIPESKGVGGFPVSGQFLRCTN
FT                   PDVAAHHHAKVYGKASVGAPPMSVPHLDTRVIDGKAGLLFGPYAGFSTKFLKHGSLWDL
FT                   PKSIHMDNLGAMLAVARDNMPLTRYLIQQVLQSNEARLAALRDFVPTARAEDWELIVAG
FT                   QRVQVIKKDEKKGGVLQFGTEVVTGANGTVAALLGASPGASTAVPIMLTVIRKCFPGEL
FT                   PRWDAKLKEMIPSFGGSLADRPDLCAQVHEHTTRVLLLEG"
FT   gene            complement(421030..422019)
FT                   /locus_tag="Gdia_0382"
FT   CDS_pept        complement(421030..422019)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0382"
FT                   /product="Phosphate butyryltransferase"
FT                   /EC_number="2.3.1.19"
FT                   /note="PFAM: phosphate acetyl/butaryl transferase; KEGG:
FT                   gdi:GDI2163 putative phosphate acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50178"
FT                   /db_xref="GOA:B5ZLP9"
FT                   /db_xref="InterPro:IPR002505"
FT                   /db_xref="InterPro:IPR012147"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZLP9"
FT                   /protein_id="ACI50178.1"
FT                   /translation="MMAPPTPGHGMTDEVTDAKMDAMIAGPGFLDTLSARLAGSPPVDA
FT                   AVIYPCSLPSLQAAVGLGQQGIAQPILIGPGERIRALARSASLDLAACRLVEAADEHLA
FT                   AARGVALARDGTARMLMKGSLHSSIFLREIGHHESGLRTDRRMSHVFVLDVPTCSRPLL
FT                   VTDGAVNIAPDLPARRDIVQNAIDLARTIGISRPRVAILSAIETVNPELPSTVDAALLA
FT                   KMAERGQITGGIVDGPLALDNALSAEAARCKGVESPVAGCADILVVPDLEAGNMLAKQL
FT                   TFMGGASAAGVVLGARVPVVLTSRADSVRTRILSGILAAVLAQAWGMD"
FT   gene            complement(422035..422658)
FT                   /locus_tag="Gdia_0383"
FT   CDS_pept        complement(422035..422658)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0383"
FT                   /product="Ferric reductase domain protein transmembrane
FT                   component domain"
FT                   /note="PFAM: Ferric reductase domain protein transmembrane
FT                   component domain; KEGG: gdi:GDI2164 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50179"
FT                   /db_xref="GOA:B5ZLQ0"
FT                   /db_xref="InterPro:IPR013130"
FT                   /db_xref="InterPro:IPR022837"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZLQ0"
FT                   /protein_id="ACI50179.1"
FT                   /translation="MAVSRRGPSALLTRQGLIRFGLYAVGLVPAVATFVMGATNRLGAD
FT                   PVNSFERTLGLWALRFLILSLCVTPLRERTGVNLLRYRRVLGLLAFWYALFHLSAYVGL
FT                   DQGFDLPVLLADVTRRPFIILGMVAFTILVVLAATSNAWSIRRLGRRWRSVHRWVYLAA
FT                   LCAAIHFILSFKVIRAETLVYALIVVGLLAYRLLPAALRRPRVA"
FT   gene            complement(422660..423613)
FT                   /locus_tag="Gdia_0384"
FT   CDS_pept        complement(422660..423613)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0384"
FT                   /product="oxidoreductase molybdopterin binding"
FT                   /note="PFAM: oxidoreductase molybdopterin binding; KEGG:
FT                   gdi:GDI2165 putative molybdopterin-biniding oxidoreductase
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50180"
FT                   /db_xref="GOA:A9HL07"
FT                   /db_xref="InterPro:IPR000572"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR022867"
FT                   /db_xref="InterPro:IPR036374"
FT                   /db_xref="UniProtKB/TrEMBL:A9HL07"
FT                   /protein_id="ACI50180.1"
FT                   /translation="MSVFRYPRPPSSDITPHAAWLSRRDILATGLAGAAGAILPPRIAQ
FT                   ADTLAARPGPLSDGGLTPTPLQDVTHYNNFYEFGLEKTDPAERSGDFHPRPWTLRVEGM
FT                   VAKPRTYDIDTLLARPLEERIYRMRCVEAWSMVIPWIGFSLGDLLREVEPLGSARYVAF
FT                   ESVLRPSEMPGQSGLLPVLDWPYVEALRLDEALHPLTILAVGLYGQTLPNQNGAPVRLV
FT                   VPWKYGFKGIKSVVRIRLTDSRPRTAWNVRAPDEYGFYANVNPAVDHPRWSQATERPIG
FT                   VRGGFFGAARQPTLPFNGYGAQVAGLYAGMDLRRDF"
FT   sig_peptide     complement(423473..423613)
FT                   /locus_tag="Gdia_0384"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.842) with cleavage site probability 0.828 at
FT                   residue 47"
FT   gene            423704..424612
FT                   /locus_tag="Gdia_0385"
FT   CDS_pept        423704..424612
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0385"
FT                   /product="6-phosphogluconate dehydrogenase NAD-binding"
FT                   /note="PFAM: NADP oxidoreductase coenzyme F420-dependent;
FT                   6-phosphogluconate dehydrogenase NAD-binding; KEGG:
FT                   gdi:GDI2166 6-phosphogluconate dehydrogenase, NAD-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50181"
FT                   /db_xref="GOA:A9HL10"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR015815"
FT                   /db_xref="InterPro:IPR029154"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A9HL10"
FT                   /protein_id="ACI50181.1"
FT                   /translation="MSNSSANSSTANGSTGTIGFIGFGAMASRMGHNLREAGYQIMAYT
FT                   PSGKGGDGTTRFLPTPRALAEAAGTVLVCVPDDESLAKSLYGPDGALAGMTKGALLVNT
FT                   SSVSPEASAALAAAAGKQDVAVLDAPVSGSTPEAESGTLVVLVGGDAAVVARAQPIFDV
FT                   IGKATIHAGPSGSGTKLKLVVNGIMGAGLAAVAEGVTYGLAAGLDRDMLFGALDSVAVI
FT                   SPHHKRKLKAARVGDFTPQFPTRLMQKDMRLLMTDAARAEAPLATMAATTQLLSLTRRT
FT                   HPDDDYSALFAVLERTVANSP"
FT   gene            complement(424634..425512)
FT                   /locus_tag="Gdia_0386"
FT   CDS_pept        complement(424634..425512)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0386"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gdi:GDI2167 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50182"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZLQ3"
FT                   /protein_id="ACI50182.1"
FT                   /translation="MTNTTEKRAAETGLSAMGEIARRSDPDRFFCTLFLPASVREDAFT
FT                   LIAFNHESVRALSGMHSRSVAGPMAGLIRLQWWREIVEGASHPHEVADPLRALIRAGRV
FT                   RRDTLLGILDAREAELEGLPDWAAWRAAMRAGAGGVQAAIAQVAGTGTTDPDLLRAVEF
FT                   LGAAYGVGGLLRHMGAVLAGGRCPLPEPALQEFGLSGESIRDGAGIQGADLTPLRARLR
FT                   DEGREFLAQAGMQVAAGAGRVRLPRAVRAAGLPGALARRDLGRGHDREVGAARGLGDRL
FT                   AVMAAMARGRI"
FT   gene            425662..426270
FT                   /locus_tag="Gdia_0387"
FT   CDS_pept        425662..426270
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0387"
FT                   /product="Superoxide dismutase"
FT                   /EC_number="1.15.1.1"
FT                   /note="PFAM: manganese and iron superoxide dismutase; KEGG:
FT                   gdi:GDI2168 superoxide dismutase"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50183"
FT                   /db_xref="GOA:B5ZLQ4"
FT                   /db_xref="InterPro:IPR001189"
FT                   /db_xref="InterPro:IPR019831"
FT                   /db_xref="InterPro:IPR019832"
FT                   /db_xref="InterPro:IPR019833"
FT                   /db_xref="InterPro:IPR036314"
FT                   /db_xref="InterPro:IPR036324"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZLQ4"
FT                   /protein_id="ACI50183.1"
FT                   /translation="MAFELPTLPFQTNALAARGMCQETLELHHGKHHQAYVTALNGFVE
FT                   AKPELQGKSLEEIILAVKGDAASAPVFNNAGQHWNHILFWQNLSPTGGAIPDALAKKLA
FT                   EDFGSVDDFKTAFKTAATTQFGSGWAWLVLAADGKLKVTKTANGSNPLAEGQGKVLLGL
FT                   DVWEHSYYLDFRNRRPDYTTNYLDKLANYEFAEAQFKAA"
FT   gene            complement(426354..427772)
FT                   /locus_tag="Gdia_0388"
FT   CDS_pept        complement(426354..427772)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0388"
FT                   /product="sugar transporter"
FT                   /EC_number="1.3.1.74"
FT                   /note="KEGG: gdi:GDI2169 putative galactose-proton
FT                   symporter; TIGRFAM: sugar transporter; PFAM: General
FT                   substrate transporter; major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50184"
FT                   /db_xref="GOA:B5ZCC0"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZCC0"
FT                   /protein_id="ACI50184.1"
FT                   /translation="MEAYGYAATTGSRHLRKAVPGRAGLVAGLAAVAGLMFGLDIGVIS
FT                   GALSLIAQEFDATQFQQEAIVAAMMLGAAVGVPIAGWLSFDLGRKRTLVIGASLFIVGS
FT                   TACALSGSVGMLIAARIVLGLAIGISTFTAPLYIAEIADAANRGAMVSIYQLMVTIGIL
FT                   TAFVSDALFAYFDAWRWMLGIVAFPGIVFLIGVAFLPASPRWLMLRGRRDEARRALLEL
FT                   RGQAHGVARELSEIDAQLRTQGRGWALFRSNRNFRRAVFLGVMLQCVQQFTGMNVVMYY
FT                   APRIFGLAGFAEHARLWGTATVGGVNMAATFMAIWLVDRWGRRPILICGLMVMSVGMAG
FT                   LGLMLREGMGQGADQTMAVALLLCFVAGFAFSAGPLVWVLCSEIQPLQGRDFGIACSTA
FT                   TNWISNMIVGVSFLTLLDRLGRPETFWLYAGLNALFVVLVALFVPETKGLSLERIERDL
FT                   MGGVRLRDIGRRRP"
FT   gene            complement(427862..428647)
FT                   /locus_tag="Gdia_0389"
FT   CDS_pept        complement(427862..428647)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0389"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   gdi:GDI2170 putative oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50185"
FT                   /db_xref="GOA:B5ZCC1"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZCC1"
FT                   /protein_id="ACI50185.1"
FT                   /translation="MVGPGPDTGSYARYPSLAGRSVLVTGGASGIGAALVRAFADQGAR
FT                   VAFVDLDRVAADALAGEVAQAGRQVLFIPCDVTDVAALREAVATAFGAHGPVDILLNNA
FT                   GNDARHTLDEVDVAMWERLSAINIRAQFFAAQAVAPGMRAAGRGSIVCLGSTGWMQKNA
FT                   GYPIYVTAKAAVLGLVNALARELGQDHIRVNALVPGWVMTERQRRLWLTPEGERQIDRS
FT                   QCLPGRVEPGDIARMALFLAADDSRMCSGQQFIVDGGWV"
FT   gene            complement(428641..429789)
FT                   /locus_tag="Gdia_0390"
FT   CDS_pept        complement(428641..429789)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0390"
FT                   /product="Mandelate racemase/muconate lactonizing protein"
FT                   /note="PFAM: Mandelate racemase/muconate lactonizing
FT                   protein; KEGG: gdi:GDI2171 putative galactonate
FT                   dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50186"
FT                   /db_xref="GOA:B5ZCC2"
FT                   /db_xref="InterPro:IPR013341"
FT                   /db_xref="InterPro:IPR013342"
FT                   /db_xref="InterPro:IPR018110"
FT                   /db_xref="InterPro:IPR023592"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR029065"
FT                   /db_xref="InterPro:IPR034593"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZCC2"
FT                   /protein_id="ACI50186.1"
FT                   /translation="MKITKLTTFQVPPRWLFLKIETDEGISGWGEPVVEGRADTVAAAV
FT                   AELADYLVGKDPFRIEDHWTVLYRGGFYRGGAVHMSAIAGIDQALWDIKGRAFGVPVHD
FT                   LLGGRCRDRIRVYSWIGGDRPADTAQAVRAVVDRGFTAIKMNATEELQYVDSHAKVDDV
FT                   IARVAAIREEAGPYLGIGVDFHGRVHKPMAKVLARELEPYDLMFIEEPVLSEHLEDLPE
FT                   ITKHTSIPIALGERLFSRWDFKRVFEQGCVDIIQPDPSHAGGITETRKIAAMAEAYDVA
FT                   VALHCPLGPIALAANLQLDALCYNAFIQEQSLGIHYNKTNDLLDYLVDPDVFAYRDGHV
FT                   DIPTGPGLGIEINEDYVRARAAEGHRWRNPVWRHRDGSFAEW"
FT   gene            complement(429786..430454)
FT                   /locus_tag="Gdia_0391"
FT   CDS_pept        complement(429786..430454)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0391"
FT                   /product="KDPG and KHG aldolase"
FT                   /note="PFAM: KDPG and KHG aldolase; KEGG: gdi:GDI2172
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50187"
FT                   /db_xref="GOA:B5ZCC3"
FT                   /db_xref="InterPro:IPR000887"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR031338"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZCC3"
FT                   /protein_id="ACI50187.1"
FT                   /translation="MMTFDRALDVCPLVAILRGIRPDEVLDIGQALVEAGFAIIEVPMN
FT                   SPEPLRSIRLLQDRFGDAALIGAGTVLSAEMVGQVADAGGRLIVMPHADVAVIGAARAA
FT                   GMACTPGVATPTEGFAALAAGAAALKLFPAEQIGPGALKAWRSVFPAGTRFIPVGGITP
FT                   DTMDPWVTAGAAGFGLGSALYRAGRSAGEVGATARLFIAGLEKAGLEKSRLEKQERKRT
FT                   "
FT   gene            complement(430451..431437)
FT                   /locus_tag="Gdia_0392"
FT   CDS_pept        complement(430451..431437)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0392"
FT                   /product="2-keto-3-deoxy-galactonokinase"
FT                   /note="PFAM: 2-keto-3-deoxy-galactonokinase; KEGG:
FT                   gdi:GDI2173 putative 2-dehydro-3-deoxygalactonokinase"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50188"
FT                   /db_xref="GOA:B5ZCC4"
FT                   /db_xref="InterPro:IPR007729"
FT                   /db_xref="InterPro:IPR042257"
FT                   /db_xref="InterPro:IPR042258"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZCC4"
FT                   /protein_id="ACI50188.1"
FT                   /translation="MSVPHEQPGDGALIAIDWGTSALRAWRMAADGTVLDAASGPWGIL
FT                   NLPEGGFPAALVALLADWPDAAGLKLIACGMIGSVNGWHEVPYVDCPADAAALARALGR
FT                   PHMGGAVPGIVPGLRQFQPLPDVMRGEETQIVGALALHPDLSHAATLILPGTHSKWVTV
FT                   RHGRITGFHTAMTGELFAVLSQHSILGRPAEGAEPVAEDEARAAFRRGVQAASSSRQGV
FT                   APLLFSARSLFLTGGLGAAATRDYLSGLLVGDEIRAFLADRTEMLPTVLVGEDRLCGLY
FT                   AQAFEMLGAPVPRLVGNTAPAGLYRIAVEAGYLRPTPEEDTTHGDTT"
FT   gene            complement(431421..432206)
FT                   /locus_tag="Gdia_0393"
FT   CDS_pept        complement(431421..432206)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0393"
FT                   /product="transcriptional regulator, IclR family"
FT                   /note="PFAM: regulatory protein IclR; Transcriptional
FT                   regulator IclR; KEGG: gdi:GDI2174 putative transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50189"
FT                   /db_xref="GOA:B5ZCC5"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZCC5"
FT                   /protein_id="ACI50189.1"
FT                   /translation="MMGHNDGKGTAASGTQALERGIAIVDAVDSGHRTLPAIATATGCT
FT                   RSTTQRIVQSLVRLNWLLQQSDGTYDLGPRLAALSQRARAETSLATLARPVAERLGAET
FT                   RDTVHVGVRSGADILYLDKIPGQRGLEMRSRVGQRMRLALTGIGRALMLDLDEDEWGLL
FT                   FDAARPDATPDERTAWVERMRAYRAEGCVFDLEDNEIGIRCVAAPVRDRDGRIVVALSV
FT                   ASATPYLSPVRMQALAPVVRRAAADLSARLGWRSDVRAA"
FT   gene            complement(432399..432779)
FT                   /locus_tag="Gdia_0394"
FT   CDS_pept        complement(432399..432779)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0394"
FT                   /product="preprotein translocase, YajC subunit"
FT                   /note="TIGRFAM: preprotein translocase, YajC subunit; PFAM:
FT                   YajC family protein; KEGG: gdi:GDI2175 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50190"
FT                   /db_xref="GOA:A9HL42"
FT                   /db_xref="InterPro:IPR003849"
FT                   /db_xref="UniProtKB/TrEMBL:A9HL42"
FT                   /protein_id="ACI50190.1"
FT                   /translation="MTLLSDFLVTPAYAQTAGGEGGLLSAGGMMSILPYVAMFVIFYFI
FT                   LIRPQQQKQKQLRAQLASLRRGDRVLTAGGIVATVQKVRDDSNEMEVEIAPNVRVTVLR
FT                   ETITSVVSSSAKPANDTGAKAG"
FT   gene            432927..433799
FT                   /locus_tag="Gdia_0395"
FT   CDS_pept        432927..433799
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0395"
FT                   /product="protein of unknown function DUF815"
FT                   /note="PFAM: protein of unknown function DUF815; KEGG:
FT                   gdi:GDI2176 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50191"
FT                   /db_xref="InterPro:IPR008533"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A9HL44"
FT                   /protein_id="ACI50191.1"
FT                   /translation="MDSDLLPVLDRIASALERLSPPPPTLAGLDAADAFVWHPAQGRLT
FT                   PVGHVAHVDIDLLRGVATQRRLVLENTLHFARGLPANNAMLWGARGMGKSSLVKAAHAQ
FT                   ANLLDGRPAPAGRGRLVLIEIQREDLSTLPDLLALLRNSSRRFIVFCDDLSFESEDADY
FT                   KALKSVLDGGISGRPANVLFYATSNRRHLMPRDMIDNERSTAINPSEAVEEKVSLSDRF
FT                   GLWIGFHNCAQDVFLDMVRAYAAARALPIADAELAQRANAWSVTRGGRSGRVAYQFIED
FT                   LTAELAPAQ"
FT   gene            434029..435111
FT                   /locus_tag="Gdia_0396"
FT   CDS_pept        434029..435111
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0396"
FT                   /product="Rieske (2Fe-2S) domain protein"
FT                   /note="PFAM: Rieske [2Fe-2S] domain protein; KEGG:
FT                   gdi:GDI2177 vanillate O-demethylase oxygenase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50192"
FT                   /db_xref="GOA:A9HL46"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:A9HL46"
FT                   /protein_id="ACI50192.1"
FT                   /translation="MNQIFSTDSIPPAGLTPEGDLRRVRSNPDFWYPVAWSRELKVGKT
FT                   IGTRYAGQPIALVRPAEGEVFALEDRCAHRQVPLSKGVVKGQAVQCCYHGWAYGRSGRC
FT                   IDVPYLGKGKLPNGVRTYPCREQDGLIFVFPGDPERAAATPLPRLAQTTNPDYKTRRFG
FT                   RHVKCHYSFMHENLMDMNHQFMHMKQMGQMKPRFLGQDRGPGMIEARYTFARTGGKQPL
FT                   GEALVFGQKRDNSAKYAHRDVMTIRTEYPYQTLKIQAEGTPPVMDLWIVYVPQDAEEMT
FT                   NRVFGLLSIKRPRVPGLLDMAWPFLVAFTERIFSEDREIVELEQAAWDELGGDHNQEVF
FT                   PVIRSLRELLAECGIPAARS"
FT   gene            435116..436159
FT                   /locus_tag="Gdia_0397"
FT   CDS_pept        435116..436159
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0397"
FT                   /product="mutator MutT protein"
FT                   /note="TIGRFAM: mutator MutT protein; PFAM: NUDIX
FT                   hydrolase; GCN5-related N-acetyltransferase; KEGG:
FT                   gdi:GDI2178 putative bifunctional acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50193"
FT                   /db_xref="GOA:B5ZCC9"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="InterPro:IPR029119"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZCC9"
FT                   /protein_id="ACI50193.1"
FT                   /translation="MMHDGMTIDLGTDRTDAALQAGPYRLRTLLPSDAGTMHRLVNDWS
FT                   VIRMLSRVPFPYPRGLTDDWIASTQDLSRRGAAYHFAITHPESDDPDSLMGCIGVQVNA
FT                   AARSATVGYWVGRPYWNRKVASTTVERIARWALATLPIERVAAAVAHDNPASIAVLRRI
FT                   GFRETGSGRQAFVSRGTGDHPVLLFEATRADLAMDDPGVGSAPLPAGRTPEQKRVILVA
FT                   AVALVDTDGRILLARRPEGKPMAGLWEFPGGKVETGETPEAALIRELDEELGLDVARSC
FT                   LAPYTFVSHDYGHFHLLMPVYVCRRWKNVPHPREGQTLAWVRADDLSHYPMPEADLPLI
FT                   PLLRDLL"
FT   gene            complement(436162..437070)
FT                   /locus_tag="Gdia_0398"
FT   CDS_pept        complement(436162..437070)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0398"
FT                   /product="SMP-30/Gluconolaconase/LRE domain protein"
FT                   /note="PFAM: SMP-30/Gluconolaconase/LRE domain protein;
FT                   KEGG: gdi:GDI2179 transcriptional regulator, IclR
FT                   family/regucalcin"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50194"
FT                   /db_xref="InterPro:IPR005511"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR013658"
FT                   /db_xref="InterPro:IPR039096"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZCD0"
FT                   /protein_id="ACI50194.1"
FT                   /translation="MMMGPICGAPRCVWDLRATLGEGPVWSEGEQALYFVDIVGRAIHR
FT                   YRPESGETMTWLAPNRPGFLVPSNDGTFLCGLKDGLHRFDPASGHFSLDTLVEPELPDN
FT                   RINDGHVDRFGRLWFGTMHDAETDPTGSLYSVSQDQGRLHVHREDEGYIVSNGPALSPD
FT                   GRTLYHNHSPARTVYAFDVGSGGVLSNRRVFATLQGGYPDGIAVDSAGFLWIGVWGGGR
FT                   IERLAPDGTPVDPIPLPARNVTKVAFGGADYRTVFVTTARKGLSPEQLDAEPLTGGLFS
FT                   FGTSIPGQKQAVFPLDRSIVL"
FT   gene            437145..437897
FT                   /locus_tag="Gdia_0399"
FT   CDS_pept        437145..437897
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0399"
FT                   /product="molybdopterin binding domain"
FT                   /note="PFAM: molybdopterin binding domain; KEGG:
FT                   gdi:GDI2180 molybdopterin binding"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50195"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR036425"
FT                   /db_xref="UniProtKB/TrEMBL:A9HL54"
FT                   /protein_id="ACI50195.1"
FT                   /translation="MNPTACILVIGNEILSGRTQDVNVQYIARRLTELGITLAEVRVIP
FT                   DQRAVIVGTVCDVRARFDHIFTTGGIGPTHDDITAPCIAEAFGVPWSVHPDSFRLLEAH
FT                   FPPGEFNAARQRMATLPEGATPIANPVSVAPGFSIGNVHVMAGVPRIMQAMFEELAPTL
FT                   RHGTPVTSRSWYALGLYEGALAEGLADIQDRHPSVDIGSYPFRRPDGRRGVALVSKGLD
FT                   AAAVCHAADRVRELIERLGFTPAEGEPP"
FT   gene            complement(437907..438863)
FT                   /locus_tag="Gdia_0400"
FT   CDS_pept        complement(437907..438863)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0400"
FT                   /product="acetyl-CoA carboxylase, carboxyl transferase,
FT                   alpha subunit"
FT                   /EC_number="6.4.1.2"
FT                   /note="KEGG: gdi:GDI2181 acetyl-coenzyme A carboxylase
FT                   carboxyl transferase subunit alpha; TIGRFAM: acetyl-CoA
FT                   carboxylase, carboxyl transferase, alpha subunit; PFAM:
FT                   acetyl-CoA carboxylase alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50196"
FT                   /db_xref="GOA:A9HL57"
FT                   /db_xref="InterPro:IPR001095"
FT                   /db_xref="InterPro:IPR011763"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9HL57"
FT                   /protein_id="ACI50196.1"
FT                   /translation="MRQFLDFEKSVAELENKIDELRKMSEPDGINLAEEIARLTDKSEK
FT                   QLRAAYAKLSPWQKVQVARHAQRPHAADYIGTLIQDFTPLAGDRLFGEDKAVIGGIGRF
FT                   QDQPVVVIGTERGSELESRLAHNFGMARPEGYRKAQRLMELAGRFGMPILTFIDTSGAW
FT                   PGIDAEARGQAEAIARSIDTCLSAPVPVIATVIGEGGSGGAIALGAGDRVMMLEHAIYS
FT                   VISPEACASILWRDPKQATSAAEALKLTAQDLLQLKLIDRIIPEPVGGAQRDPESTIRS
FT                   VGDSIAAELPDLLSLSAPMLVAQRREKFLAMGRDSLS"
FT   gene            complement(438934..439848)
FT                   /locus_tag="Gdia_0401"
FT   CDS_pept        complement(438934..439848)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0401"
FT                   /product="integrase family protein"
FT                   /note="PFAM: integrase family protein; integrase domain
FT                   protein SAM domain protein; KEGG: gdi:GDI2182 putative
FT                   tyrosine recombinase XerD"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50197"
FT                   /db_xref="GOA:A9HL60"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR023009"
FT                   /db_xref="UniProtKB/TrEMBL:A9HL60"
FT                   /protein_id="ACI50197.1"
FT                   /translation="MSAQAEAFLEMLAAERGAAANTLKAYGRDLDDFAAHARQAGRSLH
FT                   DADSALLRDYMGSLARAGLSPRTQARRLSCLKQFHLFLAREGVRQDNPAELLDTPRLPA
FT                   TLPRFLTEDEVDALLAACVPPPDGGAARRWLVARAALEMLYASGLRISELLALPRRGLG
FT                   RDAQMLMVRGKGGRERLVPLSAAARAAAEALIAHDGPRRSPYLFPGRAPDRPLTRQGFD
FT                   RILHDVALRAGLDPARLSPHVLRHSFATHMLARGADLRALQVLLGHADIATTQIYTHVL
FT                   AERLRQAVEAYHPLARGGDGETR"
FT   gene            complement(439859..440002)
FT                   /locus_tag="Gdia_0402"
FT   CDS_pept        complement(439859..440002)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0402"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gdi:GDI2183 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50198"
FT                   /db_xref="UniProtKB/TrEMBL:A9HL62"
FT                   /protein_id="ACI50198.1"
FT                   /translation="MQRILLALAGIVVLAAAGGFVSLGAFPPPAPTLPVHKDLPSDRFA
FT                   HP"
FT   sig_peptide     complement(439928..440002)
FT                   /locus_tag="Gdia_0402"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.525 at
FT                   residue 25"
FT   gene            440106..441881
FT                   /locus_tag="Gdia_0403"
FT   CDS_pept        440106..441881
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0403"
FT                   /product="3-dehydroquinate synthase"
FT                   /note="PFAM: shikimate kinase; 3-dehydroquinate synthase;
FT                   KEGG: gdi:GDI2184 putative bifunctional protein: shikimate
FT                   kinase and 3-dehydroquinate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50199"
FT                   /db_xref="GOA:A9HL64"
FT                   /db_xref="InterPro:IPR000623"
FT                   /db_xref="InterPro:IPR016037"
FT                   /db_xref="InterPro:IPR023000"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030960"
FT                   /db_xref="InterPro:IPR031322"
FT                   /db_xref="UniProtKB/TrEMBL:A9HL64"
FT                   /protein_id="ACI50199.1"
FT                   /translation="MSRPIEPPAPESTDLSPAGGRDAPFLAFDLDALVAADRPDRPGPR
FT                   APGPHERSVVLVGLMGAGKTTIGRRIAARLGMPFVDADVEIERAAGCSIADLFRRYGEA
FT                   EFRKGEHRVIRRILSGHPLVLATGGGAFMDPVTRAVIRDRATSVWLRCPLPVLVRRVQG
FT                   RTHRPLLNEGNPRDILAALMEIRHPVYAEANITVDCGEESVDQSAATVISALTLAKPPR
FT                   LVPVILERWRYDVTIGEDLLRHAGILLAPVLPQKRVVVVTDSTVATLHLPRLLAGLAEG
FT                   AIRAETIVVPPGEGSKTMAEYERVTNALLDMGVERGTTVIALGGGVVGDLAGFAAATTL
FT                   RGLPFVQIPTTLLSQVDSSVGGKTGINTPFGKNLLGAFHQPLAVLVDTTTLASLPAREV
FT                   RAGYAEIVKSGLIGDAALFEWCEANGQAVLDGDADIRAEAVRQACAFKAHVVGDDEREE
FT                   KKSDGRALLNLGHTFGHALEAELGYDGRLLHGEAVSIGLRLAFLASVRMGFCDRTDLNR
FT                   VTAHLERLGMPARISDVGETFSADRLIAHMQRDKKMRDGRLSFVLVRGIGQAFTCRDVP
FT                   DAVVRDILLAEGCAA"
FT   gene            442214..443350
FT                   /locus_tag="Gdia_0404"
FT   CDS_pept        442214..443350
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0404"
FT                   /product="OmpA/MotB domain protein"
FT                   /note="PFAM: surface antigen msp4 family protein; OmpA/MotB
FT                   domain protein; KEGG: gdi:GDI2185 outer membrane
FT                   lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50200"
FT                   /db_xref="GOA:P84838"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="UniProtKB/Swiss-Prot:P84838"
FT                   /protein_id="ACI50200.1"
FT                   /translation="MRLRTALLATTLMAAAPVAANATIITGPYVDLGGGYNLVQNQHGH
FT                   FSNDPANASMLTKSSSQYRHDAGFTGFGAVGWGFGNGLRLEAEGLYNYSEINHRAPTAA
FT                   TGVTSGHDQSYGGMLNVLYDIDLKQFGIDVPVTPFVGVGAGYLWQNVSPTTTRYSNGNV
FT                   SRLGGTNGGFAYQGIVGAAYDIPNMPGLQLTAQYRMVGQAFSDGPFTMTSYTNGVGKSV
FT                   GHAFFDNRFNHQFILGLRYAFNTAPPPPPPAPVVVPPAPTPARTYLVFFDWDRSDLTAR
FT                   AREIVAEAAQASTHVQTTRIEVNGYTDNSAAHPGPRGEKYNMGLSIRRAQSVKAELIRD
FT                   GVPTGAIDIHGYGEQHPLVPTGPNTREPQNRRVEIILH"
FT   sig_peptide     442214..442282
FT                   /locus_tag="Gdia_0404"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.626 at
FT                   residue 23"
FT   gene            443457..444032
FT                   /locus_tag="Gdia_0405"
FT   CDS_pept        443457..444032
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0405"
FT                   /product="GtrA family protein"
FT                   /note="PFAM: GtrA family protein; KEGG: gbe:GbCGDNIH1_1448
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50201"
FT                   /db_xref="GOA:B5ZCD7"
FT                   /db_xref="InterPro:IPR007267"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZCD7"
FT                   /protein_id="ACI50201.1"
FT                   /translation="MLDPVSSSPSPRQASSRWLADLRARLMPFVKFGVVGTFGLMWDTA
FT                   TVYGFRALLGLTGATILAYFVAATMNWLLNRHWTFRHVVHADHPLVQWARFLMANSLGF
FT                   VLNRGMVFTLFLTVPLCRTIPFLALAAGSLTGLFANFTLSHRVVFRHRQATAPTPSDPE
FT                   FQSAPERPACQNAASSFTAVRNSDSSIG"
FT   gene            complement(443948..444652)
FT                   /locus_tag="Gdia_0406"
FT   CDS_pept        complement(443948..444652)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0406"
FT                   /product="transcriptional activator, TenA family"
FT                   /note="PFAM: TENA/THI-4 domain protein; KEGG: gdi:GDI2186
FT                   thiaminase-2 protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50202"
FT                   /db_xref="InterPro:IPR004305"
FT                   /db_xref="InterPro:IPR016084"
FT                   /db_xref="UniProtKB/TrEMBL:A9HL70"
FT                   /protein_id="ACI50202.1"
FT                   /translation="MEWTAERDWPRLASGLAGRLRRDCGAEWDGFIHHPFVRGLADGSL
FT                   PEAEFRRFLIQDYLYLIQYARAYALAIYKADRLEDMRSASAIVSGLLDTELALHVSYCT
FT                   GWGLCIEDLQSQPESLELLAYTRFILDRGQAGDLLDLMVTLAPCLIGYGEIGVRLVADP
FT                   HTRRDGNPYWPWIALYGGEKFIGLVDAGIDTLEALSLRYGADARYPMLLSEFRTAVKLE
FT                   AAFWHAGRSGAL"
FT   gene            444871..447516
FT                   /locus_tag="Gdia_0407"
FT   CDS_pept        444871..447516
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0407"
FT                   /product="alanyl-tRNA synthetase"
FT                   /EC_number="6.1.1.7"
FT                   /note="KEGG: gdi:GDI2187 alanyl-tRNA synthetase
FT                   (alanine--tRNA ligase) (AlaRS); TIGRFAM: alanyl-tRNA
FT                   synthetase; PFAM: alanyl-tRNA synthetase class IIc;
FT                   phosphoesterase DHHA1; Threonyl/alanyl tRNA synthetase SAD"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50203"
FT                   /db_xref="GOA:A9HL73"
FT                   /db_xref="InterPro:IPR002318"
FT                   /db_xref="InterPro:IPR003156"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR012947"
FT                   /db_xref="InterPro:IPR018162"
FT                   /db_xref="InterPro:IPR018163"
FT                   /db_xref="InterPro:IPR018164"
FT                   /db_xref="InterPro:IPR018165"
FT                   /db_xref="InterPro:IPR023033"
FT                   /db_xref="UniProtKB/TrEMBL:A9HL73"
FT                   /protein_id="ACI50203.1"
FT                   /translation="MSTTNDIRAAFLDYFAANGHQIVPSSSLVPRNDPTLLFTNAGMVQ
FT                   FKNVFTGQETRPYSRATTAQKVVRAGGKHNDLDNVGYTARHHTFFEMMGNFSFGDYFKA
FT                   DAIEFAWTLITRNFGLPRDRLLATVYADDEEAADLWRKVAGLPDERIIRIGTADNFWRM
FT                   GDTGPCGPCSEIFFDHGPDVPGGPPGSPDEDGDRFVEIWNLVFMQFFEDPPGVRSPLPR
FT                   PSIDTGMGLERFAAIMQGKRDNYDTDTMRALILASAEATGQDPDGPFRASHRVVADHLR
FT                   STSFLIADGVLPSKDGRGYVLRRIMRRAMRHLHMMGTRETVFHRLVPALVRQMGAAYPE
FT                   LVQAEALIRETMRGEEERFKAMLDRGLALLADETARLGDGQPLPGDVAFKLYDTFGFPL
FT                   DLTQDALRGSSHDVDVTGFDRAMQVQRERARAAWSGSGDSATETVWFEARDRFGASEFL
FT                   GYATEQADAEIQAIVTDGRSVTEAPAGTEIALLLNQTPFYGESGGQVGDTGLITAPGLR
FT                   IAVTDTQKRLGDLMVHYGTVVEGTVRVGQAVTATVDHDRRSAIRAHHSATHLLHEALRR
FT                   RLGAHVTQKGSLNAPDRLRFDISQPRPLTPEEIADVEAEVNARIRENSPVVTRPMSQEE
FT                   AVAQGAMALFGEKYGDEVRVVFMGAPEDDRPAWSIELCGGTHVNRTGDIGLFRITSEAG
FT                   VSAGIRRIEAVTGKSAEQAAVATEQRLGQMAAMLRVSAAEAPERLAVILDERKVMERQI
FT                   SDLQRKLASGGSDGAQAETINGIGFVARDVGDLPARELKPLADSLRQQVGSGVVALVST
FT                   AEGKGSVVVAVTSDLTDRLDAVELVRLASAAMGGKGGGGRRDMAQAGGPDIARSEAALA
FT                   AVRGAVAAAA"
FT   gene            447809..448504
FT                   /locus_tag="Gdia_0408"
FT   CDS_pept        447809..448504
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0408"
FT                   /product="Carbonate dehydratase"
FT                   /EC_number="4.2.1.1"
FT                   /note="PFAM: carbonic anhydrase; KEGG: gdi:GDI2188 carbonic
FT                   anhydrase 1"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50204"
FT                   /db_xref="GOA:A9HL77"
FT                   /db_xref="InterPro:IPR001765"
FT                   /db_xref="InterPro:IPR015892"
FT                   /db_xref="InterPro:IPR036874"
FT                   /db_xref="UniProtKB/TrEMBL:A9HL77"
FT                   /protein_id="ACI50204.1"
FT                   /translation="MADTDARTSLISLLQGVEKFNTEVFPQNRELFAELADQQSPDTLF
FT                   IACADSRVNPSMITQTRPGDLFVLRNIGNIVPAYGEMLGGVSSAIEYAVLALGVSHIIV
FT                   CGHSDCGAMKALLDPDPTKLARMPTVASWLRNAEAARAVAGVLQATDAGPQSVRSLAEQ
FT                   NVLLQIAHLRTHPAVAAGLARNTLILQGWFYDIASGEVVVLDETTRTSIHVDEAIARLN
FT                   KTGTETPAA"
FT   gene            448510..449382
FT                   /locus_tag="Gdia_0409"
FT   CDS_pept        448510..449382
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0409"
FT                   /product="Endonuclease/exonuclease/phosphatase"
FT                   /note="PFAM: Endonuclease/exonuclease/phosphatase; KEGG:
FT                   gdi:GDI2189 putative endonuclease/exonuclease/phosphatase
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50205"
FT                   /db_xref="GOA:A9HL79"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:A9HL79"
FT                   /protein_id="ACI50205.1"
FT                   /translation="MGNVLRQWACAGLVAVALAHPAAGRTIKVSTWNLDWLTARAAGDP
FT                   TLPPDVHPRADADLRRLAVYAARLDADIVGFQEVDSPALAARLFPPGRYRIVMTADPVV
FT                   QRTGLAVATSLTIERHPDLAALDVYPPTAPHPLRSGLDVTIGDGTANLRVLVVHLKAGC
FT                   RDAAPSDRRAACLTLARQMAVLDDWVAQRQDEGVPFLVMGDFNRNLTPGDPFFHLLDQD
FT                   GPLTLATAGRASPCWGGTYFIDHLLLGNQARGWLRPDSLRVLTYDEQDPARAPALSDHC
FT                   PVSVRLEMP"
FT   sig_peptide     448510..448584
FT                   /locus_tag="Gdia_0409"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.958) with cleavage site probability 0.850 at
FT                   residue 25"
FT   gene            449432..450394
FT                   /locus_tag="Gdia_0410"
FT   CDS_pept        449432..450394
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0410"
FT                   /product="aldo/keto reductase"
FT                   /note="PFAM: aldo/keto reductase; KEGG: gdi:GDI2190
FT                   oxidoreductase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50206"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZCE2"
FT                   /protein_id="ACI50206.1"
FT                   /translation="MEQRHLGRSGLRVSAVGLGCNNLGGRIGLEESRMVVHQALDSGIT
FT                   LFDVADVYGRRESHCGASEEVLGAILGSRREDIVLATKFGMPMAADGSMQGASRRYIRQ
FT                   AVEASLTRLRTDRIDLYQVHVPDPDTPIDETLRALDDLIRDGKVLYAGCSNFPAWQVAD
FT                   AHHVARAGGFSGFISCQDELSLLARDALRELVPAMRRYGLGLLPYFPLASGVLTGKYHR
FT                   DIPPPPGSRLSEWTHLRDRYLTDTNWTILDGLGSVARAHGRTLTELAFGWLLSHDVVGS
FT                   VIAGATRPNQVIENVAAATRPLTPEECDAITAILPDHAR"
FT   gene            450405..451118
FT                   /locus_tag="Gdia_0411"
FT   CDS_pept        450405..451118
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0411"
FT                   /product="NUDIX hydrolase"
FT                   /note="PFAM: NUDIX hydrolase; KEGG: gdi:GDI2191 NUDIX
FT                   hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50207"
FT                   /db_xref="GOA:A9HL84"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="UniProtKB/TrEMBL:A9HL84"
FT                   /protein_id="ACI50207.1"
FT                   /translation="MRWPSRWPSIALDSGLTVRVAGHMPDLPAPVAAEVEAIWRERQAA
FT                   NPALFNGRVFTADRITTRGIVGHWTTYHRVLAQMTRPTLYPALRLKPLAVTGILHTPDG
FT                   IVLGRRAPHSTYLAGWWQTPPAGSVESRHGENKVDLTAQILAEAQEELGLAPDMLTVAG
FT                   PVRATRHPATRIVDIGIRLDTALPFDRVLQGWHAGGNDEYDRLAIVKPNQNPEDVVGPH
FT                   ILPGTREYLDVDRRS"
FT   gene            complement(451133..451270)
FT                   /locus_tag="Gdia_0412"
FT   CDS_pept        complement(451133..451270)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0412"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gdi:GDI2192 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50208"
FT                   /db_xref="GOA:A9HL87"
FT                   /db_xref="UniProtKB/TrEMBL:A9HL87"
FT                   /protein_id="ACI50208.1"
FT                   /translation="MPDIEDHSAPAPLRDVVQLMGAVTFVLAMLAVGWHAAHVSGVWPG
FT                   "
FT   gene            451479..452075
FT                   /locus_tag="Gdia_0413"
FT   CDS_pept        451479..452075
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0413"
FT                   /product="Cupin domain protein"
FT                   /note="PFAM: Cupin domain protein; KEGG: gdi:GDI2193
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50209"
FT                   /db_xref="GOA:A9HL90"
FT                   /db_xref="InterPro:IPR006045"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014500"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:A9HL90"
FT                   /protein_id="ACI50209.1"
FT                   /translation="MTVSRRAFQTFLAGLGLSLAGQEVRAASHAGHDVESFMLARNGWV
FT                   PNNDHLPVLYYRNAAALPADDPASGFERLFTANGWPPQWRWGVYDFHHFHSTAHEVLGV
FT                   ASGSARLMLGGPGGRIVDVRAGDVVVLPAGTGHRNLGSDDDFLVVGAYPPDQHYDLRRS
FT                   GLSPDELARMAHVPFPASDPVSGAGGSLPALWHQT"
FT   sig_peptide     451479..451559
FT                   /locus_tag="Gdia_0413"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.809) with cleavage site probability 0.548 at
FT                   residue 27"
FT   gene            452083..452829
FT                   /locus_tag="Gdia_0414"
FT   CDS_pept        452083..452829
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0414"
FT                   /product="NADP oxidoreductase coenzyme F420-dependent"
FT                   /note="PFAM: NADP oxidoreductase coenzyme F420-dependent;
FT                   KEGG: gdi:GDI2194 putative NADP oxidoreductase, coenzyme
FT                   F420-dependent"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50210"
FT                   /db_xref="InterPro:IPR028939"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A9HL93"
FT                   /protein_id="ACI50210.1"
FT                   /translation="MTEPTSLPPHVLRRRALLAGLSALLLPRLSRAATSLPIGIIGSGH
FT                   VGSTLGGLWLRAGHPVMFSARDLSSAQSVAAGLGALARAGTPEQAARFGEAVLLAVPYG
FT                   ALPALGASLHGVLAGKVVIDACNPYSWRDGDVARLARQQGAGPTTQSFFPGAHVIRAFN
FT                   SEDMSTISVEAHRLPPLLGIPYAGDDAAAMDVVRGLIVDAGFDPVRAGPLSVARLFQPG
FT                   GPEFEADLTAPELRGRLEQDQHGAGR"
FT   sig_peptide     452083..452181
FT                   /locus_tag="Gdia_0414"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.985 at
FT                   residue 33"
FT   gene            complement(452896..453447)
FT                   /locus_tag="Gdia_0415"
FT   CDS_pept        complement(452896..453447)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0415"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gdi:GDI2195 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50211"
FT                   /db_xref="GOA:A9HL96"
FT                   /db_xref="InterPro:IPR005325"
FT                   /db_xref="UniProtKB/TrEMBL:A9HL96"
FT                   /protein_id="ACI50211.1"
FT                   /translation="MATPFTQRWGLFVLLGVVSIALGIVAWIDAISVTLASTMIIGLVL
FT                   VIAGAVQMFHAFSVRDWGGFLLSLLGGVLYIVGGFILMQEPVTGSIVLTLVIAACLIIS
FT                   GTTRMLIAARHRELNGWWIILGGGLISLLVGACLYLTLPWSGLWLIGTFIAVELIAAGV
FT                   GWIQFGLALRQANLLSGSGV"
FT   gene            453781..454398
FT                   /locus_tag="Gdia_0416"
FT   CDS_pept        453781..454398
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0416"
FT                   /product="RNA-binding S4 domain protein"
FT                   /note="PFAM: ribosomal protein S4; RNA-binding S4 domain
FT                   protein; KEGG: gdi:GDI2196 30S ribosomal protein S4"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50212"
FT                   /db_xref="GOA:A9HL98"
FT                   /db_xref="InterPro:IPR001912"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR005709"
FT                   /db_xref="InterPro:IPR018079"
FT                   /db_xref="InterPro:IPR022801"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9HL98"
FT                   /protein_id="ACI50212.1"
FT                   /translation="MSKRLESKYKINRRLGVNLWGRAKSPVNKREYGPGQHGQRRKQKP
FT                   SDFSVQLMAKQKLKGYYGNISEKQFRKYYDEAVRRKGDTSENLIDLLERRLDAVVYRLK
FT                   FAMTPFAARQFVSHGHITVNGRKVNIPSYIVRDEDVIEVREKSKHLAIVLDAAQSGERD
FT                   VPEYMEVDHRQMKGRFLRAPKLSDVPYPVQMEPNLVIEFYSR"
FT   gene            454517..456100
FT                   /locus_tag="Gdia_0417"
FT   CDS_pept        454517..456100
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0417"
FT                   /product="peptide chain release factor 3"
FT                   /note="TIGRFAM: peptide chain release factor 3; small
FT                   GTP-binding protein; PFAM: protein synthesis factor
FT                   GTP-binding; elongation factor Tu domain 2 protein; KEGG:
FT                   gdi:GDI2197 putative peptide chain release factor 3"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50213"
FT                   /db_xref="GOA:A9HLA2"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004548"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR032090"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR038467"
FT                   /db_xref="InterPro:IPR041732"
FT                   /db_xref="UniProtKB/TrEMBL:A9HLA2"
FT                   /protein_id="ACI50213.1"
FT                   /translation="MDAPVNAEPATAPTSGLAATIAREIARRRTFAIISHPDAGKTTLT
FT                   ERILRAGGAIQMAGNVRAKGERRRTRSDWMGIERDRGISVVTSVMTFEYGGCIFNLLDT
FT                   PGHEDFSEDTYRTLTAVDAAVMVIDAAKGIEDRTRKLFEICRLRDIPIVTFINKMDREA
FT                   QDPFTLLDEISSALALDTAPATWPVGRAAQFVGTYDLRARSLHVSTPLEQSDPRMVQLA
FT                   EDLELAEAALPVFDRDSFNAGHLTPVFFGSAMKEIGVTDLLDALVAFGPPPRDQATESR
FT                   TVRADETGLTALVFKIQANMDPNHRDRMAFARICSGRLERGMRLKHVRIGKQFALHTPQ
FT                   FFFARDRQLAEEAFAGDVVGIPNHGTLRIGDTLTEGEDLRFTGVPHFAPEILRRVRLDD
FT                   AMKAKKLRQALTELAEEGVVQLFRPQDGAPPIVGVVGTLQLDVLQARLSGEYGVAIGFE
FT                   STPYNLARWVTGDRAKLETFAMANRSAMADDLDGDPVFLAGSAFMMRRTAEMNLDLSFH
FT                   DIKQIGIETR"
FT   gene            complement(456072..457418)
FT                   /locus_tag="Gdia_0418"
FT   CDS_pept        complement(456072..457418)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0418"
FT                   /product="MATE efflux family protein"
FT                   /note="TIGRFAM: MATE efflux family protein; PFAM: multi
FT                   antimicrobial extrusion protein MatE; KEGG: gdi:GDI2198
FT                   putative multidrug resistance protein NorM
FT                   (multidrug-efflux transporter)"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50214"
FT                   /db_xref="GOA:B5ZCF0"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZCF0"
FT                   /protein_id="ACI50214.1"
FT                   /translation="MLRIAAPIALAQIAQMAMGVTDSVLLGGLGADALAIGGLSTMLFF
FT                   TLLVMLQANLGAGGVLIAQARGSGDEGRIASIHAMLLVVALLLCVPFLALLTQAGPLLR
FT                   LMHQPATLVGPVTSFLHILMWGVPPALIGTGVVEVVLPALDAQGVLLRVMPVVAVVNGV
FT                   LNAGLIHGWFGLPAMGLRGSALATTLTMWGAALVLLAMVHSRPHLRLLLWPPRPRAADM
FT                   AVLLRLGVPMMMATGAEIMLFQVTALQAATLGPHALAAHQIVLNLTATTYMAIMALGQA
FT                   ANVRVAYWTGAARPARARHAAWVAVGTAIAGMVASGCLIYLFRARLVAFYLDPSVPANA
FT                   ESTHIAMAALLLAAVFQVADGTQAVLVGALRGRGDAIVPMVLAVLGYWGIGFPLGTWLA
FT                   FRCGLGVVGLWGGVACALVAVALMLGVRAARTLGDRGPAAVSVSRCRSA"
FT   sig_peptide     complement(457359..457418)
FT                   /locus_tag="Gdia_0418"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.851) with cleavage site probability 0.834 at
FT                   residue 20"
FT   gene            457597..458958
FT                   /locus_tag="Gdia_0419"
FT   CDS_pept        457597..458958
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0419"
FT                   /product="cysteinyl-tRNA synthetase"
FT                   /EC_number="6.1.1.16"
FT                   /note="KEGG: gdi:GDI2199 putative cysteinyl-tRNA
FT                   synthetase; TIGRFAM: cysteinyl-tRNA synthetase; PFAM:
FT                   Cysteinyl-tRNA synthetase class Ia DALR; tRNA synthetase
FT                   class I (M); Cysteinyl-tRNA synthetase class Ia"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50215"
FT                   /db_xref="GOA:B5ZCF1"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015273"
FT                   /db_xref="InterPro:IPR015803"
FT                   /db_xref="InterPro:IPR024909"
FT                   /db_xref="InterPro:IPR032678"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZCF1"
FT                   /protein_id="ACI50215.1"
FT                   /translation="MPDSMPQLTLHDSRSRKTVPFAPLDPGNVRVYYCGPTVYDLAHIG
FT                   NLRAMVTADILVRLLRHLYPRVTYVRNITDVDDKINTRARANGETIDSLTARTIRDFHE
FT                   DLDAVGILPPDIEPRATHHIAEMLTLIGQLIDSGHAYEAQGHVLFAVSRFPAYGALSGR
FT                   SPEDLLAGARVEVAPYKRDPGDFVLWKPSAPDLPGWESPWGRGRPGWHIECSAMSHRYL
FT                   GESFDIHGGGSDLLFPHHENELAQSQCCFPHGRFANHWVHNAMLLVNGEKMSKSLGNFL
FT                   TVRDALSVSPAEALRLLLLHAQYRSVLNFTLAGLEDAKQTLNRFYRAVGDTPPDGTVPV
FT                   PAPVLAALCDDLNTPRALAEMHALADRALAGDRDAALGLRAAGQLLGLLGQTEDAWFRA
FT                   GTYVHPETIERLIVERQDARKSRDFARADAIRESLAKDGIVLEDGPSGTTWRRA"
FT   gene            458955..459731
FT                   /locus_tag="Gdia_0420"
FT   CDS_pept        458955..459731
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0420"
FT                   /product="tRNA/rRNA methyltransferase (SpoU)"
FT                   /note="PFAM: tRNA/rRNA methyltransferase (SpoU); KEGG:
FT                   gdi:GDI2199 putative cysteinyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50216"
FT                   /db_xref="GOA:B5ZCF2"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR004384"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZCF2"
FT                   /protein_id="ACI50216.1"
FT                   /translation="MTGRDGGADIGPIGNSPVVILVRPQMAENIGTTARAMANGGLFHL
FT                   RLVAPRDGWPLERAWRSASGADRILEAATVHDSVDDAIADLHHVFATCPRPRHIVKTVL
FT                   TARGGAAELRQMSGRGLRTGLLFGPERAGLDNEDMARADALIRYPLNAAFMSLNLAQAV
FT                   MIMAYEWWMAEDATPPRALMTNETHVATKGELDNFMRHLIDDLDECGFLRNEQKRAGMV
FT                   RNLRHFFTRGEVTEQELRTLHGVVTELTRGRRARGQ"
FT   repeat_region   460172..461968
FT                   /rpt_unit_range=460172..460200
FT                   /note="CRISPR Recognition Tool, Bland et al. 2007"
FT   gene            complement(462037..462384)
FT                   /locus_tag="Gdia_0421"
FT   CDS_pept        complement(462037..462384)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0421"
FT                   /product="CRISPR-associated protein Cas2"
FT                   /note="TIGRFAM: CRISPR-associated protein Cas2; KEGG:
FT                   gdi:GDI2203 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50217"
FT                   /db_xref="InterPro:IPR010152"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZCF3"
FT                   /protein_id="ACI50217.1"
FT                   /translation="MLVIVVENAPPRLRGRLAVWLLEVRAGVYVGTYGQRVREMIWGQV
FT                   CAYIEDGNAVMAWAAPNDAGFEFDTCGRNRRVAVDFDGLRLVSFGPEAALPAQPGPAAT
FT                   TPPRRRGRGVL"
FT   gene            complement(462365..463324)
FT                   /locus_tag="Gdia_0422"
FT   CDS_pept        complement(462365..463324)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0422"
FT                   /product="CRISPR-associated protein Cas1"
FT                   /note="TIGRFAM: CRISPR-associated protein Cas1; KEGG:
FT                   gdi:GDI2204 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50218"
FT                   /db_xref="GOA:B5ZCF4"
FT                   /db_xref="InterPro:IPR002729"
FT                   /db_xref="InterPro:IPR019851"
FT                   /db_xref="InterPro:IPR033641"
FT                   /db_xref="InterPro:IPR042206"
FT                   /db_xref="InterPro:IPR042211"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZCF4"
FT                   /protein_id="ACI50218.1"
FT                   /translation="MSRPMPGLPPPRPIPLKERSSLLFVEKGQIDVLDGAFVLVGHNGI
FT                   RTHIPIGGLACLMLEPGTRVSHAAAALAARAGTLLIWVGEAGVRLYASGQPGGARADRL
FT                   LLQARLALDDAARLKVVRKMYALRFGEDAPERRSVDQLRGIEGSRVRETYRLLARTHGA
FT                   EWDGRRYDPHEWDTANLVNRCLSAATAALYGITEAAILAAGYAPAIGFLHTGKPQSFVY
FT                   DIADIVKFETVVPEAFRVAAAVQHERPLDGQRISDPVAAVRHRCRDQFRRTNILGRLIP
FT                   LIEEILSAGGAEMPPAQDEAMPVAFKDAKGLGDAGHRG"
FT   gene            complement(463336..464022)
FT                   /locus_tag="Gdia_0423"
FT   CDS_pept        complement(463336..464022)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0423"
FT                   /product="CRISPR-associated protein, Cse3 family"
FT                   /note="TIGRFAM: CRISPR-associated protein, Cse3 family;
FT                   PFAM: CRISPR-associated protein CT1974; KEGG: gdi:GDI2205
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50219"
FT                   /db_xref="InterPro:IPR010179"
FT                   /db_xref="UniProtKB/TrEMBL:A9HLC4"
FT                   /protein_id="ACI50219.1"
FT                   /translation="MMRGFLSRIALRRDAPVRALARLLVPDGEGRQHAAAHHLLWALFG
FT                   DDPDRTRDFLWRQMEAGRFMVLSAREPVDSHGLFDVETRPFDPLLKEGDRLRFLLRANA
FT                   TVDRKTPGRTRSQRHDVVMDALHRRSQREGAEARDSMIADALETWMGRQGVRAGFAPAS
FT                   PLVIEGRDVLRIPRSGGRGIVSFGVVNLTGEVRVTAPDAFLDSLMQGFGRARAFGCGLM
FT                   LIRRAV"
FT   gene            complement(464019..464801)
FT                   /locus_tag="Gdia_0424"
FT   CDS_pept        complement(464019..464801)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0424"
FT                   /product="CRISPR-associated protein Cas5 family"
FT                   /note="TIGRFAM: CRISPR-associated protein Cas5 family;
FT                   CRISPR-associated protein Cas5; KEGG: gdi:GDI2206
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50220"
FT                   /db_xref="GOA:A9HLC6"
FT                   /db_xref="InterPro:IPR010147"
FT                   /db_xref="InterPro:IPR013422"
FT                   /db_xref="InterPro:IPR021124"
FT                   /db_xref="UniProtKB/TrEMBL:A9HLC6"
FT                   /protein_id="ACI50220.1"
FT                   /translation="MGQFLTFAMVAPMASFGAIAVGERRDGWDRPARSAVLGLMAACLG
FT                   LTRDDEDAQAALAADYGLAILCHAPGKLLTDYHTAQAAPARRNWRPATRAEELAASPGD
FT                   LATILSRRDYRMGTWHLGAVWTSGKTARWSLEALQAAMREPVFTPSLGRRSCPAGLPLA
FT                   PSVTDGVSAAAVLLDRHRNGPEAGLRIRHDSFRRQFAGASRSGGLLLVLDAVDMAEHGG
FT                   GHTPLRREIRRDQPLSRRRWQFGLREEAVLLCREEGTI"
FT   sig_peptide     complement(464739..464801)
FT                   /locus_tag="Gdia_0424"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.980) with cleavage site probability 0.928 at
FT                   residue 21"
FT   gene            complement(464810..465868)
FT                   /locus_tag="Gdia_0425"
FT   CDS_pept        complement(464810..465868)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0425"
FT                   /product="CRISPR-associated protein, Cse4 family"
FT                   /note="TIGRFAM: CRISPR-associated protein, Cse4 family;
FT                   PFAM: CRISPR-associated protein CT1975; KEGG: gdi:GDI2207
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50221"
FT                   /db_xref="InterPro:IPR010148"
FT                   /db_xref="UniProtKB/TrEMBL:A9HLC8"
FT                   /protein_id="ACI50221.1"
FT                   /translation="MSRFLQLHLLTFYPPSNVNRDDTGNPKTANVGGVTRLRISSQALK
FT                   RAWRTSEIFSSALAGHMGQRTQRLGNEIRQHLLEKGLDEKRSLAIARDIAGIYGKVKAE
FT                   KDANSTYTEQLVFISPAEREAAFAMADRLAAGEKIDLAKEKDALLYRTDTAADIALFGR
FT                   MLASEPSYNREAAVQVAHAITTHRVTVEDDYYTAIDDLKRPEEDAGAGFLSEAGFGSGV
FT                   FYLYLCVNRELLRKNLGDADESGVMETALGALVEAAATVAPSGKQNSFAALARAQYVLA
FT                   ERGNAQPRTLAGAFARPVAGTDLMAGSIAALRTFRGELARVYGAGIDAECELETARKDS
FT                   ATLADIAAFCRS"
FT   gene            complement(465865..466455)
FT                   /locus_tag="Gdia_0426"
FT   CDS_pept        complement(465865..466455)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0426"
FT                   /product="CRISPR-associated protein, Cse2 family"
FT                   /note="TIGRFAM: CRISPR-associated protein, Cse2 family;
FT                   PFAM: CRISPR-associated protein Cse2; KEGG: gdi:GDI2208
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50222"
FT                   /db_xref="InterPro:IPR013382"
FT                   /db_xref="InterPro:IPR038287"
FT                   /db_xref="UniProtKB/TrEMBL:A9HLD1"
FT                   /protein_id="ACI50222.1"
FT                   /translation="MTGDDRNAIAEKARNWWRELQPDPGGRPGDRGTLARLRRCASIVD
FT                   ALFEPAVQTLARRCGARREGELARVALVAAVLAHVRSDNPAQFVARQIGPTDMAKVATA
FT                   LCKPVRFRRLLDASEFDECLTAFRRLVTLAGRTVNVADLARSVLAWPRTGMWDDMAAEK
FT                   IRVRWVYEYWNAGEPDSGASAEQSIESEKELQS"
FT   gene            complement(466452..468092)
FT                   /locus_tag="Gdia_0427"
FT   CDS_pept        complement(466452..468092)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0427"
FT                   /product="CRISPR-associated protein, Cse1 family"
FT                   /note="TIGRFAM: CRISPR-associated protein, Cse1 family;
FT                   PFAM: CRISPR-associated protein Cse1; KEGG: gdi:GDI2209
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50223"
FT                   /db_xref="InterPro:IPR013381"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZCF9"
FT                   /protein_id="ACI50223.1"
FT                   /translation="MNLLTASWLPIRRKSGAAETIRPAQIVDRVADDPIMALDWPRADF
FT                   RIASLEFLIGLLATAFPPKNEDIWCETWEDPPSVEALDEAFAPVAEAFWLDGPGPRFLQ
FT                   DLENLQSGQEPVERLLIDAPGDSTVKKNTDLFVHRQRIMALGRPAACMALFTLQSWAPS
FT                   GGAGNMTGLRGGGPLVTLVLPREGASLWEMVWANTPFGVPPSEADLPRVFPWLAPTIGS
FT                   GKDGTSVRPGHNAHPLQCWWGMPRRIRLDFEAAEDGICDLTGQPDAVLVPGWRQRPYGA
FT                   SYADWTGMPYGAGASIHPLTPRYRQKKDAEWLSVHPQPGGIGYRHWAGIVVNSSDTHRL
FT                   PASTVLSWRNDRARNVAASLTPRLLAAGYDMDNMKARSFVESEMPLPGVVDPVRQEALD
FT                   ALARAYVEAADQVAGILRQCVREALFGKGTISPDATLFSGLRERFWAQTEGTFFDLLHQ
FT                   AVLLGDGDDIDLRRIWLRALRRVALDLFDSAVMLTPDTGTTEAQRSALARRRLGAAVAG
FT                   GGKEGQALMMVLKIPVPVTRKATSRMKQP"
FT   gene            complement(468474..471167)
FT                   /locus_tag="Gdia_0428"
FT   CDS_pept        complement(468474..471167)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0428"
FT                   /product="CRISPR-associated helicase Cas3"
FT                   /note="KEGG: gdi:GDI2210 putative helicase protein;
FT                   TIGRFAM: CRISPR-associated helicase Cas3; PFAM: helicase
FT                   domain protein; SMART: DEAD-like helicases"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50224"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR006474"
FT                   /db_xref="InterPro:IPR006483"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR035011"
FT                   /db_xref="InterPro:IPR038257"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZCG0"
FT                   /protein_id="ACI50224.1"
FT                   /translation="MRSNGLEFFWGKARAVPAEGAMIGPVMHPLIAHMLDVAAVAVLLP
FT                   ENAKCGLDRRQLGLLVALHDIGKLMPAFQAKVEICWPEAILGGFPVELVPCFHDAAGLA
FT                   LLDLMVDDVLAALFANGQDGKCWRLTHKLKLLRAVAGHHGQPVSAQDRNTLAPDTIERA
FT                   RTLVALLFDVFRPPPILRPGDDTLRRLEWMLARVTIQADWIGSQQEWFPYVTPESVADP
FT                   SGYFWNHALPRAQSAIHRAGLGPMVGAPFAGTAGLFDHIREPSPMQALLETLPVPSGPV
FT                   LVVIEDATGSGKTEAALVMAQRLIAAGRSSGLFVALPTMATANAMYDRLAAAYRRLFQP
FT                   SARPSLALAHGRARLDERFAAALAPDDGSDAFPDARIMDETAEAYCAAWLGSESRRALM
FT                   AQVGVGTIDQALMAVLPVRFATVRHAGLAGKILIVDECHAFDPYMRREMVALLRFHAAM
FT                   GGSALLLSATLTQRIRQELTNAFRSGLDTVDPAPLSGTAYPLVTLVGKAGAEEYPCALR
FT                   PGLARSIAVRRLADTDAASREVIAAAAAGAAVAWIRNTVDEVIATARFLRAQGVELLVF
FT                   HARFAMVDRLAIERDVLARFGKNKETTGRSAVLVASQVIEQSLDLDFDVLVTDLAPMDQ
FT                   VIQRAGRLRRHDRIARPVDREELLVISPEPVAEPDPSWVRRVLPGTAAVYRDPALLWRT
FT                   ARTLFRYGRIESPGRIRALIEEAGDADAPGAVPDGLAAGSTDAMGKALAAGFAADRNVL
FT                   SFDAGYVADGALWEREARTPTRLEDLPYVTVRLAVMQDGRVLPWAAKIDPGLACAGEHR
FT                   RAWALSEVSVAQYRLARCPPPPGLERVVAAARAEWPRWEREDESSVLLLILQKMEEGWR
FT                   GAGQIETGHEVVIGYDRTYGLEVVPA"
FT   gene            complement(471212..472543)
FT                   /locus_tag="Gdia_0429"
FT   CDS_pept        complement(471212..472543)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0429"
FT                   /product="glutamyl-tRNA synthetase"
FT                   /note="TIGRFAM: glutamyl-tRNA synthetase; PFAM:
FT                   glutamyl-tRNA synthetase class Ic; KEGG: gdi:GDI2211
FT                   glutamyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50225"
FT                   /db_xref="GOA:A9HLD9"
FT                   /db_xref="InterPro:IPR000924"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR004527"
FT                   /db_xref="InterPro:IPR008925"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020058"
FT                   /db_xref="InterPro:IPR020751"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9HLD9"
FT                   /protein_id="ACI50225.1"
FT                   /translation="MKLRFAPSPTGLIHVGNARQAIANALYARRHGGTFQLRIDDTDRE
FT                   RSRDEYVDALHTDLAWLGITWDETFRQSDRLDRYAAAIETLKASGRLYPCFESEQELAS
FT                   KREARIRMRKPPIYDRAMLRMTAEQRAQAEANGKVPYWRFRLSDRTVAWDDMVMGRSQV
FT                   KLQSISDPVLVRADGTVLYTLASVVDDMETGVTHVLRGEDHLTNTGVQIDIAEALGGKV
FT                   GQFAFAHLPLLLDEAGGKLSKRFDGLSIRALRQDGIDPVAIVSYLARLGSADDPAPLSF
FT                   DDLAASYDVRRVSRSAARFDMRQLLALNRRVMHQMPFGAIRDRLPEGATEAFWMAVRGN
FT                   VDMVSELRHWWDVVGGVIVPPVQDDEGAYLLQALALLPPEPWDAQTWKDWTTAVRDATG
FT                   RSGKSVFHPLRVALTGEEKGPEMRDLLPLMGHDRVAERLRIAAR"
FT   gene            complement(472608..473009)
FT                   /locus_tag="Gdia_0430"
FT   CDS_pept        complement(472608..473009)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0430"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gdi:GDI2212 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50226"
FT                   /db_xref="UniProtKB/TrEMBL:A9HLE3"
FT                   /protein_id="ACI50226.1"
FT                   /translation="MTDTPPPFEPTEPTASETGWRVRILDLSGGAEEGIVEDIGGFLDL
FT                   AHANAFARAYVRDSIERCRVAGAAPREVLQAWMSFGEDAEILDAGDDGWRSANELDDFT
FT                   AHAATPMERDWRTIDPRRMVEDDEDETPE"
FT   gene            complement(473036..474217)
FT                   /locus_tag="Gdia_0431"
FT   CDS_pept        complement(473036..474217)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0431"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gdi:GDI2213 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50227"
FT                   /db_xref="GOA:A9HLE5"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR036068"
FT                   /db_xref="UniProtKB/TrEMBL:A9HLE5"
FT                   /protein_id="ACI50227.1"
FT                   /translation="MSAADTDGAFGPSQALDDGTISARTDAYFNRTRDIVTRFGDRVVT
FT                   YAMFIRRPVISAPRLMIDWLDNVTRARGSAITHEVMFPEGTWVGAGEPLVYITGSFAAL
FT                   SDLETLLLQKLGPPCVAAHNAYQMAMALPNVRFLAMEARHCAGFEMQEQMAYAASVGSA
FT                   AARREGALGFIGGANDATASFFGAEHGLGTMPHALIGYAGSTLRAAEMFHETYPDADLV
FT                   VLVDYFGREITDALQVCRAFPELAAAGRLAVRLDTHGGRFLEGLDPASSYAALERNTPG
FT                   TIRRYRSETELRHLVGTGVSAAAIWRMREALDEAGFPRVRIIVSSGFSGEKCLAMADAH
FT                   APIDVVGTGSFIPDRWSETYATADIVSYDGQARVKVGREFLLRQAHGRAVPPS"
FT   gene            complement(474240..475652)
FT                   /locus_tag="Gdia_0432"
FT   CDS_pept        complement(474240..475652)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0432"
FT                   /product="phospho-2-dehydro-3-deoxyheptonate aldolase"
FT                   /EC_number="2.5.1.54"
FT                   /note="KEGG: gdi:GDI2214
FT                   3-deoxy-D-arabinoheptulosonate-7-phosphate synthase (DAHP
FT                   synthetase, phenylalanine repressible); TIGRFAM:
FT                   phospho-2-dehydro-3-deoxyheptonate aldolase; PFAM: DAHP
FT                   synthetase class II"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50228"
FT                   /db_xref="GOA:A9HLE8"
FT                   /db_xref="InterPro:IPR002480"
FT                   /db_xref="UniProtKB/TrEMBL:A9HLE8"
FT                   /protein_id="ACI50228.1"
FT                   /translation="MSATHSHDSSSRQAWTPESWRSFPIRQVPDYPDAAALRAVEERLR
FT                   RYPPLVFAGEARRLKASLAAASQGRAFVLQGGACAESFSEFTADIVRDTFRVLLQMAVV
FT                   LTFGAKVPVVKIGRMAGQYAKPRSSGTETIGGVSLPSYRGDIINGADFTPEARIPDPAR
FT                   METGYFQSAGVMNLLRAFAGGGYANLQEVHRWNLGFVERSPLAERYGVLAERIDETLAF
FT                   MAACGVTGATTRQMDETEFYTSHEALLLPYEQALTRVDSTSGEWYDCSAHFVWIGDRTR
FT                   QPDGAHVEFLRGVRNPIGIKVGPTTTIEDLERLLDILNPRDEAGRISLISRMGAEGVGK
FT                   HLPPLLRKVVASGRTVTWLCDPMHGNTISTDNKIKTRSFEAILAEIRGFFDVFQAENAH
FT                   PGGVHIEMTGQNVTECVGGAHRLTEADLGERYETFCDPRLNAEQSLEMAFLLSEELTAR
FT                   LRGSAAKGTEAA"
FT   gene            475975..476367
FT                   /locus_tag="Gdia_0433"
FT   CDS_pept        475975..476367
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0433"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gdi:GDI2215 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50229"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZCG5"
FT                   /protein_id="ACI50229.1"
FT                   /translation="MAATLRTGLFPLLAGLCLLASPALPSRAMAAPDDFSSPGNRLPPQ
FT                   NQDGVEAQHGEDKTVVGRRSLPPGYQDAPSMDMNHGPDPDHEANVHRDAVTGSDLSRFG
FT                   NAYQSSGPYGQGQMGDATGNGWVTPR"
FT   sig_peptide     475975..476067
FT                   /locus_tag="Gdia_0433"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.977 at
FT                   residue 31"
FT   gene            complement(476476..477876)
FT                   /locus_tag="Gdia_0434"
FT   CDS_pept        complement(476476..477876)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0434"
FT                   /product="pyridine nucleotide-disulphide oxidoreductase
FT                   dimerisation region"
FT                   /note="PFAM: FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; pyridine nucleotide-disulphide
FT                   oxidoreductase dimerisation region; KEGG: gdi:GDI2216
FT                   glutathione reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50230"
FT                   /db_xref="GOA:A9HLF3"
FT                   /db_xref="InterPro:IPR001100"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR012999"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A9HLF3"
FT                   /protein_id="ACI50230.1"
FT                   /translation="MTYDFDLFVIGAGSGGVRCARIAAGHGARVAVAENRHWGGTCVNL
FT                   GCVPKKLMVQASEYNDLARDSHGFGWNIAPGHHDWAALIAAKDHEISRLNGIYVSLLEK
FT                   AGVTLFTGTARFEDAHTLVIGPGALAPDAPVRRVTAERIVIATGSAPDMPSLPGIEHAI
FT                   SSDAAFHLESRPQRVCMVGGGYIGIEFAGIFRGLGSEVDLVYRQDLPLRGFDQDMRHGI
FT                   HDAIAARGIRQHTGRSPVSIQPVGDAYEVRLDDGSHVIADCVFFATGRSPNVGALGLDH
FT                   AGVDTVAGGRIVVDGTGETNVEGIYAIGDVTNRLNLTPVAIAEGHSLADRLFGTGHHPR
FT                   SWSLATTPKAVFFSPPLATVGLTEEEAARDGIVDIYLARFTPMRHTLTGRARKTIMKLV
FT                   VDQATQKVVGAHMIGDDAPEMMQGLAIAVTAGLTKADFDRTVGIHPTSAEEFVTMRTRT
FT                   RVTDRQAD"
FT   gene            complement(477895..478773)
FT                   /locus_tag="Gdia_0435"
FT   CDS_pept        complement(477895..478773)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0435"
FT                   /product="Oxidoreductase FAD-binding domain protein"
FT                   /note="PFAM: Oxidoreductase FAD-binding domain protein;
FT                   KEGG: gdi:GDI2217 ferredoxin--NADP reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50231"
FT                   /db_xref="GOA:B5ZCG7"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR008333"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR033892"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZCG7"
FT                   /protein_id="ACI50231.1"
FT                   /translation="MSDTLTMPATETVPTGLEPVPGEAGVYHLAEPTKTYGHLNAETVL
FT                   TVHHWTDRLFSFTTTRDAALRFENGQFAMIGIEVEGKPLLRAYSIASANYEDQMEFLSI
FT                   AVPDGPLTSRLRHVKPGDKVLIGRKPTGTLLLDNLRPGRNLYFLSTGTGLAPFMSLIKD
FT                   PSAYERFDRVILSHTVRISGELAYANHIRHELPQHEFLGEDVSGKLLYYPAVTREPFAV
FT                   TDRITKLIETGKIFTDLNIPELDPEHDRVMICGSPEMLADTEAMLVARGFDEGNNSTPG
FT                   AYVVEKAFAER"
FT   gene            478977..481424
FT                   /locus_tag="Gdia_0436"
FT   CDS_pept        478977..481424
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0436"
FT                   /product="helicase domain protein"
FT                   /note="PFAM: helicase domain protein; KEGG: gdi:GDI2218
FT                   ATP-dependent RNA helicase"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50232"
FT                   /db_xref="GOA:B5ZCG8"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR022192"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041082"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZCG8"
FT                   /protein_id="ACI50232.1"
FT                   /translation="MTSESPARHAVDAAIAETGLAIETRELPKLERTVARALAPGQDRV
FT                   DAATFRAALCAVRRKPWGSRLMDLTRRAGEVWVTRADTEAAAATIDDPEPDDASLLRAL
FT                   GEVVRARLRATAPTPEAALETIRADLFDGTGRVLSPAETETLSRAVAAAFGLDAATGFV
FT                   EAVRRTADARQEEQDAIEQAARARRREEVRRLREWEDSLVAFSEVPRLLHCSQKEALRW
FT                   IAENRLPVARRVPQPNGTERWEFDPRELVALRARLPEWRGGLPGVATPLVPDPGTRKVG
FT                   NAVIARVAALDRYAAHFKTARALKRRITLVTGPTNSGKSHTALEALARAESGMALAPLR
FT                   LLAHEFREALTARGVPTSLATGEERIDIPGSRHLAATVEMCPLHNPVDVAMIDEAQMLS
FT                   DPDRGAAWTAAIMGAPARHLFVLGAPDCIPMVRRIAELCGDPLDEVHLERKGPLVTASE
FT                   PVRLQDLKPHDALIAFSRREVLDLRAALLARGRRVAVVYGALSPEVRRAEAQRFNDGEA
FT                   DILIATDAIGMGLNLTIRRVIFTALRKFDGTQTRDLNAQEVKQIGGRAGRYGKHEQGVV
FT                   AVLAGAGSASFIRAMMAAPPAELADLRPQVQPDADIIQAVAAEIGSESLFGVLARIRRA
FT                   VLRPDDPNYRLANMEQAFAIATALEGVSGLSLAQRWVYAMCPVDDRDNGIQRLIHWAAD
FT                   HAAGRPVVPPGPGRLPPPDRAERIELERAEKRHKRLVAWRWLSLRFPDAYPAREDAEDA
FT                   TARLNDWIEDVLRQQSSRSRAGGEEPRPGQPPHAPGRGHRKGGGRNGNRGGKGPPRHSV
FT                   SGR"
FT   gene            complement(481411..482685)
FT                   /locus_tag="Gdia_0437"
FT   CDS_pept        complement(481411..482685)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0437"
FT                   /product="seryl-tRNA synthetase"
FT                   /EC_number="6.1.1.11"
FT                   /note="KEGG: gdi:GDI2219 seryl-tRNA synthetase; TIGRFAM:
FT                   seryl-tRNA synthetase; PFAM: tRNA synthetase class II (G H
FT                   P and S); Seryl-tRNA synthetase, class IIa-like"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50233"
FT                   /db_xref="GOA:A9HLG2"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002317"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR015866"
FT                   /db_xref="InterPro:IPR033729"
FT                   /db_xref="InterPro:IPR042103"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9HLG2"
FT                   /protein_id="ACI50233.1"
FT                   /translation="MHDLRALRADPAAFDAALARRGEAPAAIHIASLDEDRRAAVTALQ
FT                   DKQARRKSLSKEVGALRRTGEDSTALEAEAVQLREDIEKLEVLVRELDAEIRDCLVVLP
FT                   NRLDDGVPEGADESANVVVHQVGERRDFAFPPREHFALGEALGLMDFETAGKLSGARFV
FT                   VLRGALARMERALGQFMLDLHVQEHGYTETAVPVLVNEAAMFGTDKLPKFADQSFRTED
FT                   GRWLIPTAEVPLTASVAGDILPASALPRRMVALSSCFRSEAGAAGRDTRGMLRQHQFQK
FT                   VEMVSITAPGDSDAEHERMTRCAEKVLERLGIPYRRMLLCAGDTGFGAARTFDLEAWLP
FT                   GQDAWREISSCSTTRDFQARRMNARYRPADGAGPEFVHTLNGSGLAVGRTLIAVMENYQ
FT                   NADGSITVPQALRPYMNGLAAISAR"
FT   gene            complement(482678..483442)
FT                   /locus_tag="Gdia_0438"
FT   CDS_pept        complement(482678..483442)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0438"
FT                   /product="Sec-independent protein translocase, TatC
FT                   subunit"
FT                   /note="TIGRFAM: Sec-independent protein translocase, TatC
FT                   subunit; PFAM: Sec-independent periplasmic protein
FT                   translocase; KEGG: gdi:GDI2220 putative sec-independent
FT                   protein translocase protein TatC"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50234"
FT                   /db_xref="GOA:A9HLG5"
FT                   /db_xref="InterPro:IPR002033"
FT                   /db_xref="InterPro:IPR019820"
FT                   /db_xref="UniProtKB/TrEMBL:A9HLG5"
FT                   /protein_id="ACI50234.1"
FT                   /translation="MPLLDHLVELRRRLLWSAVTFGLCFLLCYHFSARIYLFLARPLGD
FT                   VMRAQGEQPHLIYTALYEAFFTYIKVAIFGAAFLSFPMVAIQVWMFVAPGLYRSEKRAF
FT                   LPFLVATPVMFVMGAALAYYFVFPFAWKFFLSFQTADGQDGLQIQLQAKVSEYLALVMK
FT                   LIMAFGVAFELPVVLTLLARVGIVTADTLKRFRRYAYVGAFVIAAILTPPDVITQTGLA
FT                   VPLIGLYEISIFCARLVQPKRADDADQENRDA"
FT   gene            complement(483523..484104)
FT                   /locus_tag="Gdia_0439"
FT   CDS_pept        complement(483523..484104)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0439"
FT                   /product="twin-arginine translocation protein, TatB
FT                   subunit"
FT                   /note="TIGRFAM: twin-arginine translocation protein, TatB
FT                   subunit; KEGG: gdi:GDI2221 putative sec-independent protein
FT                   translocase protein TatB"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50235"
FT                   /db_xref="GOA:B5ZCH1"
FT                   /db_xref="InterPro:IPR018448"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZCH1"
FT                   /protein_id="ACI50235.1"
FT                   /translation="MFDFAWSEMAVIGVVALLLIGPKDMPVAIRTVTGLIKKGRKLASE
FT                   FQSHVDEMVRDADLTEARDQLNRMRRLNVRNQIMQAIDGDGTIRRTIEESPLDGTRAGP
FT                   ADLSGFDPGGLHEYGYATPVASYAETAFPPAPDAGPPPALLPPSVARRLAAERARLHPP
FT                   AFLPPVRVIHGARRVSVTAPDVGAPAPHRG"
FT   gene            complement(484209..484904)
FT                   /locus_tag="Gdia_0440"
FT   CDS_pept        complement(484209..484904)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0440"
FT                   /product="chromosome segregation and condensation protein,
FT                   ScpB"
FT                   /note="TIGRFAM: segregation and condensation protein B;
FT                   PFAM: chromosome segregation and condensation protein ScpB;
FT                   KEGG: gdi:GDI2222 putative segregation and condensation
FT                   protein B"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50236"
FT                   /db_xref="GOA:A9HLH0"
FT                   /db_xref="InterPro:IPR005234"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A9HLH0"
FT                   /protein_id="ACI50236.1"
FT                   /translation="MTDTPLPETTVRADPASVRLVEALIFASPDPVSERAIAELLEAQG
FT                   QVPADIDDLGAYVRSVIDAVVALYDGRGVAPVLIAGGWQFRTAADLAPRLTRVLHRPRR
FT                   LARATLETLAIIAYHQPCTRAEIEEIRGVSLSQQVLDTLLEASLIVPRGRKEVPGRPIL
FT                   WGTSADFLRHFGLRDLRDLPRREELLVDVPDNPVLNPAPNPAPGPALDPAVSPPAATTP
FT                   QAVSDAPPT"
FT   gene            complement(484901..485806)
FT                   /locus_tag="Gdia_0441"
FT   CDS_pept        complement(484901..485806)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0441"
FT                   /product="chromosome segregation and condensation protein
FT                   ScpA"
FT                   /note="PFAM: chromosome segregation and condensation
FT                   protein ScpA; KEGG: gdi:GDI2223 putative segregation and
FT                   condensation protein A"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50237"
FT                   /db_xref="GOA:B5ZCH3"
FT                   /db_xref="InterPro:IPR003768"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZCH3"
FT                   /protein_id="ACI50237.1"
FT                   /translation="MQPDAVQGGAAVGPGGQDGGLPDGLPGGLTAPMLRLEGFEGPLDL
FT                   LLELARAQKVDLARISILQLVEQYLAIVESARRIRLELAADWLVMAAWLAWLKSRLLLP
FT                   AEEGEAVDAEEAAELLQARLLELARIGRAAEWLAARPQLGRDVFARGEREDLTEIDRSG
FT                   LALDLPQLMGAYMAAMRRGARKRVYQPRRLNFWTVQDALARLHRLLGTDIVPGTGWCDL
FT                   GAFLPDSGPGLDGGDEDERLRLRRAAMAGTLIAGLELARSGSIELRQDEQFGRIMLRPC
FT                   TADDAAEDAGEDMDRMDAAE"
FT   gene            complement(485816..486742)
FT                   /locus_tag="Gdia_0442"
FT   CDS_pept        complement(485816..486742)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0442"
FT                   /product="Sporulation domain protein"
FT                   /note="PFAM: Sporulation domain protein; KEGG: gdi:GDI2224
FT                   putative sporulation protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50238"
FT                   /db_xref="GOA:B5ZCH4"
FT                   /db_xref="InterPro:IPR007730"
FT                   /db_xref="InterPro:IPR036680"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZCH4"
FT                   /protein_id="ACI50238.1"
FT                   /translation="MNESAPSDPTGRDPHEDRLSRARERMSADYDDDTPPRASGRGDGG
FT                   RPAWGRPRVSVGGLMDGLLGSDPMTRRLAYGAAGLGGLLVLAIGGWALMGHHPSGIPVL
FT                   GPPPGPVRVRPLDPGGMQVLGAEAPTGDDGAVARLAPGPEQPRPDQLAEQYGQKPAAPA
FT                   PIPAAPAPAPVAPAPAAPAAAPPVTAAPVPSAPPASTAAPPADTASTVPAPSTPPAPAP
FT                   AAPLAGRYGVQLAALDSQAAAEKEWARLVQHDPDLFAGHAPIIERTERNGAVFFRLRTR
FT                   GFASIAQATSFCQHVRLNGLACTLAGF"
FT   gene            complement(486739..488532)
FT                   /locus_tag="Gdia_0443"
FT   CDS_pept        complement(486739..488532)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0443"
FT                   /product="arginyl-tRNA synthetase"
FT                   /EC_number="6.1.1.19"
FT                   /note="KEGG: gdi:GDI2225 arginyl-tRNA synthetase; TIGRFAM:
FT                   arginyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50239"
FT                   /db_xref="GOA:B5ZCH5"
FT                   /db_xref="InterPro:IPR001278"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR005148"
FT                   /db_xref="InterPro:IPR008909"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR035684"
FT                   /db_xref="InterPro:IPR036695"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZCH5"
FT                   /protein_id="ACI50239.1"
FT                   /translation="MSDSLFVRYLSHVRDALRRIVPDLPDEVAARVELTPTRDPAHGDM
FT                   ATNAALLAAKIARRRPAEIAADLAAALAGVPGVAKAEPAGPGFVNVTLDAAVLRSIVPA
FT                   VLGAGESYGDAALGQGVRVNVEYVSANPTGPMHVGHCRGAVVGDALANLLAKAGYGVTK
FT                   EYYINDAGAQVIALAWATYWRYLQVIGTTMGQEEFAALVPGGIQYGGDYLVPVGRALAE
FT                   AHGTALAEPGAQPAAPEHWLPTVKSFVVAQMMAMIRQDLDALGVRHDVFTSEAKILADG
FT                   ITDRAIARLDAQGLLYEGVLEPPKGKLPEDWEARPQTLFRSTAFGDDVDRPLRKSDGSN
FT                   TYFANDIGYHDDKIRRGADLLIDVWGADHGGYVTRMKAAVKALGKDGGTVDFDVLLCQI
FT                   VRIVRDGQPVRMSKRAGTFVTLRDLIDEVGRDAVRFTMLTRKADAQMEFDLDQVVAQTR
FT                   DNPVFYVQYAHARCRSVLRAAQEMLGAQDVAPATLAQAALDGIESDAELALLRRIAQWP
FT                   RTVEGAAQAHEPHRIAFYLGELAGDFHTLWNRGRDDATLRFLQEDDLAATRAKLALVEA
FT                   TATVIRSGLAVLGVTPVEEMR"
FT   gene            complement(488616..489818)
FT                   /locus_tag="Gdia_0444"
FT   CDS_pept        complement(488616..489818)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0444"
FT                   /product="deoxyguanosinetriphosphate triphosphohydrolase"
FT                   /note="KEGG: gdi:GDI2226 deoxyguanosinetriphosphate
FT                   triphosphohydrolase-like protein; TIGRFAM:
FT                   deoxyguanosinetriphosphate triphosphohydrolase; PFAM:
FT                   metal-dependent phosphohydrolase HD sub domain; SMART:
FT                   metal-dependent phosphohydrolase HD region"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50240"
FT                   /db_xref="GOA:B5ZCH6"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006261"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR023023"
FT                   /db_xref="InterPro:IPR026875"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZCH6"
FT                   /protein_id="ACI50240.1"
FT                   /translation="MSIAPYAVQPATARGRLHAEPESPSRTPWQRDRDRVLHSAGFRTL
FT                   QYKTQVFVNHQGDFFRTRLTHSLEVAQIARSIARNLGVDEDLTETLALAHDLGHTPFGH
FT                   AGEDALAAAMRAWGGFDHNTQTLRQVTQLERRYFGFDGLNLTWETLEGLIKHNGPVDHP
FT                   TGYVARYAERLGLDLTTFAPVEAQVAAMADDIAYHAHDLDDGLRAGLLCLSDLAGLPVV
FT                   GAALAQVRQLAGGADLPASAPQAPGLHAADLHVDDRMRHETIRRVINALAVDLTEQTRR
FT                   NLERLAPRSADDVRRAEAPVVAYSPAMARDNGAIRTFLYARLYRHWRVNRMTRKARMAV
FT                   ESIFSILADDLSLLPDGWRQQARGADQTGARRVVADYIAGMTDRFAMEEHRRLTDLSVP
FT                   G"
FT   gene            489929..490300
FT                   /locus_tag="Gdia_0445"
FT   CDS_pept        489929..490300
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0445"
FT                   /product="iron-sulfur cluster assembly accessory protein"
FT                   /note="TIGRFAM: iron-sulfur cluster assembly accessory
FT                   protein; PFAM: HesB/YadR/YfhF-family protein; KEGG:
FT                   gdi:GDI2227 putative iron-sulfur assembly protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50241"
FT                   /db_xref="GOA:B5ZCH7"
FT                   /db_xref="InterPro:IPR000361"
FT                   /db_xref="InterPro:IPR016092"
FT                   /db_xref="InterPro:IPR017870"
FT                   /db_xref="InterPro:IPR035903"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZCH7"
FT                   /protein_id="ACI50241.1"
FT                   /translation="MDTASTPTPDTRFRVSPQAVTRLEEIVAAEPAPEGAAAPGLRVSV
FT                   LAGGCNGFQYSFALDGERRADDVLIPAGQSHVVVDPSSMDLLDGAELHFNDSLMGAHFT
FT                   IRNPNATSSCGCGTSFSID"
FT   gene            490317..491093
FT                   /locus_tag="Gdia_0446"
FT   CDS_pept        490317..491093
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0446"
FT                   /product="exodeoxyribonuclease III Xth"
FT                   /note="TIGRFAM: exodeoxyribonuclease III;
FT                   exodeoxyribonuclease III Xth; PFAM:
FT                   Endonuclease/exonuclease/phosphatase; KEGG: gdi:GDI2228
FT                   putative exodeoxyribonuclease III"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50242"
FT                   /db_xref="GOA:B5ZCH8"
FT                   /db_xref="InterPro:IPR004808"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR020847"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="InterPro:IPR037493"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZCH8"
FT                   /protein_id="ACI50242.1"
FT                   /translation="MKIASWNVNSVRQRQAHVLDWLEREKPDLLGLQEIKCEDAAFPAE
FT                   AFRAAGYDCVVVGQKSYNGVAILSRLPFSVTARALPFLDGEALQARYVEIEAGGLTFGN
FT                   LYLPNGNSGGSAGYEAKLAFMEALALHARALLEAGRDFVLAGDYNVCPTDEDCAPGALP
FT                   PTDALVRPESRAAFRRLIWLGLTDALRALHPHGRYYTFWDYQAGAWPRDCGLRIDHALL
FT                   SPRIAERLDSAQPDRDERGRAQPSDHVPLVITLDGP"
FT   gene            complement(491158..491496)
FT                   /locus_tag="Gdia_0447"
FT   CDS_pept        complement(491158..491496)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0447"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gdi:GDI2229 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50243"
FT                   /db_xref="InterPro:IPR024447"
FT                   /db_xref="UniProtKB/TrEMBL:A9HLI9"
FT                   /protein_id="ACI50243.1"
FT                   /translation="MSRQIVRGTLLALGVLAGGALTTYDASPALAQPYRYGPVTPGWAP
FT                   PPMPPPRAEVVPPPRRGWVWQQGGWDWGNGGYVWVPGRYVRYGRHGGWGAGRWEQRGPR
FT                   WVWVRPGW"
FT   sig_peptide     complement(491401..491496)
FT                   /locus_tag="Gdia_0447"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.997) with cleavage site probability 0.923 at
FT                   residue 32"
FT   gene            complement(491611..492981)
FT                   /locus_tag="Gdia_0448"
FT   CDS_pept        complement(491611..492981)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0448"
FT                   /product="amino acid permease-associated region"
FT                   /note="PFAM: amino acid permease-associated region; KEGG:
FT                   gdi:GDI2230 GabA permease"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50244"
FT                   /db_xref="GOA:B5ZCI0"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004840"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZCI0"
FT                   /protein_id="ACI50244.1"
FT                   /translation="MLKAAPTGGGLAHSLRSRHVSMIAIGGMIGAGLFVNTSVMIQGAG
FT                   PLVLLSYLLAGLMVFLVMRMLGEMAIDCPDAGSFVGHVRRGLGHRAAFVTGWSYWLFWV
FT                   VVASVEAKAAGMVAGPMLGVPPLGVALGLTAVMTGVNMGSVRGYGEFEFWFSLMKITAI
FT                   GVFTVIAGLALFGVIGPPLHGGLAHLWDQGGFMPHGFSASLSLLPAILFTFAGAEIATV
FT                   AAAETDDPGRNIVQAIRTVVIRVMLFYMASLGVILCLVPWNQVQPGHSPFLEVLHRIGI
FT                   PGAEGAMTLVVLVAIASCLNSTLYVTSRILFEMAAHGDAPGWLVRTGPSGAPRRAISTG
FT                   ALVASVLTVVASTFPGEVFGFLLNASGAVILFDYLMVVFAQISLRRQMKRAGRHPAFPM
FT                   LLFPYLSWLTVAAILLVMVTMMLTPDTRVQIELGSVTLALILVLGLVTSRRGGRPTL"
FT   gene            complement(492975..493820)
FT                   /locus_tag="Gdia_0449"
FT   CDS_pept        complement(492975..493820)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0449"
FT                   /product="Domain of unknown function DUF1849"
FT                   /note="PFAM: Domain of unknown function DUF1849; KEGG:
FT                   gdi:GDI2231 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50245"
FT                   /db_xref="InterPro:IPR015000"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZCI1"
FT                   /protein_id="ACI50245.1"
FT                   /translation="MTWWPLLRGIVARAVVAGPMLGLVVVPARAAPAMAPAAGGAVALA
FT                   PHRAVYDLTLAAVTGGDTVSASGTMTYGVTDACASWSTQQQLRLQTVSRSGAVTDMESD
FT                   YATLEAKDGHHLVFRTVQTSNDQSPSRIMGEATMTPSGGEVRYTQPSVHTVPLPAGTLF
FT                   PMAHTAAIIRAAQNGEQAFSPMLFDGTGENGAQYTYVMLLGWIQPPSASPYPVLARQPS
FT                   GRVHVAFYTPASHDMRPDYAIGMRYFANGVSDRLDMDFGDFRMQGTLRSFTPVTAARRC
FT                   "
FT   sig_peptide     complement(493728..493820)
FT                   /locus_tag="Gdia_0449"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.968) with cleavage site probability 0.964 at
FT                   residue 31"
FT   gene            complement(493878..495677)
FT                   /locus_tag="Gdia_0450"
FT   CDS_pept        complement(493878..495677)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0450"
FT                   /product="aspartyl-tRNA synthetase"
FT                   /note="TIGRFAM: aspartyl-tRNA synthetase; PFAM: GAD domain
FT                   protein; tRNA synthetase class II (D K and N); nucleic acid
FT                   binding OB-fold tRNA/helicase-type; KEGG: gdi:GDI2232
FT                   aspartyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50246"
FT                   /db_xref="GOA:B5ZCI2"
FT                   /db_xref="InterPro:IPR002312"
FT                   /db_xref="InterPro:IPR004115"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR004524"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR029351"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZCI2"
FT                   /protein_id="ACI50246.1"
FT                   /translation="MHPYRTHSCAALRASDAGQTARLSGWVHSKRDHGGLLFIDLRDHF
FT                   GMTQIVIPAGSPVLEAVERVRVESVLTITGEVVLRDAATKNPNLPTGEIELRAQQVDIQ
FT                   SSADVLPFQVAGHEHYPEDLRLTYRYIDLRRDKVHRNMMLRAQVIASLRRRMTDQGFVE
FT                   FQTPILTASSPEGARDFLVPARMHPGKFYALPQAPQQFKQLAMVAGFDRYFQIAPCFRD
FT                   EAARADRSPGEFYQLDFEMAFATQEDVFATLEPVMEGVFREFGGGRTVSAAPFERIPYA
FT                   TAMKLYGSDKPDLRNPLLLSDVTESFANSGFGLFARIVADGGEVRAIPAPGAGDRPRAF
FT                   YDKLNAWAREAGAGGLGYIIFDEEGGKGPIAKNLEPARVAAIREATGLKAGDAVFFAAG
FT                   KGDEVVKFSGLVRTRIATELDLIEQDSFRFCWITDFPMYERNEETGQIDFSHNPFSMPQ
FT                   GGLEALNGQDPLTITAYQYDIVCNGVELSSGAIRNHRPDVMIRAFELAGYPASEVEARF
FT                   GGMLNAFRYGAPPHGGSAPGVDRIVMLLADEPNIREVILFPLNQQGEDLMMGAPAPVPA
FT                   ERLKELSLALNLPRPKPGVKAGE"
FT   gene            complement(495806..496903)
FT                   /locus_tag="Gdia_0451"
FT   CDS_pept        complement(495806..496903)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0451"
FT                   /product="translation initiation factor, aIF-2BI family"
FT                   /EC_number="5.3.1.23"
FT                   /note="KEGG: gdi:GDI2233 translation initiation factor;
FT                   TIGRFAM: translation initiation factor, aIF-2BI family;
FT                   eIF-2B alpha/beta/delta-related uncharacterized protein;
FT                   PFAM: initiation factor 2B related"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50247"
FT                   /db_xref="GOA:A9HLJ6"
FT                   /db_xref="InterPro:IPR000649"
FT                   /db_xref="InterPro:IPR005251"
FT                   /db_xref="InterPro:IPR011559"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:A9HLJ6"
FT                   /protein_id="ACI50247.1"
FT                   /translation="MKIGTVPYRSVWVDQDDGWSVHIFDQTRLPWELDILRLTERDQVA
FT                   HAIRTMQVRGAPLIGAVAAYGLALALRVDAGDAAMERDAALLAATRPTAINLRWAIERM
FT                   LGRLRPLPAAERVAAAYDEAGRICDEDAAQNEAIGRHGLRLIQDIVARRGEGTTVNILT
FT                   HCNAGWIATVDWGTALAPIYMAHDSGLSVHVWVDETRPRNQGAALTAWELGSHGVPHTV
FT                   VADNAGGHLMQHGAVDLVIVGTDRVTRTGDVANKIGTYLKALAAHDNGVPFWVALPSTT
FT                   IDWHVSDGLTEIPIEERNGAEVTSITGRTEDGRIETVRLTPPDSRAANPAFDVTPARLV
FT                   TGLITERGCCQATQAGLAGLFPEHA"
FT   gene            complement(497038..498927)
FT                   /locus_tag="Gdia_0452"
FT   CDS_pept        complement(497038..498927)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0452"
FT                   /product="heat shock protein Hsp90"
FT                   /note="PFAM: heat shock protein Hsp90; ATP-binding region
FT                   ATPase domain protein; KEGG: gdi:GDI2234 chaperone protein
FT                   HtpG"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50248"
FT                   /db_xref="GOA:B5ZCI4"
FT                   /db_xref="InterPro:IPR001404"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020575"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR037196"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZCI4"
FT                   /protein_id="ACI50248.1"
FT                   /translation="MTDQATDSDKAQPAPQAGGEEHAFSAEVGRLLDLVVHALYSEREI
FT                   FLRELVANAADATDRRRFEALTDAARTLPEGAGVRIDPDKDARRLTISDDGAGMSKDEL
FT                   ARNLGTIARSGTRAFGQELDKQKLGENAGDRPSLIGQFGVGFYAAFMVADHVDVVSRRA
FT                   GSDEAWRWSSDGKGSFTLSPATRERPGTDIVLYIKEDADEFLDAWRLESIVRKWADHIA
FT                   WPITIRRDGEDTPANAGTALWRKPKGEVTEEQLTEFYRHVSHNFDTPWATLHWHAEGTI
FT                   EFTALLFIPGSRPFEFGEQVRDSRVRLHVRRMFITDDAALLPPWMRFVQGVVDTEDLPL
FT                   NVSREMLQATPVLARIRKAVTNRVLNELRSRAKDAESYATFWDNFGPVLKEGIWDDAEY
FT                   RTDLAGLARFRSSTEEGWTTLADYVSRMKDGQEAIYYLTGDNPDTLPASPQLEGFRARG
FT                   IEVLLLSDPVDSFWPDRLGTFEGKALRSVSQGHADLDKFEAPQDDGARADLEALLPAMK
FT                   AALGEAVSDVRGTNRLVGSAVVLSAAGQGPDLQLQRLLRRSGQAVPDQAPVLEINATHP
FT                   LIRDLADRVARGESVADIALILLDIARIQDGESPKDPTAFANRLTATLTQIQG"
FT   gene            complement(499021..499668)
FT                   /locus_tag="Gdia_0453"
FT   CDS_pept        complement(499021..499668)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0453"
FT                   /product="NUDIX hydrolase"
FT                   /note="PFAM: NUDIX hydrolase; KEGG: gdi:GDI2235 putative
FT                   MutT-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50249"
FT                   /db_xref="GOA:B5ZCI5"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZCI5"
FT                   /protein_id="ACI50249.1"
FT                   /translation="MSGAERDGEPDWLVWGREIQAIAQTGLTFTRDPYDRERYEMLRAL
FT                   AARMMAAHTATPARRIEALFVGQDGYATPKIDVRAAVFDSDGRLLMVRETLDGGRWTLP
FT                   GGWADVNMTPADSAVKEVREESGYIATVRKLAALWDRTRQGHPATVFSCAKLFYLCDLA
FT                   GGAPATSLETSGIGWFGADEIPDDLSLGRVLPDQIRRMFEHHRTPTLPTDFE"
FT   gene            complement(499665..500141)
FT                   /locus_tag="Gdia_0454"
FT   CDS_pept        complement(499665..500141)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0454"
FT                   /product="protein of unknown function DUF985"
FT                   /note="PFAM: protein of unknown function DUF985; KEGG:
FT                   gdi:GDI2236 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50250"
FT                   /db_xref="InterPro:IPR009327"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR039935"
FT                   /db_xref="UniProtKB/TrEMBL:A9HLK4"
FT                   /protein_id="ACI50250.1"
FT                   /translation="MTDHAVDLRDPTLPVEAVRAALSLSPHPEGGWYRELWRDTPPDGG
FT                   RGAATTIQFLLARGERSHWHRVDAAEIWCWQGGAPLRLRIAGAGGEQVLLLGPCPTSGQ
FT                   VQQAVVPAMAWQASESLGAWSAVGCMVAPAFQFSGFELAPPDWTPDGLEPGGGT"
FT   gene            complement(500198..500869)
FT                   /locus_tag="Gdia_0455"
FT   CDS_pept        complement(500198..500869)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0455"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gdi:GDI2237 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50251"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZCI7"
FT                   /protein_id="ACI50251.1"
FT                   /translation="MGLGVGAWVAASLVAAPARADGGGASWPDTPVARLELQALIETLD
FT                   ARLLSHPSATLTLEGWCRDHRLSPVTQVVARRVAVAARPPSMAQRRDLDVGPGEAVAYR
FT                   RVELTCGSRVLSVADNWYVPARLTPAMNALLDHTDTAFGHAVAALHFTRRTLDSTRLFA
FT                   PLPEGWEQHPLPPAASGTIRIPAEILRHRALLYRQDGVPFSQVVETYTAAMLDFPPPAG
FT                   P"
FT   sig_peptide     complement(500807..500869)
FT                   /locus_tag="Gdia_0455"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.993) with cleavage site probability 0.989 at
FT                   residue 21"
FT   gene            complement(500890..502266)
FT                   /locus_tag="Gdia_0456"
FT   CDS_pept        complement(500890..502266)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0456"
FT                   /product="Xanthine/uracil/vitamin C permease"
FT                   /note="PFAM: Xanthine/uracil/vitamin C permease; KEGG:
FT                   gdi:GDI2238 putative permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50252"
FT                   /db_xref="GOA:A9HLK9"
FT                   /db_xref="InterPro:IPR006043"
FT                   /db_xref="UniProtKB/TrEMBL:A9HLK9"
FT                   /protein_id="ACI50252.1"
FT                   /translation="MRHDGAGVRGWIDRTFHVTRRGSTLARELVAGLTTFGAMAYIMIV
FT                   NPAIMALAGLDRHDMIMTTIAASVCGSLLMALMANLPIALAPAMSSNLVFAQVVVVQMG
FT                   VKPSVAFTMVLIGGLAFVALSLTRWRQRIVMGFPIPVRNGIHCAIGAFIAHIGMVSGGL
FT                   AVGGAQGFSFGSLHDPAVLLGLAGLFLAATLQMLRVPAGMLLSIVAVTVAGCFVRHPGG
FT                   HPVTTLPAAWLEWPHYPTNMLFPFDFHGFLSHIGIVLPVTIYFFLGDFFDATGTMMAVT
FT                   RRAGLTVEDGQPLLGRAAFAADGTASVIGSVLGTSTVSAYLESLVGAEAGGRTGLVGVT
FT                   VALLFLLSSVLWPVITAVPAVATAPVLVLVGLGMLSDMGRSGAQSGDGDVGGVLAPLLM
FT                   VLVTVMTGNFMVSLALGLLLYTVLAVAGRRWAEVTPILLALDAVFVVYLVLASGMGGGS
FT                   "
FT   gene            502620..504038
FT                   /locus_tag="Gdia_0457"
FT   CDS_pept        502620..504038
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0457"
FT                   /product="diguanylate cyclase"
FT                   /note="TIGRFAM: diguanylate cyclase; PFAM: GGDEF domain
FT                   containing protein; KEGG: gdi:GDI2239 putative signalling
FT                   protein, GGDEF family"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50253"
FT                   /db_xref="GOA:B5ZCI9"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR009050"
FT                   /db_xref="InterPro:IPR012292"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR039435"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZCI9"
FT                   /protein_id="ACI50253.1"
FT                   /translation="MMSVAQVAVDAELRRAFTNVPDATRLLVHDVVERLTPALVAAFYD
FT                   HFTSHPEGQTYLTDPETTERLRGTLMVWMAELFSAAPQHPQRMADSQRHIGRFHARSSI
FT                   PIHLVSEGVSLVQRTIIHALGHENLTHEELTDAVLYVTNVLTAATGVMTFTYWRQRERA
FT                   ASNDVAYRLFALNQDLSREGEGQKAALLGWSYNVLRSLYVAKTPEDLQTMGLARSEFGL
FT                   WVTYKVGLLFEGTDISALLTGQIAKVDNELLPAILEDMAAERDISPALAALHAGVTEIL
FT                   SSLEVLFHASRSSNDVEDPLTRVLNRRFLPSIISYELRVAHQTGRPMSVLFLDIDHFKH
FT                   INDTFGHAAGDSVLQAIARVLEEASRLSDVIFRYGGEEFLVLMGDTDTEQMLIGAERLR
FT                   QKIENTPIRLPDGNLHQITVSIGAAQYAGHPDYEELLRAADAALYRAKRNGRNRIEVAD
FT                   APHHTPAPSLEGAS"
FT   gene            complement(504071..505204)
FT                   /locus_tag="Gdia_0458"
FT   CDS_pept        complement(504071..505204)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0458"
FT                   /product="peptidase M50"
FT                   /note="PFAM: CBS domain containing protein; peptidase M50;
FT                   KEGG: gdi:GDI2240 putative peptidase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50254"
FT                   /db_xref="GOA:B5ZCJ0"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR008915"
FT                   /db_xref="InterPro:IPR016483"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZCJ0"
FT                   /protein_id="ACI50254.1"
FT                   /translation="MTWSIPLGRIAGTAIRVHVTFFLLLLWIAMVAGAQGGPAAAWQGV
FT                   VFIMLVFVCVVLHEFGHILMARRFGVTTSDITLLPIGGVARLSRMPERPGQELLVALAG
FT                   PAVNLVIGLLLFAATGTWPSLDAATSGMVGGGGMVVRLASVNLFLLLFNLLPAFPMDGG
FT                   RVLRALLGYRMGFVRATQVAASVGQGFAFLLGFLGLIGNPILLFIALFVYLGAASEAHM
FT                   VQLRQVAQGMIAADAMMTRYETLPTLTTLDEAVRAAIRCAQTLFPVMDGQGRLQGVLTQ
FT                   AALINHLQIDGPGAVVADAMTPAIPAIHPYQPLSEALRLLQEGNLPAVAVVDAGDRLVG
FT                   LITSETIGELMLTHGIRVTQGRRAADSDRPPTDRAAA"
FT   sig_peptide     complement(505079..505204)
FT                   /locus_tag="Gdia_0458"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.939) with cleavage site probability 0.371 at
FT                   residue 42"
FT   gene            complement(505292..506218)
FT                   /locus_tag="Gdia_0459"
FT   CDS_pept        complement(505292..506218)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0459"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: gdi:GDI2241 putative
FT                   transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50255"
FT                   /db_xref="GOA:A9HLL7"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A9HLL7"
FT                   /protein_id="ACI50255.1"
FT                   /translation="MPRQYDLDLLRYLHVLVEEQSVSAAARRMKVSEPTMSRQLGKLRE
FT                   AFGDPILVQSGRRMVPTAFATRIREKVGQLVLDAERLHEDREKLDLTTVSPRFTIRASD
FT                   VIVGAFASELVQVLRRDCPQCDVCFTPETDEHVGDAMRRQTIDLYIGATDEMRPELRRQ
FT                   SLFAMSIRGMVRRGHPILAEGVTPQNLVRYDHIGVSRKGLRRGPIDTILQERYGLRRRV
FT                   VLVVPSHFAMIESIRETDMILPMPDIVIDRLPTKLIRLVAFDFPFALQPVEAFQAWHPR
FT                   HDFDPVHRWLRDTVFRITRRRAAQPAA"
FT   gene            506319..506681
FT                   /locus_tag="Gdia_0460"
FT   CDS_pept        506319..506681
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0460"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gdi:GDI2242 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50256"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZCJ2"
FT                   /protein_id="ACI50256.1"
FT                   /translation="MQGRNKQTCNNQDELDSRIGIHRGRPAWNRPGAAMRPSIQTDLQC
FT                   QRAWRVGVPYGIRTRVTAVKGQNLALDNCGLRGYRVELTHLLCHPPSPIVTLKHLRCGS
FT                   KMAHDFGRGFWLKRDF"
FT   gene            506717..506824
FT                   /locus_tag="Gdia_0461"
FT   CDS_pept        506717..506824
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0461"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50257"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZCJ3"
FT                   /protein_id="ACI50257.1"
FT                   /translation="MWLFGATPYEERNMTAFDPHLSLVPRGPRADDLSI"
FT   gene            506986..508794
FT                   /locus_tag="Gdia_0462"
FT   CDS_pept        506986..508794
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0462"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gdi:GDI2243 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50258"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZCJ4"
FT                   /protein_id="ACI50258.1"
FT                   /translation="MARPFASFTELSAPLVGRKTGINHDLQDRLAVMDARALRIMELAG
FT                   IRTHTHNGRDIYRISEVTLIVEKMPQERLRRTLLIPSQAYGIRRERGDELRFYAENHMK
FT                   TPLCSGTFTCSEMTPIGGDLVGDMKRLRGRIGDMLRWCRRGPFSGYGFDVLMLANDFAF
FT                   QFHPLTGVSVNGHVNYCYTMKSPMPPEVWEDFRRAVREKFDLGFYVTGPVTDLSALLDY
FT                   MTKLYKAERTRTDEILFSDLSDDVAAWFLGQVDQMWNLTPLAGFKVFRASLKTDKEKVV
FT                   RKRAVPVRKPVRTTDGRSVDALVPPRPREHSLVVAKRLSPRILAGADDSPFPPGFTEGP
FT                   PRVRVQDQHVSHPVYANYAIHSDIASNREAAAASPLGATPPSGGLASGACPSPGNSVLD
FT                   QGLDGSVYANSANGSDFATKKSRGHVENLVIARERSSPTEAGIWETWTQVMNLTLRPET
FT                   EEGERGLAILLRHHEQATAQARRNGWTGRVGNPLARLAAGLVAADSAEPHIPDDQSLFM
FT                   HANSATQNDIKTIPETIPTSPPSLPDAPPSSAYSHPSAEDVAAARSVLPPEVLSRGLPD
FT                   VYLVMLANGQRREAEIAKLPSMMGRH"
FT   gene            complement(508791..510194)
FT                   /locus_tag="Gdia_0463"
FT   CDS_pept        complement(508791..510194)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0463"
FT                   /product="MobA/MobL protein"
FT                   /note="PFAM: MobA/MobL protein; KEGG: gdi:GDI2244 putative
FT                   mobilization protein A"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50259"
FT                   /db_xref="InterPro:IPR005053"
FT                   /db_xref="UniProtKB/TrEMBL:A9HLM3"
FT                   /protein_id="ACI50259.1"
FT                   /translation="MAIMSLSSKPISRSAGRSAVAAAAYRSAEKLTDERTGQIHDYRNK
FT                   NGVVATACSVGNQRVDRETLWNAAEAAEKRKDGRTAREWLLALPSELSPRDRQQLAAEF
FT                   AKMLHQKYGVATDICIHEPSRTGDDRNHHAHLMATTRIVTIENGKPVFGAKATFELENR
FT                   ERQRRGLPSTMQEMKGIRREWADMVNHALELAGSTERIDHRSHADRGLDEAPSRHLGPA
FT                   ATAIERKTNQPSELRLKHRAERMAAFQEKLAARRAVKAARDEQRKAKDEAYIAKSVARG
FT                   LDIAASRNDRLTAMLHNEAQRARDNSISAMQRAAASATRAASLSQRLSELADEEGDDPQ
FT                   TAARKAFQRAKIQGDMLREAAQQAAEAFMRRLSKPTDGQIEYAERRTKLIAQVAVDQST
FT                   TIADREAEARQRQAERKTQWAAERAEKRQQNNEQWQSVKDFFGIDDQHTQQNDNHQKQK
FT                   RKNDKPRQP"
FT   gene            510353..510604
FT                   /locus_tag="Gdia_0464"
FT   CDS_pept        510353..510604
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0464"
FT                   /product="putative mobilization protein C"
FT                   /note="KEGG: gdi:GDI2245 putative mobilization protein C"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50260"
FT                   /db_xref="UniProtKB/TrEMBL:A9HLM6"
FT                   /protein_id="ACI50260.1"
FT                   /translation="MEKSVGRLERAKQRLTQAQARYEKVSSVESQKARKEDVRRKIIVG
FT                   GAVLAMVDSDDRAASLLNVVIDGLKSDRDKALFNVSAA"
FT   gene            510588..510911
FT                   /locus_tag="Gdia_0465"
FT   CDS_pept        510588..510911
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0465"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gdi:GDI2246 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50261"
FT                   /db_xref="GOA:A9HLM8"
FT                   /db_xref="UniProtKB/TrEMBL:A9HLM8"
FT                   /protein_id="ACI50261.1"
FT                   /translation="MSAPLDDDSDDVLDRTTLLFVGLVEALDADRLARQHLAVASAEQA
FT                   AKQAMVQAEAIKIVRMAGKIARVSEQAMTRRPVLPVLIAGLVGAAMALIAVGGGYGAGR
FT                   LGM"
FT   gene            511327..511944
FT                   /locus_tag="Gdia_0466"
FT   CDS_pept        511327..511944
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0466"
FT                   /product="Resolvase domain"
FT                   /note="PFAM: Resolvase domain; Resolvase helix-turn-helix
FT                   domain protein; KEGG: gdi:GDI2247 putative resolvase"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50262"
FT                   /db_xref="GOA:B5ZCJ8"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR006120"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036162"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZCJ8"
FT                   /protein_id="ACI50262.1"
FT                   /translation="MRIGYARTSTTEQAAGLAAQVRDLEAQGCNRVFAEQVSGTITVRP
FT                   ELEAAIDYLRQGDALVVTKPDRLARSTTDLLSFVHRVQAKGADLVILSMGGQPLDTSSP
FT                   TSKLTLTLLAAVAEFERDIMKERQAEGIAKAKAEGKYRGRKPTARAKAVHVRAMSAEGV
FT                   SPTEIAKRLGIGRASVYRCLALQLRFSESSESMGNHDSERDE"
FT   mobile_element  511873..513291
FT                   /mobile_element_type="insertion sequence:Gdi12"
FT                   /note="family IS701"
FT   gene            511922..513172
FT                   /locus_tag="Gdia_0467"
FT   CDS_pept        511922..513172
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0467"
FT                   /product="transposase IS701"
FT                   /note="KEGG: gdi:GDI2722 putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50263"
FT                   /db_xref="GOA:B5ZCJ9"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR038721"
FT                   /db_xref="InterPro:IPR039365"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZCJ9"
FT                   /protein_id="ACI50263.1"
FT                   /translation="MILNEMNSAASVEDVLALTLEALRDAKERMRPVFGQERVAASAGR
FT                   FLETLLGNEPRKTGWMRAEAAGDPGPWRQQALLGRGHWDADALRDVVRDHVVEHLGDAD
FT                   AVLVVDETGFLKKGSASCGVGRQYTGSAGKITNCQIGVFAAYVSDKGHAFLDRALYLPK
FT                   AWTEKPERLAAAHVPGDVTFASKPSLATAMIGRALAADVPFRWVAGDSVYGVGELEMAL
FT                   RRAGKGFVLGVNANHWFHSWRPDIHWSGEAREIIKTLPDETWVRCSAGRGTKGERLYDW
FT                   LYCPMADLEASEYSGISTGIWTRGLLVRRNPSDGDLAYFTTWCPQGTPLEILVRVEGTR
FT                   WRIEEGFETAKNEFGLDHNETRSWHGWHRHVSLVMLAYAMMAAVRSQANAMALKKSQLH
FT                   KRGRSSAGQSRKSAASP"
FT   gene            complement(513510..514790)
FT                   /locus_tag="Gdia_0468"
FT   CDS_pept        complement(513510..514790)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0468"
FT                   /product="helix-turn-helix domain protein"
FT                   /note="PFAM: helix-turn-helix domain protein; protein of
FT                   unknown function DUF955; KEGG: gdi:GDI2248 putative
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50264"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010359"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZCK0"
FT                   /protein_id="ACI50264.1"
FT                   /translation="MTARWALKQFGYAALREAVDEGATVISVSLDEPARSLREQRVRLG
FT                   LTQEQVARASMLTVNDVRRAEQLGAISPVRRLQLLAQTLGLNDEQLGVRPDASADQQLA
FT                   VRLRTLGSAGHNVRFSPSLVLKLAEAAWTISRQNLLAVELGVVPNILKHFDASDDYYAP
FT                   VWRRGYDLAERTRTLLNLDPLAPIPSVRELIDQLGIPLIQAAMGAAFAGATVVNGDDRG
FT                   IVINTEGDNQNVWVRRMTLCHELGHLLWDPPARLRRLHVDRYDDLRTAEAGGGDEVEAR
FT                   ANAFAISFLAPREAVIEIVKRGASPTDQVIELMKRFGVGATAAKYHIANVSRNWGAEVD
FT                   TRHVASNQLPPPDDYWTTNENWTADYFPVAGVPISRRGRFSGLVAIAASRELISTDTAA
FT                   SWLQAAPSALAQQLATIAELTAQDLAV"
FT   gene            complement(514940..515362)
FT                   /locus_tag="Gdia_0469"
FT   CDS_pept        complement(514940..515362)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0469"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gdi:GDI2249 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50265"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZCK1"
FT                   /protein_id="ACI50265.1"
FT                   /translation="MTSADGLEQWRDGTGEVAEGEPPMLMKNHPKLRLWVVRAEDVVHA
FT                   PECGSFADTLNGKEIKHSNLTGARPAHCGGQLVFVENDAVALDGGSGRYGPRSKEEMTA
FT                   VARAFKNSGYGVWSYGWDDENAWPFRIGSRLPQWVK"
FT   gene            complement(515906..516247)
FT                   /locus_tag="Gdia_0470"
FT   CDS_pept        complement(515906..516247)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0470"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gdi:GDI2250 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50266"
FT                   /db_xref="GOA:A9HLN7"
FT                   /db_xref="InterPro:IPR041657"
FT                   /db_xref="UniProtKB/TrEMBL:A9HLN7"
FT                   /protein_id="ACI50266.1"
FT                   /translation="MTSKEDESRRLPAVMDYKQAAEYLGVSHGRLRNLMWLGCGPKSFS
FT                   FGKRDRRFRVSDLDAFIGAKVGDVAPATVIKRGPGRPRKGRTCFGAMLAVGLLSIAIAA
FT                   LSLLAKILW"
FT   gene            complement(516237..517433)
FT                   /locus_tag="Gdia_0471"
FT   CDS_pept        complement(516237..517433)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0471"
FT                   /product="integrase family protein"
FT                   /note="PFAM: integrase family protein; KEGG: gdi:GDI2251
FT                   putative phage integrase"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50267"
FT                   /db_xref="GOA:B5ZCK3"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZCK3"
FT                   /protein_id="ACI50267.1"
FT                   /translation="MASSSDKTRDQAVTRAKGDIDPATGKTLPAGISCRGPKQYQARKQ
FT                   VDGKRYRKTFSTAALARRWLNETAAKVELGQFKDTSALDKQTIGDLVDRYAKECMDGRG
FT                   ADLTGHIPAILRDKDLPGVRLSKFCLADVRGFRDRMMSADYSPATVVKRLNLLASVIQH
FT                   AISEWDTSIVNYASGRFVKRPEGADKKRNRRLDEDKDKDGKTEFDRLIVAVSDSVYPDD
FT                   VWLVRWSIEQGTRRGEAIGLRWCDVDIERSLIKLGGESGKTKTHKTQEEQGPEIRPLTP
FT                   GARRLLLEKRDTYETPPEPGDSVFSVGKESTFSMRYGRMVKRTGLHNLTFHDLRHEATS
FT                   RLARLLPNPLDLKRVTGHRDLKSLDRYYQPVPESISKQIEEAERLAGIIAAEEGDDDE"
FT   gene            complement(517529..517604)
FT                   /locus_tag="Gdia_R0007"
FT                   /note="tRNA-Glu2"
FT   tRNA            complement(517529..517604)
FT                   /locus_tag="Gdia_R0007"
FT                   /product="tRNA-Glu"
FT   gene            complement(517729..518070)
FT                   /locus_tag="Gdia_0472"
FT   CDS_pept        complement(517729..518070)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0472"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gdi:GDI2252 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50268"
FT                   /db_xref="GOA:B5ZCK4"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZCK4"
FT                   /protein_id="ACI50268.1"
FT                   /translation="MNAQAPNGPGSKALLAAVIGMGVLLAVGSLVLVGVLVHRISHPHS
FT                   VSSVRVVSPPDGAYGPLVLDEPAGTHITAMARQDDAMLAVSLSGGGPDRIVLWDLAHAR
FT                   VAGRLTLAR"
FT   gene            518134..519102
FT                   /locus_tag="Gdia_0473"
FT   CDS_pept        518134..519102
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0473"
FT                   /product="pseudouridine synthase, RluA family"
FT                   /EC_number="3.2.1.17"
FT                   /note="KEGG: gdi:GDI2253 putative ribosomal large subunit
FT                   pseudouridine synthase D; TIGRFAM: pseudouridine synthase,
FT                   RluA family; PFAM: RNA-binding S4 domain protein;
FT                   pseudouridine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50269"
FT                   /db_xref="GOA:B5ZCK5"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR006224"
FT                   /db_xref="InterPro:IPR006225"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZCK5"
FT                   /protein_id="ACI50269.1"
FT                   /translation="MTDDTQPIRLTPETEHAGQRTDRFLADMVGTLSRSRVKALMEGGH
FT                   VLRDGHVLREPADPVRAGLCYEIRMPPAIPATPRAQAIPFAILYEDSDLIVLDKPAGLV
FT                   VHPAPGNEDGTLVNALLAHCGDSLTGIGGERRPGIVHRLDKDTSGVMVVAKTEQAHTAL
FT                   SDAFAARDIDRTYLALAWGILSPASGTFEGAIGRDRRDRKRMAVVTHGGKHAMTHYRTL
FT                   HSFHGGISSVECRLATGRTHQIRVHFSTSGHPLVGDPVYLRRIPAAARALPEDARRAAL
FT                   DFPRQALHAARLGFTHPRTGESLLFETAPPDDFKTLLAKIA"
FT   gene            519355..520242
FT                   /locus_tag="Gdia_0474"
FT   CDS_pept        519355..520242
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0474"
FT                   /product="RNA polymerase, sigma 32 subunit, RpoH"
FT                   /note="TIGRFAM: RNA polymerase sigma factor RpoH; RNA
FT                   polymerase sigma factor, sigma-70 family; PFAM: sigma-70
FT                   region 2 domain protein; sigma-70 region 4 domain protein;
FT                   KEGG: gdi:GDI2254 putative RNA polymerase sigma-32 factor"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50270"
FT                   /db_xref="GOA:B5ZCK6"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR009042"
FT                   /db_xref="InterPro:IPR012759"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZCK6"
FT                   /protein_id="ACI50270.1"
FT                   /translation="MASSVLNVGPESNLSRYLQDIRKFPMLSPEDEQRLSRRWKDKGDT
FT                   EAAHALVTSHLRLVAKIAMGYRGYGLPLGELISEGNIGMMQAVRRFDPDRGFRLATYAM
FT                   WWIRAAIQEYILHSWSLVKMGTTAAQKKLFFNLRRLKGQMQAIDDGDLKPEQVNKIAES
FT                   LGVPEQDVINMNRRLSAPDHSLNAPLRADSEGEWQDWLVDEHDNQEQTLAENEEFSGRK
FT                   ALLDNAMKTLNDRERHILTERRLKDDPATLEELSHTYNISRERVRQIEVRAFEKVQAAM
FT                   KAEVEAHREAHAAN"
FT   gene            complement(520303..521592)
FT                   /locus_tag="Gdia_0475"
FT   CDS_pept        complement(520303..521592)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0475"
FT                   /product="Adenylosuccinate synthase"
FT                   /EC_number="6.3.4.4"
FT                   /note="PFAM: adenylosuccinate synthetase; KEGG: gdi:GDI2255
FT                   adenylosuccinate synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50271"
FT                   /db_xref="GOA:A9HLQ1"
FT                   /db_xref="InterPro:IPR001114"
FT                   /db_xref="InterPro:IPR018220"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033128"
FT                   /db_xref="InterPro:IPR042109"
FT                   /db_xref="InterPro:IPR042110"
FT                   /db_xref="InterPro:IPR042111"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9HLQ1"
FT                   /protein_id="ACI50271.1"
FT                   /translation="MSNVTVIGAQWGDEGKGKIVDWLASRADIVVRFQGGHNAGHTLVV
FT                   GSQTYKLSLLPSGLVRGKMGVIGNGVVVDPEALLAEIDRVSAQGLEVSPRTLRIAENVP
FT                   LILPVHGAIDRAREAARGDRKIGTTGRGIGPAYEDKVARRAIRLCDLAEPETLDWKLDE
FT                   LLLHHNTLLAGLGAETFTKDALLAHLTALAPRVLPYMDTVWDLLDDARRAGRRILFEGA
FT                   QAVMLDVDHGTYPFVTSSNTIAANAATGSGVGPGSVGFVLGIAKAYSTRVGEGPFPSEL
FT                   HDDMGRTLGERGHEFGTVTGRPRRCGWFDAMLVRRAVRVGGVNGLALTKLDVLDGLPEI
FT                   RVCVGYELDGQEIRSFPSSPAAQARVKPIYETMEGWTDTTYGARSWADLPAQAIKYVRR
FT                   IEELVEAPVTLLSTSPERDDTILMRDPFEN"
FT   gene            complement(521652..522797)
FT                   /locus_tag="Gdia_0476"
FT   CDS_pept        complement(521652..522797)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0476"
FT                   /product="tRNA synthetase class II (G H P and S)"
FT                   /note="PFAM: tRNA synthetase class II (G H P and S); KEGG:
FT                   gdi:GDI2256 putative histidyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50272"
FT                   /db_xref="GOA:B5ZCK8"
FT                   /db_xref="InterPro:IPR004516"
FT                   /db_xref="InterPro:IPR004517"
FT                   /db_xref="InterPro:IPR041715"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZCK8"
FT                   /protein_id="ACI50272.1"
FT                   /translation="MTDDPPPNPALLPAGFVDLLPSDAEAEAAGMEDLMRVFATHGYSR
FT                   VKPPLLEFEDTLLSGSGAAVADQAFRLMDPDTRRMMALRPDITPQIARIAATRLADVPR
FT                   PLRLSYTGLCVLASGGARESDRQISQAGIELIGPDSPQADAEIIALGAEGLAVLGVPGV
FT                   SFDLTMPSLAPALIAEIDYTPAERQALMRALDRKDAAAVARLAGGLAPVLTELLHAAGP
FT                   AERALAVLGGLVLPEPVRALSDRLAATCAAIKARVPDIRLTVDPVEFRGWRYHTGVCVT
FT                   VYARGQHEELGRGGRYISNNDEPACGLTLRPEALLRAAPTRPGRIRVFLPAGCDPALGR
FT                   RLRTEGYATVDALAPVADQAAEARRLGCTMIAAGDGIVALD"
FT   gene            complement(522843..524024)
FT                   /locus_tag="Gdia_0477"
FT   CDS_pept        complement(522843..524024)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0477"
FT                   /product="phosphoserine aminotransferase"
FT                   /EC_number="2.6.1.52"
FT                   /note="TIGRFAM: phosphoserine aminotransferase; KEGG:
FT                   gdi:GDI2257 putative phosphoserine aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50273"
FT                   /db_xref="GOA:B5ZCK9"
FT                   /db_xref="InterPro:IPR006271"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR022278"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZCK9"
FT                   /protein_id="ACI50273.1"
FT                   /translation="MLSISPDAIVKPGARPGNPCFSSGPCAKRPGWSLDALSGALLGRS
FT                   HRAPDGRARLNEVITRSRAILGMPDDWKLGIVPASDTGAVEMVLWSLVGQRPVDVLAFE
FT                   SFSATWANDIVAQLQIPDARVLRADYGRLPDLGQVDWSHDVVLAWNGTTSGVRIPDGSA
FT                   IPADRDGLVICDATSAAFAMDLPWDKLDVVTWSWQKVLGGEAAHGMLALSPRAVRRLEQ
FT                   APAPRALPKIFRLTSKGKLIEGIFRGDTINTPSMLCVEDALDGLRWAEAIGGLPALVAR
FT                   SQANLAVVSDWVARSDWAAFLAGTAAERSSTAICLTIVAPWFRALDAETQARAARRIVA
FT                   LLEGEGVALDIGSYRDAPPGLRLWGGATVESGDLRALMPWLDWAEAQVRAEYA"
FT   gene            complement(524043..524126)
FT                   /locus_tag="Gdia_R0008"
FT                   /note="tRNA-Leu6"
FT   tRNA            complement(524043..524126)
FT                   /locus_tag="Gdia_R0008"
FT                   /product="tRNA-Leu"
FT   gene            complement(524187..525119)
FT                   /locus_tag="Gdia_0478"
FT   CDS_pept        complement(524187..525119)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0478"
FT                   /product="N-acetyl-gamma-glutamyl-phosphate reductase"
FT                   /EC_number="1.2.1.38"
FT                   /note="KEGG: gdi:GDI2258 putative
FT                   N-acetyl-gamma-glutamyl-phosphate reductase; TIGRFAM:
FT                   N-acetyl-gamma-glutamyl-phosphate reductase; PFAM:
FT                   Semialdehyde dehydrogenase NAD - binding"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50274"
FT                   /db_xref="GOA:B5ZCL0"
FT                   /db_xref="InterPro:IPR000534"
FT                   /db_xref="InterPro:IPR010136"
FT                   /db_xref="InterPro:IPR023013"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZCL0"
FT                   /protein_id="ACI50274.1"
FT                   /translation="MDGQATVFIDGEAGTTGLGIRQRLHALPVAVRSIDPERRKDADAR
FT                   REMMESADLVVLCLPDAASREAASMVAAMEAAGGPAPRLLDASTAFRVDPDWAYGFPEM
FT                   GADQAAAIATARRVSNPGCYPTGAIALLRPLVRAGLLAPDFPVTINAVSGYSGGGRTMI
FT                   EAHEREGGPAFELYGLGLDHKHVPEITRYAGLSRTPLFVPSVGHFPQGMIVSIPLHLDM
FT                   LAAPATGADLRAVLADVYAGSDRVGVAEAGTTLDADALAGTDLMELRVHANDARRQAVL
FT                   TARLDNLGKGASGAAIQNIALMLGLASPA"
FT   gene            525264..526040
FT                   /locus_tag="Gdia_0479"
FT   CDS_pept        525264..526040
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0479"
FT                   /product="MazG family protein"
FT                   /note="TIGRFAM: MazG family protein; PFAM: MazG nucleotide
FT                   pyrophosphohydrolase; phosphoribosyl-ATP
FT                   pyrophosphohydrolase; KEGG: gdi:GDI2259 putative protein
FT                   MazG"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50275"
FT                   /db_xref="InterPro:IPR004518"
FT                   /db_xref="InterPro:IPR011551"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZCL1"
FT                   /protein_id="ACI50275.1"
FT                   /translation="MSEATQALSRLIDIMARLRDPVAGCPWDREQDFATIAPFAIEEAY
FT                   EVEDTIARQDWAALPDELGDLLLQVVYHARMAEEAGWFDFATVAGMIGDKMVRRHPHVF
FT                   GDATLQAGQWEDEKERERQARREEGTLAGIPAALPALLRARKLSARAARVGFDWPDARD
FT                   VLDKVDEEVAELKAELDSGDRARITDELGDVLFTLATLARKLDIDPEACLRQANAKFTR
FT                   RFTAMEQDLARRGTSLPDSTLAEMEAGWQEVKRRER"
FT   gene            complement(526054..526911)
FT                   /locus_tag="Gdia_0480"
FT   CDS_pept        complement(526054..526911)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0480"
FT                   /product="inositol monophosphatase"
FT                   /note="PFAM: inositol monophosphatase; KEGG: gdi:GDI2260
FT                   putative inositol-1-monophosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50276"
FT                   /db_xref="GOA:B5ZCL2"
FT                   /db_xref="InterPro:IPR000760"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZCL2"
FT                   /protein_id="ACI50276.1"
FT                   /translation="MTVPVSAGPVSVGQMREVLGIMRLAAARQVMSRFRQLDSASIRCK
FT                   TSKLDVVTEADEAAERDITEALLRLSPKAVVIGEEAVSARPALLDSLGEAELAYVVDPI
FT                   DGTANYAAGVPLFGVMVAVVARGEVVGAAILDPVCDVAALAVRGEGAWLVGPDGAERTL
FT                   ACAPPAPAEEMCGNASWRYLPLPIRDTVARNLPRVMGSWDFRCAAHEYLMLADGKCHFL
FT                   LFNRTLPWDHLAGWLIHREAGGYCAHFDGSPYRPTDLAGGLLYAPDRASWLDLRRLLLE
FT                   YDRD"
FT   gene            complement(526940..528250)
FT                   /locus_tag="Gdia_0481"
FT   CDS_pept        complement(526940..528250)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0481"
FT                   /product="GTP-binding proten HflX"
FT                   /note="TIGRFAM: GTP-binding proten HflX; PFAM: GTP-binding
FT                   protein HSR1-related; KEGG: gdi:GDI2261 GTP-binding protein
FT                   HflX"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50277"
FT                   /db_xref="GOA:B5ZCL3"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR016496"
FT                   /db_xref="InterPro:IPR025121"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030394"
FT                   /db_xref="InterPro:IPR032305"
FT                   /db_xref="InterPro:IPR042108"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZCL3"
FT                   /protein_id="ACI50277.1"
FT                   /translation="MPISSDDPVSQSATRAAVILPWERPDRQEEVRAAEARLEEAVGLA
FT                   ASIGLVIVRQAVLVLRARRPSTLLGNGQVESLRAAVQQDRVAVVIVDSRLSPVQQRNLE
FT                   RALGCKVIDRTALILDIFGERAATKEGTLQVELAHLEYQRSRLVRTWTHLERQRGGFGF
FT                   LGGPGETQIEADRRMIGDRIVRLKRELEQVRRTRGLHRAARRRVPFPVVALVGYTNAGK
FT                   STLFNALTGATVFAQDQLFATLDPTMRGIRLPSGRRIILSDTVGFISDLPTELIAAFRA
FT                   TLEEVAEADVILHVRDISHPDSAAQRADVEDVLEGMAGSGTLEDDWRRRVIEVQNKADL
FT                   IGGRDAVPPRKGSVVISAITGEGLPDLLAAIDSRLTEAMETVRYTIPVKDGAMLAWLYA
FT                   HGEVTSREDGEQAIVVTVRLLPADRARFEMQIAGQDQ"
FT   gene            complement(528234..528530)
FT                   /locus_tag="Gdia_0482"
FT   CDS_pept        complement(528234..528530)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0482"
FT                   /product="RNA chaperone Hfq"
FT                   /note="TIGRFAM: RNA chaperone Hfq; PFAM: Like-Sm
FT                   ribonucleoprotein core; KEGG: gdi:GDI2262 putative protein
FT                   NrfA (Nif-regulating factor)"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50278"
FT                   /db_xref="GOA:A9HLS1"
FT                   /db_xref="InterPro:IPR005001"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9HLS1"
FT                   /protein_id="ACI50278.1"
FT                   /translation="MAKEPTQNVQDVFLNHVRRSKTPVTVFLVNGVKLQGIITWFDNFS
FT                   VLLRRDGHTQLVYKHAISTVMPATPVVLFDPSRTEGATVDLTEKDLAGDADLL"
FT   gene            complement(528647..530038)
FT                   /locus_tag="Gdia_0483"
FT   CDS_pept        complement(528647..530038)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0483"
FT                   /product="two component, sigma54 specific, transcriptional
FT                   regulator, Fis family"
FT                   /note="PFAM: response regulator receiver; sigma-54 factor
FT                   interaction domain-containing protein; helix-turn-helix
FT                   Fis-type; SMART: AAA ATPase; KEGG: gdi:GDI2263 nitrogen
FT                   assimilation regulatory protein NtrX"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50279"
FT                   /db_xref="GOA:A9HLS3"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A9HLS3"
FT                   /protein_id="ACI50279.1"
FT                   /translation="MGHEILIVDDEPDIRLLVEGILRDEGYETRLAGDSDSAISAFRAR
FT                   RPSLVILDVWLQGSRLDGLGILQAIQGEEPVVPTIMISGHGTIETAVAALQHGAYDFIE
FT                   KPFQSDRLLLVVRRALEASRLARENAELRLRAGPEAMLYGDSPVIAGVRNQIERVAPSG
FT                   SRVLISGAAGAGKEVAARMIHARSRRAEGPFIALNCATLAPGRFEEELFGIEGAPDGTG
FT                   RRTGVLERAHGGTLLLDEVSDMPIETQGKIVRALQDQSFERVGGASRVKVDVRVLAATN
FT                   RDLQEAIAAGRFREDLYYRLAVVPLRVPSLRERREDIPGLARLFLRRAAENAGLPLRDL
FT                   SGDAVAALQSYDWPGNARELRNLMERLLIMMPGNGSDLIRAEMLPPSVGQGAPALLKFD
FT                   PAADVMGLPLREARDLFETQYLQAQLLRFGGNISRTAGFVGMERSALHRKLKQLGVTSE
FT                   ERGAG"
FT   gene            complement(530028..532292)
FT                   /locus_tag="Gdia_0484"
FT   CDS_pept        complement(530028..532292)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0484"
FT                   /product="multi-sensor signal transduction histidine
FT                   kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase HAMP region domain protein; histidine
FT                   kinase A domain protein; PAS fold-4 domain protein; PAS
FT                   fold domain protein; KEGG: gdi:GDI2264 putative histidine
FT                   kinase, nitrogen regulation protein NtrY"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50280"
FT                   /db_xref="GOA:B5ZCL6"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR017232"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZCL6"
FT                   /protein_id="ACI50280.1"
FT                   /translation="MTEPRASRARIPAPPLMRGLFGLLARRDVTIALVALALCFGVATF
FT                   VVLSGGLSVTHYPRIQALIFVLNFLVLLLLALALSERLGRVLAERRRGLAGARLHVRLV
FT                   TLFGIVAVAPTIVVGCFATVFFHYGIQIWFSDRVNTALNEALQASHGYLQEHNANIRTE
FT                   AFSLANYLAGAANGLEGSGSDLMHDPEALDQILDSQATLRGLNEAVIYDPLTNHIVASG
FT                   GLMSHPGDMQALPPPSATMMARTNEIAILDSPDEKTVRAVISLGDTPPLMLVITRPVDP
FT                   EILDHMHKTENVVADYQRLNRNRSKIQFTFVLIFALVGLLVLFAAILIGLVLANQIVRP
FT                   LGLLILASGRISDGDLKVRVPEGERDDELSSLSRAFNRMTDQLSSQRSELMIAYDQIDE
FT                   RRRFTEAVLSGVSAGVIGLDAQQVIELPNRAAATLLQQDLAAAIGRRLVDVVPEFHPML
FT                   DEVARASDRVWTGEVQVGSGARACTLLVRIGAETRGAKAEGYVVTFDDITALQAAQRKA
FT                   AWADVARRIAHEIKNPLTPIQLAAERLKRRFLREITSDPETFSQCADTIVRHVGDIGRM
FT                   VDEFSAFARMPQPIIRPEDLSRIVREALVLQRAAHPEIRYETDLPEHGPVVSCDRRLMV
FT                   QALTNLLQNAADAIAMVPKDGNAACSPAGPAGIVGIVLHIEGSEAHLTVADDGIGLPEE
FT                   DRQRLTEPYVTHKPKGTGLGLAIVKKILEDHGGSIRLEDRPDARGAVSILILPVKDDHG
FT                   A"
FT   gene            complement(532315..533763)
FT                   /locus_tag="Gdia_0485"
FT   CDS_pept        complement(532315..533763)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0485"
FT                   /product="nitrogen metabolism transcriptional regulator,
FT                   NtrC, Fis Family"
FT                   /note="KEGG: gdi:GDI2265 putative nitrogen assimilation
FT                   regulatory protein; TIGRFAM: nitrogen regulation protein
FT                   NR(I); PFAM: response regulator receiver; sigma-54 factor
FT                   interaction domain-containing protein; helix-turn-helix
FT                   Fis-type; ATPase associated with various cellular
FT                   activities AAA_5; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50281"
FT                   /db_xref="GOA:B5ZCL7"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR010114"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZCL7"
FT                   /protein_id="ACI50281.1"
FT                   /translation="MPLPTVLVADDDRSIRTVLSQALGRAGYQVRVTAHAATLWQWVEE
FT                   GEGDLVITDVVMPDENGLDLIPRIKRARPDLRVVVMSAQSTLMTAVKATQRGAFEYLPK
FT                   PFDLKELLSVVARALASPAGALAEPAPVDTDERMPLIGRSMVMQDIYRIIARLTTSDLT
FT                   VMINGESGTGKELVARALHDYGRRRGGPFVAVNMAAIPRELIESELFGHERGAFTGATS
FT                   RNPGRFEQAAGGTLFLDEIGDMPPEAQTRLLRVLQDGEFTTVGGRQPIRANVRIIAATH
FT                   RDLRQAIRTGSFREDLFYRLNVVPIRLPPLRERAEDIPLLARHFLDRCREDGLPGKILD
FT                   DGAVERLQASRWPGNVRELENLMRRLAALYPQETITADLIDSELAETLHEQGADAPDLR
FT                   EQEPLADAVARHIRHFLASGQDGMPLHDIYDRVIAEVERPLIQMTLAATRGNQIKAAAM
FT                   LGLNRNTLRKKIRDLEIPVVRGAN"
FT   gene            complement(533822..534931)
FT                   /locus_tag="Gdia_0486"
FT   CDS_pept        complement(533822..534931)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0486"
FT                   /product="signal transduction histidine kinase, nitrogen
FT                   specific, NtrB"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase A domain protein; PAS fold-4 domain
FT                   protein; SMART: PAS domain containing protein; KEGG:
FT                   gdi:GDI2266 putative histidine kinase, nitrogen regulation
FT                   protein NtrB"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50282"
FT                   /db_xref="GOA:A9HLT3"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A9HLT3"
FT                   /protein_id="ACI50282.1"
FT                   /translation="MAAGMALDMPQPDGAALLDAMSMPVVLVGPGNHIRYINSAAEPFF
FT                   GASRQQLMHRDLAEILAADHPIFLLVEQVRRDGVTTAEHELTLDGPRLHRTGITVQGTQ
FT                   LPDEPDSVLLTFHDSSAARQLDRQLTFRSAARSVSGMAAILAHEVKNPLSGIRGAAQLL
FT                   ESSVAEGDRELAVLIRDEADRIRDLVERMEMFSDKPLERRPVNIHRVLERVRMLAEQGF
FT                   AGNIRIVEDYDPSLPPVWGNRDQLVQVLLNLVKNAAEAIASDGQGGEITLGTSYRHGVR
FT                   LAVPGMEHRVELPLVVSVRDTGPGIPDSIRPHLFEPFLTTKTSGSGLGLALAGKIIDDH
FT                   GGVIEIDSRPGRTEVRLHLPMVAEGRTLP"
FT   gene            complement(534937..535998)
FT                   /locus_tag="Gdia_0487"
FT   CDS_pept        complement(534937..535998)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0487"
FT                   /product="TIM-barrel protein, nifR3 family"
FT                   /note="TIGRFAM: TIM-barrel protein, nifR3 family; PFAM:
FT                   dihydrouridine synthase DuS; KEGG: gdi:GDI2267
FT                   tRNA-dihydrouridine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50283"
FT                   /db_xref="GOA:B5ZD50"
FT                   /db_xref="InterPro:IPR001269"
FT                   /db_xref="InterPro:IPR004652"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018517"
FT                   /db_xref="InterPro:IPR024036"
FT                   /db_xref="InterPro:IPR035587"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZD50"
FT                   /protein_id="ACI50283.1"
FT                   /translation="MSSEMLRPVDLGGGVVLRTPVILAPMSGVTDLPFRRLARRLGAGL
FT                   VISEMIASWAMVRENQATLRMAEVADDDGPNAVQLAGCEPEAMAQAARIAVDRGADMVD
FT                   INFGCPVKKVAVGQQAGSALMRDEALAARLLDAVVRAVDVPVTLKMRMGWDHASLNAPA
FT                   LARIAEQTGIRMVTVHGRTRQQFYNGTADWSFVRQVKDAVSLPVIVNGDIQTVDDARQA
FT                   LALSGADGVMIGRGCYGRPWFLAQVAQALTTGDIVPDPDLATEKAIVLDHYDMMLSHFG
FT                   AHPGLRLARKHVAWYSAGLPDSAGFRAAINRVDQAQEAIGMISAFYDRHIAAGSHRARR
FT                   GTAAGGQDAAQAA"
FT   gene            536247..537401
FT                   /locus_tag="Gdia_0488"
FT   CDS_pept        536247..537401
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0488"
FT                   /product="2C-methyl-D-erythritol 2,4-cyclodiphosphate
FT                   synthase"
FT                   /note="TIGRFAM: 2-C-methyl-D-erythritol 4-phosphate
FT                   cytidylyltransferase; 2C-methyl-D-erythritol
FT                   2,4-cyclodiphosphate synthase; PFAM:
FT                   4-diphosphocytidyl-2C-methyl-D-erythritol synthase;
FT                   MECDP-synthase; KEGG: gdi:GDI2269 IspD/IspF bifunctional
FT                   enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50284"
FT                   /db_xref="GOA:A9HLU2"
FT                   /db_xref="InterPro:IPR001228"
FT                   /db_xref="InterPro:IPR003526"
FT                   /db_xref="InterPro:IPR018294"
FT                   /db_xref="InterPro:IPR020555"
FT                   /db_xref="InterPro:IPR026596"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR034683"
FT                   /db_xref="InterPro:IPR036571"
FT                   /db_xref="UniProtKB/TrEMBL:A9HLU2"
FT                   /protein_id="ACI50284.1"
FT                   /translation="MRVAAILLAAGVGRRFSATTASPVAKQYLTLGGRPIIRHAADALI
FT                   PHVDLLQPVGDAQALADALQGLDVLPPVAGGETRQESVRAGLEALDRLPESARPDLVLI
FT                   HDGARPYVPGEVTQAVIAALAAHPGAIPAVQVADTIKRGRDGVIAGTVPRDDLFRAQTP
FT                   QGFRFALLRDLHRGAAATDATDDAALLEAAGHTVALVPGSEDNIKLTYKEDLMRLERLI
FT                   GPTLLPRTGIGYDVHAFAENRALILCGITVPHDRGLAGHSDADVGIHALCDAIYGALAE
FT                   GDIGRHFPPSQNQWKDADSARFLVHAGERIRARGGMLVNADVTLICERPKIGPHSEAMR
FT                   QRLADLLQVGIDRISVKATTSERLGFTGREEGIACTASATVLVP"
FT   sig_peptide     536247..536309
FT                   /locus_tag="Gdia_0488"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.795) with cleavage site probability 0.407 at
FT                   residue 21"
FT   gene            complement(537514..537726)
FT                   /locus_tag="Gdia_0489"
FT   CDS_pept        complement(537514..537726)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0489"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gdi:GDI2271 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50285"
FT                   /db_xref="GOA:B5ZD52"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZD52"
FT                   /protein_id="ACI50285.1"
FT                   /translation="MASIDWRPLSEPSGFAERDPWQDIAARRDRPQTSRRMKQRLGHWV
FT                   ATCAMGAWALLAIVPVIVVLMAIDG"
FT   gene            complement(537875..538615)
FT                   /locus_tag="Gdia_0490"
FT   CDS_pept        complement(537875..538615)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0490"
FT                   /product="ATP12 ATPase"
FT                   /note="PFAM: ATP12 ATPase; KEGG: gdi:GDI2272 putative ATP12
FT                   chaperone protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50286"
FT                   /db_xref="GOA:B5ZD53"
FT                   /db_xref="InterPro:IPR011419"
FT                   /db_xref="InterPro:IPR023335"
FT                   /db_xref="InterPro:IPR042272"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZD53"
FT                   /protein_id="ACI50286.1"
FT                   /translation="MSGDPARDDARKRFWDQATVETLPDGFAVLLDGRTVRLPGGTALC
FT                   VRSAALATALAAEWQAAGGSKGGVFTPADLPLTRIAGTMLERIAPDRSATVAVLAGYAG
FT                   GDLLCYRVRTPALLVERQRQEWDPWLDWLRVRYGISLTVTEGVMPIAQSEEALGAVRAV
FT                   LDALSDGALAALGVAVPALGSLVLGLALAEGRLTAEQATACATLDERTQMELWGHDAQQ
FT                   AERLSRLEWDVRDAETFLHLVNES"
FT   gene            complement(538612..541068)
FT                   /locus_tag="Gdia_0491"
FT   CDS_pept        complement(538612..541068)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0491"
FT                   /product="AsmA family protein"
FT                   /note="PFAM: AsmA family protein; KEGG: gdi:GDI2273
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50287"
FT                   /db_xref="InterPro:IPR007844"
FT                   /db_xref="InterPro:IPR032712"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZD54"
FT                   /protein_id="ACI50287.1"
FT                   /translation="MTGPGARSGRGRAWLLASVAAVVLVAGSATMAARAMIDPASLRQQ
FT                   AVAAVWRQTGRVLRVGALDVRILPYPSVSVRDLALSDMAGGARPDMLTATGLDARLAIL
FT                   PLLHHEIRLEDVRLTHPDLLVERMADGRANWQMHPQPDTAPAASNPGGSSHSARWAVRI
FT                   GSVRVRDAVVTWDDRQAHGTGTVALDRVALDGLTGSAPSFDVQGHRPADAGAGFTMQGQ
FT                   VGPLVTPSSDPWKVRVQAAFLLDGQPGGSLGLDGALSDPAHLRGYDVTLHATAGQVSGL
FT                   NRLFVHAGLPDVRNVDLAARIVDMADGDAAPQPGLRMLHLRAGPVDAGQVVPALRLDHL
FT                   AIDAPTPADHMTIQAAGTYGARPFDLHGTVGTLSETIAAARSRLGSPMPLDLSGDVAGA
FT                   ALHGGGSIGGGQSDLDLHVAADRLALPGDRVLDHLTADAHVAMQGGDSVRLSGLRVDAT
FT                   QMALAGGLDFTRHGGTGGVPLLGGRIRADRLDLDALHITAPHAAAPTPRAPAPDTTAPA
FT                   APAPAPAPADAVLPFDRLRRMNIDLDLAASQLRLNGDDYHDALAHVLLRGGRLVIDPLR
FT                   ADGAGRHLNGTITVDASGDVPRLSASVGSLVLPAEWVAAQAGIPASVHGALQMVGVLDT
FT                   QGTTRAALRSALAGHLGLSLVNGQIDGAALGRLLGPGAAGAAQDALAGLRCFGVHMALG
FT                   GGQATLDTIGMQTRRLSVTGHGTVGLVRQDLDLHLVPQLLIGSTGAAMPVEIGGTIQAP
FT                   QPRLDPAGAGRRFVLTIGPSSGIADPCPAALQAAREGQPGPAPGAAPKAKAPKVMDMLR
FT                   GLGLFR"
FT   sig_peptide     complement(540961..541068)
FT                   /locus_tag="Gdia_0491"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.987) with cleavage site probability 0.550 at
FT                   residue 36"
FT   gene            complement(541099..542076)
FT                   /locus_tag="Gdia_0492"
FT   CDS_pept        complement(541099..542076)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0492"
FT                   /product="pseudouridine synthase, RluA family"
FT                   /EC_number="3.2.1.17"
FT                   /note="KEGG: gdi:GDI2274 putative ribosomal large subunit
FT                   pseudouridine synthase A; TIGRFAM: pseudouridine synthase,
FT                   RluA family; PFAM: RNA-binding S4 domain protein;
FT                   pseudouridine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50288"
FT                   /db_xref="GOA:A9HLV5"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR006224"
FT                   /db_xref="InterPro:IPR006225"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:A9HLV5"
FT                   /protein_id="ACI50288.1"
FT                   /translation="MSVVTLTVSEDEADIRLDRWFRRHYPHLTQGALQKLCRTGQVRVD
FT                   GKRAETSTRLLPGQAVRVPPIPGASRPAPPPRPVLDERLVREIRGMVIYSDDQVIVLNK
FT                   PAGLPVQGGPGIIHHVDAMLDGLKDQDDDPRPRLVHRIDRDTSGLLLLARTPGVAAKLA
FT                   ASFRGRDVRKTYWAIVVGRPSPASGVIDQPLARLGAGPGALTVVASRKDADAAHALSEY
FT                   EVLDAAGRKLSWLALSPLTGRTHQLRVHCEALGTPILGDPKYGGDTAHPEGFVDRLHLH
FT                   ARTLDLPHPAGGRLVVSADLPSHMRETFRQLGFSAGATQPPRRG"
FT   gene            complement(542153..544285)
FT                   /locus_tag="Gdia_0493"
FT   CDS_pept        complement(542153..544285)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0493"
FT                   /product="diguanylate cyclase/phosphodiesterase with
FT                   PAS/PAC sensor(s)"
FT                   /note="KEGG: gdi:GDI2275 putative signalling protein, GGDEF
FT                   family; TIGRFAM: PAS sensor protein; diguanylate cyclase;
FT                   PFAM: GGDEF domain containing protein; EAL domain protein;
FT                   PAS fold domain protein; SMART: PAS domain containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50289"
FT                   /db_xref="GOA:B5ZD56"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZD56"
FT                   /protein_id="ACI50289.1"
FT                   /translation="MKHSASSSLLMRDLSTPGPTVGPSDKGERIFELFRDDPELMLVAV
FT                   VDEGGAPIGLVERQAFFAKVSGQFGHALFAGRPVALLMDDRPVIVDAAVSSTDFTSMTI
FT                   TAQSSDVLRGYIVVAGGRYLGTGTALDLINASHSNAVASAANLHETAEELRKANRKILR
FT                   DKLFMDTIVENIPSALVVRSVRDDRLVLINRAAELMTGRERSELVEHTAADAFTETEIG
FT                   HALVHPEGTRREGVSESLLRNRAGDMRAVATRYVTIADERGDARWELCVADDVTERRQA
FT                   RQQVERLAHYDPLTGLANRALFGARLDGVCVAGHEAILLCIDLDYFKTVNDLYGHAAGD
FT                   ALLRLVADRLRACSRPDDLIARLGGDEFAIIWPNVPEKEELAHRAGEIVETISRPYVID
FT                   GQHVAIGASIGSASYPADAGSSDLLRQHADIALYKAKALGRNCFHSFDAGLSYEMRNKA
FT                   RLGDELRAAIGSSQICLHFQPLYTMPDNQIAACEALVRWNHPVRGMIPPDQFIGLAEEN
FT                   GLIHELGEWVLRAACREAVCWPPHVKVAVNVSPVQFRNSRFMAIVQSALMEAGLVPHRL
FT                   EVEITENIFVQNSAVNRDILRQLADMGCSVVLDDFGTGYSALSYLRLFSFQKIKIDRSF
FT                   VKELPEKSASGIIQAIVSLAQSMDIPTTAEGVETQEQWARLHAMGCSEAQGFLLGRPEP
FT                   VAAIRERLGVRDVVMS"
FT   gene            complement(544508..545087)
FT                   /pseudo
FT                   /locus_tag="Gdia_0494"
FT   mobile_element  complement(545163..546686)
FT                   /mobile_element_type="insertion sequence:Gdi16"
FT                   /note="family 1182"
FT   gene            complement(545238..546614)
FT                   /locus_tag="Gdia_0495"
FT   CDS_pept        complement(545238..546614)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0495"
FT                   /product="transposase IS1182 family protein"
FT                   /note="PFAM: transposase IS4 family protein; KEGG:
FT                   swi:Swit_4905 transposase, IS4 family"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50290"
FT                   /db_xref="InterPro:IPR008490"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZD57"
FT                   /protein_id="ACI50290.1"
FT                   /translation="MMGDRTKIQEALFYEFRLEDHVPAGHLLRSIDRFVDLDGLREHLR
FT                   PFYSGTGRPSIDPELIIRMLIVGYVMGIRSERRLCEEVHLNLAYRWFCGLGLNGPVPDH
FT                   STFSKNRHGRFRESDLLRQMFEMTVRQCIAKGLVGGEGFAVDASTIKADANRQRSVPSP
FT                   DKLPIEVAQRAVREYFSVLDDAAFGSATPVQPKYISPVDPAARWNAASGGLAYYAYCTN
FT                   YLIDLKSAVIMDVETTTAIRQAEVTAQRRMIERTQETFGIWPERLAADTAYGSAENLAW
FT                   LVHERGIEPHIPVFDKSARQDGTFERRDFTYDHVHDLYICPGGQQLKQQWRKINSDQPN
FT                   APPDNLLRYRSSKLACDVCTLKPKCCPNQPNRKVLRSIHEGARDMARDIALTDAYIISR
FT                   RERKKVEMLFAHLKRILKIDRLRLRGPNGARDEFHLAAAAQNLRKMAKLIPPGVPALST
FT                   "
FT   gene            547091..547378
FT                   /locus_tag="Gdia_0496"
FT   CDS_pept        547091..547378
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0496"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50291"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZD58"
FT                   /protein_id="ACI50291.1"
FT                   /translation="MHRIFNSVFPGGYRPRVLTEIEARDPVVIKVIVDELITEFPIAAD
FT                   IIAEVLLQHDAWLAAMEYLCAPADETEVKAEARMIDMEKTVLVTGSKSHA"
FT   gene            complement(547403..548824)
FT                   /locus_tag="Gdia_0497"
FT   CDS_pept        complement(547403..548824)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0497"
FT                   /product="AAA ATPase central domain protein"
FT                   /note="PFAM: AAA ATPase central domain protein; ATPase
FT                   associated with various cellular activities AAA_5; SMART:
FT                   AAA ATPase; KEGG: gdi:GDI2278 ATPase, AAA family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50292"
FT                   /db_xref="GOA:A9HLW5"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR021886"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032423"
FT                   /db_xref="UniProtKB/TrEMBL:A9HLW5"
FT                   /protein_id="ACI50292.1"
FT                   /translation="MAGRRDDHGDGDLFGGPASPVQGTSGQGASGSGGRRGRAAPPRTQ
FT                   PLADRLRPESLDDVVGQDHLLGPDGALRRMLDRGSLASLILWGGPGVGKTTIARLLADA
FT                   AGLRFVQLSAVFSGVADLKRAFDDARRLGEAGQGTLLFVDEIHRFNRAQQDGFLPVVED
FT                   GTVVLVGATTENPSFALNGALLSRCQVMVLRRLDDPALERLLCRAEEATGRALPLTPDG
FT                   RATLRAMADGDGRYLLNMVEQVLAVRTDQPMDAHGLSGLLARRAVLYDKDREEHYNLIS
FT                   ALHKSLRGSDTDAALYWFARMLEGGEDPRYIARRLTRFAAEDVGMADPQALPLAIAAWE
FT                   TYERLGSPEGELALAQLVVHLGTAPKSNAVYTAYKAARRLAKSTGSLMPPAHILNAPTN
FT                   LMKDLGYGRGYDSEYADVYADADPGAGQRTAARDHFPDGMGPQQLYRPFDRGFEREIGK
FT                   RLEYWARLRAGGKGQ"
FT   gene            complement(548900..549652)
FT                   /locus_tag="Gdia_0498"
FT   CDS_pept        complement(548900..549652)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0498"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   gdi:GDI2279 putative short-chain dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50293"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZD60"
FT                   /protein_id="ACI50293.1"
FT                   /translation="MTANETRRVALVTGAVRGIGLETARQLARQGIHVLVAGRRQEQAD
FT                   GVADRLRGEGLSAEGVVLDIDNPAQQTALRDYIATTYGRLDILVNNAGVLLDRGADGAA
FT                   PPPSATPDKTLRDTFEINLFATVQVTQTLLPLVLKSPAGRIVNLSSILASLGAHSDPAS
FT                   PIYGKLTFAYDASKTALNAFTVHLAHELKDTAVKVNSAHPGWVRTDMGGQDAPLDVAQG
FT                   ALTSVRLATLPDDGPTGGFFHMDHALPW"
FT   gene            complement(549675..550871)
FT                   /locus_tag="Gdia_0499"
FT   CDS_pept        complement(549675..550871)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0499"
FT                   /product="HI0933 family protein"
FT                   /note="PFAM: fumarate reductase/succinate dehydrogenase
FT                   flavoprotein domain protein; HI0933 family protein; FAD
FT                   dependent oxidoreductase; FAD-dependent pyridine
FT                   nucleotide-disulphide oxidoreductase; KEGG: gdi:GDI2280
FT                   putative glutathione reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50294"
FT                   /db_xref="InterPro:IPR004792"
FT                   /db_xref="InterPro:IPR023166"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZD61"
FT                   /protein_id="ACI50294.1"
FT                   /translation="MSLAMDFDVIVLGAGAAGLMAALAAGQRGRRVAVLDHAAEAGRKI
FT                   LISGGGRCNFTNLDTDAGRFLSGNPHFAKSALARFGPADILAMIERHGIAWHEKTLGQL
FT                   FCDGSARAVVAMLLAECDAGGVDIRLSHRITDVAGGDGFSVATDHGTFRAPALVLATGG
FT                   LSIPKMGATGLSHAIARQFGLRVTPTLPALVPLTIDAATPGWVPDLAGVSLDVVARCGA
FT                   TRFREAMLFTHRGLSGPAILQVSSYWDSGREICLDLMPGRDAAEALRAAKRQRPRVEGR
FT                   TMLSGFLPQRLAQAMAMHHLPDGPVGDMPDAVLNRLGQHLGRWCLVPAGTEGFAKAEVT
FT                   RGGIDTRDLSSRTMEARSVPGLYAVGEAVDVTGWLGGYNFQWAWASGYAAGRAIAEGG"
FT   sig_peptide     complement(550797..550871)
FT                   /locus_tag="Gdia_0499"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.960) with cleavage site probability 0.919 at
FT                   residue 25"
FT   gene            complement(550879..551547)
FT                   /locus_tag="Gdia_0500"
FT   CDS_pept        complement(550879..551547)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0500"
FT                   /product="Glutathione S-transferase domain"
FT                   /note="PFAM: Glutathione S-transferase domain; KEGG:
FT                   gdi:GDI2281 glutathione S-transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50295"
FT                   /db_xref="GOA:A9HLX4"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="InterPro:IPR040079"
FT                   /db_xref="UniProtKB/TrEMBL:A9HLX4"
FT                   /protein_id="ACI50295.1"
FT                   /translation="MRILYHLPLSPFCRKVRLVLGEKRLPFELMMERVWERRPEFLAAN
FT                   PAATVPLLVEENGLAIPNSAVICEYLEEAYPDTPLLGRTLAERVEVRRLVTWFDEKFAA
FT                   EVTENLLHEKVMKRISGRGNPDGNALRAGYANIRYHLSYIDWLAETRKWLAGPTLSLAD
FT                   FAAAAHLSCLDFINDVDWSKAPAAKDWYARIKSRPCFRSLLNDRVTGIVPPDHYADLDF
FT                   "
FT   gene            551721..552434
FT                   /locus_tag="Gdia_0501"
FT   CDS_pept        551721..552434
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0501"
FT                   /product="septum site-determining protein MinC"
FT                   /note="TIGRFAM: septum site-determining protein MinC; PFAM:
FT                   Septum formation inhibitor MinC; KEGG: gdi:GDI2283 putative
FT                   septum site-determining protein MinC"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50296"
FT                   /db_xref="GOA:B5ZD63"
FT                   /db_xref="InterPro:IPR005526"
FT                   /db_xref="InterPro:IPR007874"
FT                   /db_xref="InterPro:IPR013033"
FT                   /db_xref="InterPro:IPR016098"
FT                   /db_xref="InterPro:IPR036145"
FT                   /db_xref="InterPro:IPR038061"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZD63"
FT                   /protein_id="ACI50296.1"
FT                   /translation="MSDDSRPPPRIRARGRSFLALVLSPEAGLDDWLRGLDAQIARSPS
FT                   FFVGKPIILDLGLLSGDAEGLADLYPALLERGVRIIGIEGGDSAWPALAGWDWPQGFEG
FT                   GRASGTVALPEETDGGEAASATVPAASLIVERPVRSGQSVLHHDGDVIVIGSVASGAEI
FT                   SAGGSVHVYGTLRGRAIAGMGGQAGARIFATAMKAELLAIDGYYMIAEEIDPALSGQPA
FT                   QALLEDGTLVVRPLH"
FT   gene            552532..553347
FT                   /locus_tag="Gdia_0502"
FT   CDS_pept        552532..553347
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0502"
FT                   /product="septum site-determining protein MinD"
FT                   /note="TIGRFAM: septum site-determining protein MinD; PFAM:
FT                   Cobyrinic acid ac-diamide synthase; KEGG: gdi:GDI2284
FT                   septum site-determining protein MinD"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50297"
FT                   /db_xref="GOA:A9HLY3"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR010223"
FT                   /db_xref="InterPro:IPR025501"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A9HLY3"
FT                   /protein_id="ACI50297.1"
FT                   /translation="MAKVLVVTSGKGGVGKTTSTAALGAALAQTGKNVVVVDFDVGLRN
FT                   LDLVMGAERRVVFDLINVVQGDAKLAQALIRDKRVETLSILPASQTRDKDALTPEGVAR
FT                   VMDELREKFDWVICDSPAGIERGAQLAMYHADQAVVVTNPEVSSVRDSDRIIGMLDSTT
FT                   ERAKRGEKVDKHLLLTRYDPARAARGEMLRTEDVLEILSIPLLGIVPESEEVLRASNLG
FT                   TPVTLSNPTSAPARAYFEAVRRLEGEKLDISVPTERKGLFDWLFKRSVA"
FT   gene            553344..553634
FT                   /locus_tag="Gdia_0503"
FT   CDS_pept        553344..553634
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0503"
FT                   /product="cell division topological specificity factor
FT                   MinE"
FT                   /note="TIGRFAM: cell division topological specificity
FT                   factor MinE; PFAM: Septum formation topological specificity
FT                   factor MinE; KEGG: gdi:GDI2285 putative cell division
FT                   topological specificity factor"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50298"
FT                   /db_xref="GOA:A9HLY4"
FT                   /db_xref="InterPro:IPR005527"
FT                   /db_xref="InterPro:IPR036707"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9HLY4"
FT                   /protein_id="ACI50298.1"
FT                   /translation="MSLLASLFGRKTSAPVARDRLQILLAHERSAGEGQSELIAKLQEE
FT                   ILAVITRHITVDQDKVQIKMDRGAGVSMLEIDIEVPELKASAPPQAAAAPR"
FT   gene            complement(553670..554326)
FT                   /locus_tag="Gdia_0504"
FT   CDS_pept        complement(553670..554326)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0504"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="PFAM: regulatory protein GntR HTH; GntR domain
FT                   protein; KEGG: gdi:GDI2286 putative transcriptional
FT                   regulator, GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50299"
FT                   /db_xref="GOA:B5ZD66"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZD66"
FT                   /protein_id="ACI50299.1"
FT                   /translation="MTSDGGRKMLGIDAYNHIRTGLIRSRYRVGQRLVLRPLAAELGLS
FT                   PTPVREALLRLVSEQALELNDRNTAVVPEITPASFREIHTLRVDLESRLVQAAALRATS
FT                   AELDALAELDDDFQEACTRHDDARMAASNADFHAMLAAIADLPLTANILRSLWARIGPL
FT                   YALARTGPPTRPPGVPHPHDELLRALRARDPIAASLALVHDAEYARTWIESLMPF"
FT   gene            complement(554330..556129)
FT                   /locus_tag="Gdia_0505"
FT   CDS_pept        complement(554330..556129)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0505"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: gdi:GDI2287 putative ABC transporter, ATP-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50300"
FT                   /db_xref="GOA:B5ZD67"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZD67"
FT                   /protein_id="ACI50300.1"
FT                   /translation="MASDTETTIPDDQLVRYLGRPLSFIFRYMRRHAVQHVVIFLSVAV
FT                   AVACTVGATYATRFLVDTMTAHGAGEMAAVWRAVAILVVVIAFDNLSWRVAGWFATYAF
FT                   VEMTGDVRRDLFRYLTGHSASYFADRMPGAMASRISTSAMSLFTLENLAAWNVLPPCLN
FT                   VALSIGLLLTISPLMAGVIVALSGGLCLLMFRMAAGGRGLHQHYAAEASRVDGEMLDII
FT                   NNVSLVRSFGMTHYERLRLADVMRQEMGARGRSLRYMEKLRLVHAVLTAVLTAGLLAWV
FT                   VLLWQMGRATIGDVVMVANLGFMILHGTRDLAVALVETIQHIARLDEALSAILVRHEMV
FT                   DSPDARGFTGTSRGEVAFRDVTFAYPGARPVLSHFNLEIAAGSRVGLVGRSGSGKSTIL
FT                   ALIQRLRYVQGGAIEIDGIDIRDLDEPSLRACMSVVPQDVSMLRRSVLENIRYGKPDAT
FT                   DEEVLAAAAAAGCRDFIDAMPEGFQTEVGDRGVKLSGGQRQRIAIARAFLRNAPILILD
FT                   EATSALDSESEQHVQAALDRLKVGRTVIAVAHRLSTLRDFDRIVVMDQGRIVQDGPVAL
FT                   LERSVGPYRDFLERQSMTVEGAV"
FT   gene            556445..557479
FT                   /locus_tag="Gdia_0506"
FT   CDS_pept        556445..557479
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0506"
FT                   /product="glycosyl transferase group 1"
FT                   /note="PFAM: glycosyl transferase group 1; KEGG:
FT                   gdi:GDI2289 glycosyl transferase, group 1"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50301"
FT                   /db_xref="GOA:A9HLZ7"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:A9HLZ7"
FT                   /protein_id="ACI50301.1"
FT                   /translation="MRIAQIAPLHEAVPPKLYGGTERVVSFLTEELTAMGHDVTLFASG
FT                   DSVTSARLNACWPQALRLDPAIRDPIAPHMLMMEQVARAADQFDILHFHMDYWPFTHFS
FT                   RQKTPMLTTMHGRLDLMELQPVFNAFPNVPIVSISDNQRLPLPQAHYVRTVLHGLPANL
FT                   LTPQPGPRDYLAFLGRICPEKGVDKAIRIARALGVKLKIAAKIDKVDVEYFDREILPML
FT                   GDGVELIGEINDQQKPGFLSGAKALLMPIDWPEPFGLVMIEAMACGTPVVAFRRGSVPE
FT                   VLEDGLTGLIVDDEQQAIAACARLPEMNSTRIRQRFEERFTARRMAEDYLAVYRDLIAA
FT                   RAQA"
FT   gene            complement(557497..557838)
FT                   /pseudo
FT                   /locus_tag="Gdia_0507"
FT   gene            complement(557954..559057)
FT                   /locus_tag="Gdia_0508"
FT   CDS_pept        complement(557954..559057)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0508"
FT                   /product="protein of unknown function UPF0075"
FT                   /note="PFAM: protein of unknown function UPF0075; KEGG:
FT                   gdi:GDI2291 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50302"
FT                   /db_xref="GOA:B5ZD69"
FT                   /db_xref="InterPro:IPR005338"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZD69"
FT                   /protein_id="ACI50302.1"
FT                   /translation="MIRVIGLMSGTSLDGVDAAGVETDGVTVRAAGPAATVPFPPSLRR
FT                   RVRDLCDRAPGLPADDPDLRAVERDLTLLHAQAVRALDWPAQLIGFHGQTILHRPEEAR
FT                   TWQIGDAALLAAETGLPVVHDFRSADMAAGGEGAPLVPVFHQALAHGMDHPVAVLNIGG
FT                   VANVSLIGPHGRLVACDTGPGNALLDDWAMRHTGVPCDRDGALARAGRPDPDVLAELMS
FT                   DPFFLRGAPKSLDRLSFHRGMEVLERLSAADGAATLAAFTVRAVAGLKLPFQPRRWLVC
FT                   GGGRHNPVLMEGLRDSLPAAVDPVEAAGWNGDALEAQCFGFLAARSLLGLPLSFPGTTG
FT                   AGRPVTGGRLETQGVPEAALSALRLCG"
FT   gene            559186..562413
FT                   /locus_tag="Gdia_0509"
FT   CDS_pept        559186..562413
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0509"
FT                   /product="glycosyl transferase family 2"
FT                   /note="PFAM: glycosyl transferase family 2; KEGG:
FT                   gdi:GDI2292 putative glycosyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50303"
FT                   /db_xref="GOA:B5ZD70"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZD70"
FT                   /protein_id="ACI50303.1"
FT                   /translation="MPTPPGDTVVGLLLDIACLLLSNGADAPAIENTVGAFASCLGHDA
FT                   GLTITYRVDAFLLDIGTSSGEQARHAVPIATMRVAPSVIEPLLALAGHASCTQDDIHAA
FT                   RARALRRDAAADPGHQPAWYRFDPDWYRAAYPFVAEQMVFLGCDDVVAYFRDFGIGLGH
FT                   SPNPFFDEAWYRTAHPDIARLIADGVVQNGFVHYLTTGFADRSPHWLFDSGLYRRAHPD
FT                   LSPEGLAIRGYRNLYDHYLEVGDPSGLRGQWLFDPSGRFRQVAASLPHVAPTLSLSPCF
FT                   DAIWYLKTYPEVAALIAAGAYSCALHHYLANPTPTRFCATPWFSEDYYRVFYEDVDSAL
FT                   RNGTFRTGYEHFLEFGLREWRRPHPDVDLRAFRDRLARTNPEMRLEPDPFRFWLAVPAD
FT                   LRIAPAPPRIDEAISRDAFRQAAEDMLLLHAHEPIDFTPDGPADLAVVMVAHNRFSLTM
FT                   QALAALRTGGPGNMQVIIADSGSHDETRHLERYVAGARIIRFARNVGYIEACNAALRMV
FT                   TAPCTLYLNNDLIVEYGAIARALRRLHAAPDIGAVGAKIVRSNGILQEAGSILWRDGTT
FT                   SGYLRDRDPATPEANFVREADYCSGAFLLARTGLLHQLDGFDPAFSPAYYEEVDLCVRM
FT                   RKAGYRVVYDPSVMVRHLEYGSSDTDHSRVLMHRNHRVFSDRHRDILRYCQPRAAGNAI
FT                   FARSPRGARRRILYIEDRPPIRRHGAGYARSNDIVRLMVEMDYQVTIFPILMTDTPLLD
FT                   IYGALPDSVEILHDRHIGMLADLIRERPGYYDLVWVGRTHNLAQILPILAASPAALPVE
FT                   GFILDTECIAAPRTAERARVLGLASPPKLDQAVRDELACAYFCQQIVAVSDHDAALVRS
FT                   AGYDNVAVLGHMLEPAPTPSGWAERSGILFLGALHDMESPNYDSIAWFITQVMPRMPAE
FT                   MHLTIAGHVDPSVHFSALAGHGRVTFLGAVDDPRPLYDRHRVFVAPTRFAGGLPYKVHE
FT                   AAAHGLPVVASTVLCRQVGWDVGTDILCGGSDDPQCFADAIMALYEDAGLWRTVRDGAI
FT                   GRIARENDPHAYRRRLADILEKLLSMG"
FT   gene            562442..563587
FT                   /locus_tag="Gdia_0510"
FT   CDS_pept        562442..563587
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0510"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gdi:GDI2293 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50304"
FT                   /db_xref="InterPro:IPR011045"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZD71"
FT                   /protein_id="ACI50304.1"
FT                   /translation="MRFGLLSLLCLSLMIAPAAQAQTVLSANDAHSILRNGVQVLPKPL
FT                   KPDTLSVLDRGADGLWTVRASVAVPVSVVGPPTALVLTPDGRTALVSSASKADPARDRI
FT                   VPDDRISVIDLSGDRPRVVQQVTSAPGATTLRITPDQKHVLVANGAGGVVTWFRFDGRR
FT                   LSDRTVITLPGAAGFPGGLAITPDGRRALVSLWKGDRVFVLHLDGDRVTVDPHPLEIGP
FT                   GPWNIRLTGDGHYAVMGILGHGEGLPGALSVLDLTAAPIREIQRVVVPNAPEGLDISSD
FT                   GRFVAVVSQNGSAVVPTSPHYHDRGIVTVFSLSGGHLTQLAQAPGTLWPQGLVFAPDGT
FT                   SILVQGVMDRMLRTLSWDGTTLAVKGDTPLPGGGADIERQR"
FT   sig_peptide     562442..562507
FT                   /locus_tag="Gdia_0510"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.996 at
FT                   residue 22"
FT   gene            complement(563638..564624)
FT                   /locus_tag="Gdia_0511"
FT   CDS_pept        complement(563638..564624)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0511"
FT                   /product="pantothenate kinase"
FT                   /EC_number="2.7.1.33"
FT                   /note="KEGG: gdi:GDI2294 putative pantothenate kinase;
FT                   TIGRFAM: pantothenate kinase; PFAM:
FT                   phosphoribulokinase/uridine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50305"
FT                   /db_xref="GOA:B5ZD72"
FT                   /db_xref="InterPro:IPR004566"
FT                   /db_xref="InterPro:IPR006083"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZD72"
FT                   /protein_id="ACI50305.1"
FT                   /translation="MTSSSSRRGRSVRPVAAFRESDTPLPYLAFSRSEWAALRANVPLS
FT                   LSEDEIAGLRGRNEPVSLADITEIYLPLSRLLNLYVMASRSLNSMVESAFLGCPSISVP
FT                   FVIGIAGSVGVGKSTFARLLQAVLSRWPDHPRVDLVTTDGFLLPTRVLEERDLMQRKGF
FT                   PESYDLRRMIGFLAALKAGERHLDVPFYSHDAYDIVPDRFQTVDRPDILIFEGLNVLQT
FT                   GSDRSAVASDFFDFSIYLDAATADIESWYVERFLLLQRTAFRKPTSYFHHYADLPRDKA
FT                   EEMARQIWGRINLPNLQANILPTRERARLVVRKERSHAVGEVRLRHI"
FT   gene            complement(564794..565156)
FT                   /locus_tag="Gdia_0512"
FT   CDS_pept        complement(564794..565156)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0512"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gdi:GDI2295 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50306"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZD73"
FT                   /protein_id="ACI50306.1"
FT                   /translation="MLMLLAGLAACTVKRPEGDSIDVPPTGLFSGAPRPDATSPGKAGA
FT                   ARPGRPDNAGDLAARQPDYRPLPDAPGMQMISSGFDSNASDDDAEKEDGKHYVIPDTQV
FT                   SYGARGTRQGQPAAGQ"
FT   gene            complement(565182..566234)
FT                   /locus_tag="Gdia_0513"
FT   CDS_pept        complement(565182..566234)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0513"
FT                   /product="recA protein"
FT                   /EC_number="3.6.3.8"
FT                   /note="KEGG: gdi:GDI2296 protein RecA (recombinase A);
FT                   TIGRFAM: recA protein; PFAM: RecA domain protein; SMART:
FT                   AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50307"
FT                   /db_xref="GOA:B5ZD74"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013765"
FT                   /db_xref="InterPro:IPR020584"
FT                   /db_xref="InterPro:IPR020587"
FT                   /db_xref="InterPro:IPR020588"
FT                   /db_xref="InterPro:IPR023400"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZD74"
FT                   /protein_id="ACI50307.1"
FT                   /translation="MAQAPGIDKSKALEGALSQIERAFGKGSVMRLGQRANEAVDVIST
FT                   GSLGLDIALGIGGLPRGRIVEIYGPESSGKTTLALHAIAEAQKKGGVCAFIDAEHALDP
FT                   GYARKLGVDVDNLLISQPDAGEQALEIADTLVRSGAIDVLVVDSVAALVPRAELEGDMG
FT                   DSHVGLHARLMSQALRKLTGTVSRSNTMMIFLNQIRLKIGVMFGSPETTTGGNALKFYA
FT                   SVRMDIRRIGQIKDKDEVVGNQTRVKVVKNKMAPPFRQVEFDIVYGEGISKMGELIDLG
FT                   VKAGIVEKSGAWFSYDSQRIGQGRENSKQYLREHPEMAADIERRVREQAGVVAEAMLVS
FT                   PGEQDLAEIE"
FT   gene            complement(566402..567886)
FT                   /locus_tag="Gdia_0514"
FT   CDS_pept        complement(566402..567886)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0514"
FT                   /product="gamma-glutamyltranspeptidase"
FT                   /note="PFAM: gamma-glutamyltranspeptidase; KEGG:
FT                   gdi:GDI2297 gamma-glutamyltranspeptidase precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50308"
FT                   /db_xref="GOA:B5ZD75"
FT                   /db_xref="InterPro:IPR000101"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZD75"
FT                   /protein_id="ACI50308.1"
FT                   /translation="MRERPLYPPFRRYGARLLSTALAVALGGCSSTPVRMVSHELFGFG
FT                   GAGAGKTSPYLTGYIGNVVADEPQAAMAARDVLARGGNAGDAATALGLALAVTLPSRAS
FT                   LGGGGACLAWRPGDSDGGRAFVFMPAAGATTPEGGAPVDRPAAVPMLARGLYLMHLRYG
FT                   SVDFNETITPALQLARGGATVSRALAGDLAAVQQPLLADAGARALFSRNDGTVLAEGDS
FT                   LVQSRLAGVLEQMRAMGVGDLYNGALAASFVAGSQGAGGGLMAADLRGALPSETMPLTV
FT                   RVDRMTVSFLPPPADGGLGSAMAFRALSDGGQGGTVGQQAVAAWRARATGTRKAGDLVA
FT                   QAQAMVDSGTVSGGGMLPHLPASTSFAVVDRHGGAVACSLTMDNLFGTGRVAGSTGIVM
FT                   AASPQRLPPPLLTAAIASQGETFRAVATGSGQNDAADAVAAELRQVLTGQKPGERPVTA
FT                   EGRINAISCPAGLPGGEGSCVGASDVRAAGLAVGSD"
FT   gene            568091..568900
FT                   /locus_tag="Gdia_0515"
FT   CDS_pept        568091..568900
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0515"
FT                   /product="DSBA oxidoreductase"
FT                   /note="PFAM: DSBA oxidoreductase; KEGG: gdi:GDI2298
FT                   putative oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50309"
FT                   /db_xref="GOA:B5ZD76"
FT                   /db_xref="InterPro:IPR001853"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR041205"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZD76"
FT                   /protein_id="ACI50309.1"
FT                   /translation="MPYFAPVRPPARRAARRRAALSGVAAAILLGLSTTGARAGDGGTF
FT                   TADQRKEIVAIVRDALKTDPTILTDAIAALRAGAEAQEQATTRDALAANRAALGTPAPT
FT                   DAILGAPHARMTIVEFYDPRCPYCRKVLPDLDRLVHDDPDVRIVEKVVAVLGPASLLTA
FT                   QAIAAAALQGGQDAYFRMQRAIMADSQKPDAARIRTLAAQAGLDPDRLATDMAGSAVAS
FT                   TLRANSTLATAIHLEGTPTFVFDGRYVIPGAVDLDELKAAIAKVRRG"
FT   sig_peptide     568091..568210
FT                   /locus_tag="Gdia_0515"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.987 at
FT                   residue 40"
FT   gene            complement(568954..570204)
FT                   /locus_tag="Gdia_0516"
FT   CDS_pept        complement(568954..570204)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0516"
FT                   /product="5-aminolevulinic acid synthase"
FT                   /EC_number="2.3.1.37"
FT                   /note="KEGG: gdi:GDI2299 putative 5-aminolevulinate
FT                   synthase; TIGRFAM: 5-aminolevulinic acid synthase; PFAM:
FT                   aromatic amino acid beta-eliminating lyase/threonine
FT                   aldolase; aminotransferase class I and II; aminotransferase
FT                   class-III"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50310"
FT                   /db_xref="GOA:B5ZD77"
FT                   /db_xref="InterPro:IPR001917"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR010961"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZD77"
FT                   /protein_id="ACI50310.1"
FT                   /translation="MASIDVGGHPFYRFCRSALQDIRQQGRYRQFTPLARQADRYPVYE
FT                   YGAVRPLEGRDVVVWSANDYLGMGVEPAVAEAAIAAIREHGAGAGGTRNIAGTSPLHAA
FT                   LEAELADLHGKEAGLLFVSGYVSNQASLQTILTSMPGWICFSDRQNHASMIAGIKGARG
FT                   SSCVIFEHNDLADLEAKLAAAPRDVPKLVAFESVYSMDGDIADIGATCALARKYGAMTY
FT                   LDEVHAVGLYGPQGGGVAERDGVADQVDIIEGTLAKGFGVHGGYVTGSAELIDYLRCAA
FT                   SGFIFTTSLPPSVVAAALASVRMVRKDAWRRERMFERVAAFRARLTAAGVPFMPTPSHI
FT                   VPIPVGDADRCMDISRRLLSEYGLYATPINYPTVPRGTERLRLTPGPFHTDEMMDEMTA
FT                   ALVTLLGLSDQRKVEAA"
FT   gene            complement(570303..570767)
FT                   /locus_tag="Gdia_0517"
FT   CDS_pept        complement(570303..570767)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0517"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gox:GOX0509 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50311"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZD78"
FT                   /protein_id="ACI50311.1"
FT                   /translation="MFHPSRPELFLLAVTMAGTLCLASCNLVDQRTFDPRASRAPRPHY
FT                   PPPPPAPKPVPPLVEIRHGTPPDQWQPALKGAVTRAMARKPNVLFVVTVIVPAGPTPAQ
FT                   ESAALGRATATDGQAVAAAIVADGAGPAQVEITAMSDSTMTSGVIRVYVR"
FT   sig_peptide     complement(570684..570767)
FT                   /locus_tag="Gdia_0517"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.703) with cleavage site probability 0.204 at
FT                   residue 28"
FT   gene            570843..572960
FT                   /locus_tag="Gdia_0518"
FT   CDS_pept        570843..572960
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0518"
FT                   /product="Transketolase"
FT                   /EC_number="2.2.1.1"
FT                   /note="PFAM: Transketolase domain protein; Transketolase
FT                   central region; KEGG: gdi:GDI2301 putative transketolase"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50312"
FT                   /db_xref="GOA:B5ZD79"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033247"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZD79"
FT                   /protein_id="ACI50312.1"
FT                   /translation="MRACACGPPATILNHRSMARARTPMPDLDDDPAAEAGPGMAPADP
FT                   DARNMVHALGDAVRGFIGAAVDDAEAACRAAAMAVPACVLWNQFLRFDPACPDWPDRDR
FT                   FVVSSTRHRPLRNALMRLAGQVTSPGEAVMEYGAHPAVEMAFGPGGQGLGAAIGMALAE
FT                   RRMAARFGRSIVNHRIWVLSCGTELSTGVAMEAASLAARMGLDRITVLFEIPPQDESEA
FT                   EDTLARYAATGWSVRKVAADDPDAVHAALSAATRSRKPCVVACSIAPSPNAAAAPGENA
FT                   PRDLPALQDLSTLLWPRVARRGASARRAWLRRLAKHRQRGEFDRVTAGRLPSFWREDWA
FT                   RSWQVGTGAPPPGPGHGSDPAPYEQGTLGYGRRGLDILRGLVPEMLCLASRRGGELTGP
FT                   IRPDDAAAGDCGTRVHGLAALLNGIALHGGLIPCGATTFVAVDRMRPALRFAAMMRRRV
FT                   IYLLTDDGLALGQDGAGWLPVEQLASLRAMPNVAVFRPADRRETTECWELALHRADGPS
FT                   LIALCPVSAGQAEFPDLRGRRSRGASAHGGYVMEEARGPRQVTLVATGSEVAIARQAQQ
FT                   LLVRDGIHAALVSLPCWELFDRQDASYREQVLGSAPRIGIEAASGFGWDRWLGPRGAFI
FT                   GMEDFGETAPSSELYRRLGITAERIHQTAIHLISETGRDFHAPSGQKAEGGRGRYAAGG
FT                   TVQLRPTFRNG"
FT   gene            572981..574003
FT                   /locus_tag="Gdia_0519"
FT   CDS_pept        572981..574003
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0519"
FT                   /product="glyceraldehyde-3-phosphate dehydrogenase, type I"
FT                   /EC_number="1.2.1.12"
FT                   /note="KEGG: gdi:GDI2302 glyceraldehyde-3-phosphate
FT                   dehydrogenase; TIGRFAM: glyceraldehyde-3-phosphate
FT                   dehydrogenase, type I; PFAM: glyceraldehyde 3-phosphate
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50313"
FT                   /db_xref="GOA:A9HM29"
FT                   /db_xref="InterPro:IPR006424"
FT                   /db_xref="InterPro:IPR020828"
FT                   /db_xref="InterPro:IPR020829"
FT                   /db_xref="InterPro:IPR020830"
FT                   /db_xref="InterPro:IPR020831"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A9HM29"
FT                   /protein_id="ACI50313.1"
FT                   /translation="MAVKVAINGFGRIGRLVLRGIIESGRTDVVPVAINDLGSVADNAH
FT                   LLSYDSIHGRFPADVRVEGNAIVITANGRTYAPIAVSAEADPTKVPFDGVDVALECTGR
FT                   FTTKEKAAHLIEAGARKVIISAPGTHVDATIVYGVNQDTLTSDMTVISNASCTTNCLAP
FT                   IAKVLDETFGIERGYMVTIHSYTGDQRTVDTLHKDPRRARAAAMNIIPTSTGAARAVGL
FT                   VLPHLKGKLDGTAIRVPTPNVSLVSLDFVPTRIPASVEEVNAAMLKAASEGPLKGILAY
FT                   NTAPLVSSDFNHSIASSTFDATETALVDGGKLVRVCSWYDNEWGFSNRMSDTAALFGSL
FT                   "
FT   gene            574003..575226
FT                   /locus_tag="Gdia_0520"
FT   CDS_pept        574003..575226
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0520"
FT                   /product="Phosphoglycerate kinase"
FT                   /EC_number="2.7.2.3"
FT                   /note="PFAM: phosphoglycerate kinase; KEGG: gdi:GDI2303
FT                   phosphoglycerate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50314"
FT                   /db_xref="GOA:A9HM30"
FT                   /db_xref="InterPro:IPR001576"
FT                   /db_xref="InterPro:IPR015824"
FT                   /db_xref="InterPro:IPR015911"
FT                   /db_xref="InterPro:IPR036043"
FT                   /db_xref="UniProtKB/TrEMBL:A9HM30"
FT                   /protein_id="ACI50314.1"
FT                   /translation="MAALSFKTLDALQPKGRKVLLRADLNVPVRDGKITDLTRIERLAP
FT                   TIRELADKGARVIVVSHFDRPKGQRVPEMSLAPIAAALGTTLGRPVQFADDCIGPVAEE
FT                   AVSKLQDGDVLVLENTRFHAGEEKNDPDLSKALAALADDYVNDAFSAAHRAHASTEGVA
FT                   RFLPSFAGRLMEAELNALNVALENPVRPVGAIVGGAKISTKLDLIGNLLDKVDVLIIGG
FT                   AMANTFLAANGVRVGKSLQEADMHDTARAIMAKAEERGCEIVLPVDAVTATEFRADPPT
FT                   RTVPIDEIPADAMMLDAGPETVTLLIQKIVGLKTLVWNGPLGAFELHPFDTATNLVAAE
FT                   VARRTQAGQLTSVAGGGDTVSALRHAGVADEMSYTSTAGGAFLEWLEGKVLPGIQALGE
FT                   VSGRILPL"
FT   gene            complement(575249..576229)
FT                   /locus_tag="Gdia_0521"
FT   CDS_pept        complement(575249..576229)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0521"
FT                   /product="signal recognition particle-docking protein FtsY"
FT                   /note="KEGG: gdi:GDI2304 cell division protein FtsY;
FT                   TIGRFAM: signal recognition particle-docking protein FtsY;
FT                   PFAM: GTP-binding signal recognition particle SRP54 G-
FT                   domain; GTP-binding signal recognition particle SRP54
FT                   helical bundle; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50315"
FT                   /db_xref="GOA:A9HM31"
FT                   /db_xref="InterPro:IPR000897"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004390"
FT                   /db_xref="InterPro:IPR013822"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036225"
FT                   /db_xref="InterPro:IPR042101"
FT                   /db_xref="UniProtKB/TrEMBL:A9HM31"
FT                   /protein_id="ACI50315.1"
FT                   /translation="MALGFFSRLKAGLSRSTQKLGGGIAAVFTRRKLDDEALEELEDLL
FT                   ISADLGPAVAARIIESFRHSRFGAEVTDDEVRDALSAEIAQVLEPVAVPFVPDPQRKPH
FT                   VVLVVGVNGTGKTTTIGKMARYYGEQGLKVMMVAGDTFRAAAVEQLQVWGQRVGAPVIA
FT                   GPPNADAAGLAFEALKRGQAEGCDLLLIDTAGRLHNKGALMEELAKIIRVMRKFDESAP
FT                   HSVLLVLDATTGQNAIEQVRVFKELVNVTGLVVTKLDGSARGGIVVALADTFGLPVHAV
FT                   GVGEQAEDLRPFSAEAFARGLVGDSVRLTPREGGEATEEKEDGPA"
FT   gene            complement(576231..577493)
FT                   /locus_tag="Gdia_0522"
FT   CDS_pept        complement(576231..577493)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0522"
FT                   /product="MiaB-like tRNA modifying enzyme"
FT                   /EC_number="1.3.1.74"
FT                   /note="KEGG: gdi:GDI2305 hypothetical protein; TIGRFAM: RNA
FT                   modification enzyme, MiaB family; MiaB-like tRNA modifying
FT                   enzyme; PFAM: Radical SAM domain protein; Protein of
FT                   unknown function UPF0004; SMART: Elongator protein
FT                   3/MiaB/NifB"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50316"
FT                   /db_xref="GOA:A9HM32"
FT                   /db_xref="InterPro:IPR005839"
FT                   /db_xref="InterPro:IPR006467"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013848"
FT                   /db_xref="InterPro:IPR020612"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR038135"
FT                   /db_xref="UniProtKB/TrEMBL:A9HM32"
FT                   /protein_id="ACI50316.1"
FT                   /translation="MTAKPEILTFGCRLNTYESEVMRGHAAALDDVIIVNTCAVTAEAE
FT                   RQARQAIRRAHRDRPGARIVVTGCAAQIDPDRWSALPGVTRVLGNREKLEAASWTPAAM
FT                   QDGHAVSDIMAATETVPHLVTEFAGRTRAFVEVQQGCDHRCTFCIIPFGRGPSRSVPVG
FT                   AVVEQVRALVASGYREIVLTGVDITSWGGDLPGRPALGQLCRRVLALVPELERLRLSSV
FT                   DPVEIDDDLWRLLAQEGRFMPYLHLSLQAGSDMVLKRMKRRHLVEDVARVLDRARACRP
FT                   DLGIGADVIAGFPTETDALFAETLDFVRAQRLPYLHVFPYSERPGTPAARMPAVPVAVR
FT                   KERAAQLRAAGQAAARDYHASLLGRTLNVLLETATTGHSEEFAPVRLAPDRLDGTAAEA
FT                   GRIVTVRATAIDENGLVAETL"
FT   gene            complement(577490..578329)
FT                   /locus_tag="Gdia_0523"
FT   CDS_pept        complement(577490..578329)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0523"
FT                   /product="Diaminopimelate epimerase"
FT                   /EC_number="5.1.1.7"
FT                   /note="PFAM: diaminopimelate epimerase; KEGG: gdi:GDI2306
FT                   putative diaminopimelate epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50317"
FT                   /db_xref="GOA:B5ZD84"
FT                   /db_xref="InterPro:IPR001653"
FT                   /db_xref="InterPro:IPR018510"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZD84"
FT                   /protein_id="ACI50317.1"
FT                   /translation="MMTPFHKMHGLGNDFVVVDERAERYGLTPARIAALADRHRGIGCD
FT                   QFVVLQPATRDGADVLVRFFNADGTEAGACGNASRCVAALLWRQEGRRETVLQTRAGLL
FT                   PARVDDAGVVTVDMGRPALDWRDVPLARAADTLHLPLAGDPAAASMGNPHATFFLDDML
FT                   DLDPVVAGPLLEHDPLFPERANIGFAHVRSRTELRLRVWERGSGLTLACGSGACAAVVN
FT                   AVRRGLVERTCTVGMDGGALSVSWRAQDDPGEGGHVLMTGPATVSFVGTFDPEGYPS"
FT   gene            complement(578381..578782)
FT                   /locus_tag="Gdia_0524"
FT   CDS_pept        complement(578381..578782)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0524"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; KEGG: gdi:GDI2307 putative
FT                   lactoylglutathione lyase"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50318"
FT                   /db_xref="GOA:A9HM34"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:A9HM34"
FT                   /protein_id="ACI50318.1"
FT                   /translation="MAKLIHSMIRVRDEAASLAFYERAFGLRVADRLVFDGFTLIYLSN
FT                   AEQTFELELTVNHDRDRPYDLGDGYGHLAVSVADIDAEHDRFTREGLSPLAVKQLSLGE
FT                   RVVGRFFFVADPDGYRIEVLQRGAPGRFL"
FT   gene            578815..579528
FT                   /locus_tag="Gdia_0525"
FT   CDS_pept        578815..579528
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0525"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: Methyltransferase type 11; KEGG: gdi:GDI2308
FT                   putative methyltransferase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50319"
FT                   /db_xref="GOA:B5ZD86"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZD86"
FT                   /protein_id="ACI50319.1"
FT                   /translation="MYSGPAGIVGLDFPPDLSHVRGMTDEPHGFHPAAFTVASDEPDAS
FT                   FFARRDPGPLMDPGAQSAVTALYHTLVAEGADVLDLMAGPDSHLPRDATYGSVIGIGLD
FT                   ADAMADNPRIGHRIVQDLNATPTLPLPDDAVDVACLCDVAPYLRQPMATLAEIRRVLRP
FT                   GGVVIVTFSDRVIAGKAVALWQALDSTDRRRLLTILLQRAGFAGIDSGEVHPPADTPSW
FT                   RDTVYAITARVPNAA"
FT   gene            579748..581655
FT                   /locus_tag="Gdia_0526"
FT   CDS_pept        579748..581655
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0526"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gdi:GDI2309 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50320"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZD87"
FT                   /protein_id="ACI50320.1"
FT                   /translation="MWISVRTSPLPWRLSVLLLCGATVAPAHASAQDEAAQIDAMESRI
FT                   ARIQAQQLELQKDLMAMRQELARHRARLTGGHAGGTAAARQPVREAASAAPHASSAMKV
FT                   TAPESLAGIDSQDRGAPVADAAPPATVAATSAPAPMDVPPPRIGFDEPTVAAVVGRRSE
FT                   DMVNRIADNNVGPHPRETVGAQAAGALGDHGVFHLGPVSIILGGFFDTAAVLENRHMAS
FT                   GTFNYWQAMPFPNQSSFHENNFEGSARYSRFSLMARGNVDADTTISGFVETDFGAGAET
FT                   TNPYESNAYVPRLRQAYLAYDNTRSDNHFLIGQAWSLLTPGRGGIIARQESLPETIESS
FT                   MLAGQTWARQWQARVVHDMMHHRLWLGLSIENPATIYDTTGFANANGSVPLPNGGTANV
FT                   GANGTGLTEFTTNYSDEIAPDVIGKVAWDPAWGHYEAEGVVRFPHDRVVVNGVGRNNTA
FT                   ISGGGGGSAILPVIPHKVEIRLAGLAGMGIGRYGSVLLPDVTLSSSGKPKPLPDAQGTA
FT                   GIVAHPNSAIDVYGYYGMQRSGRSYFSADGTAYGYGNPNASNAGCEIELSPLACTANIR
FT                   SVQEFTIGAWWRFLKGRYGTVEAGTQLAYSRVETWRGIGGAPSTSASQIFFDFRYLPFQ
FT                   "
FT   sig_peptide     579748..579837
FT                   /locus_tag="Gdia_0526"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.725 at
FT                   residue 30"
FT   gene            581732..582073
FT                   /locus_tag="Gdia_0527"
FT   CDS_pept        581732..582073
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0527"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gdi:GDI2310 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50321"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZD88"
FT                   /protein_id="ACI50321.1"
FT                   /translation="MQDKVLRGLALSLCLVAMAAPALADDEEEAHKTMSLHQLAKRPPI
FT                   PTAHKDFSQYRYRPAGDKIVEQSDADRLMFWTQDGTPDGYAERRGNAILYYDRTGKAVR
FT                   VQEMDPTAD"
FT   sig_peptide     581732..581806
FT                   /locus_tag="Gdia_0527"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.998 at
FT                   residue 25"
FT   gene            complement(582160..582897)
FT                   /locus_tag="Gdia_0528"
FT   CDS_pept        complement(582160..582897)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0528"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: gdi:GDI2311 putative ABC-type Fe3+ transport system
FT                   ATP-binding component"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50322"
FT                   /db_xref="GOA:A9HM39"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A9HM39"
FT                   /protein_id="ACI50322.1"
FT                   /translation="MTHLVVESLSFSRDGRRVLDDVSFAMRAGEGVALLGPNGAGKTTI
FT                   LRLVLRLLRPRAGRILLDGQPIMGMARRDLASRVAYVPQGHAVAFPYRVRDVVALGRLA
FT                   AGTMVSPFVSAADRAAAGQAMDHLAIGHLADRSYAALSGGERQSVLIARALAQGARLLV
FT                   LDEPETGLDYGQQLRLFDLLRRLAGDGYAVLATTHDPLRAARVFSRAILLQKGRMIADG
FT                   PAADVLSTAAISSLYGYPASWSG"
FT   gene            complement(582894..583922)
FT                   /locus_tag="Gdia_0529"
FT   CDS_pept        complement(582894..583922)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0529"
FT                   /product="transport system permease protein"
FT                   /note="PFAM: transport system permease protein; KEGG:
FT                   gdi:GDI2312 putative ABC-type Fe3+ transport system
FT                   permease component"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50323"
FT                   /db_xref="GOA:Q288C8"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:Q288C8"
FT                   /protein_id="ACI50323.1"
FT                   /translation="MSPRTGGGRNVAGLALPAAGLVILAIVSLGLGRYPVSAADIVSVL
FT                   LGRDGGVMPARRALLHSILIGTRLPRIAGAIVVGAALSVSGAGYQAVFRNPLVSPGLLG
FT                   VLAGAGFGAAAGIVTGAGPVGMHLLSFLGGTVAVAAGVGVARLFDAASMLMLVFGGLVS
FT                   TALFTALLSLLKYVADPDRQLPDIVFWLLGSLTQVAWSDLAVMAPPVLVGIVALGACGR
FT                   MLDALAMGDDEARTLGVPVTALRYGVIAAATVLSALTVSVAGMIGWVGLIVPHVARLLA
FT                   GPRNARVLPLSACLGGAFLLACDDLARSLSAEEIPVGLIADLLGVCVFVSVLPLIRRGW
FT                   AE"
FT   sig_peptide     complement(583806..583922)
FT                   /locus_tag="Gdia_0529"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.609) with cleavage site probability 0.550 at
FT                   residue 39"
FT   gene            complement(583919..584947)
FT                   /locus_tag="Gdia_0530"
FT   CDS_pept        complement(583919..584947)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0530"
FT                   /product="periplasmic binding protein"
FT                   /note="PFAM: periplasmic binding protein; KEGG: gdi:GDI2313
FT                   putative ABC-type Fe3+ transport system periplasmic
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50324"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZD91"
FT                   /protein_id="ACI50324.1"
FT                   /translation="MGRHDLAAAILAAAVVGVWPAAGRARTVMDMTGHAVTCPDHPDRI
FT                   ADLWFAHNELTIMLGAAGRIAVTDDLPAARPWMYRVAPALHQAVGVTSPVPNTEMLMQS
FT                   GVDLAFVANDSPAAASLRHVGLPVVQAGFTDLASLLRAVDLTADILGDASAHDVARRYR
FT                   AVLTATVERVRQAVAPVPLSARPRVLHVKSLVPLTVDGEHTIIDEWITRAGGRNAATGL
FT                   TGNMRPVSMEQIAAWDPDVVILGADSGDATAAPEGWAALRAVRAGRVHQNPAGVFPWDR
FT                   YGSELPLQLLWTARTLYPDRFRDVDMVSETIKFYHDFFAYDLKPDDAARILAAQRPAEG
FT                   GR"
FT   sig_peptide     complement(584870..584947)
FT                   /locus_tag="Gdia_0530"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.882) with cleavage site probability 0.527 at
FT                   residue 26"
FT   gene            complement(585052..585246)
FT                   /locus_tag="Gdia_0531"
FT   CDS_pept        complement(585052..585246)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0531"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gdi:GDI2314 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50325"
FT                   /db_xref="GOA:A9HM45"
FT                   /db_xref="UniProtKB/TrEMBL:A9HM45"
FT                   /protein_id="ACI50325.1"
FT                   /translation="MFHISMAGPHRPHLHAPWRAVAARQDDPSGVDARDRITVALICGG
FT                   LLSAFVIDMAILYFSMFRP"
FT   gene            complement(585442..588324)
FT                   /locus_tag="Gdia_0532"
FT   CDS_pept        complement(585442..588324)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0532"
FT                   /product="glycine dehydrogenase"
FT                   /EC_number="1.3.1.74"
FT                   /note="KEGG: gdi:GDI2315 glycine dehydrogenase; TIGRFAM:
FT                   glycine dehydrogenase; PFAM: glycine cleavage system
FT                   P-protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50326"
FT                   /db_xref="GOA:B5ZD93"
FT                   /db_xref="InterPro:IPR003437"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR020581"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZD93"
FT                   /protein_id="ACI50326.1"
FT                   /translation="MTSTSLWRNTTPAADAFCTRHVGPAERDVAAMLGVIGADSLDDLM
FT                   DQTVPASIRLRGDMGLGDGLSEPAVLARLREIAGRNRVMVSLIGQGYYGTVLPGVIQRN
FT                   VLENPAWYTAYTPYQPEISQGRLEALLNFQTLVTDLTGLDVANASLLDEATAAAEAMAL
FT                   ARRVARSKADGFFVDADCHPQTLAVLRTRAEPMGWRIIVGNPEHDLDPDAVFGALFQYP
FT                   GSSGRIRDPRAWIERLHAAHAIVAMAADPLALTVLEAPGTLGADIAVGSMQRYGMPMGA
FT                   GGPHAAYMAVRDAYKRNMPGRLVGVSIDSRGEPAYRLALQTREQHIRREKATSNICTAQ
FT                   VLPAVISAMYAVYHGPEGLAAIARRTHRLTAILVAGLRALSIRVETESVFDTITVHTRG
FT                   EADLLQVRAEEAGMNLRVVDGDRVGISLDETSTPHTVRAIWRCFCRDAGRLAALERDLT
FT                   APDDLLPAALRRTTLFLTHPVFHAHRSETDMLRYLRRLSDRDLALDRTMIPLGSCTMKL
FT                   NATVEMMPVTWPEFCDIHPFAPAAQQAGYAELFQDLERLLKAVSGYDAVSLQPNSGAQG
FT                   EYAGLLAIRAYHRSRGEGRRDICLIPASAHGTNPASAQMVGMRVVVVACDGQGNVDIGD
FT                   LKAKIAQHADRLAAIMITYPSTHGVFEESVVEICDLVHAAGGQVYLDGANMNAQVSLSR
FT                   PGAFGADVSHFNLHKTFCIPHGGGGPGMGPIGVGAHLAPFLPGAPQEGGTNAVSAAPFG
FT                   SAAVLPISWTYMTLMGDAGLRRATEIAILNSNYIASRLSDHYPVLYRGANGRVAHECIV
FT                   DLRPIKDQTGITVDDIAKRLIDHGFHAPTVSFPVAGTFMIEPTESEGRVELDRFCDAMI
FT                   AIRAEIRDIEAGVLTADESPLRHAPHTVRDLTETAWERAYDRQRGCLPGDVVPSSKYWS
FT                   PVNRLDNAYGDRNLVCSCPDMSAYQEEATA"
FT   gene            complement(588362..588727)
FT                   /locus_tag="Gdia_0533"
FT   CDS_pept        complement(588362..588727)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0533"
FT                   /product="glycine cleavage system H protein"
FT                   /note="TIGRFAM: glycine cleavage system H protein; PFAM:
FT                   glycine cleavage H-protein; KEGG: gdi:GDI2316 glycine
FT                   cleavage system H protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50327"
FT                   /db_xref="GOA:A9HM50"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR002930"
FT                   /db_xref="InterPro:IPR003016"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR017453"
FT                   /db_xref="InterPro:IPR033753"
FT                   /db_xref="UniProtKB/TrEMBL:A9HM50"
FT                   /protein_id="ACI50327.1"
FT                   /translation="MTVYYTKDHEWLRIEGDVATVGITAHAAEELGELVFVEAKPDGTE
FT                   VAQGDSAAVVESVKAASDIYAPVSGTVAGFNGALADDPSLVNRDPEAEGWILKMRIADQ
FT                   GQLASLLDAAAYAALIA"
FT   gene            complement(588750..589883)
FT                   /locus_tag="Gdia_0534"
FT   CDS_pept        complement(588750..589883)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0534"
FT                   /product="glycine cleavage system T protein"
FT                   /note="TIGRFAM: glycine cleavage system T protein; PFAM:
FT                   glycine cleavage T protein (aminomethyl transferase);
FT                   Glycine cleavage T-protein barrel; KEGG: gdi:GDI2317
FT                   glycine cleavage system aminomethyltransferase T"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50328"
FT                   /db_xref="GOA:B5ZD95"
FT                   /db_xref="InterPro:IPR006222"
FT                   /db_xref="InterPro:IPR006223"
FT                   /db_xref="InterPro:IPR013977"
FT                   /db_xref="InterPro:IPR027266"
FT                   /db_xref="InterPro:IPR028896"
FT                   /db_xref="InterPro:IPR029043"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZD95"
FT                   /protein_id="ACI50328.1"
FT                   /translation="MTQPLLRTPLHDLHLSLGARMVPFGGYEMPVQYRAGVMAEHQHTR
FT                   AAAGLFDVSHMGQIRLRARSGRVEDAALALERLVPADILSLKPGRQRYALLTNEQGGII
FT                   DDLMVSRVGDTLLLVVNAACKDADLAHITAALDDACIVESLPDRALIALQGPLAGAALA
FT                   RLAPASADMRFMDVAEFDVAGVPCIVSRSGYTGEDGFELGMESGGTVRVAEALLAQAEV
FT                   EPVGLGARDSLRLEAGLCLYGSDIGPDTTPVEGALEWSIQKSRRAGGARAGGFPGADII
FT                   LARIQDGAARRRVGIAVDGRAPVRGGARLFADAEGHRPVGHVTSGAFGPTAGAPVAMGY
FT                   VDIAHAATGTALFAELRGKYVPVTVAALPFVAPGFKR"
FT   misc_binding    complement(589991..590064)
FT                   /bound_moiety="glycine"
FT                   /note="gcvT element as predicted by Rfam (RF00504), score33
FT                   .85"
FT   misc_binding    complement(590065..590151)
FT                   /bound_moiety="glycine"
FT                   /note="gcvT element as predicted by Rfam (RF00504), score50
FT                   .61"
FT   gene            590291..590596
FT                   /locus_tag="Gdia_0535"
FT   CDS_pept        590291..590596
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0535"
FT                   /product="Antibiotic biosynthesis monooxygenase"
FT                   /note="PFAM: Antibiotic biosynthesis monooxygenase; KEGG:
FT                   gdi:GDI2318 putative antibiotic biosynthesis monooxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50329"
FT                   /db_xref="GOA:A9HM53"
FT                   /db_xref="InterPro:IPR007138"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:A9HM53"
FT                   /protein_id="ACI50329.1"
FT                   /translation="MDATPFTVIAEFATTPESHDKFLKICAYDAARSVTDEPGCHRFDA
FT                   LLPDGEPNTVILYEVYTDRAAFDTHLTTPHYKVFADGVAELGVEIVKVRMLTTQPA"
FT   gene            complement(590648..591517)
FT                   /locus_tag="Gdia_0536"
FT   CDS_pept        complement(590648..591517)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0536"
FT                   /product="spermidine synthase"
FT                   /note="TIGRFAM: spermidine synthase; PFAM: Spermine
FT                   synthase; KEGG: gdi:GDI2319 spermidine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50330"
FT                   /db_xref="GOA:B5ZD97"
FT                   /db_xref="InterPro:IPR001045"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR030374"
FT                   /db_xref="InterPro:IPR035246"
FT                   /db_xref="InterPro:IPR037163"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZD97"
FT                   /protein_id="ACI50330.1"
FT                   /translation="MTEAWIGETLYDGWQQRFRVRTELARTRSAFQDIVVFESETHGRV
FT                   LVLDGVIQITEGDEFVYQEMLTHVPLLAHGNAASVLIIGAGDGGVLRRVLQHRGVTRAV
FT                   MVEIDGEVIALSKQFLPGIAGDAWTDPRAEVIVGDGIDYVARAETGSVDVIIVDSTDPI
FT                   GVGEVLFTDSFYEHCARILTPNGIIVNQCGVPFMQADELRDTSLRRARFFPHVSAYVAA
FT                   VPTYVGGFMTLGVAAKGTNPATPSVETIRARAEAAGILGTTGYWTPEIHTGAFNLPPYI
FT                   AKHLPAAK"
FT   gene            complement(591639..592097)
FT                   /locus_tag="Gdia_0537"
FT   CDS_pept        complement(591639..592097)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0537"
FT                   /product="S-adenosylmethionine decarboxylase proenzyme"
FT                   /note="TIGRFAM: S-adenosylmethionine decarboxylase
FT                   proenzyme; PFAM: S-adenosylmethionine decarboxylase
FT                   related; KEGG: gdi:GDI2320 putative S-adenosylmethionine
FT                   decarboxylase proenzyme"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50331"
FT                   /db_xref="GOA:B5ZD98"
FT                   /db_xref="InterPro:IPR003826"
FT                   /db_xref="InterPro:IPR016067"
FT                   /db_xref="InterPro:IPR017716"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZD98"
FT                   /protein_id="ACI50331.1"
FT                   /translation="MNALAQLGMVSEYPSNIQSSTPSSCDEERKDYFVEKDGMKFAGTH
FT                   LLVDLWDATNLDDPEQIDRTLCEAAVTAGATILHSHFHHFTPNGGVSGVVVLAESHISI
FT                   HTWPERNFAAVDIFMCGACDPHLAIPVMQRLFQADRVVVDEQRRGRVA"
FT   gene            complement(592256..595168)
FT                   /locus_tag="Gdia_0538"
FT   CDS_pept        complement(592256..595168)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0538"
FT                   /product="excinuclease ABC, A subunit"
FT                   /note="TIGRFAM: excinuclease ABC, A subunit; PFAM: ABC
FT                   transporter related; KEGG: gdi:GDI2321 putative UvrABC
FT                   system protein A"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50332"
FT                   /db_xref="GOA:B5ZD99"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR004602"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041102"
FT                   /db_xref="InterPro:IPR041552"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZD99"
FT                   /protein_id="ACI50332.1"
FT                   /translation="MGNRSRPAPGLPAAQSIRVRGARAHNLKNIDVEIPRDALTVVTGL
FT                   SGSGKSSLAFDTIYAEGQRRYVESLSAYARQFLELMGKPDVDAIEGLSPAISIEQKTTS
FT                   KNPRSTVGTITEIHDYMRLLWARAGVPYSPATGLPIEAQTISQMVDRVMALPEGTRLML
FT                   LAPVIRDRKGECRKELAELQRKGFARVKVDGTLYDIAEVPDLNRKLRHTVEAVVDRVVV
FT                   KPGLESRLADSFETALGLSDGLVYAEELPRGEAEPPPHIVFSSRFACPVSGFTLEEIEP
FT                   RLFSFNAPQGACPACDGIGLETFFDPHLIVPDESLSLERGAIAPWRSTQSPYYQQTLDS
FT                   LAAHYGVGMDTPWRDLPAGVRETILDGGKDEILFRYRDGRKSYDLTKRFEGVVTNLRRR
FT                   MAETDSVWVREELSRYQSDKPCHVCHGTRLRPEALSVRVAGSTIAEASDLPIRRALDWF
FT                   GTVEATLTPQRAEIARRILREILDRLHFLNDVGLDYLTLSRGSATLSGGESQRIRLASQ
FT                   IGSGLTGVLYVLDEPSIGLHQRDNERLLGTLDRLKRLGNTLIVVEHDEDAIRSADWLID
FT                   MGPGAGVNGGHVVAIGTPEEVAANPASLTGDYLSGRKRIDVPTVRRPIDPARMLVLEGA
FT                   GGNNLKDVTAHFPLGTFTCVTGVSGGGKSTLVIDTLYKALSRQLMGSGQNPAPYRGIAG
FT                   LDLLDKIIDIDQSPIGRTPRSNPATYTDLFAPIRDWFAELPESKARGYKAGRFSFNVKG
FT                   GRCEACQGDGVLKIEMHFLPDVFVTCDTCKGARYNRETLEVKFRGKSIADVLAMTVDEA
FT                   LPYFSAVPRIRDRLAILQQVGLGYVALGQQATTLSGGEAQRVKLSKELARRATGRTLYI
FT                   LDEPTTGLHTEDVRKLLEVLHALVDQGNTVVVIEHNLEVIKTADWVLDMGPEGGDGGGR
FT                   IVAEGTPEDIAACPESHTGRFLRPLLPAAAPKARRRRSKG"
FT   gene            595463..596017
FT                   /locus_tag="Gdia_0539"
FT   CDS_pept        595463..596017
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0539"
FT                   /product="single-strand binding protein"
FT                   /note="TIGRFAM: single-strand binding protein; PFAM:
FT                   single-strand binding protein/Primosomal replication
FT                   protein n; KEGG: gdi:GDI2322 single-stranded DNA-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50333"
FT                   /db_xref="GOA:B5ZDA0"
FT                   /db_xref="InterPro:IPR000424"
FT                   /db_xref="InterPro:IPR011344"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZDA0"
FT                   /protein_id="ACI50333.1"
FT                   /translation="MAGSVNKVILVGNLGKDPEVRNSQAGAKIVSLTLATSDTWNDRAS
FT                   GERRERTEWHRVVIFNERLADVAERFLRKGRKVYLEGTLQTRKWTDQSGQERYTTEVVI
FT                   DRFRGELVLLDSNRGGESGDDAGGGGYGGGYSAPSAPRQIGGGRGGSAGGPGGGGAGGG
FT                   NPGGGWDAPHGGSDLDDEIPF"
FT   gene            596185..598977
FT                   /locus_tag="Gdia_0540"
FT   CDS_pept        596185..598977
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0540"
FT                   /product="DNA gyrase, A subunit"
FT                   /EC_number="5.99.1.3"
FT                   /note="KEGG: gdi:GDI2323 putative DNA gyrase subunit A;
FT                   TIGRFAM: DNA gyrase, A subunit; PFAM: DNA
FT                   gyrase/topoisomerase IV subunit A; DNA gyrase repeat
FT                   beta-propeller"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50334"
FT                   /db_xref="GOA:A9HM65"
FT                   /db_xref="InterPro:IPR002205"
FT                   /db_xref="InterPro:IPR005743"
FT                   /db_xref="InterPro:IPR006691"
FT                   /db_xref="InterPro:IPR013757"
FT                   /db_xref="InterPro:IPR013758"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR035516"
FT                   /db_xref="UniProtKB/TrEMBL:A9HM65"
FT                   /protein_id="ACI50334.1"
FT                   /translation="MTEIPDPPEPPAPSDMIPVTIEEEMRSSYLAYAMSVIVSRALPDV
FT                   RDGLKPVHRRILYSMRESGFTHDKPYRKSARAVGDVMGKYHPHGDSSIYDAMVRMAQFW
FT                   SMRVKLIDGQGNFGSVDGDSPAAMRYTEARLAKAASFLLDDIDRDTVDFQPNYDESEQE
FT                   PKILPAAFPNLLINGASGIAVGMATNIPTHNPAEIIDATLALIANPDLTLDDLIRIVPG
FT                   PDFPTGGIILGHAGIRSAFETGRGSILIRARAEIEELRRDRSAIVITEIPYQVNKATLQ
FT                   ERIAELVRAKQIEGISDIRDESDRSGMRIVIEIKRDATPEVVLNQLYRFTQLQTSFGVN
FT                   MLALDNGQPRLMGLKDVLEAFITFREDVILRRARFDLNKARDRGHLLVGLVIAVANIDA
FT                   VIALIRAAPDAAHAREALMATAWDAADVEPLLALIQDEGNVVTDGKVYLTEAQARGILE
FT                   LRLQRLTGLEREKIQQELSEVAARINELLTIIASRPRRMEVMCEELAAIRAELATPRMT
FT                   EIAQYAGDQTDESLIEPGQMVVTITREGFIKRTPLDVFRAQNRGGRGRTAAGRRGDDIV
FT                   VRSFNAHTHQWVLFFSSGGKAYREKVWRLPEASPTAKGRALVNLLPDLGGDSITAVLPL
FT                   PQDETLWENLHLVFATATGNVRRNRLSDFRNIRSSGLIAMKLDDGDRLIGVATCREGQD
FT                   VFLATRAARCIRFQITDDTLRVFAGRDSSGVRGIRLAEGDEVNSLCVLNHVEATVEERA
FT                   SFLRMANARRRAENAALQAGEEAEEVAAEPSDDEALPADSVIDPERFAEMEQAEEILLT
FT                   VSNAGFGRRSSAYDYRVSGRGGQGIANMTFNGGKRGSEVVATLPVINGTDVMLVTDAGR
FT                   LIRVPVDQIRVMSRQASGVTLFRLDTTERVTSVFPVMDDGDDDAEDGGPDAPAAEDENA
FT                   "
FT   gene            598970..599479
FT                   /locus_tag="Gdia_0541"
FT   CDS_pept        598970..599479
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0541"
FT                   /product="pantetheine-phosphate adenylyltransferase"
FT                   /EC_number="2.7.7.3"
FT                   /note="KEGG: gdi:GDI2324 putative phosphopantetheine
FT                   adenylyltransferase; TIGRFAM: pantetheine-phosphate
FT                   adenylyltransferase; cytidyltransferase-related domain
FT                   protein; PFAM: cytidylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50335"
FT                   /db_xref="GOA:A9HM68"
FT                   /db_xref="InterPro:IPR001980"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:A9HM68"
FT                   /protein_id="ACI50335.1"
FT                   /translation="MPDATPRTGFYPGTFDPMTNGHLDIVERAARLVDRLVVGVAENTG
FT                   KQPLMPLDERVACVQAETRAVAQRNGTTIDVVGFGNLLVEVARSHGATVIVRGLRAVVD
FT                   FDYEVQMFGMNHHLAPDIETVFLMATERNQYISSRLVKEVARLGGDITGFVPPFTRRHV
FT                   LARLEG"
FT   gene            599538..600023
FT                   /locus_tag="Gdia_0542"
FT   CDS_pept        599538..600023
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0542"
FT                   /product="peptidyl-prolyl cis-trans isomerase cyclophilin
FT                   type"
FT                   /note="PFAM: peptidyl-prolyl cis-trans isomerase
FT                   cyclophilin type; KEGG: gdi:GDI2325 putative
FT                   peptidyl-prolyl cis-trans isomerase B"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50336"
FT                   /db_xref="GOA:A9HM70"
FT                   /db_xref="InterPro:IPR002130"
FT                   /db_xref="InterPro:IPR020892"
FT                   /db_xref="InterPro:IPR024936"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:A9HM70"
FT                   /protein_id="ACI50336.1"
FT                   /translation="MSDTAPKADLIDLELKTGRVVIQLRPDLAPLAAERIRTLAAEGFY
FT                   DNTPFHRVIHGFMAQGGDPTGTGTSGSHLPDLKAEFTRAAKFERGTIGMARTMNPDSAN
FT                   SQFFIMFEPSPHLDGQYTIVGQVVEGMEHIDQIKRGAGQSGTVQDPDRIISMRPAAA"
FT   gene            600094..600166
FT                   /locus_tag="Gdia_R0009"
FT                   /note="tRNA-Lys1"
FT   tRNA            600094..600166
FT                   /locus_tag="Gdia_R0009"
FT                   /product="tRNA-Lys"
FT   gene            600274..601515
FT                   /locus_tag="Gdia_0543"
FT   CDS_pept        600274..601515
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0543"
FT                   /product="integrase family protein"
FT                   /note="PFAM: integrase family protein; KEGG: mex:Mext_0175
FT                   integrase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50337"
FT                   /db_xref="GOA:B5ZDA4"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZDA4"
FT                   /protein_id="ACI50337.1"
FT                   /translation="MGKHSSSSVAGAFNSQPWSIYKQTNSKNWFVRFSIKGQGQIRKSL
FT                   QTADEKEADRKAARIYYEALLRAEQGLEARDKTVRVLADEWIAEGVLKAPERTALSRYI
FT                   VGYFGDDKPSDITYRGLQAYRKWRLSYWTEGPGKNLEMVVYQRLGRQIRRPVTRKTPTR
FT                   STLNSEQVVFKKFLTRCQNLGHIKTIPKFDKIEGEVHNRPGFSHAEIEKILSVLRKRTV
FT                   LPALSNEERYPHILLYGYVGIMCGSGMRPIECQKLRWIDLVGFDESRNAKLCEGRITVR
FT                   VHGKGKSREFVPLDGTISDFLMIWDVQKIIRGSDPDPNDYIFVDIKGRHIQTFNPEVVS
FT                   LLEECSLRQDYRGIKRTSYSFRHYYITFMINAHANIYDIAKNCGTSVAMIEKFYSHVTL
FT                   ESIRDRLRPSGTRI"
FT   gene            complement(601711..603342)
FT                   /locus_tag="Gdia_0544"
FT   CDS_pept        complement(601711..603342)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0544"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: lpl:lp_2473 prophage Lp3 protein 8, helicase"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50338"
FT                   /db_xref="InterPro:IPR007936"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZDA5"
FT                   /protein_id="ACI50338.1"
FT                   /translation="MMEDNLTPPQDDKDSKKKFNFETVNRYIDLIEQGKMEIDDAVISA
FT                   FTMMSDDIQKVSVVFKKSGCVSAGDIKRCLKTFLKQQTSFAVIEFYGVEDFVKKYMEKF
FT                   KLKFNEHKNIEDDSFNESIEKMKREIAEKGDPHHAIERNMIMERQLKHISHKDISDYIT
FT                   DMNNYVLDNGLSKRIGGKQNIIDTVNKIRNDVDRERKNNIINYLIYGYDTGNRDLEGFQ
FT                   KFIERGSEMLDESHKHISFTFDRLKKAAEIISDDDSTYVATVLYHFIWQVKRKMTGRQV
FT                   DHHMMPIFTGKQGLGKSQFISASLLKPIDSLWSQVSFGIIEEEKSFEIYNNYVLFLDEM
FT                   GGVRKADVENIKNVISAPTRTGRPMRTNDSITVRNNVVFIGASNKTLDDLIKDDTGARR
FT                   FPTITYGKNNLAPYMNPDFKNIDWEQIWLGVNEAAPCLFEMYKELKELVIGKIEEVRYV
FT                   GPFEEWAFREETVRDFGMNGAVGNKAYKTATALYENFKTFMDTCHPRAFQMSQRAFSIQ
FT                   LKKTATDNPDKISHKIIEKQSMYCWL"
FT   gene            complement(604526..604633)
FT                   /locus_tag="Gdia_0545"
FT   CDS_pept        complement(604526..604633)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0545"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50339"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZDA6"
FT                   /protein_id="ACI50339.1"
FT                   /translation="MRWWSPKVLYRNKVINLDRLMSLGDRNQRREGMDS"
FT   gene            complement(604743..605525)
FT                   /locus_tag="Gdia_0546"
FT   CDS_pept        complement(604743..605525)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0546"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cja:CJA_0810 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50340"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZDA7"
FT                   /protein_id="ACI50340.1"
FT                   /translation="MTKPPTAKSEPIEQEKEKTCFVVMPISDPDGYEPGHFKRVYDNLI
FT                   APACGFAGFKPIRADDVMHTNMIHLDILNQLLEADLVICDLSSRNPNVMFELGIRQAFD
FT                   KPVVLIQEEGTPRVFDISPIRCVDYPRSLRYDSVVEIQSKISRYMNETFDAKDSDKSIN
FT                   SIVKLLSISRAAGISKPSGDENHNMMRLIIEEISSIKNIVYKDRERENKEIIMMRNANL
FT                   DLERRNDFSLQNKISKNKLYSLGDLMRDAGGNLKNDKL"
FT   gene            605714..606181
FT                   /locus_tag="Gdia_0547"
FT   CDS_pept        605714..606181
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0547"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ade:Adeh_3279 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50341"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZDA8"
FT                   /protein_id="ACI50341.1"
FT                   /translation="MDQVPIDRIRAILAEVKPLAAEYYRLTGKPLGVTGEVAEYVAAEV
FT                   LGLELAEARTPGYDAIRHTANGPQRIQIKGRACGEAAKPGQKISRIKSDAPCDVVLLVL
FT                   LDDKTLNAREMWEAPFPSIAARLAIPGSKARQRGALSIGEFKRIARKIWPT"
FT   gene            607181..607378
FT                   /locus_tag="Gdia_0548"
FT   CDS_pept        607181..607378
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0548"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0548"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50342"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZDA9"
FT                   /protein_id="ACI50342.1"
FT                   /translation="MTLGIEKIQDLIDIIEFNDIDLPHIRESKKTLLRDLKPYIDKQLY
FT                   GGYVLTQSAYLILLELFLQQ"
FT   gene            complement(607432..607653)
FT                   /locus_tag="Gdia_0549"
FT   CDS_pept        complement(607432..607653)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0549"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: atc:AGR_L_3548 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50343"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZDB0"
FT                   /protein_id="ACI50343.1"
FT                   /translation="MTPTRLRECLVLVRWSQRGLAAALDADERLVRRWASGDADIPEAV
FT                   AEWIEGLAQAHASLPAPGRWRSRETALS"
FT   gene            complement(607650..607859)
FT                   /locus_tag="Gdia_0550"
FT   CDS_pept        complement(607650..607859)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0550"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50344"
FT                   /db_xref="GOA:B5ZDB1"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZDB1"
FT                   /protein_id="ACI50344.1"
FT                   /translation="MSDTTAHPDLDLAEKVLKIANLHADSELKNAQRFFLPWQFLVSAL
FT                   ALAFTAGAGLTGGLFALIRWKVGG"
FT   gene            complement(607976..608656)
FT                   /locus_tag="Gdia_0551"
FT   CDS_pept        complement(607976..608656)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0551"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50345"
FT                   /db_xref="GOA:B5ZDB2"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZDB2"
FT                   /protein_id="ACI50345.1"
FT                   /translation="MTSLYVLLFLAVCLFIFGSLIAGVLIHVWKKDKNRRKKHNRIYND
FT                   SILIGEELKENNILDPVGDARALVLVSRFQAGVPASIKGLDDICDHLKTMSEEDKIVPS
FT                   DIVNALSREVYLKILQINNQSTSVNDDITVHPHLTRSSLYRKKDGKGYILSSCEDSKTF
FT                   CLNAGLKIHNEVFPAIFDDEDEYWFHNDVDITDKVQSIIEKHKLPHWSKWNKSHIAKLK
FT                   LFLG"
FT   sig_peptide     complement(608588..608656)
FT                   /locus_tag="Gdia_0551"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.997) with cleavage site probability 0.991 at
FT                   residue 23"
FT   gene            complement(608906..609340)
FT                   /locus_tag="Gdia_0552"
FT   CDS_pept        complement(608906..609340)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0552"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50346"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZDB3"
FT                   /protein_id="ACI50346.1"
FT                   /translation="MNDDMIPMSDDPETRTLQFELIEAEREVRRINLRLEEGQSEIQSY
FT                   ISTAIEDPDAGIGPIELEADGKVYVSSGDWGTRFALEIASKTDLIEIITYSNSDEDTSG
FT                   FDESIPDFIEKLQAWIDKELFGGYILTTRDYAEIKVRYLK"
FT   gene            complement(609403..609909)
FT                   /locus_tag="Gdia_0553"
FT   CDS_pept        complement(609403..609909)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0553"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50347"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZDB4"
FT                   /protein_id="ACI50347.1"
FT                   /translation="MTNSFLSILSNACADGNAINSNDKGATARDNFAAALRIQINVLND
FT                   VYEYGFNQGIKLAKEGSTKRFLPWFRRNDCGSYEMRFVYATYSFDLLTGDFKGSYTVLG
FT                   DGSINSLIEWCEQIHAGAMRGDLDEILEKARCGQIEMVRKGREAKKAQKAADQGAILMI
FT                   EHKAA"
FT   gene            complement(610268..610858)
FT                   /locus_tag="Gdia_0554"
FT   CDS_pept        complement(610268..610858)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0554"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50348"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZDB5"
FT                   /protein_id="ACI50348.1"
FT                   /translation="MGFFDTLTVSDGVKKVTEVKKASPRDKFVEQLNGQLSYVAEAIEE
FT                   GSIAKLRARYSEDHEAELVRLKREADRTGNPEGKPKTKARLILWFEETRNGYVSGFRYG
FT                   TSGFNPMGGENPQAVFVAGKTLQDLQAFYQGAIKAAEDGELDTLLDAAEKARKPTGRGA
FT                   AKANAEKGSVSSQVPDNDVRLVAPPKTGRSPAK"
FT   gene            complement(611462..612808)
FT                   /locus_tag="Gdia_0555"
FT   CDS_pept        complement(611462..612808)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0555"
FT                   /product="phage portal protein, HK97 family"
FT                   /note="TIGRFAM: phage portal protein, HK97 family; PFAM:
FT                   portal protein; KEGG: det:DET1087 portal protein, HK97
FT                   family, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50349"
FT                   /db_xref="InterPro:IPR006427"
FT                   /db_xref="InterPro:IPR006944"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZDB6"
FT                   /protein_id="ACI50349.1"
FT                   /translation="MKFQTTQLDGILSSFKSAINSYVEPPINPGISGFIGMMPTASGIS
FT                   INVENMLQSSAVSSCLRIIIDDIGKLDINLEIKNKRGGWVVDETPDTLRLLRYPNQENV
FT                   MQTLLKALVFDYLTYGNAYVVCIRNPDGSTQKLVHVKANGVTVRRNEKGELRYTASSKM
FT                   FIGERTSVRSEGPEQETRSISNEDMIHIKDFSVYGGAVGTSIVDYAREVFGLTIAAQET
FT                   AARTFNNGGALQGYWKTTNAKAGKKTTENVQADLQNIIGGVSNSGKISVINDMDYVPTS
FT                   MSPQALQLIEARNQMTLEIARLFRVPLHKLGMSETDKAANIEQQEISYINDTLKAITNN
FT                   IESCFNRKILLERDIGIKRFKFDFESMTCPDLQTRSLAYTTLVDHGLMTPGFAANKLGI
FT                   PVPEDEEYADSYRVPLNMGTIGANEDIPLSLQTPEPEKKVRKRTQKKEA"
FT   gene            613375..613590
FT                   /pseudo
FT                   /locus_tag="Gdia_0556"
FT   gene            complement(614459..615238)
FT                   /locus_tag="Gdia_0557"
FT   CDS_pept        complement(614459..615238)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0557"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gdi:GDI3569 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0557"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50350"
FT                   /db_xref="InterPro:IPR009826"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZDB7"
FT                   /protein_id="ACI50350.1"
FT                   /translation="MITDCSFGGFQLYVKEISESDIGPNFVSHIFPYSSVPYLEITGNR
FT                   IPRYEVRGFFSNQTGLEKMEFLAICQKQKLQSFFHPDLGLQQCALVGISTSENDRQIGI
FT                   VSFQMTLLQSNQPAKFSLFNVLTNPLGALNSVVNSGIGAVSGQFGGLIASTGISAITAA
FT                   THTNLTAITNAIGSSTSLGRVSGVDSMLNGATLGRFAQDTTLSSSVMTSVASGSASQSN
FT                   SQIVASLSAAASQAKSQSISNIKTSVSDATSDVSTLA"
FT   gene            complement(615755..616948)
FT                   /locus_tag="Gdia_0558"
FT   CDS_pept        complement(615755..616948)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0558"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cel:H43E16.1 H43E16.1"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50351"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZDB8"
FT                   /protein_id="ACI50351.1"
FT                   /translation="MQSITFVSANFNTGQPGSPWTGPNAQLVYDELNNVLAIAGITPNG
FT                   TNSQVATALTDYFAPLASPGLTGSPTAPTPAQGDDSTHIATTAFVQTAVSSAELPYTPV
FT                   RQGTGSGQGSNTISIGLSTDGTDQLLAQYDSTPMGPLALRDYTDATYLKLTGGSLSGAL
FT                   SVSGTITGTGDIHTGSGNTLYTNNINAPSGTLSITGSNLTTTGSLTVGGSIYGSSNVVD
FT                   IMYGTSNGWKSAFQNDGSFAIYNPSGTNIFSVGGSDGDIVTSMPMTVNNSLYAYNSPPS
FT                   GDSSTQVPNTEWVDNNFYSLTKYNSDFSTSNGGVINLPWNNCIQAWSFDLVTSGYTANV
FT                   NFPVAFSAGPFAISIESCAGDMDTWTNNWSATGFTINVPDNSATTNGNISVIAIGPR"
FT   gene            complement(617923..619062)
FT                   /locus_tag="Gdia_0559"
FT   CDS_pept        complement(617923..619062)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0559"
FT                   /product="Mu-like protein prophage tail sheath protein
FT                   gpL-like protein"
FT                   /note="KEGG: gox:GOX2347 bacteriophage tail sheath protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50352"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZDB9"
FT                   /protein_id="ACI50352.1"
FT                   /translation="MASSINTGVPSSFPIPGTWINISSAGSTNITTDFVVVLMGTMTSG
FT                   SSATINTLAIAGAVADVQTAYGATSDIATMYTRYREIDPVTTVYLISPATSAGTDVATA
FT                   LTSLNNFAFDVAISPYSTEDVVNAFDTYCSTTWGYASELYGIHITAASDTFTNLAALGA
FT                   TANSKYTEIAAFAPGSTDSVAQRAAAVGAVTVIRASADPALPLQEMSLNVAPSGFSNAF
FT                   NISQRTSLFNAGLAITREDFSGNVYLERSRTTYQTNSAGLPDTSYQNVETLLSLSYSSK
FT                   YIRTGLTSVFFGNNPFKIVDDGNPIPNSGNITTPSAIQAEIVSLYSDLVTDYICQDQAT
FT                   FNTNVSVQYAGNGVVNAYIPLILANQLRQINASISFTAA"
FT   gene            complement(620462..621109)
FT                   /locus_tag="Gdia_0560"
FT   CDS_pept        complement(620462..621109)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0560"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50353"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZDC0"
FT                   /protein_id="ACI50353.1"
FT                   /translation="MLESLTTTEIVCPVPITLIQQYIGVLDPSQTTIIQMMANSITRTI
FT                   ENRIGNYIIQRPIVWVCSKSRQDQSKDYYDSWLSSGISFGWSWNQTISQWITLPTSAVS
FT                   IESVSIARWGEADVLLVGGDDYVADLETQEARIQFSFYDYVSEFYNSYAHLVVNYTGGI
FT                   CAGTTDDPVPSSIQYVICELTKRLFEKRGEPSALFTVGIETMLNEHMRYAIA"
FT   gene            complement(621303..623486)
FT                   /locus_tag="Gdia_0561"
FT   CDS_pept        complement(621303..623486)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0561"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bph:Bphy_1875 putative membrane protein, phage
FT                   K related"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50354"
FT                   /db_xref="GOA:B5ZDC1"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZDC1"
FT                   /protein_id="ACI50354.1"
FT                   /translation="MAGNTNGSYSIRVALIDDASSALKTLNKNLMATQAPMNKLSREFN
FT                   KFTKLSGIRDLGNSIGSLTGKLRMAIDPAVTLAKALTGITGIAGAAGLGIAIKTASDRA
FT                   LQISNTARVLGQSPRSVRAEQNAGSLLFRDQSAVTSQIQATQDRRSQVIQGHATQYEND
FT                   YMTATGRNIGRDDALTTLRSELDYIKQQTQRYNLDPGRVRDLMGQFGIDQRYTGMSGTD
FT                   LQRAISRGQSNSGNLSNQDYDNLDKMNQSITDIQQKAVGIIDEFAAKLAPALQPGLDIL
FT                   SQVEDKIEKWLSNSPQAQQMFDNIGTAVKNFGDWLLKIDFDKVESNLETIIDDMGGIKT
FT                   AAEALIGISLVGWFSPLILATGSLALNLLKIGTNLNALKNSGLNKAIASGTVGSTLGSG
FT                   ARLLGRLIGPGITVGMGAYEAGSAITDYHKGQITRRQEAERLGGASGGVAGSLAGAAGG
FT                   AAVGGAIGSMVPLVGTVIGAGVGGAIGGYFGWQGGAAAGTKGTDLYRDMMGYDRGAASL
FT                   ANNFSNKQISSLMGSITDIEGARYDQMGGAGNKYLGKYQLGQGAIADGSRMLGISTPSN
FT                   SELLKNPQLQDQIAMAFEQSNYEALRKSPEFRALNSDQQIGVMAYAHNQGAGGAIKWLR
FT                   TGVAGKDAFGTSGTEYQNLALSKLGTSDNGVAVPPVGSGNQGGSVQMASNDSRIQLDIN
FT                   FDGTKFVAQAKSSGRPVQVNTRLRQTQVIPVAV"
FT   gene            623581..624999
FT                   /locus_tag="Gdia_0562"
FT   CDS_pept        623581..624999
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0562"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rsp:RSP_1645 putative phage-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50355"
FT                   /db_xref="InterPro:IPR024455"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZDC2"
FT                   /protein_id="ACI50355.1"
FT                   /translation="MNIREMKAEYSALKKKKTVLVGLINQKDVEGADIEADEKSLSDLK
FT                   AKISRLERSIERAEDALEDEEDAKEVDDENEDGDDEKSKPKSKTFGIVSEVGSGLNPAE
FT                   GIARKVIATSLVKRLGISDARKTAVDRLGIRNGDRLIKDLTSAGQPVVAQDYRGFIDLV
FT                   RAEAVVRQFARIEYMPKGNLTEPRQITGSTGSWINEGAPIPTSQMSLDIINFLWKKLAV
FT                   FTYSTKEYLMYANFDAAGKITEDLARQIALFEDEAFLNSAAETNGTPIGLAGSVLSTNT
FT                   FGSTGVDFASVYENLLRAESYIRQNNIKGELVWVMSTQTKLFLRSLITSLGIRVFENEI
FT                   QGGTLNGHKIFDTTLVPSNLPNTLATPTDTVSPIYLVAKDYAVVADAGSYEVQEIDQGS
FT                   FVTGGGVQINTAQSDIIAWKCANRVDFKMTLDNAIACINADGWNLGNFAASIGNTQTPS
FT                   TSVSGASGTKNSGS"
FT   gene            complement(626865..628619)
FT                   /locus_tag="Gdia_0563"
FT   CDS_pept        complement(626865..628619)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0563"
FT                   /product="Terminase"
FT                   /note="PFAM: Terminase; KEGG: par:Psyc_0464 probable phage
FT                   terminase, large subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0563"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50356"
FT                   /db_xref="InterPro:IPR005021"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZDC3"
FT                   /protein_id="ACI50356.1"
FT                   /translation="MKYEEIYNNLDPLSKQQYSYPYKVLNGTLGTEVCELTRLACERSF
FT                   RDFELPDFYYDPTDPERFRFLTTKLVYLAGVGSVGGTHVQIEDWQLWYFSQLLGWKNAN
FT                   GRNKGKRRFRKGSLWVARGNNKTGAGAWFCLYMLLCDGEWDPQVYSVGVDRDQASHTFK
FT                   AAANQIETNPKLFKALGAQVYSKFIKGIQNYKGENKLGVFKALARGASKMNGLNIHFAF
FT                   LDELHAYPDRLTYDVIVSGAKKRDQSLVLAASTAGLNLDSFGYEDYCYARSVLRQEFDQ
FT                   QDEQFFSCVWEADEGDDPYSEATWEKANPCWNSAIDQLSFRAEAASAKRIPSKRREFFT
FT                   KNLNQWLSSGTTWLDMDAVKACYDPDIEEDDDYDFGITGIDLGSRSDLCVYTNVFVNTI
FT                   DEQLHYYVFPHPYTSEGFLEKNISSQFRAWQNDGWLTVHKGNAVSSISFQKDLLENYEN
FT                   LDILEYAFDRNQANYTMETCSEEGIEVISIGQNAETLSEATSEFEIAILENRIHFKNPM
FT                   FLHHCANSHIFTTIDGYMKPIKESRNSNNKIDIVASTVNAIARCLWNQSNQVMAPGVIA
FT                   SIQILNKR"
FT   gene            630173..631264
FT                   /locus_tag="Gdia_0564"
FT   CDS_pept        630173..631264
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0564"
FT                   /product="Baseplate J family protein"
FT                   /note="PFAM: Baseplate J family protein; KEGG:
FT                   bph:Bphy_1870 baseplate J family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50357"
FT                   /db_xref="InterPro:IPR006949"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZDC4"
FT                   /protein_id="ACI50357.1"
FT                   /translation="MFQYPNYSTINQRINSAIAQACGNQPLPGSVLNAVSKAIAKELSY
FT                   QYGYLDYISLQGVPFTATGTILENWGSLKGVVRDSAVAASGSITFSGTADTDIPAGSVI
FT                   TRNSDGLTFTTTASGVVGSPVPIVASQTGVIGNTASGSGFTLSVAISGVSPSLTLTSNI
FT                   TSGTDIETDDALRSRILAAFSTIPSGGTPTDHVNWLLEVPGVEQAWCAPVPVQGNVVVC
FT                   YIMMSPTNGNNGFPNGTDGVSSSDPRLPAATGDQLIAANATFSLRPIGETMYISAPVPY
FT                   PINITISGISNASAAQKSSISAALSNYLYSSGDPLGTSIYTTSLANVVEAAYGSSSFTL
FT                   LSPADTVAIAQGGWPTLGTITYS"
FT   gene            631271..631651
FT                   /pseudo
FT                   /locus_tag="Gdia_0565"
FT   gene            631882..632538
FT                   /locus_tag="Gdia_0566"
FT   CDS_pept        631882..632538
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0566"
FT                   /product="peptidase U35 phage prohead HK97"
FT                   /note="PFAM: peptidase U35 phage prohead HK97; KEGG:
FT                   eba:ebA5486 conserved hypothetical protein, putative major
FT                   phage head protein/prohead proteinase"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0566"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50358"
FT                   /db_xref="InterPro:IPR006433"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZDC5"
FT                   /protein_id="ACI50358.1"
FT                   /translation="MARTKYTLKEYKRNVDELNGRGDVSVMKDFIFSISDSNENTATFI
FT                   ITTPETDRANDNVITSGIDVSNYLNNPVVLWGHDDEDFPIGKCISLDKNSDRIIATVKF
FT                   ADFSTPIAGVRAACVHSLITQGILNAVSIGFRPIESYFNDDGGFVIEKSELLEFSVVNI
FT                   PCHQDALILDHTSEDTDSEESVLDESVEDDSPAEEEISQNEREKQLRIRRRLRDL"
FT   gene            632888..633166
FT                   /locus_tag="Gdia_0567"
FT   CDS_pept        632888..633166
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0567"
FT                   /product="lysozyme"
FT                   /note="KEGG: stm:STM1028 lysozyme"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0567"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50359"
FT                   /db_xref="GOA:B5ZDC6"
FT                   /db_xref="InterPro:IPR002196"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZDC6"
FT                   /protein_id="ACI50359.1"
FT                   /translation="MAQMAPEVVSLQNEITTACMPQILTDSQLTALTSFAYNVGFDAFR
FT                   GSTLHRFILAGNMTGAAGQFVLWDKADGEVVQGLLDRRIKERDIFLS"
FT   gene            633775..634878
FT                   /locus_tag="Gdia_0568"
FT   CDS_pept        633775..634878
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0568"
FT                   /product="Mu-like protein prophage tail protein gpP-like
FT                   protein"
FT                   /note="KEGG: bxe:Bxe_A3050 putative bacteriophage tail
FT                   protein GpP,Mu-like"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0568"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50360"
FT                   /db_xref="InterPro:IPR023399"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZDC7"
FT                   /protein_id="ACI50360.1"
FT                   /translation="MLVGNYNFETNIESFSISNSLSTLPSTFSARFYLEHPVDFRGSSV
FT                   VIKLNGSVAFKGVVNWMRISRSTESNVYEMGGRSLLWNMFDCSVQNLPGSFQFFSLEQL
FT                   ANTLCSPYNITVSSDGVSSTTSSPSGLTANLSFGSSPYNEIMKWSGFFGKILVDNLGTL
FT                   QITDVNTTSTPIDLNVHNIKDAEIEMHNDNLFNVIDVSQVVNGIGVTGEKAFYGSASMT
FT                   YQPNGYLTPISGNVSRVKYIYNDSNYTSAKPGTQITDGQYQSFSQNYAQWVLNRSMGES
FT                   QVLRVVVPSAFCDSAQTSLWAVNSLVNVNLPDLLTNNQTLLVESIDFSYSFVSGSNTTL
FT                   SLMQSSAFEPQPSPGYQGASLYVNVSN"
FT   gene            635447..638242
FT                   /locus_tag="Gdia_0569"
FT   CDS_pept        635447..638242
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0569"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rbo:A1I_04370 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0569"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50361"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR025195"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZDC8"
FT                   /protein_id="ACI50361.1"
FT                   /translation="MGAWADSVVKDIQSIQVCGDLQEVEAEIKNILSAQEAALQQMITS
FT                   LESYLPLLSLPGADPVSIVNWLKQLILGTVNPYIVAFQSAMNTIDGVAGDVSEISEAIA
FT                   SKIAELGSCTSSFDAAALVISAEILSAAQASLTDAQNQISSIEASIASEPTGGSSPATT
FT                   LNDVAADLSVLTENVLSCEATKYADTLMITVFNEFDLDTEVQISTYDTPFNGTIDFYIK
FT                   NIEAGSCSANFPYMVKNDLSHLPNIETLMIWTQWFSLCPDSTGNNPGLVQPAINSTIAA
FT                   ELSSVSQWFAGGIYASSAVKLNGTAGGTANDASMIRGMQYLVSRGYNVGFAPIVLGWNN
FT                   AQGLSDSAALIWRGYFTWTETSDFQSWMTSYIAFNQYYIDLFQTNGVIPTRWAVGSEFA
FT                   DLTTNAPPDQWGIFVQGLQSIASSVRAAFPNCTITYAANYTDYGVGGGFRCDALWSHPD
FT                   IDEVGIDWYFPLTTDVSASPSDIRGGLVAGEDIDYTYNLSDGSQRTITGSKGVGKTLET
FT                   QIPIAASAGIKNVKVFWEGCHYVSKASGFMAGATSLAGYGPDFDPYGLPGLTGTAAPVV
FT                   APGLTAPGVSGQQITPRDTDTYLPTDGKSTYGTFQTPTFTPASLQTQWTLDTMLQVMTI
FT                   PSQNYARLFECAGVFELMIDTSSGGGFKIGIGPSSNEFFITLGEVDNNIHNLSVSFTPS
FT                   TYSLTIVWDGVSSQYTVSSASVMEIPSDTSVYLGGYNTNTNLVAANFYTFGMTFIQDGI
FT                   TYGGTFHFDEAYAGTRTSWVPKMKVLSATELGFASISGTSVEPNEFPYADLGSPTIAVP
FT                   ATLNSITQSLYNSFISKGWNPTEVYAAYGCSFNYAPDEQAYALNETLKRLQVLRNNGAF
FT                   SAITLYNMDARPAQAMTILVNDKIYYTDAPLAVFNHSLGGKLAGGSTFFDQKIIQNGSI
FT                   F"
FT   gene            638299..638598
FT                   /locus_tag="Gdia_0570"
FT   CDS_pept        638299..638598
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0570"
FT                   /product="addiction module killer protein"
FT                   /note="TIGRFAM: addiction module killer protein; PFAM:
FT                   protein of unknown function DUF891; KEGG: maq:Maqu_2671
FT                   protein of unknown function DUF891"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0570"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50362"
FT                   /db_xref="InterPro:IPR009241"
FT                   /db_xref="InterPro:IPR014056"
FT                   /db_xref="InterPro:IPR035093"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZDC9"
FT                   /protein_id="ACI50362.1"
FT                   /translation="MKYEIIWSGQVQKWFRKIRDQRASAAIFERIRRIEELGLFGDVKP
FT                   VGEGVHEIRVDHGIGYRVYFTTQGGKLVILLVGGDKRTQAGDIQKAKRMKKDWT"
FT   gene            638595..638768
FT                   /locus_tag="Gdia_0571"
FT   CDS_pept        638595..638768
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0571"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0571"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50363"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZDD0"
FT                   /protein_id="ACI50363.1"
FT                   /translation="MKKGYSRFDAVEELVRNPDLRAGVMAAAKESDDPRMVEIIRKDVA
FT                   RAEAIVAEGMAD"
FT   gene            638931..639563
FT                   /locus_tag="Gdia_0572"
FT   CDS_pept        638931..639563
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0572"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0572"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50364"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZDD1"
FT                   /protein_id="ACI50364.1"
FT                   /translation="MDLQTVDQCIQAGRDALLFGSAAKDFIPEWVKEKFKGKFKQLQVE
FT                   KNIENTLTLAKGKMGDRKQDSHTSFKVIEEVLEACSDEDRTELQELWAALLARIATGEG
FT                   RSITKEIISIVKSFEPIDALVLKTCDVVGRTQFNAHSLYQHIVTNVPSGSQYHLGDITA
FT                   SCRRLFQSECFDYVQKGIDPTQRFTADRPLQLAYQGANILRVVGDIG"
FT   gene            complement(640165..640974)
FT                   /locus_tag="Gdia_0573"
FT   CDS_pept        complement(640165..640974)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0573"
FT                   /product="transglutaminase domain protein"
FT                   /note="PFAM: transglutaminase domain protein; KEGG:
FT                   gdi:GDI2327 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0573"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50365"
FT                   /db_xref="InterPro:IPR002931"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZDD2"
FT                   /protein_id="ACI50365.1"
FT                   /translation="MLIRAGYDIALTVQVPTPLVLMLEVHPDREPDLMTPQIPVFDPPV
FT                   PAQRYLDGFGNRCTRVVAPVGTLRTSMSFVIADSGLPDRQMPWAREVPVADLPADCLVF
FT                   LMGSRYCETDLLSPVAWSLFGHLAPGWGRVQAIVSFVHNHIRFDYAHARPTRSAYEAYN
FT                   EGVGVCRDFAHLAVTLCRCMNIPARYCTGYLGDIGIPPVDYPMDFSAWFEVWLDGQWFT
FT                   FDARHNTPRIGRVVMARGRDATDVALTTSFGPSILSGFSVTTYEEIG"
FT   gene            complement(641132..641503)
FT                   /locus_tag="Gdia_0574"
FT   CDS_pept        complement(641132..641503)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0574"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gdi:GDI2328 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0574"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50366"
FT                   /db_xref="InterPro:IPR027405"
FT                   /db_xref="UniProtKB/TrEMBL:A9HM78"
FT                   /protein_id="ACI50366.1"
FT                   /translation="MSITNSATNLGTTLGDFLTGARYDLSGLTSAINEYLDGVRREYGP
FT                   NGFAERAEAAGYGDIVARWKADDKTGPMTEDMVRTLIVPNDLEWFAGQTGLSDRAVVMI
FT                   LAKQLPIVVYKRAHAVVPH"
FT   gene            complement(641833..642579)
FT                   /locus_tag="Gdia_0575"
FT   CDS_pept        complement(641833..642579)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0575"
FT                   /product="putative periplasmic ligand-binding sensor
FT                   protein"
FT                   /note="KEGG: gdi:GDI2329 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0575"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50367"
FT                   /db_xref="InterPro:IPR018648"
FT                   /db_xref="UniProtKB/TrEMBL:A9HM79"
FT                   /protein_id="ACI50367.1"
FT                   /translation="MNNEERDLITKFVARVGGAPQGGFGSVPATAPNLPPIDPEADNYI
FT                   GQMFQQYPEARYRVTQMAVVQEAALVQAQNRIQQLQWQLQQAQQALQARQQAPSGGGGL
FT                   FGGLFGGGQRPQAAPPPGWGGQQAAPPPPQPAYPPGMQPGMFPARGSGFLGSALTTAAG
FT                   VAGGMMVGNALTDLFSGHHDAGGFGGGMPGGETIINNNYGDAGAPGADPFGGAGGAVDP
FT                   GFDAGGDAGGDAGFGGGDWGGGDDNF"
FT   gene            642794..643681
FT                   /locus_tag="Gdia_0576"
FT   CDS_pept        642794..643681
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0576"
FT                   /product="glycyl-tRNA synthetase, alpha subunit"
FT                   /EC_number="6.1.1.14"
FT                   /note="KEGG: gdi:GDI2331 glycyl-tRNA synthetase alpha
FT                   chain; TIGRFAM: glycyl-tRNA synthetase, alpha subunit;
FT                   PFAM: glycyl-tRNA synthetase alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0576"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50368"
FT                   /db_xref="GOA:B5ZDD5"
FT                   /db_xref="InterPro:IPR002310"
FT                   /db_xref="InterPro:IPR006194"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZDD5"
FT                   /protein_id="ACI50368.1"
FT                   /translation="MVPAPAPRPPATRPLSFQALILKLHQFWSEQGCAILQPYDTEVGA
FT                   GTLSPHTTLRALGARPWKAAYVQPCRRPSDGRYGENPNRLQHYYQYQVLLKPTPEDSQK
FT                   LLLDSYRAIGIDPMEHDIRFVEDDWENPTIGAWGLGWEVWCDGMEVTQFTYFQQVGGIP
FT                   TVMPSTELTYGLERLAMYVQGIENVYDLDFNGQGLTYGDVFLRAERDYSRHNFELADTE
FT                   MLHRHFIDAEREAIALVEYGVAQPAYDQCLKASHLFNLLDARGVISVSERASYIGRVRT
FT                   LARRCCDAWLAGEE"
FT   gene            643685..645745
FT                   /locus_tag="Gdia_0577"
FT   CDS_pept        643685..645745
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0577"
FT                   /product="glycyl-tRNA synthetase, beta subunit"
FT                   /EC_number="6.1.1.14"
FT                   /note="KEGG: gdi:GDI2332 glycyl-tRNA synthetase beta chain
FT                   (glycine--tRNA LigAs beta chain) (GlyRS); TIGRFAM:
FT                   glycyl-tRNA synthetase, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0577"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50369"
FT                   /db_xref="GOA:B5ZDD6"
FT                   /db_xref="InterPro:IPR006194"
FT                   /db_xref="InterPro:IPR008909"
FT                   /db_xref="InterPro:IPR015944"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZDD6"
FT                   /protein_id="ACI50369.1"
FT                   /translation="MPELLLELFSEEIPARMQARAAEDLVRLVTDALAPLNPRDARGFS
FT                   GPRRIALTLTLDGVVPGTTVAERGPREGAPEKALAGFTRKHGVTPADLVLEDGFWVLNR
FT                   TVPPVEAATRIAEALPPLLRRFPWPKSMRWGEGSGFTWVRPLRRILCLLDGETVAFSLA
FT                   DGEDDGHGLRADRLTEGHRFTAPGAFAVTDAAAWRDGLRARQVLVDAAERRALIEEGTT
FT                   RLAAEEGLRIVPDPGLVDEVAGLTEWPVPFLGRIDETFMDLPREVMQVSMRVNQRYFAL
FT                   INDDGSAAPRFAFVANLLPEDGGALTIAGNERVLRARFADARHFWDLDRARTLASRVGA
FT                   LDAITFHAALGSQGARVQRIVRLAGLLAPMVGADPAQAERAALLAKADLTTGMVGEFPE
FT                   LQGVMGAYYARHDGEADPVATAIAEHYMPRGQNDGVPAAPVSIAVALADKIDSLAAFFA
FT                   AGEKPGGSGDPYALRRAALGVIRIIRENALRLDLVKLFVLAAEALPETLRDAPDLALLP
FT                   GFVAERLRVQLRAEGARHDILAAISSGNEDSDITRLLARTDALAAMLATDDGQNLLAAT
FT                   RRAANILRIEDRKDGPHDGAPDPTLYEQPEERELANALLDVIPAVETTIAAERFEDAMR
FT                   DAARLRPVLDRFFDAVTVNADRADLRANRLRLLAELRRMTVLIADFSQIEG"
FT   gene            complement(645726..646151)
FT                   /locus_tag="Gdia_0578"
FT   CDS_pept        complement(645726..646151)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0578"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: dra:DR_1989 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0578"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50370"
FT                   /db_xref="InterPro:IPR021710"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZDD7"
FT                   /protein_id="ACI50370.1"
FT                   /translation="MTGLRPVDPATARAYRLSLYRAGGLSVRTGRRPVPDDDAGAWWRR
FT                   GDILFISASNPGGGRRPDGWNHRMMRHLAASLPGVTLHAGEGRLGRWSEPLFAVALPLA
FT                   RGQVVARRFRQNAILLVRNGRPARLLFLAPVLTPRSG"
FT   gene            complement(646148..647302)
FT                   /locus_tag="Gdia_0579"
FT   CDS_pept        complement(646148..647302)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0579"
FT                   /product="rod shape-determining protein RodA"
FT                   /note="TIGRFAM: rod shape-determining protein RodA; PFAM:
FT                   cell cycle protein; KEGG: gdi:GDI2333 putative rod
FT                   shape-determining protein MerD"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0579"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50371"
FT                   /db_xref="GOA:B5ZDD8"
FT                   /db_xref="InterPro:IPR001182"
FT                   /db_xref="InterPro:IPR011923"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZDD8"
FT                   /protein_id="ACI50371.1"
FT                   /translation="MNFQKRLLRAEPNFRILAKLWQVNWLYVLLICVLAGVGYGALYSA
FT                   AGGSSRPFAGPQTIRFAFGMVMMICVALTSPRVLVRLAWPLYGLSLLLLVAVLRMGHVG
FT                   KGAERWLIIGGMQVQPSELAKIALVLVLATWFHRISYRRMVNPLYLLPPALMVLLPVGL
FT                   VLKEPNLGTAVIIGVVGATIFFAAGMRLWQIVLLLAPLPLLGKFAYAHLHDYQKARITT
FT                   FLHPESDPLGAGYNIIQSKIALGSGGMWGQGYLHGTQGQLNFLPEKQTDFIFTMIAEEW
FT                   GYVGGIVVIGLLMLMVLGGMLIALRSRNQFGRLLGLGIATNFFLYCAVNLSMVMGTIPV
FT                   GGVPLPLISYGGSAMLTVMFGFGLLLSAWVHRNSTFGEAASDPS"
FT   sig_peptide     complement(647162..647302)
FT                   /locus_tag="Gdia_0579"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.882) with cleavage site probability 0.471 at
FT                   residue 47"
FT   gene            complement(647342..649246)
FT                   /locus_tag="Gdia_0580"
FT   CDS_pept        complement(647342..649246)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0580"
FT                   /product="penicillin-binding protein 2"
FT                   /EC_number="2.4.1.129"
FT                   /note="KEGG: gdi:GDI2334 putative cell elongation specific
FT                   D,D-transpeptidase; TIGRFAM: penicillin-binding protein 2;
FT                   PFAM: penicillin-binding protein transpeptidase;
FT                   Penicillin-binding protein dimerisation domain"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0580"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50372"
FT                   /db_xref="GOA:A9HM91"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR005311"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR017790"
FT                   /db_xref="InterPro:IPR036138"
FT                   /db_xref="UniProtKB/TrEMBL:A9HM91"
FT                   /protein_id="ACI50372.1"
FT                   /translation="MIRRRKTATRLMSRPDTGNPSRGVFTRRALVVLGAQMAALGALGH
FT                   RLYGLQVLDGDHYAKLAENNRVNRSLIAPPRGRVVDRFGIAVASNKVNWRALLLPEDTS
FT                   DISGTLDRFSALVPIEARDRARIEREMRHKRRFIPIMLHDFLSWDDMARIELNAPSLPG
FT                   VLIDVGTTRNYPFGPLMAHVVGYVAPPGEKDVTADATMALPGMRIGRSGIEQTQDTLLR
FT                   GQVGAVEIEVNAVGRVMAELSRDDGQAGDEITLTIDSGLQQAVLGRIADQSASAVVMDC
FT                   RNGEVLAMVSNPSFDPSLFDSGVSQAQWVEWTNNQGTPLINKAVAGVYPPGSTFKPAVA
FT                   MAALQAGTLSPTDRIFCPGYLDVGGTRFHCWSRYGHGSLTLKDGLKFSCDVFFYEAARR
FT                   TGMDAIAAASHAFGLGTHLDIELPHTRQGLIPTPDWRRAHGQHWNGGDTIVSGIGQGFV
FT                   QVTPLQLATYASRIASGRAVQPHLVRAVAGKLAEGTDPTHWPALGMPDPFLGQLRAGMF
FT                   AVINEEHGTAPKARLDIPGVQMAGKTGSAQVRRVSRALRESGHFDSSALPWEYRPHALF
FT                   ICYAPYDAPRYAVSVVVEHGNAGAAVAAPLARDIMTDALTRDPANRKEPPGQVVADIE"
FT   sig_peptide     complement(649112..649246)
FT                   /locus_tag="Gdia_0580"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.614) with cleavage site probability 0.428 at
FT                   residue 45"
FT   gene            complement(649302..649865)
FT                   /locus_tag="Gdia_0581"
FT   CDS_pept        complement(649302..649865)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0581"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gdi:GDI2335 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0581"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50373"
FT                   /db_xref="GOA:B5ZDE0"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZDE0"
FT                   /protein_id="ACI50373.1"
FT                   /translation="MTPDQSPALQPGIQPRASLWRRLDVLSRRGLPGALTGLAILLLSA
FT                   PFNLPGQAELLPGVVLSSVFFWTIFRPASMSSPLVFLLGLLVDLLGFGPPGVMLLVLLI
FT                   VHGVGMSARYGFARIHGLLLWLVFGGVSLGGTVLQWTLVSALSLRVMPVGAFVFQWTLG
FT                   LGVFPVLYAVFAAMARTIANPDRA"
FT   gene            complement(649878..650783)
FT                   /locus_tag="Gdia_0582"
FT   CDS_pept        complement(649878..650783)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0582"
FT                   /product="Rod shape-determining protein MreC"
FT                   /note="PFAM: Rod shape-determining protein MreC; KEGG:
FT                   gdi:GDI2336 putative rod shape-determining protein MreC"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0582"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50374"
FT                   /db_xref="GOA:A9HM95"
FT                   /db_xref="InterPro:IPR007221"
FT                   /db_xref="InterPro:IPR042175"
FT                   /db_xref="InterPro:IPR042177"
FT                   /db_xref="UniProtKB/TrEMBL:A9HM95"
FT                   /protein_id="ACI50374.1"
FT                   /translation="MIPLSIPLRQALDRLVLPLLIVAAVGIMLLGQADRGLTERVRMSV
FT                   ADILAPAYGLIVWPQEKFHGLFGRMRDMGRMEAENQRLRLENANLRHWYDVAAALADEN
FT                   AALKANLHWMPDPAPSFVTGRVVRDTSGLYARSVLVAANVDAGIHKDEIVLDASGLVGR
FT                   VTEVGARSVRVLLVTDASSRIPVTLEVSHGAAIMAGDNSGTPRLIYYPQDTPPIEGERV
FT                   VTNGEIDSLPPGLPVGRVHYPRAGQPVIVPAASLEHLDIVRVFDYGRSAVVAPDAPGRV
FT                   PLLRPGSILSVPFQSPLGRG"
FT   gene            complement(650921..651967)
FT                   /locus_tag="Gdia_0583"
FT   CDS_pept        complement(650921..651967)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0583"
FT                   /product="cell shape determining protein, MreB/Mrl family"
FT                   /note="TIGRFAM: cell shape determining protein, MreB/Mrl
FT                   family; PFAM: cell division protein FtsA; cell shape
FT                   determining protein MreB/Mrl; KEGG: gdi:GDI2337 putative
FT                   rod shape-determining protein MreB"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0583"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50375"
FT                   /db_xref="GOA:B5ZDE2"
FT                   /db_xref="InterPro:IPR004753"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZDE2"
FT                   /protein_id="ACI50375.1"
FT                   /translation="MFARLLGLLSADMAIDLGTANTLVYVKGRGVVLNEPSVVAIAEVR
FT                   GKKMVLAVGEEAKQMVGRTPGNITAIRPLRDGVIADFEVAEEMIKHFIRKVHNRRMFAS
FT                   PLIIVCVPSGSTAVERRAIQESAESAGARKVFLIEEPMAAAIGAGLPVTEPSGSMIVDI
FT                   GGGTTEVAVISLGGIVYARSARVGGDKMDEAIISYIRRNHNLLIGESSAERIKIELGSA
FT                   LPPDDLEDYGGWREVKGRDLINGVPREVVVSQAQIAESLAEPVSQIVDAVTTALENTPP
FT                   ELAADIVDKGIVLTGGGALLYRLDEVLRRATGLPVTVGEDALSCVALGTGRALEEMKRL
FT                   KNVLTSMY"
FT   gene            652331..652618
FT                   /locus_tag="Gdia_0584"
FT   CDS_pept        652331..652618
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0584"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gdi:GDI2338 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0584"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50376"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZDE3"
FT                   /protein_id="ACI50376.1"
FT                   /translation="MKIRMHAPTSTQTRHRTLVRSALAGAGLLALAGCGNPYDPGARAG
FT                   TGALIGAGGGAAIGGLAGGGGGAAIGALTGGAVGAATGAATTPPPPRRGY"
FT   sig_peptide     652331..652438
FT                   /locus_tag="Gdia_0584"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.950) with cleavage site probability 0.632 at
FT                   residue 36"
FT   gene            652652..653092
FT                   /locus_tag="Gdia_0585"
FT   CDS_pept        652652..653092
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0585"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: acr:Acry_0749 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0585"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50377"
FT                   /db_xref="GOA:B5ZDE4"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZDE4"
FT                   /protein_id="ACI50377.1"
FT                   /translation="MTTFLLRSLSPRADSTIHRRVRVAGAMAVLGAALSLAACTNPYDP
FT                   GQRALGGGLLGAGGGAAIGGLAGGGRGAALGALAGGAVGAATGAATTPAPPPPPPAYPP
FT                   PGYPPPGYGYGGYAQPAYPPQGYPQGYYPPPPNDGGGYYNGY"
FT   sig_peptide     652652..652768
FT                   /locus_tag="Gdia_0585"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.684 at
FT                   residue 39"
FT   gene            complement(653167..654741)
FT                   /locus_tag="Gdia_0586"
FT   CDS_pept        complement(653167..654741)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0586"
FT                   /product="2-isopropylmalate synthase"
FT                   /note="TIGRFAM: 2-isopropylmalate synthase; PFAM: pyruvate
FT                   carboxyltransferase; LeuA allosteric (dimerisation) domain;
FT                   KEGG: gdi:GDI2339 2-isopropylmalate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0586"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50378"
FT                   /db_xref="GOA:A9HMA2"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR002034"
FT                   /db_xref="InterPro:IPR005671"
FT                   /db_xref="InterPro:IPR013709"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR036230"
FT                   /db_xref="UniProtKB/TrEMBL:A9HMA2"
FT                   /protein_id="ACI50378.1"
FT                   /translation="MTIDHPSFGRIDNDRVIIFDTTLRDGEQSPGFSMNLAEKLRMAEA
FT                   LAELGVDVIEAGFPVASKGDFDSVHQIASHIRAPVICALARSGGRNDIASAGEAIRPAA
FT                   RGRIHNFISTSPLHMKYKLRMEPETVLELITAGNQAARQFTDDVEWSAEDGSRTDPDFL
FT                   CRCVEAAIKAGATTINIPDTVGYATPEDMARIFADLLARVPGADTVIFSAHNHNDLGLG
FT                   VANTIASLSAGARQIECTINGIGERAGNAALEEIVMALRTRQDVLPYSTGIKTQNLLRT
FT                   SRMLATITGFDVQPNKAIVGRNAFAHESGIHQDGVLKNAATYEIMTPESVGWTRSSLVL
FT                   GKHSGRAAFRDKLKAMGYGEMDEAHLNDAFARFKDLADRKKVVYDEDLVALVDDEARDH
FT                   ARIRFVSLDIEAGSRRPARADLALEVDGEARSATVTGQGPVDAAFNAVREIFPHEATLQ
FT                   LYSVGAVTEGSDAQARTTVRLEEDGKLVDGQGADSDTLVSAVRAYVHALNKLLVKRTRA
FT                   EPEAMTA"
FT   gene            complement(655045..655605)
FT                   /locus_tag="Gdia_0587"
FT   CDS_pept        complement(655045..655605)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0587"
FT                   /product="Chloramphenicol phosphotransferase family
FT                   protein"
FT                   /note="PFAM: Chloramphenicol phosphotransferase family
FT                   protein; KEGG: gdi:GDI2340 putative chloramphenicol 3-O
FT                   phosphotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0587"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50379"
FT                   /db_xref="GOA:A9HMA5"
FT                   /db_xref="InterPro:IPR012853"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A9HMA5"
FT                   /protein_id="ACI50379.1"
FT                   /translation="MDRPPCVIILNGVGSVGKSSVARALQGLLDRPFLHVAMDDFVSML
FT                   PPRMLDHPDGMQFVPETRDGHPSIAIRGGAVMARAMRGMRHAVAAMAGQGNDLIVDDVM
FT                   LDAADARDYRALLAGCVVHLVGLFAPLAILEARERARGDRRIGLARWQYDRVHRGMAYD
FT                   LELDTVRMTPGQSAHSIRDAFGL"
FT   gene            complement(655609..656508)
FT                   /locus_tag="Gdia_0588"
FT   CDS_pept        complement(655609..656508)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gdia_0588"
FT                   /product="N-acetylmuramoyl-L-alanine amidase"
FT                   /EC_number="3.5.1.28"
FT                   /note="PFAM: cell wall hydrolase/autolysin; KEGG:
FT                   gdi:GDI2341 putative N-acetylmuramoyl-L-alanine amidase
FT                   AmiA precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Gdia_0588"
FT                   /db_xref="EnsemblGenomes-Tr:ACI50380"
FT                   /db_xref="GOA:B5ZDP6"
FT                   /db_xref="InterPro:IPR002508"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZDP6"
FT                   /protein_id="ACI50380.1"
FT                   /translation="MHEDRSDNVTARGRRQVLRAGLSATGLAAALAVRPRVASAAQRRV
FT                   AHHARHAAGLAAPAIVGRAAAPLPLVMLDPGHGGKDPGAIGVSGTYEKHIAEAAAAELR
FT                   RQLLASGAYRVAMTRSDDRFIPLEGRVDIAHAHRAALFISMHADALTDRGVRGASVYTL
FT                   SGQASDAQTAALARTENSADRFGGPQVHASSPEVQAILASLVTEETRRGAAHMASSVVA
FT                   SFQSRIGLLPHPSRHAAFVVLKSADIPSVLVEMGFMSNRMDEAALRQAGHRMMVAGAMK
FT                   QAIDRYFASANGITHLTG"
FT   gene            657134..660163
FT                   /locus_tag="Gdia_0589"
FT   CDS_pept        657134..660163
FT                   /codon_start=1
FT                   /transl_table=11
FT