(data stored in ACNUC28527 zone)

EMBL: CP001191

ID   CP001191; SV 1; circular; genomic DNA; STD; PRO; 4537948 BP.
XX
AC   CP001191; ABKO01000000-ABKO01000027;
XX
PR   Project:PRJNA20179;
XX
DT   18-OCT-2008 (Rel. 97, Created)
DT   11-SEP-2019 (Rel. 142, Last updated, Version 5)
XX
DE   Rhizobium leguminosarum bv. trifolii WSM2304 chromosome, complete genome.
XX
KW   .
XX
OS   Rhizobium leguminosarum bv. trifolii WSM2304
OC   Bacteria; Proteobacteria; Alphaproteobacteria; Rhizobiales; Rhizobiaceae;
OC   Rhizobium/Agrobacterium group; Rhizobium.
XX
RN   [1]
RC   Publication Status: Online-Only
RP   1-4537948
RX   DOI; 10.4056/sigs.44642.
RX   PUBMED; 21304679.
RA   Reeve W., O'Hara G., Chain P., Ardley J., Brau L., Nandesena K., Tiwari R.,
RA   Malfatti S., Kiss H., Lapidus A., Copeland A., Nolan M., Land M.,
RA   Ivanova N., Mavromatis K., Markowitz V., Kyrpides N., Melino V., Denton M.,
RA   Yates R., Howieson J.;
RT   "Complete genome sequence of Rhizobium leguminosarum bv trifolii strain
RT   WSM2304, an effective microsymbiont of the South American clover Trifolium
RT   polymorphum";
RL   Stand Genomic Sci 2(1):66-76(2010).
XX
RN   [2]
RP   1-4537948
RG   US DOE Joint Genome Institute
RA   Lucas S., Copeland A., Lapidus A., Glavina del Rio T., Dalin E., Tice H.,
RA   Pitluck S., Chain P., Malfatti S., Shin M., Vergez L., Lang D., Larimer F.,
RA   Land M., Hauser L., Kyrpides N., Mikhailova N., Yates R., Ardley J.,
RA   Tiwari R.P., O'Hara G., Howieson J., Brau L., Reeve W.;
RT   "Complete sequence of chromosome of Rhizobium leguminosarum bv. trifolii
RT   WSM2304";
RL   Unpublished.
XX
RN   [3]
RP   1-4537948
RG   US DOE Joint Genome Institute
RA   Lucas S., Copeland A., Lapidus A., Glavina del Rio T., Dalin E., Tice H.,
RA   Pitluck S., Chain P., Malfatti S., Shin M., Vergez L., Lang D., Larimer F.,
RA   Land M., Hauser L., Kyrpides N., Mikhailova N., Yates R., Ardley J.,
RA   Tiwari R.P., O'Hara G., Howieson J., Brau L., Reeve W.;
RT   ;
RL   Submitted (13-OCT-2008) to the INSDC.
RL   US DOE Joint Genome Institute, 2800 Mitchell Drive B100, Walnut Creek, CA
RL   94598-1698, USA
XX
DR   MD5; 672bec7fd22855ed88d263c5f5252b1d.
DR   BioSample; SAMN00000679.
DR   EnsemblGenomes-Gn; EBG00000998715.
DR   EnsemblGenomes-Gn; EBG00000998716.
DR   EnsemblGenomes-Gn; EBG00000998717.
DR   EnsemblGenomes-Gn; EBG00000998718.
DR   EnsemblGenomes-Gn; EBG00000998719.
DR   EnsemblGenomes-Gn; EBG00000998720.
DR   EnsemblGenomes-Gn; EBG00000998721.
DR   EnsemblGenomes-Gn; EBG00000998722.
DR   EnsemblGenomes-Gn; EBG00000998723.
DR   EnsemblGenomes-Gn; EBG00000998724.
DR   EnsemblGenomes-Gn; EBG00000998725.
DR   EnsemblGenomes-Gn; EBG00000998726.
DR   EnsemblGenomes-Gn; EBG00000998727.
DR   EnsemblGenomes-Gn; EBG00000998728.
DR   EnsemblGenomes-Gn; EBG00000998729.
DR   EnsemblGenomes-Gn; EBG00000998730.
DR   EnsemblGenomes-Gn; EBG00000998731.
DR   EnsemblGenomes-Gn; EBG00000998732.
DR   EnsemblGenomes-Gn; EBG00000998733.
DR   EnsemblGenomes-Gn; EBG00000998734.
DR   EnsemblGenomes-Gn; EBG00000998735.
DR   EnsemblGenomes-Gn; EBG00000998736.
DR   EnsemblGenomes-Gn; EBG00000998737.
DR   EnsemblGenomes-Gn; EBG00000998738.
DR   EnsemblGenomes-Gn; EBG00000998739.
DR   EnsemblGenomes-Gn; EBG00000998740.
DR   EnsemblGenomes-Gn; EBG00000998741.
DR   EnsemblGenomes-Gn; EBG00000998742.
DR   EnsemblGenomes-Gn; EBG00000998743.
DR   EnsemblGenomes-Gn; EBG00000998744.
DR   EnsemblGenomes-Gn; EBG00000998745.
DR   EnsemblGenomes-Gn; EBG00000998746.
DR   EnsemblGenomes-Gn; EBG00000998747.
DR   EnsemblGenomes-Gn; EBG00000998748.
DR   EnsemblGenomes-Gn; EBG00000998749.
DR   EnsemblGenomes-Gn; EBG00000998750.
DR   EnsemblGenomes-Gn; EBG00000998751.
DR   EnsemblGenomes-Gn; EBG00000998752.
DR   EnsemblGenomes-Gn; EBG00000998753.
DR   EnsemblGenomes-Gn; EBG00000998754.
DR   EnsemblGenomes-Gn; EBG00000998755.
DR   EnsemblGenomes-Gn; EBG00000998756.
DR   EnsemblGenomes-Gn; EBG00000998757.
DR   EnsemblGenomes-Gn; EBG00000998758.
DR   EnsemblGenomes-Gn; EBG00000998759.
DR   EnsemblGenomes-Gn; EBG00000998760.
DR   EnsemblGenomes-Gn; EBG00000998761.
DR   EnsemblGenomes-Gn; EBG00000998762.
DR   EnsemblGenomes-Gn; EBG00000998763.
DR   EnsemblGenomes-Gn; EBG00000998764.
DR   EnsemblGenomes-Gn; EBG00000998765.
DR   EnsemblGenomes-Gn; EBG00000998766.
DR   EnsemblGenomes-Gn; EBG00000998767.
DR   EnsemblGenomes-Gn; EBG00000998768.
DR   EnsemblGenomes-Gn; EBG00000998769.
DR   EnsemblGenomes-Gn; EBG00000998770.
DR   EnsemblGenomes-Gn; EBG00000998771.
DR   EnsemblGenomes-Gn; EBG00000998772.
DR   EnsemblGenomes-Gn; EBG00000998773.
DR   EnsemblGenomes-Gn; EBG00000998774.
DR   EnsemblGenomes-Gn; EBG00000998775.
DR   EnsemblGenomes-Gn; EBG00000998776.
DR   EnsemblGenomes-Gn; EBG00000998777.
DR   EnsemblGenomes-Gn; EBG00000998778.
DR   EnsemblGenomes-Gn; EBG00000998779.
DR   EnsemblGenomes-Gn; EBG00000998780.
DR   EnsemblGenomes-Gn; EBG00000998781.
DR   EnsemblGenomes-Gn; EBG00000998782.
DR   EnsemblGenomes-Gn; EBG00000998783.
DR   EnsemblGenomes-Gn; EBG00000998784.
DR   EnsemblGenomes-Gn; EBG00000998785.
DR   EnsemblGenomes-Gn; EBG00000998786.
DR   EnsemblGenomes-Gn; EBG00000998787.
DR   EnsemblGenomes-Gn; EBG00000998788.
DR   EnsemblGenomes-Gn; EBG00000998789.
DR   EnsemblGenomes-Gn; EBG00000998790.
DR   EnsemblGenomes-Gn; EBG00000998791.
DR   EnsemblGenomes-Gn; EBG00000998792.
DR   EnsemblGenomes-Gn; EBG00000998793.
DR   EnsemblGenomes-Gn; EBG00000998794.
DR   EnsemblGenomes-Gn; EBG00000998795.
DR   EnsemblGenomes-Gn; EBG00000998796.
DR   EnsemblGenomes-Gn; EBG00000998797.
DR   EnsemblGenomes-Gn; EBG00000998798.
DR   EnsemblGenomes-Gn; EBG00000998799.
DR   EnsemblGenomes-Gn; EBG00000998800.
DR   EnsemblGenomes-Gn; EBG00000998801.
DR   EnsemblGenomes-Gn; EBG00000998802.
DR   EnsemblGenomes-Gn; EBG00000998803.
DR   EnsemblGenomes-Gn; Rleg2_R0001.
DR   EnsemblGenomes-Gn; Rleg2_R0002.
DR   EnsemblGenomes-Gn; Rleg2_R0003.
DR   EnsemblGenomes-Gn; Rleg2_R0004.
DR   EnsemblGenomes-Gn; Rleg2_R0005.
DR   EnsemblGenomes-Gn; Rleg2_R0006.
DR   EnsemblGenomes-Gn; Rleg2_R0007.
DR   EnsemblGenomes-Gn; Rleg2_R0008.
DR   EnsemblGenomes-Gn; Rleg2_R0009.
DR   EnsemblGenomes-Gn; Rleg2_R0010.
DR   EnsemblGenomes-Gn; Rleg2_R0011.
DR   EnsemblGenomes-Gn; Rleg2_R0012.
DR   EnsemblGenomes-Gn; Rleg2_R0013.
DR   EnsemblGenomes-Gn; Rleg2_R0014.
DR   EnsemblGenomes-Gn; Rleg2_R0015.
DR   EnsemblGenomes-Gn; Rleg2_R0016.
DR   EnsemblGenomes-Gn; Rleg2_R0017.
DR   EnsemblGenomes-Gn; Rleg2_R0018.
DR   EnsemblGenomes-Gn; Rleg2_R0019.
DR   EnsemblGenomes-Gn; Rleg2_R0020.
DR   EnsemblGenomes-Gn; Rleg2_R0021.
DR   EnsemblGenomes-Gn; Rleg2_R0022.
DR   EnsemblGenomes-Gn; Rleg2_R0023.
DR   EnsemblGenomes-Gn; Rleg2_R0024.
DR   EnsemblGenomes-Gn; Rleg2_R0025.
DR   EnsemblGenomes-Gn; Rleg2_R0026.
DR   EnsemblGenomes-Gn; Rleg2_R0027.
DR   EnsemblGenomes-Gn; Rleg2_R0028.
DR   EnsemblGenomes-Gn; Rleg2_R0029.
DR   EnsemblGenomes-Gn; Rleg2_R0030.
DR   EnsemblGenomes-Gn; Rleg2_R0031.
DR   EnsemblGenomes-Gn; Rleg2_R0032.
DR   EnsemblGenomes-Gn; Rleg2_R0033.
DR   EnsemblGenomes-Gn; Rleg2_R0034.
DR   EnsemblGenomes-Gn; Rleg2_R0035.
DR   EnsemblGenomes-Gn; Rleg2_R0036.
DR   EnsemblGenomes-Gn; Rleg2_R0037.
DR   EnsemblGenomes-Gn; Rleg2_R0038.
DR   EnsemblGenomes-Gn; Rleg2_R0039.
DR   EnsemblGenomes-Gn; Rleg2_R0040.
DR   EnsemblGenomes-Gn; Rleg2_R0041.
DR   EnsemblGenomes-Gn; Rleg2_R0042.
DR   EnsemblGenomes-Gn; Rleg2_R0043.
DR   EnsemblGenomes-Gn; Rleg2_R0044.
DR   EnsemblGenomes-Gn; Rleg2_R0045.
DR   EnsemblGenomes-Gn; Rleg2_R0046.
DR   EnsemblGenomes-Gn; Rleg2_R0047.
DR   EnsemblGenomes-Gn; Rleg2_R0048.
DR   EnsemblGenomes-Gn; Rleg2_R0049.
DR   EnsemblGenomes-Gn; Rleg2_R0050.
DR   EnsemblGenomes-Gn; Rleg2_R0051.
DR   EnsemblGenomes-Gn; Rleg2_R0052.
DR   EnsemblGenomes-Gn; Rleg2_R0053.
DR   EnsemblGenomes-Gn; Rleg2_R0054.
DR   EnsemblGenomes-Gn; Rleg2_R0055.
DR   EnsemblGenomes-Gn; Rleg2_R0056.
DR   EnsemblGenomes-Gn; Rleg2_R0057.
DR   EnsemblGenomes-Gn; Rleg2_R0058.
DR   EnsemblGenomes-Gn; Rleg2_R0059.
DR   EnsemblGenomes-Gn; Rleg2_R0060.
DR   EnsemblGenomes-Gn; Rleg2_R0061.
DR   EnsemblGenomes-Gn; Rleg2_R0062.
DR   EnsemblGenomes-Gn; Rleg2_R0063.
DR   EnsemblGenomes-Gn; Rleg2_R0064.
DR   EnsemblGenomes-Gn; Rleg2_R0065.
DR   EnsemblGenomes-Tr; EBT00001525966.
DR   EnsemblGenomes-Tr; EBT00001525967.
DR   EnsemblGenomes-Tr; EBT00001525968.
DR   EnsemblGenomes-Tr; EBT00001525969.
DR   EnsemblGenomes-Tr; EBT00001525970.
DR   EnsemblGenomes-Tr; EBT00001525972.
DR   EnsemblGenomes-Tr; EBT00001525974.
DR   EnsemblGenomes-Tr; EBT00001525976.
DR   EnsemblGenomes-Tr; EBT00001525978.
DR   EnsemblGenomes-Tr; EBT00001525980.
DR   EnsemblGenomes-Tr; EBT00001525982.
DR   EnsemblGenomes-Tr; EBT00001525984.
DR   EnsemblGenomes-Tr; EBT00001525987.
DR   EnsemblGenomes-Tr; EBT00001525989.
DR   EnsemblGenomes-Tr; EBT00001525991.
DR   EnsemblGenomes-Tr; EBT00001525993.
DR   EnsemblGenomes-Tr; EBT00001525995.
DR   EnsemblGenomes-Tr; EBT00001525997.
DR   EnsemblGenomes-Tr; EBT00001525998.
DR   EnsemblGenomes-Tr; EBT00001526000.
DR   EnsemblGenomes-Tr; EBT00001526002.
DR   EnsemblGenomes-Tr; EBT00001526003.
DR   EnsemblGenomes-Tr; EBT00001526005.
DR   EnsemblGenomes-Tr; EBT00001526007.
DR   EnsemblGenomes-Tr; EBT00001526010.
DR   EnsemblGenomes-Tr; EBT00001526012.
DR   EnsemblGenomes-Tr; EBT00001526014.
DR   EnsemblGenomes-Tr; EBT00001526016.
DR   EnsemblGenomes-Tr; EBT00001526017.
DR   EnsemblGenomes-Tr; EBT00001526019.
DR   EnsemblGenomes-Tr; EBT00001526020.
DR   EnsemblGenomes-Tr; EBT00001526023.
DR   EnsemblGenomes-Tr; EBT00001526025.
DR   EnsemblGenomes-Tr; EBT00001526027.
DR   EnsemblGenomes-Tr; EBT00001526030.
DR   EnsemblGenomes-Tr; EBT00001526032.
DR   EnsemblGenomes-Tr; EBT00001526035.
DR   EnsemblGenomes-Tr; EBT00001526038.
DR   EnsemblGenomes-Tr; EBT00001526040.
DR   EnsemblGenomes-Tr; EBT00001526042.
DR   EnsemblGenomes-Tr; EBT00001526044.
DR   EnsemblGenomes-Tr; EBT00001526046.
DR   EnsemblGenomes-Tr; EBT00001526048.
DR   EnsemblGenomes-Tr; EBT00001526050.
DR   EnsemblGenomes-Tr; EBT00001526052.
DR   EnsemblGenomes-Tr; EBT00001526054.
DR   EnsemblGenomes-Tr; EBT00001526056.
DR   EnsemblGenomes-Tr; EBT00001526058.
DR   EnsemblGenomes-Tr; EBT00001526060.
DR   EnsemblGenomes-Tr; EBT00001526062.
DR   EnsemblGenomes-Tr; EBT00001526064.
DR   EnsemblGenomes-Tr; EBT00001526066.
DR   EnsemblGenomes-Tr; EBT00001526068.
DR   EnsemblGenomes-Tr; EBT00001526070.
DR   EnsemblGenomes-Tr; EBT00001526073.
DR   EnsemblGenomes-Tr; EBT00001526075.
DR   EnsemblGenomes-Tr; EBT00001526077.
DR   EnsemblGenomes-Tr; EBT00001526079.
DR   EnsemblGenomes-Tr; EBT00001526081.
DR   EnsemblGenomes-Tr; EBT00001526083.
DR   EnsemblGenomes-Tr; EBT00001526085.
DR   EnsemblGenomes-Tr; EBT00001526086.
DR   EnsemblGenomes-Tr; EBT00001526088.
DR   EnsemblGenomes-Tr; EBT00001526090.
DR   EnsemblGenomes-Tr; EBT00001526092.
DR   EnsemblGenomes-Tr; EBT00001526094.
DR   EnsemblGenomes-Tr; EBT00001526096.
DR   EnsemblGenomes-Tr; EBT00001526097.
DR   EnsemblGenomes-Tr; EBT00001526099.
DR   EnsemblGenomes-Tr; EBT00001526101.
DR   EnsemblGenomes-Tr; EBT00001526103.
DR   EnsemblGenomes-Tr; EBT00001526105.
DR   EnsemblGenomes-Tr; EBT00001526107.
DR   EnsemblGenomes-Tr; EBT00001526109.
DR   EnsemblGenomes-Tr; EBT00001526110.
DR   EnsemblGenomes-Tr; EBT00001526113.
DR   EnsemblGenomes-Tr; EBT00001526115.
DR   EnsemblGenomes-Tr; EBT00001526116.
DR   EnsemblGenomes-Tr; EBT00001526118.
DR   EnsemblGenomes-Tr; EBT00001526119.
DR   EnsemblGenomes-Tr; EBT00001526122.
DR   EnsemblGenomes-Tr; EBT00001526125.
DR   EnsemblGenomes-Tr; EBT00001526127.
DR   EnsemblGenomes-Tr; EBT00001526129.
DR   EnsemblGenomes-Tr; EBT00001526130.
DR   EnsemblGenomes-Tr; EBT00001526132.
DR   EnsemblGenomes-Tr; EBT00001526134.
DR   EnsemblGenomes-Tr; EBT00001526136.
DR   EnsemblGenomes-Tr; EBT00001526137.
DR   EnsemblGenomes-Tr; Rleg2_R0001-1.
DR   EnsemblGenomes-Tr; Rleg2_R0002-1.
DR   EnsemblGenomes-Tr; Rleg2_R0003-1.
DR   EnsemblGenomes-Tr; Rleg2_R0004-1.
DR   EnsemblGenomes-Tr; Rleg2_R0005-1.
DR   EnsemblGenomes-Tr; Rleg2_R0006-1.
DR   EnsemblGenomes-Tr; Rleg2_R0007-1.
DR   EnsemblGenomes-Tr; Rleg2_R0008-1.
DR   EnsemblGenomes-Tr; Rleg2_R0009-1.
DR   EnsemblGenomes-Tr; Rleg2_R0010-1.
DR   EnsemblGenomes-Tr; Rleg2_R0011-1.
DR   EnsemblGenomes-Tr; Rleg2_R0012-1.
DR   EnsemblGenomes-Tr; Rleg2_R0013-1.
DR   EnsemblGenomes-Tr; Rleg2_R0014-1.
DR   EnsemblGenomes-Tr; Rleg2_R0015-1.
DR   EnsemblGenomes-Tr; Rleg2_R0016-1.
DR   EnsemblGenomes-Tr; Rleg2_R0017-1.
DR   EnsemblGenomes-Tr; Rleg2_R0018-1.
DR   EnsemblGenomes-Tr; Rleg2_R0019-1.
DR   EnsemblGenomes-Tr; Rleg2_R0020-1.
DR   EnsemblGenomes-Tr; Rleg2_R0021-1.
DR   EnsemblGenomes-Tr; Rleg2_R0022-1.
DR   EnsemblGenomes-Tr; Rleg2_R0023-1.
DR   EnsemblGenomes-Tr; Rleg2_R0024-1.
DR   EnsemblGenomes-Tr; Rleg2_R0025-1.
DR   EnsemblGenomes-Tr; Rleg2_R0026-1.
DR   EnsemblGenomes-Tr; Rleg2_R0027-1.
DR   EnsemblGenomes-Tr; Rleg2_R0028-1.
DR   EnsemblGenomes-Tr; Rleg2_R0029-1.
DR   EnsemblGenomes-Tr; Rleg2_R0030-1.
DR   EnsemblGenomes-Tr; Rleg2_R0031-1.
DR   EnsemblGenomes-Tr; Rleg2_R0032-1.
DR   EnsemblGenomes-Tr; Rleg2_R0033-1.
DR   EnsemblGenomes-Tr; Rleg2_R0034-1.
DR   EnsemblGenomes-Tr; Rleg2_R0035-1.
DR   EnsemblGenomes-Tr; Rleg2_R0036-1.
DR   EnsemblGenomes-Tr; Rleg2_R0037-1.
DR   EnsemblGenomes-Tr; Rleg2_R0038-1.
DR   EnsemblGenomes-Tr; Rleg2_R0039-1.
DR   EnsemblGenomes-Tr; Rleg2_R0040-1.
DR   EnsemblGenomes-Tr; Rleg2_R0041-1.
DR   EnsemblGenomes-Tr; Rleg2_R0042-1.
DR   EnsemblGenomes-Tr; Rleg2_R0043-1.
DR   EnsemblGenomes-Tr; Rleg2_R0044-1.
DR   EnsemblGenomes-Tr; Rleg2_R0045-1.
DR   EnsemblGenomes-Tr; Rleg2_R0046-1.
DR   EnsemblGenomes-Tr; Rleg2_R0047-1.
DR   EnsemblGenomes-Tr; Rleg2_R0048-1.
DR   EnsemblGenomes-Tr; Rleg2_R0049-1.
DR   EnsemblGenomes-Tr; Rleg2_R0050-1.
DR   EnsemblGenomes-Tr; Rleg2_R0051-1.
DR   EnsemblGenomes-Tr; Rleg2_R0052-1.
DR   EnsemblGenomes-Tr; Rleg2_R0053-1.
DR   EnsemblGenomes-Tr; Rleg2_R0054-1.
DR   EnsemblGenomes-Tr; Rleg2_R0055-1.
DR   EnsemblGenomes-Tr; Rleg2_R0056-1.
DR   EnsemblGenomes-Tr; Rleg2_R0057-1.
DR   EnsemblGenomes-Tr; Rleg2_R0058-1.
DR   EnsemblGenomes-Tr; Rleg2_R0059-1.
DR   EnsemblGenomes-Tr; Rleg2_R0060-1.
DR   EnsemblGenomes-Tr; Rleg2_R0061-1.
DR   EnsemblGenomes-Tr; Rleg2_R0062-1.
DR   EnsemblGenomes-Tr; Rleg2_R0063-1.
DR   EnsemblGenomes-Tr; Rleg2_R0064-1.
DR   EnsemblGenomes-Tr; Rleg2_R0065-1.
DR   EuropePMC; PMC3133165; 21398532.
DR   EuropePMC; PMC3301998; 22419837.
DR   EuropePMC; PMC5739047; 29220487.
DR   EuropePMC; PMC6117902; 30165827.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00504; Glycine.
DR   RFAM; RF00517; serC.
DR   RFAM; RF00518; speF.
DR   RFAM; RF00519; suhB.
DR   RFAM; RF00520; ybhL.
DR   RFAM; RF00521; SAM_alpha.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01766; cspA.
DR   RFAM; RF01793; ffh.
DR   RFAM; RF01849; alpha_tmRNA.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   SILVA-LSU; CP001191.
DR   SILVA-SSU; CP001191.
XX
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 4024175
CC   Source DNA and organism available from Wayne Reeve
CC   (W.Reeve@murdoch.edu.au)
CC   Contacts: Wayne Reeve (W.Reeve@murdoch.edu.au)
CC             David Bruce (microbe@cuba.jgi-psf.org)
CC   Annotation done by JGI-ORNL and JGI-PGF
CC   Finishing done by JGI-LLNL
CC   Finished microbial genomes have been curated to close all gaps with
CC   greater than 98% coverage of at least two independent clones. Each
CC   base pair has a minimum q (quality) value of 30 and the total error
CC   rate is less than one per 50000.
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. it is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..4537948
FT                   /organism="Rhizobium leguminosarum bv. trifolii WSM2304"
FT                   /strain="WSM2304"
FT                   /mol_type="genomic DNA"
FT                   /note="biovar: trifolii"
FT                   /db_xref="taxon:395492"
FT   gene            620..2170
FT                   /locus_tag="Rleg2_0001"
FT   CDS_pept        620..2170
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0001"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /note="KEGG: rec:RHECIAT_CH0000397 chromosomal replication
FT                   initiator protein; TIGRFAM: chromosomal replication
FT                   initiator protein DnaA; PFAM: Chromosomal replication
FT                   initiator DnaA domain; Chromosomal replication initiator
FT                   DnaA; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53304"
FT                   /db_xref="GOA:B5ZMW3"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZMW3"
FT                   /protein_id="ACI53304.1"
FT                   /translation="MQMNTMTAGGPDNGDVAPQAFGSIRLEGGDTKAEMKHSILFERVS
FT                   ARLKAQVGPDVYASWFARLKLHSVSKSVVRLSVPTTFLKSWINNRYLDLITGLFQAEDP
FT                   EIMKIEVLVRTATRSGTKALDEAVQPEPVVAPQARRPASAQPAGQAVQQAVSSVAAARP
FT                   ASFGSPLFGSPLDSRFTFDTFVEGSSNRVALAAAKTIAEAGSGAVRFNPLFIHSTVGLG
FT                   KTHLLQAIANAAVQNPRALRVVYLTAEYFMWRFATAIRDNDALTLKDSLRNIDLLIIDD
FT                   MQFLQGKMIQHEFCHLLNMLLDSAKQVVVAADRAPWELESLDPRVRSRLQGGVAIEFDA
FT                   PDYEMRLEILRRRLAAARLEDPSLDIPAELLQHVARNVTASGRELEGAFNQLVFRRSFE
FT                   PNLSIERVDELLAHLVGSGEPRRVRIEDIQRIVARHYNVSRQELVSNRRTRVIVKPRQI
FT                   AMYLSKTLTPRSFPEIGRRFGGRDHTTVLHAVRKIEELISGDTKLSHEVELLKRLINE"
FT   gene            2336..3418
FT                   /locus_tag="Rleg2_0002"
FT   CDS_pept        2336..3418
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0002"
FT                   /product="Saccharopine dehydrogenase"
FT                   /note="PFAM: Saccharopine dehydrogenase; KEGG:
FT                   ret:RHE_CH00359 putative dehydrogenase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53305"
FT                   /db_xref="GOA:B5ZMW4"
FT                   /db_xref="InterPro:IPR005097"
FT                   /db_xref="InterPro:IPR032095"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZMW4"
FT                   /protein_id="ACI53305.1"
FT                   /translation="MSFRKIAVLGLGKVGRLAATLLHEGGFEVIGVDAQLPLSDVPFKC
FT                   RAGDISDPQVVGELLSNVEAVLSCLPYHLNIELARAAHLAGIHYFDLTEDVPTTNFIVE
FT                   LSKTARGLMAPQCGLAPGFVGIVGASLADGFDRCRSIRMRVGALPQHPTGLLGYAFNWS
FT                   PEGVVNEYLNDCEVIEGGVRKLVSPMEWHETVYVGGVKLEAFTTSGGLGTMCDTMLGKI
FT                   DNLDYKTMRYPGHMELMNFFFHELLMRDKRKLAGEILTNAKPPVEDDVVYVHVAAEGTE
FT                   NGSLRRKEFVRAYYPIEIAGARRTAIAWTTSASVVAVIEMVRDGLLPATGFLHQEHIPL
FT                   EMFLKTPTGSLFKAGATSHS"
FT   gene            complement(3481..4686)
FT                   /locus_tag="Rleg2_0003"
FT   CDS_pept        complement(3481..4686)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0003"
FT                   /product="oxygen-independent coproporphyrinogen III
FT                   oxidase"
FT                   /EC_number="1.3.98.3"
FT                   /note="KEGG: rec:RHECIAT_CH0000399 oxygen-independent
FT                   coprophorphyrinogen III oxidase protein; TIGRFAM:
FT                   oxygen-independent coproporphyrinogen III oxidase; PFAM:
FT                   Radical SAM domain protein; HemN domain protein; SMART:
FT                   Elongator protein 3/MiaB/NifB"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53306"
FT                   /db_xref="GOA:B5ZMW5"
FT                   /db_xref="InterPro:IPR004559"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010723"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR034505"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZMW5"
FT                   /protein_id="ACI53306.1"
FT                   /translation="MDNFDTPGRPSRDAALLPDTGEPGFGVYVHWPFCAAKCPYCDFNS
FT                   HVRHQPVDQERFASAFLKEMAAVRALSGPKTVTSIFLGGGTPSLMKPETVSAILDGIAR
FT                   HWHVPAGIEITMEANPSSVEAERFRGYRAAGVNRVSLGVQALDDRDLKFLGRLHDVADA
FT                   LKAIRLARDIFPRMSFDLIYARPDQTVEQWERELKQAISYAVDHLSLYQLTIEEGTPFY
FT                   GLHKAGKLIVPDGEQSAVLYEATQEITAREGMPAYEVSNHARPGAESRHNLTYWRYGDY
FT                   AGIGPGAHGRLTRGPEKIATATERKPESWLDMVERDGHGILDEERLGYEEQSDELLLMG
FT                   LRLREGVDLARWQQLSGRDLDPKREEFLLEHKFIERIGNSRLRCTPSGMLILDSVVADL
FT                   AC"
FT   gene            complement(4696..5340)
FT                   /locus_tag="Rleg2_0004"
FT   CDS_pept        complement(4696..5340)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0004"
FT                   /product="Ham1 family protein"
FT                   /note="PFAM: Ham1 family protein; KEGG:
FT                   rec:RHECIAT_CH0000400 probable nucleoside-triphosphatase
FT                   protein, HAM1-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53307"
FT                   /db_xref="GOA:B5ZMW6"
FT                   /db_xref="InterPro:IPR002637"
FT                   /db_xref="InterPro:IPR020922"
FT                   /db_xref="InterPro:IPR029001"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZMW6"
FT                   /protein_id="ACI53307.1"
FT                   /translation="MRKLETKTIVVASHNAGKIREIQELIGPLGFTAKSAAELNFVEPD
FT                   ETGTSFEENATIKAVASANAAGMPALSDDSGLVVDALDGDPGVYTANWAETSNGTRDFD
FT                   MAMAKVEKALQDAGATTPEQRTARFVSVLCLAWPDGHTELFRGEVEGSVVWPPRGGQGF
FT                   GYDPVFQPEGYGVTFGEMSGEEKHGWSVGKPQALSHRARAFKLFVETCLEA"
FT   gene            complement(5341..5766)
FT                   /locus_tag="Rleg2_0005"
FT   CDS_pept        complement(5341..5766)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0005"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; KEGG: rec:RHECIAT_CH0000401 putative
FT                   glyoxalase (lactoylglutathione lyase) protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53308"
FT                   /db_xref="GOA:B5ZMW7"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZMW7"
FT                   /protein_id="ACI53308.1"
FT                   /translation="MNPMLEGMLETALYARDLDEAEAFYENVLGFEKIARAANRHVFFR
FT                   CGPGVLLIFNPEETIKPPASDALQVPPHGTTGAGHACFRVSGRNIDAMTERLRAAGVAI
FT                   ESEVHWPNGGRSIYFRDPAGNSLECAEAKIWGIEQDI"
FT   gene            complement(5763..6482)
FT                   /locus_tag="Rleg2_0006"
FT   CDS_pept        complement(5763..6482)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0006"
FT                   /product="ribonuclease PH"
FT                   /EC_number="2.7.7.56"
FT                   /note="KEGG: rec:RHECIAT_CH0000402 ribonuclease PH protein;
FT                   TIGRFAM: ribonuclease PH; PFAM: 3' exoribonuclease;
FT                   Exoribonuclease, phosphorolytic domain 2"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53309"
FT                   /db_xref="GOA:B5ZMW8"
FT                   /db_xref="InterPro:IPR001247"
FT                   /db_xref="InterPro:IPR002381"
FT                   /db_xref="InterPro:IPR015847"
FT                   /db_xref="InterPro:IPR018336"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027408"
FT                   /db_xref="InterPro:IPR036345"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5ZMW8"
FT                   /protein_id="ACI53309.1"
FT                   /translation="MRPSGRKIDQMRKVSFERNFSKHAEGSCLVKFGDTHVLCTASLEE
FT                   KTPPWLRNSGKGWVTAEYGMLPRATGERMKREAAAGKQGGRTQEIQRLIGRSLRAVVDL
FT                   QALGERQITLDCDVIQADGGTRTASITGGWIALYDCLKWMESRNMIKVDRVLKDHVAAI
FT                   SCGVFASQPVIDLDYLEDSSAETDANFVMTGAGGIVEIQGTAEGTPFSEEEFTSLMGLA
FT                   KNGIGELVALQKQAIAG"
FT   gene            6610..7698
FT                   /locus_tag="Rleg2_0007"
FT   CDS_pept        6610..7698
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0007"
FT                   /product="heat-inducible transcription repressor HrcA"
FT                   /note="TIGRFAM: heat-inducible transcription repressor
FT                   HrcA; PFAM: Negative regulator of class I heat shock
FT                   protein; KEGG: ret:RHE_CH00364 heat-inducible transcription
FT                   repressor"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53310"
FT                   /db_xref="GOA:B5ZMW9"
FT                   /db_xref="InterPro:IPR002571"
FT                   /db_xref="InterPro:IPR021153"
FT                   /db_xref="InterPro:IPR023120"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5ZMW9"
FT                   /protein_id="ACI53310.1"
FT                   /translation="MGIRSTSVSDAVAALDERSREIFRRIVEGYLESGEPLGSRNLSRL
FT                   LPMSLSPASVRNVMSDLEDLGLIYSPHISAGRLPTQIGLRFFVDAFMQVGDLSAEDRAS
FT                   IDRQVRAESGGNPVESMMNEASRMLSGISRGAGLVITSKSDPVLKHVEFIRLEPTKALA
FT                   VLVGDHDQVENRIIELPAGVTSSQLAEAANFLNAHMSGQTLPELRKQLSQLKDNVRHEL
FT                   DALSRDLVERGIAVWAGSPDEGKPAQLIIRGRANLLEGLAGAEDLDRLRLLFDDLEKKD
FT                   SLIEILNLAETGSGVRIFIGSENKLFSLSGSSLIVAPYRDDDDRIVGAVGVIGPTRLNY
FT                   SRIVPMVDYTAQLVSRLSRNPL"
FT   gene            7808..8440
FT                   /locus_tag="Rleg2_0008"
FT   CDS_pept        7808..8440
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0008"
FT                   /product="Ribulose-phosphate 3-epimerase"
FT                   /EC_number="5.1.3.1"
FT                   /note="PFAM: GrpE protein; KEGG: rec:RHECIAT_CH0000404
FT                   molecular chaperone heat shock protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53311"
FT                   /db_xref="GOA:B5ZMX0"
FT                   /db_xref="InterPro:IPR000740"
FT                   /db_xref="InterPro:IPR009012"
FT                   /db_xref="InterPro:IPR013805"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5ZMX0"
FT                   /protein_id="ACI53311.1"
FT                   /translation="MTDDTTKNGPDATAADAAADAAAYVENDIAQEEAPQPDALELLKA
FT                   ENGELRDRYLRLAAEMDNLRRRTEREVKDAKSYSVAGFARDMLAVSDNLRRALDAIPAE
FT                   VKDAADAGLSTLIEGVEMTERAMLSALERHGVRKLEPVGQKFDPNFHQAMFEVPNPDVP
FT                   NNTVVQVVQAGFSIGERVLRPAMVGVAKGGPKAAEAETNSVFDEKDA"
FT   gene            complement(8472..9437)
FT                   /locus_tag="Rleg2_0009"
FT   CDS_pept        complement(8472..9437)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0009"
FT                   /product="Inosine/uridine-preferring nucleoside hydrolase"
FT                   /note="PFAM: Inosine/uridine-preferring nucleoside
FT                   hydrolase; KEGG: rec:RHECIAT_CH0000405
FT                   inosine-adenosine-guanosine preferring nucleoside hydrolase
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53312"
FT                   /db_xref="GOA:B5ZMX1"
FT                   /db_xref="InterPro:IPR001910"
FT                   /db_xref="InterPro:IPR023186"
FT                   /db_xref="InterPro:IPR036452"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZMX1"
FT                   /protein_id="ACI53312.1"
FT                   /translation="MKKTVHRMASARKIIIDTDPGQDDAAAIMLAFGSPDELELLGITT
FT                   VAGNVPLSLTSRNARIVCELCGRTETKVFAGADAPIARKLVTAEHVHGKTGLDGPELSE
FT                   PTMALQTGHAVDFIIETLRREEEGTVTLCTLGPLTNIGMALQKAPDIAPRIRELVMMGG
FT                   GFFEGGNITPAAEFNIYVDPEAADIVFRSGIPIVMMPLDVTHQLLTRKDRVKRMAEIGT
FT                   APVKAMVEMLEFFERFDIEKYGSDGGPLHDPTVIAYLLKPELFNGRDCNVEIEIHSELT
FT                   VGMTVVDWWHVTERKRNAKVMRQVDADGFFDLLIERFARI"
FT   gene            9655..10080
FT                   /locus_tag="Rleg2_0010"
FT   CDS_pept        9655..10080
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0010"
FT                   /product="heat shock protein Hsp20"
FT                   /note="PFAM: heat shock protein Hsp20; KEGG:
FT                   rec:RHECIAT_CH0000406 molecular chaperone small heat shock
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53313"
FT                   /db_xref="InterPro:IPR002068"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="InterPro:IPR037913"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZMX2"
FT                   /protein_id="ACI53313.1"
FT                   /translation="MSRITPFASPLLLGFDAMEKTLERISKASDGYPPYNIERIGADSG
FT                   APERLRITLAVAGFGEEELDVSIEENQLLIRGRQVEHGERDYLYRGIAARQFQRTFVLA
FT                   DGMQVLGAGLKNGLLSVDLIRPEPARMVKKINISVSQ"
FT   gene            10128..10385
FT                   /locus_tag="Rleg2_0011"
FT   CDS_pept        10128..10385
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0011"
FT                   /product="protein of unknown function DUF1150"
FT                   /note="PFAM: protein of unknown function DUF1150; KEGG:
FT                   rec:RHECIAT_CH0000407 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53314"
FT                   /db_xref="InterPro:IPR009531"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZMX3"
FT                   /protein_id="ACI53314.1"
FT                   /translation="MLMKEATSHLTKSELAHIGSGEVAYIRKMRTEEVAKCFPEAPDID
FT                   PNVDLWALFGADGTPILLTDNRSSTFFKAAEDELKTVSLH"
FT   gene            complement(10780..11481)
FT                   /locus_tag="Rleg2_0012"
FT   CDS_pept        complement(10780..11481)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0012"
FT                   /product="tRNA (guanine-N(7)-)-methyltransferase"
FT                   /EC_number="2.1.1.33"
FT                   /note="PFAM: putative methyltransferase; KEGG:
FT                   rec:RHECIAT_CH0000409 probable tRNA
FT                   (guanine-N(7)-)-methyltransferase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53315"
FT                   /db_xref="GOA:B5ZMX4"
FT                   /db_xref="InterPro:IPR003358"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZMX4"
FT                   /protein_id="ACI53315.1"
FT                   /translation="MTDMERRGRATEAFFGRRKGKALREHQAETLNSLLPAFLIDLSAA
FT                   PPEPLTSLFPAPVEKLRLEIGFGGGEHLIHRALERPSTGFIGVEPFVNSMQKLLSRIGE
FT                   TGARNIRVYNDDATQLLDWLPDASLDQIDLLYPDPWPKRKHWKRRFVSKTNLDRFHRVL
FT                   KPGALFCFASDIDTYVNWTLLKCRDHGGFDWLADNAADWLTPYEGWPSTRYEAKARREG
FT                   RSSAYLTFRKI"
FT   gene            complement(11490..12728)
FT                   /locus_tag="Rleg2_0013"
FT   CDS_pept        complement(11490..12728)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0013"
FT                   /product="Methionine adenosyltransferase"
FT                   /EC_number="2.5.1.6"
FT                   /note="PFAM: S-adenosylmethionine synthetase; KEGG:
FT                   ret:RHE_CH00370 S-adenosylmethionine synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53316"
FT                   /db_xref="GOA:B5ZMX5"
FT                   /db_xref="InterPro:IPR002133"
FT                   /db_xref="InterPro:IPR022628"
FT                   /db_xref="InterPro:IPR022629"
FT                   /db_xref="InterPro:IPR022630"
FT                   /db_xref="InterPro:IPR022631"
FT                   /db_xref="InterPro:IPR022636"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZMX5"
FT                   /protein_id="ACI53316.1"
FT                   /translation="MRANYLFTSESVAEGHPDKVCDRISDEIVDLVYREAAKTGVNPWG
FT                   VRIACETLATTNRVVIAGEVRLPPSLMKKDKDGKDVINPSKFKAAARRAIKDIGYEQDG
FT                   FHWKKAKIDVLLHSQSADIAQGVDSAADQQGDEGAGDQGIMFGYACRETPDLMPAPIYY
FT                   SHKILQLLAVARKKGDGEVAKLGPDAKSQVTVRYVDGKPSEATSIVLSTQHLDESWDSK
FT                   KVRAVVEPYIREALGELKIADDCKWYINPTGKFVIGGPDGDAGLTGRKIIVDTYGGAAP
FT                   HGGGAFSGKDTTKVDRSAAYAARYLAKNVVAAGLADRCTIQISYAIGVAQPLSIYVDLH
FT                   GTGKVSEDQVEAAIRKNMDLSPSGIRRHLDLNKPIYAKTSAYGHFGRKAGRDGSFSWER
FT                   TDLVKALKESVKA"
FT   gene            complement(12907..13326)
FT                   /locus_tag="Rleg2_0014"
FT   CDS_pept        complement(12907..13326)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0014"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="PFAM: helix-turn-helix domain protein; KEGG:
FT                   ret:RHE_CH00371 probable transcriptional regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53317"
FT                   /db_xref="GOA:B5ZMX6"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZMX6"
FT                   /protein_id="ACI53317.1"
FT                   /translation="MIENKKKPNPIDIHVGSRIRLRRTMLGMSQEKLGESLGITFQQIQ
FT                   KYEKGTNRVGASRLQNISNILNVPVSFFFEDAPGEHAGAGGGMAEASSSNYVVDFLSSS
FT                   EGLQLNRAFVKISDPKVRRKVVELVKALAAEADSD"
FT   gene            complement(13475..15079)
FT                   /locus_tag="Rleg2_0015"
FT   CDS_pept        complement(13475..15079)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0015"
FT                   /product="apolipoprotein N-acyltransferase"
FT                   /note="TIGRFAM: apolipoprotein N-acyltransferase; PFAM:
FT                   Nitrilase/cyanide hydratase and apolipoprotein
FT                   N-acyltransferase; KEGG: rec:RHECIAT_CH0000412
FT                   apolipoprotein N-acyltransferase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53318"
FT                   /db_xref="GOA:B5ZMX7"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR004563"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5ZMX7"
FT                   /protein_id="ACI53318.1"
FT                   /translation="MERLADRVILVWGFKRSLLAIAAGAFAVLALPPFGFFAAMFLSFT
FT                   LLVWLIDGAAASPDSGLVGRLWPAFATGWLFGFGYFVAGLWWLGHALLVDQDEFAWALP
FT                   LAILGLPACLAIFYGLAVALARIFWSDGMGRIAALAAGFGLMEWLRSVVLTGFPWNAIG
FT                   YGMMPVPLMMQSAHVIGAMGVTALAVFVFSAPALAGTRQGARNGTALAVLLFAAHLGYG
FT                   AYALYVAPRAEALPEDKRPVVRLVQPDIDQAAKMDNDADRNAIFETHLKLSAETPKNGG
FT                   RKPDIIVWPETAIPFILTDNQDALTRIADTLDDNQILIAGAVRAEEMGPGTPTRYYNSI
FT                   YVIDGRGQIIAASDKVHLVPFGEYLPFEDLLTEFGIQNVVEMPGGFSAAVSRHLLALPG
FT                   GLNLYPLICYEIIFPDEMTSDIEDANAILNITNDAWFGATPGPYQHFQQARVRAVETGL
FT                   PLIRDANSGISAIVNAQGEIIAGLDLEQTGFIDATVDRFGLEAGTTFPRQTYFWLTEAL
FT                   LILIALVSRRGFISGLN"
FT   sig_peptide     complement(14987..15079)
FT                   /locus_tag="Rleg2_0015"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.828) with cleavage site probability 0.312 at
FT                   residue 31"
FT   gene            complement(15148..16299)
FT                   /locus_tag="Rleg2_0016"
FT   CDS_pept        complement(15148..16299)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0016"
FT                   /product="transporter-associated region"
FT                   /note="PFAM: CBS domain containing protein;
FT                   transporter-associated region; KEGG: rec:RHECIAT_CH0000413
FT                   putative hemolysin protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53319"
FT                   /db_xref="GOA:B5ZMX8"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR005170"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZMX8"
FT                   /protein_id="ACI53319.1"
FT                   /translation="MSDFTTKPAADAKDSEPSSSSDEAGSSSRPSGRSQSFWSRAARIL
FT                   RPQQGSLREDLADALMTDAAGNDAFSPDERAMLHNILRFREVRVADVMVPRADIEAVDQ
FT                   NITIGELMILFEESGRSRMPVYADTLDDPRGMVHIRDLLSYVAKQARNKRRGPTKPAAA
FT                   LPALPAIEVAPENIQKTTRPAKPNLDLARVDLQKTLTEAGIIRKILFVPPSMLASDLLR
FT                   RMQVNRTQMALVIDEYGGTDGLASHEDIVEMVVGDIDDEHDDEEVMFKRVAEDVFIADA
FT                   RVELEEIAAAIGPDFDISEQVDEVDTLGGLIFSALGRIPVRGEVVQALPGFEFHILDAD
FT                   PRRIKRLRITRKRHAIRRRAKVDGDVPPGSDAGDDRPAESTAN"
FT   gene            complement(16296..16811)
FT                   /locus_tag="Rleg2_0017"
FT   CDS_pept        complement(16296..16811)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0017"
FT                   /product="protein of unknown function UPF0054"
FT                   /note="PFAM: protein of unknown function UPF0054; KEGG:
FT                   rec:RHECIAT_CH0000414 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53320"
FT                   /db_xref="GOA:B5ZMX9"
FT                   /db_xref="InterPro:IPR002036"
FT                   /db_xref="InterPro:IPR020549"
FT                   /db_xref="InterPro:IPR023091"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5ZMX9"
FT                   /protein_id="ACI53320.1"
FT                   /translation="MAELDIQISVDDIGWPGEETLLSFCERVLGAAVIYLRDSEKQPFP
FT                   TMPPEVSLVFTDDASIQDINAEWRGKDKATNVLSFPAFPVRPGKMPGPMLGDIIIARET
FT                   VERETIELEKSFDDHLTHLLVHGFLHLLGYDHMNSDEAEIMEGLETRILAQLGLSDPYE
FT                   GQDLKMEP"
FT   gene            complement(16811..17863)
FT                   /locus_tag="Rleg2_0018"
FT   CDS_pept        complement(16811..17863)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0018"
FT                   /product="PhoH family protein"
FT                   /note="PFAM: PhoH family protein; KEGG:
FT                   rec:RHECIAT_CH0000415 phosphate starvation inducible
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53321"
FT                   /db_xref="GOA:B5ZMY0"
FT                   /db_xref="InterPro:IPR003714"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZMY0"
FT                   /protein_id="ACI53321.1"
FT                   /translation="MNGQELVSSSPRHPRTPSDSNHFVLTFENNRFASELFGQFDQNLK
FT                   LLEERLNIDARARGNSVVITGDVVTTNQARRTLDYLYEKLQKGGSVERSDVEGAIRMAV
FT                   AADDQLSLPTMERKAKLTMAQVSTRKKTIIARTPTQDAYIRALERAELVFGVGPAGTGK
FT                   TYLAVAHAAQLLERGAVEKIILSRPAVEAGERLGFLPGDMKEKVDPYLRPLYDALYDMI
FT                   PADKVDRAITAGVIEIAPLAFMRGRTLANAAIILDEAQNTTSMQMKMFLTRLGENARMI
FT                   VTGDPSQIDLPRGVKSGLVEALQLLNGVEGISIVRFKDTDVVRHPLVGRIVRAYDSTYA
FT                   AEAEAVSRQD"
FT   gene            complement(17882..19291)
FT                   /locus_tag="Rleg2_0019"
FT   CDS_pept        complement(17882..19291)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0019"
FT                   /product="RNA modification enzyme, MiaB family"
FT                   /EC_number="1.3.1.74"
FT                   /note="KEGG: ret:RHE_CH00376 putative 2-methylthioadenine
FT                   synthetase (MiaB-like) protein; TIGRFAM: RNA modification
FT                   enzyme, MiaB family; tRNA-i(6)A37 thiotransferase enzyme
FT                   MiaB; PFAM: deoxyribonuclease/rho motif-related TRAM;
FT                   Radical SAM domain protein; Protein of unknown function
FT                   UPF0004; SMART: Elongator protein 3/MiaB/NifB"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53322"
FT                   /db_xref="GOA:B5ZMY1"
FT                   /db_xref="InterPro:IPR002792"
FT                   /db_xref="InterPro:IPR005839"
FT                   /db_xref="InterPro:IPR006463"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013848"
FT                   /db_xref="InterPro:IPR020612"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR038135"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5ZMY1"
FT                   /protein_id="ACI53322.1"
FT                   /translation="MTQDNALLQAPELTLRDGSNSRKVFIKTYGCQMNVYDSTRMSDAL
FT                   ARDGYEPTEDMEEADLVLLNTCHIREKAAEKVYSALGRLRDMKKKKAADGREMMIGVAG
FT                   CVAQAEGEEILRRAPAVDVVIGPQTYHRLPEALRRAKEGQRVVDTDYAIEDKFEHLPIA
FT                   ESRKIRARGVTAFLTVQEGCDKFCTFCVVPYTRGSEVSRPVAQIVEEAEKLVEGGVREI
FT                   TLLGQNVNAWHGAGPRGEAWSLGDLLYRLAEIPGLARLRYTTSHPRDMDDRLIDAHRDL
FT                   RALMPYLHLPVQSGSDRILKAMNRRHTAAEYLSLIARIRTVRPDIALSGDFITGFPGET
FT                   DADFEDTLRLVEEVRYAQAFSFKYSTRPGTPGAELKDQVPEQIKAERLERLQALLLKQQ
FT                   QEFAESCIGKEIDLLLEKPGRMPEQLIGRSPWLQSVNVDAKASQIGDIIKVRITGTGNN
FT                   SLFAERAEAAV"
FT   gene            complement(19341..20138)
FT                   /locus_tag="Rleg2_0020"
FT   CDS_pept        complement(19341..20138)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0020"
FT                   /product="phospholipid/glycerol acyltransferase"
FT                   /note="PFAM: phospholipid/glycerol acyltransferase; KEGG:
FT                   rec:RHECIAT_CH0000417 1-acyl-sn-glycerol-3-phosphate
FT                   acyltransferase (phospholipid/glycerol acyltransferase)
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53323"
FT                   /db_xref="GOA:B5ZMY2"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZMY2"
FT                   /protein_id="ACI53323.1"
FT                   /translation="MIAWLRIACAAVVILIVSIVLVPLQLLALRFDWRLRRRLPRVWHR
FT                   IICYCLGIRVRVTGRLEARRPLMLCSNHSSWMDIMVLSAVADVAFIAKIEVAEWPIFGT
FT                   LAKLQKSVFVVREERRKTGHQANEIAGRMADGEIVVLFPEGTTSDGNRLLEVKSSLFGA
FT                   AAMAVPASPTGTVVVQPVAVAYTRVHGIAMGRYHRPLAAWPGDIELLPHLIDIVRCGAI
FT                   DAEVCFGEAVEYRADTNRKEVSATIASRIRNLLNSRLRGREIS"
FT   sig_peptide     complement(20052..20138)
FT                   /locus_tag="Rleg2_0020"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.802) with cleavage site probability 0.788 at
FT                   residue 29"
FT   gene            complement(20166..20594)
FT                   /locus_tag="Rleg2_0021"
FT   CDS_pept        complement(20166..20594)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0021"
FT                   /product="ferric uptake regulator, Fur family"
FT                   /note="PFAM: ferric-uptake regulator; KEGG: ret:RHE_CH00378
FT                   ferric uptake regulation protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53324"
FT                   /db_xref="GOA:B5ZMY3"
FT                   /db_xref="InterPro:IPR002481"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZMY3"
FT                   /protein_id="ACI53324.1"
FT                   /translation="MPDVAKTLEELCTERGMRMTEQRRVIARILEDSEDHPDVEELYRR
FT                   SVKVDAKISISTVYRTVKLFEDAGIIARHDFRDGRSRYETVPEEHHDHLIDLKTGTVIE
FT                   FRSPEIEALQERIAREHGFKLVDHRLELYGVPLKKEDL"
FT   gene            complement(20678..21172)
FT                   /locus_tag="Rleg2_0022"
FT   CDS_pept        complement(20678..21172)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0022"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   ret:RHE_CH00379 ribosomal-protein-alanine
FT                   N-acetyltransferase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53325"
FT                   /db_xref="GOA:B5ZMY4"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZMY4"
FT                   /protein_id="ACI53325.1"
FT                   /translation="MLEAYLTLKPEFEIIAMEREDCRDVAVLHGERFARPWGDGEFHGL
FT                   LMQDTVFGFVARQTNAILKKPLPGFILARHVAGEAEILTIAVQAKVARAGLGWRLMQAA
FT                   MREARARGGESMFLEVDDGNTAALGLYRKLGFEKVGERKGYYKQENGALSTALVMKRVL
FT                   R"
FT   gene            complement(21175..21837)
FT                   /locus_tag="Rleg2_0023"
FT   CDS_pept        complement(21175..21837)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0023"
FT                   /product="peptidase M22 glycoprotease"
FT                   /note="PFAM: peptidase M22 glycoprotease; KEGG:
FT                   rec:RHECIAT_CH0000420 probable O-sialoglycoprotein
FT                   endopeptidase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53326"
FT                   /db_xref="GOA:B5ZMY5"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR022496"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZMY5"
FT                   /protein_id="ACI53326.1"
FT                   /translation="MIVLALDTAGVDCAAAVYDSGRNTMLGEASDMIGKGHAEHLIGIV
FT                   DRALDQVDMALSDIDRIAVTIGPGSFTGIRVGVAAARGFALSLNVPAVGVTTLEVMASA
FT                   QREKTPGRAVLAAMDAKRDEIYLQSFSPDGSPLDAPRALSVAQAQAFAAGFDGEITGSA
FT                   TPLLKAGAHGDHSNNFPISVVARLGAAASPDAGKPKPLYLRGPDAKPQAGYAIARRV"
FT   gene            complement(21927..22493)
FT                   /locus_tag="Rleg2_0024"
FT   CDS_pept        complement(21927..22493)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0024"
FT                   /product="Scaffold protein Nfu/NifU"
FT                   /note="PFAM: nitrogen-fixing NifU domain protein; Scaffold
FT                   protein Nfu/NifU; KEGG: ret:RHE_CH00381 nitrogen fixation
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53327"
FT                   /db_xref="GOA:B5ZMY6"
FT                   /db_xref="InterPro:IPR001075"
FT                   /db_xref="InterPro:IPR014824"
FT                   /db_xref="InterPro:IPR034904"
FT                   /db_xref="InterPro:IPR035433"
FT                   /db_xref="InterPro:IPR036498"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZMY6"
FT                   /protein_id="ACI53327.1"
FT                   /translation="MFIQTEATPNPATQKFLPGKVVMENGTAEFRSAEEAEASPLAARL
FT                   FEIPGVTGVYFGYDFISVSKDDAEWQHLKPAILGSIMEHFMSGKPVMGDASILSEDVDA
FT                   GDEFFDEGDESIVLTIKELLETRVRPAVAQDGGDITFRGFKDGKVYLNMKGSCAGCPSS
FT                   TATLKHGVQNLLRHFVPEVQEVIAA"
FT   gene            complement(22598..23089)
FT                   /locus_tag="Rleg2_0025"
FT   CDS_pept        complement(22598..23089)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0025"
FT                   /product="UspA domain protein"
FT                   /note="PFAM: UspA domain protein; KEGG:
FT                   rec:RHECIAT_CH0000422 putative universal stress protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53328"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZMY7"
FT                   /protein_id="ACI53328.1"
FT                   /translation="MVSKRLSRLEGHRRKFMAVIDGTPECQRAVHYAGRRAKNSNGGLV
FT                   LLYVIPDGDFQQWLGVEAIMRAEAREEAEAVVAKIAQIVRETIGIEPEIVIREGGAAEQ
FT                   INAVIEDDRDVAILVLAAGSAKEGPGPLVSSIAGRAAAFPIPVTVLPDTLTNEEIDALC
FT                   "
FT   gene            complement(23199..24263)
FT                   /locus_tag="Rleg2_0026"
FT   CDS_pept        complement(23199..24263)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0026"
FT                   /product="tryptophanyl-tRNA synthetase"
FT                   /EC_number="6.1.1.2"
FT                   /note="KEGG: ret:RHE_CH00383 tryptophanyl-tRNA synthetase;
FT                   TIGRFAM: tryptophanyl-tRNA synthetase; PFAM: aminoacyl-tRNA
FT                   synthetase class Ib"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53329"
FT                   /db_xref="GOA:B5ZMY8"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002305"
FT                   /db_xref="InterPro:IPR002306"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR024109"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZMY8"
FT                   /protein_id="ACI53329.1"
FT                   /translation="MSEFKKLVFSGVQPTGNLHLGNYLGAIRRFVALQEGNDCIYCVVD
FT                   MHALTAQLVHEDMPSQTRSIAAAFIAAGIDPEKHIVFNQSAVPQHAELAWIFNCVARIG
FT                   WMNRMTQFKDKAGKDREQASLGLYAYPSLMAADILVYRATHVPVGEDQKQHLELARDIA
FT                   MKFNLDYAEHIRKTGYGIDITVGNEPVHAYFPMVEPLIGGPAPRVMSLRDGTKKMSKSD
FT                   PSDLSRINLMDDEDAISKKIRKAKTDPDGLPSEVDGLQGRPEADNLVAIYAALADKSKA
FT                   EVLAEFGGQQFSVFKPALVDLAIHVLAPITGEMRRLMDDTSHIDAILRKGGERARARAE
FT                   VTMSQVRDVIGFLY"
FT   gene            complement(24385..24783)
FT                   /locus_tag="Rleg2_0027"
FT   CDS_pept        complement(24385..24783)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0027"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; KEGG: ret:RHE_CH00384 putative
FT                   glyoxalase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53330"
FT                   /db_xref="GOA:B5ZMY9"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZMY9"
FT                   /protein_id="ACI53330.1"
FT                   /translation="MTIQSLFLVTLVVDDYDHAKAFYCGALGFDCLQDQPQPEGKRWVV
FT                   VKPRGADGAAFLLAQAANETQRAAIGNQTGGRVGFFLKTDDFARDHAAMLAAGVRFLEE
FT                   PRHEVYGTVAVFADPYGNSFDLIQHAAG"
FT   gene            24971..25399
FT                   /locus_tag="Rleg2_0028"
FT   CDS_pept        24971..25399
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0028"
FT                   /product="Peptidase M15A"
FT                   /note="PFAM: protein of unknown function DUF882; Peptidase
FT                   M15A; KEGG: rec:RHECIAT_CH0000425 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53331"
FT                   /db_xref="InterPro:IPR009045"
FT                   /db_xref="InterPro:IPR013230"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZMZ0"
FT                   /protein_id="ACI53331.1"
FT                   /translation="MQTASLLAMAGLFALQSATSAVGQDSKRPVIHLPKQEVRLAYTVQ
FT                   TVSVRTGCFPARLQAVLSHIAAKTGRRPMITSGLRSHPRRHGSLHGKCLAADIRMPGLS
FT                   ERTIIAAARSAPGIGGIGTYCNGIVHVDVGPQRRWVDC"
FT   sig_peptide     24971..25042
FT                   /locus_tag="Rleg2_0028"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.670 at
FT                   residue 24"
FT   gene            complement(25612..27198)
FT                   /locus_tag="Rleg2_0029"
FT   CDS_pept        complement(25612..27198)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0029"
FT                   /product="integral membrane protein MviN"
FT                   /note="TIGRFAM: integral membrane protein MviN; PFAM: multi
FT                   antimicrobial extrusion protein MatE; polysaccharide
FT                   biosynthesis protein; virulence factor MVIN family protein;
FT                   KEGG: rec:RHECIAT_CH0000426 virulence factor transmembrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53332"
FT                   /db_xref="GOA:B5ZMZ1"
FT                   /db_xref="InterPro:IPR004268"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZMZ1"
FT                   /protein_id="ACI53332.1"
FT                   /translation="MSLVKKFATVGGATLGSRIFGFVRETLMAAALGTGPMADVFYAAF
FT                   RFPNLFRRLFAEGAFNAAFVPLFAKEIEANGTEGAKRFSEEVFGVLFSVLLLITIVMEL
FT                   AMPLLVRFVIAPGFADDPDKFSITIRMAAVMFPYLMCMSLTAMMSGMLNSLHHFFAAAI
FT                   APVFLNVVMIGALFYALYTGADPLATAWYLSWGVLAAGVLQLAVVYIGVLAAGMSIGFR
FT                   FPKMTPNVKRLLILAVPAAVTGGITQINQLIGQAIASSRDGAIAALQYADRIYQLPLGV
FT                   VGVAVGVVLLPELARALKGGNLREAGNLQNRSIEFVLFLTIPAAFALWILSDEIIRVLY
FT                   ERGAFHQENTAVVGAILAIYGIGLPAFVLIKALQPGFYAREDTKTPMRFSAVAVATNCA
FT                   TALTLFPFMGAPGIAVAEATAGWISTVLLFTTLLRRGHLTWEWALAKRTALLIVAAAVM
FT                   GAAIVFLKQYFAPWLASSAPLLTKIGTLGLLIAISMLVYFAAAFLIGGADLGMIRRNLN
FT                   RKPAAAEDAQG"
FT   gene            complement(27224..30130)
FT                   /locus_tag="Rleg2_0030"
FT   CDS_pept        complement(27224..30130)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0030"
FT                   /product="UTP-GlnB uridylyltransferase, GlnD"
FT                   /EC_number="2.7.7.59"
FT                   /note="KEGG: rec:RHECIAT_CH0000427 [protein-PII]
FT                   uridylyltransferase protein; TIGRFAM: protein-P-II
FT                   uridylyltransferase; PFAM: amino acid-binding ACT domain
FT                   protein; DNA polymerase beta domain protein region;
FT                   metal-dependent phosphohydrolase HD sub domain; GlnD
FT                   PII-uridylyltransferase; SMART: metal-dependent
FT                   phosphohydrolase HD region"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53333"
FT                   /db_xref="GOA:B5ZMZ2"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR002934"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR010043"
FT                   /db_xref="InterPro:IPR013546"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZMZ2"
FT                   /protein_id="ACI53333.1"
FT                   /translation="MRTKHEASPDAAARHEQETAPATAMRELDFSHILDVELLQKQCDA
FT                   VAEANRNRPDVLRSDLLAVLKKASTEGRQKARAALMADGGGLNCAYRISWLQDQIITVL
FT                   YNFATAHIFPQQKDKFAVTAVGGYGRDTLAPGSDIDLLFLFPPRPTEETHKAVEFMLYV
FT                   LWDMGFKVGHATRTVEECIALSKSDMTIRTAILEMRYICGLQRLETELETRFDKEIVTG
FT                   TGPEFIAAKLAERDERHRKAGDTRYLVEPNVKEGKGGLRDLHTLFWISKYYYHVRDQAE
FT                   LVKLGVLSKHEYRLLEKADDFLWAVRCHMHFLTGKAEERLSFDIQREIAEAFGYHTRPG
FT                   LSAVERFMKHYFLVAKDVGDLTRILCAALEDQQAKSIPGLTGVISRFTHRNRKIAGSVE
FT                   FVEDRGRIALADADVFKRDPVSILRLFHVADINGLEFHPDALKRVTRSLALIDNRLREN
FT                   DEANRLFMSILTSKRDPALILRRMNEAGVLGRFIPEFGKIVAMMQFNMYHHYTVDEHLI
FT                   RTVDVLSEIDQARAEDLHPLANKLFSGIEDREALFVAVLLHDIAKGRLEDHSIAGARVA
FT                   RKLCGRFGLSQKQTEIVVWLIEEHLTMSMVAQTRDLTDRKTITDFADRVQSLDRLKMLL
FT                   ILTICDIRAVGPGVWNGWKGQLLRTLYYETELLLAGGFSEVSRKERANAAAEALHAALA
FT                   DWSQKDRNTYTKLHYQPYLLSVPLEDQIRHAHFIRQADKSGQALATTVRTDSFHAITEI
FT                   TVLSPDHPRLLAVIAGACAAAGANIVDAQIFTTSDGRALDTIHVSREFTDDADELRRAA
FT                   TIGRMIEDVLSGRKRLPEVIATRARNRKKSKAFVIPPSVNITNSLSNKFTVIEVECLDR
FT                   PGLLSEITAVLSDLSLDIQSARITTFGEKVIDTFYVTDLVGQKISGDSKRANITARMKA
FT                   VMAEEEDELRERMPSGIIAPAATARTSPSADKKADSPA"
FT   gene            complement(30238..30513)
FT                   /locus_tag="Rleg2_0031"
FT   CDS_pept        complement(30238..30513)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0031"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rec:RHECIAT_CH0000428 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53334"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZMZ3"
FT                   /protein_id="ACI53334.1"
FT                   /translation="MFMEKLIRETERLSLICSMLDTMRRADADRNARGWTSPIGMLKIT
FT                   RCCAMISELGTSIAKAGYRECDRQSLEEIMRETRQVLHLLNARATA"
FT   gene            complement(30528..33170)
FT                   /locus_tag="Rleg2_0032"
FT   CDS_pept        complement(30528..33170)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0032"
FT                   /product="DNA mismatch repair protein MutS"
FT                   /note="TIGRFAM: DNA mismatch repair protein MutS; PFAM: DNA
FT                   mismatch repair protein MutS domain protein; MutS III
FT                   domain protein; MutS II domain protein; MutS IV domain
FT                   protein; KEGG: ret:RHE_CH00388 DNA mismatch repair protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53335"
FT                   /db_xref="GOA:B5ZMZ4"
FT                   /db_xref="InterPro:IPR000432"
FT                   /db_xref="InterPro:IPR005748"
FT                   /db_xref="InterPro:IPR007695"
FT                   /db_xref="InterPro:IPR007696"
FT                   /db_xref="InterPro:IPR007860"
FT                   /db_xref="InterPro:IPR007861"
FT                   /db_xref="InterPro:IPR016151"
FT                   /db_xref="InterPro:IPR017261"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036187"
FT                   /db_xref="InterPro:IPR036678"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZMZ4"
FT                   /protein_id="ACI53335.1"
FT                   /translation="MMEQYIEIKANNPGSLLFYRMGDFYELFFEDALEASRALGITLTK
FT                   RGQHMGQDIPMCGVPVHAADDYLQKLISLGFRVAVCEQIEDPAEAKKRGGKSVVKRDVV
FT                   RLVTPGTITEEKLLSPSESNYLMALTRIRGGAEPLLALAWIDISTGVFRLAETEASRLL
FT                   ADILRIDPRELILPETIFHDPELKPVFDVLGRTAVPQPSVLFDSASAEGRIARYFGVST
FT                   LDGFGTFSRAELAAAAAAVAYVEKTQIAERPPLGKPERESAASTLFIDPATRANLELAR
FT                   TLSGDRNGSLLKAIDRTVTGGGARLLAERLMSPLTDPARINARLDSIGFLIDEPSLCGN
FT                   LRDTLKHVPDMPRALSRLALDRGGPRDLSAIRQGLQAANDVAAMLASAMLPEELGQALS
FT                   GLQALPAALETLLAETLADELPLLKRDGGFLRDGASAELDEVRALRDQSRRVIAGLQLQ
FT                   YAEEIGIRSLKIKHNNILGYFIEVTAGNASPMTDTAEAKARFIHRQTMASAMRFTTTEL
FT                   ADLESRIANAADRALTIELAAFERMTAAVVAEAEAIKSGARALAVIDVAASLALLAEEQ
FT                   AYCRPQVDGSKMFAIDGGRHPVVEQALRRQASGPFVANNCDLSPKAGDKDGAIWLLTGP
FT                   NMGGKSTFLRQNALIAILAQMGSFVPATSAHIGIVDRLFSRVGASDDLARGRSTFMVEM
FT                   VETAAILNQASDRSLVILDEIGRGTATFDGLSIAWASVEHLHEANRCRGLFATHFHELT
FT                   VLSEKLVRLSNATMRVKEWDGDVIFLHEVGPGAADRSYGIQVARLAGLPASVVTRARDV
FT                   LTRLEDADRKNPASQLIDDLPLFQVAVRREDTARGPSKVEETLKAMSLDDMTPREAMDA
FT                   LYDLKKKLK"
FT   gene            33368..35653
FT                   /locus_tag="Rleg2_0033"
FT   CDS_pept        33368..35653
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0033"
FT                   /product="Malate dehydrogenase
FT                   (oxaloacetate-decarboxylating) (NADP(+))., Phosphate
FT                   acetyltransferase"
FT                   /EC_number="1.1.1.40"
FT                   /EC_number="2.3.1.8"
FT                   /note="PFAM: phosphate acetyl/butaryl transferase; malic
FT                   protein domain protein; malic protein NAD-binding; KEGG:
FT                   rec:RHECIAT_CH0000430 malate dehydrogenase
FT                   (oxaloacetate-decarboxylating) (NADP(+)) protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53336"
FT                   /db_xref="GOA:B5ZMZ5"
FT                   /db_xref="InterPro:IPR002505"
FT                   /db_xref="InterPro:IPR012188"
FT                   /db_xref="InterPro:IPR012301"
FT                   /db_xref="InterPro:IPR012302"
FT                   /db_xref="InterPro:IPR015884"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR037062"
FT                   /db_xref="InterPro:IPR042112"
FT                   /db_xref="InterPro:IPR042113"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZMZ5"
FT                   /protein_id="ACI53336.1"
FT                   /translation="MPDIDKKDRPATSVTDQEALDFHATGRPGKLEVVPTKPMATQRDL
FT                   SLAYSPGVAVPVKAIAADPQTAYDYTARGNMVAVISNGTAILGLGNLGALASKPVMEGK
FT                   AVLFKRFADVDSIDLEIDTENVDEFINCVRFLGPSFGGINLEDIKAPDCFVIESRLREL
FT                   MDIPVFHDDQHGTAIIAAAGLINALELTGRDLKTTKLVCNGAGAAAIACIELIKAMGFA
FT                   PENIILCDTKGVIYQGRTEGMNQWKSAHAAKTDTRTLEEAMDGADVVFGLSQKGAFSAE
FT                   MIRSMADRPIIFAMANPDPEITPEEVARIRDDAIMATGRSDYPNQVNNVLGFPYIFRGA
FT                   LDVRASTINDAMKIAAVKALANLAREDVPDDVVAAYQGNRPRFGSQYIIPVPFDPRLIS
FT                   AIPVAVAEAAIETGVARKVITDMAGYARELSARRDPIASTLASLYERVRRRPKRIVFAE
FT                   AEEEQVLRAALSYANQQLGTAILLGREDLIRSTAERAGIDLNRPGLEIVNARISTRVEA
FT                   YIDYLYARLQRHGYLHRDVQRLIHNDRNHFAATMVALGDADGMVTGITRNYSTALEDVR
FT                   RCIDEKPGHRVIGVSLALCRGRTVFVADTAVHDMPTAEQLADIAEEAAGLARRMGYQPR
FT                   VAMLAYSTFGHPSGERSERVREAVKILDKRRVDFEYDGEMAADVALNRKVMEQYPFCRL
FT                   SGPANVLVMPAFHSASISTKMLQELGGSTVIGPILVGLDKPVQITSMGAKDSDIVNMAA
FT                   IAAYGAGS"
FT   gene            35839..36828
FT                   /locus_tag="Rleg2_0034"
FT   CDS_pept        35839..36828
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0034"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: helix-turn-helix- domain containing protein
FT                   AraC type; KEGG: rec:RHECIAT_CH0000431 putative
FT                   transcriptional regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53337"
FT                   /db_xref="GOA:B5ZMZ6"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR035418"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZMZ6"
FT                   /protein_id="ACI53337.1"
FT                   /translation="MPENASANFSPRFQGATFDDMVEALTKGFGSFDAWRHGREKPLDW
FT                   KVGFWGDERLSLVSNQDSGGWGARTGQGAPETLAIVVPRTGALDVTFGRTVAEATPGRL
FT                   LLMNNIEPERVSVRAVPHRSDTLSLSWTILAQTVTSVLETPLIGSLDLVPVVDRSTAAG
FT                   QLIGNLAQTMIIGMRNAGPLLHSPIAMLNLMQMFADLVVRTIPHRLSHLLDKKIHLIAP
FT                   RHVRRAIEFMHANIAQPLTMQSVAEAAGISIRALEVGFRAFKGTTPSAYLRTIRLQAVR
FT                   EDLRDPSNRQPLRDICLKWGFFHLGRFAATYRAAYGENPSDTRRRFEI"
FT   gene            complement(36940..37815)
FT                   /locus_tag="Rleg2_0035"
FT   CDS_pept        complement(36940..37815)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0035"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rec:RHECIAT_CH0000432 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53338"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZMZ7"
FT                   /protein_id="ACI53338.1"
FT                   /translation="MSAIDILNRDTTEAAPPSTAAAQKDGDILGRIGNLETRLARTARE
FT                   IDAAQAVRYRVFVDEMKAQLPLEAMRRQRDVDAYDAFCDHLLVLDRTIEGDPEDQIVGT
FT                   YRLLRQDVAIANGGFYSASEFEIEGLLAKHPDKRFMELGRSCVLPEYRTKRTVELLWQG
FT                   NWAYALKHGVSAMFGCASFPGVYLESHALALSFLYHNVLAKNEWAVSALPHLARNMDLM
FT                   PVEGVNPKRALMALPPLIKGYMRLGAMVGSSAVVDHAFNTTDVLIVLPISSISDRYLNY
FT                   YGADAGRFAS"
FT   gene            complement(37924..40203)
FT                   /locus_tag="Rleg2_0036"
FT   CDS_pept        complement(37924..40203)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0036"
FT                   /product="integral membrane sensor hybrid histidine kinase"
FT                   /note="PFAM: response regulator receiver; ATP-binding
FT                   region ATPase domain protein; histidine kinase A domain
FT                   protein; KEGG: rec:RHECIAT_CH0000433 putative two-component
FT                   sensor histidine kinase/response regulator hybrid protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53339"
FT                   /db_xref="GOA:B5ZMZ8"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZMZ8"
FT                   /protein_id="ACI53339.1"
FT                   /translation="MHNLGQLQERLSAAFGGPAAKPREERMAEFFSRPGTSAPQAADDA
FT                   KVGSAATRRLLVYWLGGAGLLAALILTLLAHAGDPLLLSGGLVVLGLAVISSYAVLMFR
FT                   RRRPPSGGKSLPDWNDGAKLFADVHDVLGDITVSRSMDRRIISANDTFRRLTGRLRPEG
FT                   HSCEEIGLAFRPGPIPHCFDVEISTPDGQRIFLWRDVVTRDPANGRLLLQSVARDVTDE
FT                   RLIAQGREEARQKAEYNSAAKSRLLATVSHEVRTPLSGLLGMTHLLAETRLTQEQQDYL
FT                   ANIRQSGHALTQLVEDLLDFSTIEVGRFALHPRSESLRKLLESVVEMLAHRAHEKGIEI
FT                   GATVSSDVPENMSFDPARLRQVLFNVIGNAVKFTQVGGVFIRVSLDADDLSITVTDSGP
FT                   GMTAEEQARVFGEFEQGGTVADRSSGTGLGLAISARIMREFNGTLTVASEKGRGSEFTI
FT                   RFPVDIGSERPDRRNTLLAGNSVVLLAPTGAARTAIAETITALGGLCHLVADGESARAT
FT                   LLGLANSGKRPTDIIIDHRMSAEFAAHLADRAEIAALGLRKVLLVNPEERSAHPLDLFD
FT                   AWLIRPLREQSLIDVLRGRMRGMEKRDALNDNQPGFGLSVAEPMVAASGLNILLGEDDP
FT                   INAMLVRVVLEKGGHKVRHVEDFEALLDCALCEANARPDIIISDLSMPGGNGIDMLGRL
FT                   RGHERRLDLASVPVIVLTADKSDESRRQVLLNGANRVMVKPVDPVRLLTEVQAVAALSA
FT                   RRAEAR"
FT   gene            complement(40259..40762)
FT                   /locus_tag="Rleg2_0037"
FT   CDS_pept        complement(40259..40762)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0037"
FT                   /product="lipoprotein signal peptidase"
FT                   /note="TIGRFAM: lipoprotein signal peptidase; PFAM:
FT                   peptidase A8 signal peptidase II; KEGG: ret:RHE_CH00392
FT                   lipoprotein signal peptidase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53340"
FT                   /db_xref="GOA:B5ZMZ9"
FT                   /db_xref="InterPro:IPR001872"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZMZ9"
FT                   /protein_id="ACI53340.1"
FT                   /translation="MTELTPARPALFSRPAPILFFIIVAVLLDQIVKIAVDHYLPLQEA
FT                   VPVVPMLALYRTYNLGVAFSMLEGMDGWFIVGMRLIIVAFVIWLWYRTAKDRWLAHLGY
FT                   ALIIAGAIGNLVDRFAYGHVIDYILFYTDSWSFAVFNLADSFITIGAGCVILDELLLPK
FT                   KAGR"
FT   gene            complement(40759..41619)
FT                   /locus_tag="Rleg2_0038"
FT   CDS_pept        complement(40759..41619)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0038"
FT                   /product="tRNA/rRNA methyltransferase (SpoU)"
FT                   /note="PFAM: tRNA/rRNA methyltransferase (SpoU); RNA 2-O
FT                   ribose methyltransferase substrate binding; KEGG:
FT                   ret:RHE_CH00393 rRNA methylase protein, TrmH family"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53341"
FT                   /db_xref="GOA:B5ZN00"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR013123"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZN00"
FT                   /protein_id="ACI53341.1"
FT                   /translation="MSKDFHDQGPRRVGQVKEVTSLANPIIKDIKALTNKKSREESGTF
FT                   LAEGLKLVIDAIELGWTIRTLVYAKAAKGKPLVEQMAARTVASGGLVLEVSEKVIASIT
FT                   RRDNPQMVVGIFEQRWMPLRDIRPRDGETWVALDRVRDPGNLGTIIRTADAAGASGIIL
FT                   VGETTDPFSLETVRATMGSVFAVPVARAAPEEFIAWRKSAGVSVVATHLAGAVDYRTID
FT                   YRKKPVVLLMGNEQSGLPDQLAGQADALARIPQQGRADSLNLAVATAVMLFEARRHLLS
FT                   LAEGK"
FT   gene            complement(41616..42713)
FT                   /locus_tag="Rleg2_0039"
FT   CDS_pept        complement(41616..42713)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0039"
FT                   /product="putative SAM-dependent methyltransferase protein"
FT                   /note="KEGG: rec:RHECIAT_CH0000436 probable SAM-dependent
FT                   methyltransferase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53342"
FT                   /db_xref="GOA:B5ZN01"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR019614"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZN01"
FT                   /protein_id="ACI53342.1"
FT                   /translation="MKQKERRPGQKKTSGPSGESRRDDRAGRPPKPVARPAAARETARE
FT                   AAVPAAPERPLMTRSGERPAERVPVILESLGAGDFHLIDSGNGEKLEQYGPYRIIRPEG
FT                   QALWRPSLPSHVWEKVDAVFTGDTDEEGSGRWRFPKEALGETWPLNLLGVDFLGRFTSF
FT                   RHVGVFPEQIVHWSWMKEQVEKAGRPLKVLNLFGYTGVASLVAAAAGAEVTHVDASKKA
FT                   IGWARENQALGRMEKLPIRWICEDAMKFILREERRGSQYDIILTDPPKFGRGPNGEVWH
FT                   LFEHLPLMLDVCREILSPKAVGLVLTAYSIRASFYSIHELMRETMRGAGGVVESGELVI
FT                   REAGLDGKTPGRALSTSLFSRWVPK"
FT   gene            43120..43575
FT                   /locus_tag="Rleg2_0040"
FT   CDS_pept        43120..43575
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0040"
FT                   /product="carbon monoxide dehydrogenase subunit G"
FT                   /note="PFAM: carbon monoxide dehydrogenase subunit G; KEGG:
FT                   rec:RHECIAT_CH0000438 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53343"
FT                   /db_xref="InterPro:IPR010419"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZN02"
FT                   /protein_id="ACI53343.1"
FT                   /translation="MDFTGEERIAAPRDVVWAALNDPEIMRGCIPGCQGIERLSPDTFE
FT                   ATIKVRFSLLSATFHGLLTLSNVDAPNSYTLSAEGKGGLAGFARGAADIVLEESGAETT
FT                   LHYRAKAELGGRLAQFGARLLDATSQRLAEGFFSDFNAAVVAKMAAG"
FT   gene            43639..44073
FT                   /locus_tag="Rleg2_0041"
FT   CDS_pept        43639..44073
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0041"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   rec:RHECIAT_CH0000439 putative acetyltransferase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53344"
FT                   /db_xref="GOA:B5ZN03"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZN03"
FT                   /protein_id="ACI53344.1"
FT                   /translation="MTWTIRPPRAEDQEMLAEIYLSVRRETFVWVDPGKFHREDFAAHT
FT                   NGETVFVCEHENGGVAGFLSLWPADDFIHMLYISPDFQGFGAGTALLQALPEWPQHRYR
FT                   LKCLVKNRRAKAFYLAHGFRVTGNGTSPEGDYEELSFSPA"
FT   gene            complement(44106..44438)
FT                   /locus_tag="Rleg2_0042"
FT   CDS_pept        complement(44106..44438)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0042"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ret:RHE_CH00398 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53345"
FT                   /db_xref="GOA:B5ZN04"
FT                   /db_xref="InterPro:IPR010445"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZN04"
FT                   /protein_id="ACI53345.1"
FT                   /translation="MAKKIVNLLILLPLGVILIVFCVANRQSVTLAFNPFRPEDQVLAV
FT                   SAPFFVFLVVALIAGMLIGSAATWFSQGKHRKRARTEAKEAIRWQGEADRHKSRAEEIA
FT                   GQLPAR"
FT   sig_peptide     complement(44352..44438)
FT                   /locus_tag="Rleg2_0042"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.913) with cleavage site probability 0.464 at
FT                   residue 29"
FT   gene            complement(44603..44902)
FT                   /locus_tag="Rleg2_0043"
FT   CDS_pept        complement(44603..44902)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0043"
FT                   /product="integration host factor, beta subunit"
FT                   /note="TIGRFAM: integration host factor, beta subunit;
FT                   PFAM: histone family protein DNA-binding protein; KEGG:
FT                   rec:RHECIAT_CH0000441 integration host factor beta-subunit
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53346"
FT                   /db_xref="GOA:B5ZN05"
FT                   /db_xref="InterPro:IPR000119"
FT                   /db_xref="InterPro:IPR005685"
FT                   /db_xref="InterPro:IPR010992"
FT                   /db_xref="InterPro:IPR020816"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5ZN05"
FT                   /protein_id="ACI53346.1"
FT                   /translation="MIKSELVQIVAARNPHLYHRDVENIVNAVLDEITDALAAGNRVEL
FT                   RGFGAFSVKNRPSRSGRNPRTGDTVFVEEKWVPFFKTGKELRERLNPGQADEED"
FT   gene            complement(44932..45882)
FT                   /locus_tag="Rleg2_0044"
FT   CDS_pept        complement(44932..45882)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0044"
FT                   /product="signal peptide peptidase SppA, 36K type"
FT                   /note="TIGRFAM: signal peptide peptidase SppA, 36K type;
FT                   PFAM: peptidase S49; KEGG: rec:RHECIAT_CH0000442 proteinase
FT                   IV protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53347"
FT                   /db_xref="GOA:B5ZN06"
FT                   /db_xref="InterPro:IPR002142"
FT                   /db_xref="InterPro:IPR004635"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZN06"
FT                   /protein_id="ACI53347.1"
FT                   /translation="MDSSIIADRRRLRRKLGFWRIVAVALIVALGLAFYSFAFGNAGTE
FT                   RPHIAHVTISGLIVDDDELLERLKKVETSDQVKAAVISISSPGGTTYGGEKIFKAIRAI
FT                   AAKKPVVSDVRTLAASAGYMIATAGDTIIAGDSSITGSIGVIFQYPQIQPLLDKIGVSL
FT                   QEIKSSPLKAEPSPFHEASEEAKAMIRNMVVDSYNWFVDLVADRRKLPRDEVLKLADGT
FT                   IYTGRQALKVKLVDTIGGEPEIRAYLKSRGVDADLPMVDWDKKSNTPFLLAGAVSRLIT
FT                   IFGYDDLLKGQDINGILPPKLLLDGLLSVWQVGRD"
FT   sig_peptide     complement(45766..45882)
FT                   /locus_tag="Rleg2_0044"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.765 at
FT                   residue 39"
FT   gene            46107..46772
FT                   /locus_tag="Rleg2_0045"
FT   CDS_pept        46107..46772
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0045"
FT                   /product="protein of unknown function DUF1239"
FT                   /note="PFAM: protein of unknown function DUF1239; KEGG:
FT                   rec:RHECIAT_CH0000443 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53348"
FT                   /db_xref="GOA:B5ZN07"
FT                   /db_xref="InterPro:IPR010664"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZN07"
FT                   /protein_id="ACI53348.1"
FT                   /translation="MLDTLKNNGNAAYAGSGRSAYGDALFHSARVRRLKILLPVAALII
FT                   AAALLAVALVSIYLPENVKFEGAKIENGKVVMEKPAIAGRNSDGINYSMLAERALQDIR
FT                   NPDLITLETIKAAVPMNDGLIARVVASTADYNRATDNLHMTAPFTLVLSSGLNANFQSA
FT                   RLDIKGGNMRSDDPVTITKDNASIVAKTLQITDKGRVITFEGNVRMNVDPSTIHKQGT"
FT   gene            46788..47423
FT                   /locus_tag="Rleg2_0046"
FT   CDS_pept        46788..47423
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0046"
FT                   /product="OstA family protein"
FT                   /note="PFAM: OstA family protein; KEGG:
FT                   rec:RHECIAT_CH0000444 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53349"
FT                   /db_xref="InterPro:IPR005653"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZN08"
FT                   /protein_id="ACI53349.1"
FT                   /translation="MTKDCRISTCKTGLAFIAGAFALVLTASGAGAQQAATMSGMKLSN
FT                   DQPIQIESDKLEIHDQEHTALFTGKVKVVQGTTTMQSGKMTVYYKDKAAKPAADGTQPA
FT                   AQPQQSASLASGSADIDKILVTDKVLLTSGTQTATADDGKFDMASQTFILTADQGNKVI
FT                   LSDGPNVFTGCKLTVHMQTGQAELESCGGRVQIQLDPKSQPNAQQKQN"
FT   sig_peptide     46788..46886
FT                   /locus_tag="Rleg2_0046"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.640 at
FT                   residue 33"
FT   gene            47464..48240
FT                   /locus_tag="Rleg2_0047"
FT   CDS_pept        47464..48240
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0047"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: rec:RHECIAT_CH0000445 probable amino acid ABC
FT                   transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53350"
FT                   /db_xref="GOA:B5ZN09"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030921"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZN09"
FT                   /protein_id="ACI53350.1"
FT                   /translation="MFGQPEPQAAGAADKSRYQGTLIARGLTKTYATRRVVNGVSLVVR
FT                   RGEAVGLLGPNGAGKTTCFYMITGLVPVDEGTIEIDGNDVTKMPMYRRSRLGVGYLPQE
FT                   ASIFRGLTVEENIRAVLEVHVKDKAEREQKLNELLEEFHIQKLRKSAAVALSGGERRRL
FT                   EIARALATDPTFMLLDEPFAGVDPISVADIQNLVHHLTARGIGVLITDHNVRETLGLID
FT                   RAYIIHAGEVLTHGRANDIVNNPEVRRLYLGDNFSL"
FT   gene            48393..49955
FT                   /locus_tag="Rleg2_0048"
FT   CDS_pept        48393..49955
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0048"
FT                   /product="RNA polymerase, sigma 54 subunit, RpoN"
FT                   /note="TIGRFAM: RNA polymerase sigma-54 factor, RpoN; PFAM:
FT                   sigma-54 factor; sigma-54 factor core-binding region;
FT                   sigma-54 DNA-binding domain protein; KEGG: ret:RHE_CH00404
FT                   RNA polymerase factor sigma-54"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53351"
FT                   /db_xref="GOA:B5ZN10"
FT                   /db_xref="InterPro:IPR000394"
FT                   /db_xref="InterPro:IPR007046"
FT                   /db_xref="InterPro:IPR007634"
FT                   /db_xref="InterPro:IPR038709"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZN10"
FT                   /protein_id="ACI53351.1"
FT                   /translation="MALSASLFLRQNQSLVMTPQLMQSIQLLQMTHVELTQFIAQEVEK
FT                   NPLLEFPSNDGEAGAERGESEDEPYGHSPEDAGSDDGYDNRTDALSSDWYDNGGSASTS
FT                   RLNDELDANYTNVYPDDSAPQRLDAPELVGQWKSMPGSGGEGADYDLDDFVAGQVSLRD
FT                   HLAQQIPFVLPDMADRLIAQNFVDQLDDAGYLQVDLVETGERLGTSLTAAERVLAALQT
FT                   LDPPGVFARSLSECLAIQLRQKDRYDPAMQALVENLELLARRDFATLKRLCGVDEEDLL
FT                   DMLGEIRQLNPKPGSGFETGVSEAIMPDVVVRPSLDGGWLVELNPDTLPRVLVNQSYFS
FT                   RVTRNGDDHAFLSECLQSANWLTRSLDQRAKTILKVASEIVRQQDAFLLNGVDHLRPLN
FT                   LKTVAEAIKMHESTVSRVTSNKYMLTPRGLFELKYFFTVSISAVAGGDSHSAEAVRHKI
FT                   RALIMQESPDAVLSDDDIVDMLKKGGVDLARRTVAKYREAMNIASSVQRRREKRALAKV
FT                   AGF"
FT   gene            50045..50959
FT                   /locus_tag="Rleg2_0049"
FT   CDS_pept        50045..50959
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0049"
FT                   /product="protein of unknown function DUF6 transmembrane"
FT                   /note="PFAM: protein of unknown function DUF6
FT                   transmembrane; KEGG: rec:RHECIAT_CH0000447 putative
FT                   permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53352"
FT                   /db_xref="GOA:B5ZN11"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZN11"
FT                   /protein_id="ACI53352.1"
FT                   /translation="MTPQNPKLARELLLLLALATLWGSSYTFIKIGVETIPPVTLIAVR
FT                   TLIAGGILLAVLRYRRIRLPTDGETWRRFVVQACLNSVIPFTLIAWAEQSVDAGLAVIL
FT                   NSATPIFTFLLTVLIARHEQVTARKLFGVISGLAGICLVIGVEVLGGLGESLLAQLAII
FT                   LATACYAGAAIFSKNFKGLDPAVPAAGSLISGAVILLPVSLVVDRPWTLDPSAASILAL
FT                   LALSAFSTALAFAIYFRLVQTLGSVGTTSQAYLRVPIGVAIGIVFLGERLSPTAWIGLV
FT                   CVIFGVAAMTIPARVRATTARIH"
FT   sig_peptide     50045..50128
FT                   /locus_tag="Rleg2_0049"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.750) with cleavage site probability 0.703 at
FT                   residue 28"
FT   gene            51253..51828
FT                   /locus_tag="Rleg2_0050"
FT   CDS_pept        51253..51828
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0050"
FT                   /product="sigma 54 modulation protein/ribosomal protein
FT                   S30EA"
FT                   /note="TIGRFAM: ribosomal subunit interface protein; PFAM:
FT                   sigma 54 modulation protein/ribosomal protein S30EA; KEGG:
FT                   ret:RHE_CH00406 probable sigma 54 modulation protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53353"
FT                   /db_xref="GOA:B5ZN12"
FT                   /db_xref="InterPro:IPR003489"
FT                   /db_xref="InterPro:IPR032528"
FT                   /db_xref="InterPro:IPR034694"
FT                   /db_xref="InterPro:IPR036567"
FT                   /db_xref="InterPro:IPR038416"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZN12"
FT                   /protein_id="ACI53353.1"
FT                   /translation="MSVRVSGKHMEIGDSFRQKIEDQIGMAITKYFDGGYSGQVTVEKA
FT                   SSRYSADCKLHLDSGVVLHAAGEATDPLLAFDAASERIEKRLRRYKRKLKDHHAGNHLN
FT                   GFAEVSYTVMDSVPDHEDEIPDDFAPAIVAESTKQLKTMSVATAVMALDMTDEPLLLFR
FT                   SPGKEHLNIVYRRHDGNIGWIDSANIKG"
FT   gene            51898..52362
FT                   /locus_tag="Rleg2_0051"
FT   CDS_pept        51898..52362
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0051"
FT                   /product="PTS IIA-like nitrogen-regulatory protein PtsN"
FT                   /note="TIGRFAM: PTS IIA-like nitrogen-regulatory protein
FT                   PtsN; PFAM: phosphoenolpyruvate-dependent sugar
FT                   phosphotransferase system EIIA 2; KEGG:
FT                   rec:RHECIAT_CH0000449 protein-N(pi)-phosphohistidine-sugar
FT                   phosphotransferase protein (enzyme II of the
FT                   phosphotransferase system)"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53354"
FT                   /db_xref="GOA:B5ZN13"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR006320"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZN13"
FT                   /protein_id="ACI53354.1"
FT                   /translation="MALADLLHQDAIIPALRVNSKKQLLQELAARAARITGLSEREIFD
FT                   VILQRERLGSTGVGNGIAIPHGKLVNIHSIVGIFARLEQPVDFEALDDQPVDLVFLLLA
FT                   PEGAGADHLKALSRIARVLRDHDLVAKLRATDSASAIYAFLNEEQTSNAA"
FT   gene            complement(52434..54770)
FT                   /locus_tag="Rleg2_0052"
FT   CDS_pept        complement(52434..54770)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0052"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="PFAM: histidine kinase HAMP region domain protein;
FT                   chemotaxis sensory transducer; KEGG: rec:RHECIAT_CH0000450
FT                   probable methyl-accepting chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53355"
FT                   /db_xref="GOA:B5ZN14"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR033479"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZN14"
FT                   /protein_id="ACI53355.1"
FT                   /translation="MSIFRMKSLAAKLIVITGIAIALVLVVSNFFLIGQTRDRVQTLTM
FT                   DQANLEAKAIANEIAANVGELASAARTMSGVIGRGHEGKSLDRKGMINVLKANLEQNAF
FT                   AFGSWFCEQLGALDGKTTEIANNNDEGTNKNGAFAPYWSKTKDGGIQYSTFDNDYTAEW
FT                   WKLAADSGKGAITTPYMAEGTDVPTLLTSIAYPVMSGGKMIGVGGVDISLKSLTDKLQA
FT                   LHPFGSGRVTLLSQTGNWIVAPIPDLMTKQYDGEGADTVKSALSSKQPGLVRNLTYDGL
FT                   DPFDRVVYPFAVPGVNATWIVLVDVPHTAINAPVQDQTTMMIVNGLIVLGAVMLALYFA
FT                   VRSLVQRPLGGLVASVEALGDGKYDEPVAAQDRTDEIGSVAKALEGFRFTLADSRRLED
FT                   EAARERQAAETERGRSESERQQSVSLQRHIVSIVGTGLSALSQGNLSHRITDDFPGEYG
FT                   KLKQDFNAALASLEETINTMNLSVANIGLGTGEISNSASDLAKRTEQQAASLEETAAAL
FT                   NELTAQVDSSADNARTAADNVNLACQDAEKSGEVVQKAIASMQGIEQSSTEVSRIISVI
FT                   DEIAFQTNLLALNAGVEAARAGEAGKGFAVVAQEVRELAQRSANAAKEIKTLINTSAVQ
FT                   VKEGVDLVGRAGGTLHKIAEQVMSINDLIRQISASASEQAVGLKEINQAMNQMDQVTQQ
FT                   NAAMVEEATAASVALNDEAQTLKALATRFRVAGSSNAAALTSVAQQMRAPTASAASPHA
FT                   TPAVRRAAAPSRGSAAVAQDSWEEF"
FT   sig_peptide     complement(54666..54770)
FT                   /locus_tag="Rleg2_0052"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.840) with cleavage site probability 0.635 at
FT                   residue 35"
FT   gene            complement(55072..55971)
FT                   /locus_tag="Rleg2_0053"
FT   CDS_pept        complement(55072..55971)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0053"
FT                   /product="PfkB domain protein"
FT                   /note="PFAM: PfkB domain protein; KEGG:
FT                   rec:RHECIAT_CH0000451 ribokinase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53356"
FT                   /db_xref="GOA:B5ZN15"
FT                   /db_xref="InterPro:IPR002139"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR011877"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZN15"
FT                   /protein_id="ACI53356.1"
FT                   /translation="MITVFGSINMDLIATTERLPKPGETVAGNGFATAAGGKGANQALA
FT                   ARRAGRYVHMAGAVGKDSFAADALALLDDAGTDLSLVKHVDGPTGTALILVGGDGENMI
FT                   AVVPGANGLVTPNDAETAIGGMTEGDILMLQFEVPADAVERALSAARAKGVTSILNLAP
FT                   LIPDAPRLGRLADIVIANETEFERLAGQDGMDTPAREAALTRLHAETGQTLIVTLGGDG
FT                   VIAIRDGAISRAQGLKIEPVDTVGAGDTFCGYFAASLDEGLDFASALRRAAVAGSLACL
FT                   KSGAQPSIPRGEDVVARI"
FT   gene            complement(56023..57246)
FT                   /locus_tag="Rleg2_0054"
FT   CDS_pept        complement(56023..57246)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0054"
FT                   /product="protein of unknown function DUF195"
FT                   /note="PFAM: protein of unknown function DUF195; KEGG:
FT                   rec:RHECIAT_CH0000452 putative DNA recombination protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53357"
FT                   /db_xref="GOA:B5ZN16"
FT                   /db_xref="InterPro:IPR003798"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZN16"
FT                   /protein_id="ACI53357.1"
FT                   /translation="MSVNSDSFTLSFASISPAMLALAGGILLALILLVIVLLLRGASLR
FT                   REQAEEASFRAGESEARMAELLKIQAEMQGRIAAMTEVFGARQSELNQAISQRLDGMSQ
FT                   RVNSTITEQTKSTHENLQRLQERLAVIDAAQNNIQTLAKDVVGLQAILSNKQTRGAFGQ
FT                   SRMETIVADGLPMGAYAFQQTLSNGSRPDCTIRMPNGAPPLVIDAKFPLEAWNAIRDAG
FT                   SPEAGKIAGQQFRRDMEVHIRDISEKYLIQGETQDTAFLFVPSESIFAEIHENFEPVVQ
FT                   KAHRARIVIVSPSLLMLSIQVIQAVLKDQRMRAQAHLIQGEVAILMDDLGRLDERVRKL
FT                   QGHFAMAQKDIDMVVTSADKLTKRGAKIEALEFEAGGDSKPGRDAEPAAKSVESRTGLL
FT                   KLRVVDEE"
FT   sig_peptide     complement(57175..57246)
FT                   /locus_tag="Rleg2_0054"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.977) with cleavage site probability 0.865 at
FT                   residue 24"
FT   gene            57537..58052
FT                   /locus_tag="Rleg2_0055"
FT   CDS_pept        57537..58052
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0055"
FT                   /product="peptide deformylase"
FT                   /EC_number="3.5.1.88"
FT                   /note="KEGG: rec:RHECIAT_CH0000454 peptide deformylase
FT                   protein; TIGRFAM: peptide deformylase; PFAM:
FT                   formylmethionine deformylase"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53358"
FT                   /db_xref="GOA:B5ZN17"
FT                   /db_xref="InterPro:IPR023635"
FT                   /db_xref="InterPro:IPR036821"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZN17"
FT                   /protein_id="ACI53358.1"
FT                   /translation="MTIKPLIILPDPILRQASKPIERVDADLQGLADDMLETMYDAPGI
FT                   GLAAIQIGVPRRMLVIDVSREGEEKQPQVFINPEIVKSSDERSVYEEGCLSIPDYYAEV
FT                   ERPAVVSVKFLDRNGKEQTVEADGLLATCLQHEIDHLNGVLFIDYISRLKREMVIKKFT
FT                   KAAKSKAL"
FT   gene            58117..58401
FT                   /locus_tag="Rleg2_0056"
FT   CDS_pept        58117..58401
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0056"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rec:RHECIAT_CH0000455 probable plasmid
FT                   stabilization protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53359"
FT                   /db_xref="GOA:B5ZN18"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZN18"
FT                   /protein_id="ACI53359.1"
FT                   /translation="MGDLLIRNISEAMKRDIAEAAQRSGNSLSDEAKELLREALHRKTG
FT                   AKPETATVYNAIRAAFVSENAVDDEFAAMMDEIEVARKKDFGRPFEDFE"
FT   gene            58398..58820
FT                   /locus_tag="Rleg2_0057"
FT   CDS_pept        58398..58820
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0057"
FT                   /product="PilT protein domain protein"
FT                   /note="PFAM: PilT protein domain protein; KEGG:
FT                   rec:RHECIAT_CH0000456 plasmid stabilization protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53360"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZN19"
FT                   /protein_id="ACI53360.1"
FT                   /translation="MIVLDTNVVSEFARPLPNENLKAWMLRQDGSRIWLCTVGLMEQIY
FT                   GAERVLLKTGSDRFFRAIENLVKGQFRDRIAGWDLEAAMATGRLRAKRESLGRPISVQD
FT                   AMIAAICLANGATLATRNTRDFEGLDLKLVNPFEDG"
FT   gene            58841..59776
FT                   /locus_tag="Rleg2_0058"
FT   CDS_pept        58841..59776
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0058"
FT                   /product="methionyl-tRNA formyltransferase"
FT                   /note="TIGRFAM: methionyl-tRNA formyltransferase; PFAM:
FT                   formyl transferase domain protein; KEGG:
FT                   rec:RHECIAT_CH0000457 methionyl-tRNA formyltransferase
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53361"
FT                   /db_xref="GOA:B5ZN20"
FT                   /db_xref="InterPro:IPR001555"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR005793"
FT                   /db_xref="InterPro:IPR005794"
FT                   /db_xref="InterPro:IPR011034"
FT                   /db_xref="InterPro:IPR036477"
FT                   /db_xref="InterPro:IPR041711"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5ZN20"
FT                   /protein_id="ACI53361.1"
FT                   /translation="MSLSIIFMGTPEFSVPTLRLLVDAGHRIVAVYTQPPRPGGRRGLD
FT                   LQKSPVHQAAELLGLPVFTPVNFKDPEERERFAALKADVAVVVAYGLLLPEAVLNGTRD
FT                   GCYNGHASLLPRWRGAAPIQRAIMAGDAETGMMVMKMDKGLDTGAVALTRKVEIGPNMT
FT                   AGELHDRLMQVGAKAMAEAMVKLEMNDLPLTPQPQDGVLYAAKIDKAETRIDFARPALD
FT                   VHNHIRGLAPFPGAWFELEIGGKPERVKVLGSELAEGQGAAGELLTDDLVVACASGAVR
FT                   LTRLQKAGGKPLAAADFLRGTPLAAGMRLS"
FT   gene            59776..60582
FT                   /locus_tag="Rleg2_0059"
FT   CDS_pept        59776..60582
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0059"
FT                   /product="tRNA pseudouridine synthase A"
FT                   /EC_number="5.4.99.12"
FT                   /note="KEGG: rec:RHECIAT_CH0000458 tRNA-pseudouridine
FT                   synthase I protein; TIGRFAM: tRNA pseudouridine synthase A;
FT                   PFAM: tRNA pseudouridine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53362"
FT                   /db_xref="GOA:B5ZN21"
FT                   /db_xref="InterPro:IPR001406"
FT                   /db_xref="InterPro:IPR020095"
FT                   /db_xref="InterPro:IPR020097"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5ZN21"
FT                   /protein_id="ACI53362.1"
FT                   /translation="MPRFRMTVEYDGGPYVGWQRQENGPSVQGAIEAAVLSLTGETVSI
FT                   RGAGRTDSGVHAMGQVIHADLSKAWSPYQLQNALNAHLRLAGERVSILDVEAVAEFFDA
FT                   RFSALRRHYLYRIVSRRAPLALEAGKAWWVPKVLDHEVMHAAAQRLVGRHDFSTFRAAH
FT                   CQANSPVRTLDRLDVTRSGELIEIRATAQSFLHNQIRSFAGTLKLAGEGKWTPDDVEAA
FT                   LEARDRKACGPVAPPDGLYFLQVDYPDVIPDRRRPVTDADDGDNLS"
FT   gene            complement(60589..61185)
FT                   /locus_tag="Rleg2_0060"
FT   CDS_pept        complement(60589..61185)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0060"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ret:RHE_CH00416 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53363"
FT                   /db_xref="GOA:B5ZN22"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZN22"
FT                   /protein_id="ACI53363.1"
FT                   /translation="MPGLREVQYYLAGLWLLIRLDPRGFRYLDLSERGVNRSFWAIAWC
FT                   LPPMGISWLWWRQVFLRSMPPEADVGFAFYLRLGFVELANWFVPLVFAGLLLLAFRMGE
FT                   RFAPVVVSVNWLGVPLSYINGLLLAMVVFLPGSVGLVSLLLLAFMLAQVFVLARILRMI
FT                   CHGHPLMVGAMTLVLLVPSMILSEYLQHFLGIYPV"
FT   gene            complement(61172..62365)
FT                   /locus_tag="Rleg2_0061"
FT   CDS_pept        complement(61172..62365)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0061"
FT                   /product="succinyl-diaminopimelate desuccinylase"
FT                   /note="TIGRFAM: succinyl-diaminopimelate desuccinylase;
FT                   PFAM: peptidase M20; peptidase dimerisation domain protein;
FT                   KEGG: rec:RHECIAT_CH0000460 succinyl-diaminopimelate
FT                   desuccinylase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53364"
FT                   /db_xref="GOA:B5ZN23"
FT                   /db_xref="InterPro:IPR001261"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR005941"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5ZN23"
FT                   /protein_id="ACI53364.1"
FT                   /translation="MTATDPVANLQTLIRCPSVTPAEGGALSALDAMLAPLGFTVDKVK
FT                   ASEAGTADIENLYARLGKDGPHLMFAGHTDVVPVGDEADWTHPPFAAEISKGELFGRGA
FT                   VDMKGGIACFIAAVARHIEKNGPPKGSISFLITGDEEGPAINGTIKLLRWAAERGERWD
FT                   ACLVGEPTNPDRLGDMIKIGRRGSLSGKITVHGVQGHAAYPHLADNPVRGMLQLTQALM
FT                   DPPFDGGTDDFQPSNLEVTTVDVGNPATNVIPAKASASFNIRFNDSWTAETLRAEILRR
FT                   LDAAAGDGRLRPGREPVKYDIVWADRPSHVFLTRNNALIASLSSAVEGVIGRSPKLSTT
FT                   GGTSDARFIKDYCPVVEFGLVGQTMHMVDERVAVSDLETLTAIYETFIAHWFANAGA"
FT   gene            complement(62465..63325)
FT                   /locus_tag="Rleg2_0062"
FT   CDS_pept        complement(62465..63325)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0062"
FT                   /product="2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
FT                   N-succinyltransferase"
FT                   /EC_number="2.3.1.117"
FT                   /note="TIGRFAM:
FT                   2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
FT                   N-succinyltransferase; KEGG: ret:RHE_CH00418
FT                   2,3,4,5-tetrahydropyridine-2-carboxylate
FT                   N-succinyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53365"
FT                   /db_xref="GOA:B5ZN24"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005664"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR023180"
FT                   /db_xref="InterPro:IPR037133"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5ZN24"
FT                   /protein_id="ACI53365.1"
FT                   /translation="MSATDLASLEKTIEAAFDNRDNVNTSTKGEVRDAVEAALDLLDAG
FT                   KVRVATRGADGAWTVNQWLKKAVLLSFRLNDMDVVKGGSGNSTWWDKVPSKFEGWGENH
FT                   FRAAGFRAVPNCVVRRSAYIAPNAILMPSFVNLGAYVGEGTMVDTWATVGSCAQIGKHV
FT                   HLSGGVGIGGVLEPMQAGPTIIEDNCFIGARSEVVEGCIVREGSVLGMGVFIGKSTKIV
FT                   DRATGEVSYGEVPPYSVVVAGSMPSGNATMGNGKPAPHLYCAVIVKRVDEQTRSKTGIN
FT                   ELLRD"
FT   gene            63519..64385
FT                   /locus_tag="Rleg2_0063"
FT   CDS_pept        63519..64385
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0063"
FT                   /product="conserved hypothetical protein"
FT                   /note="PFAM: conserved hypothetical protein; KEGG:
FT                   rec:RHECIAT_CH0000462 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53366"
FT                   /db_xref="InterPro:IPR031100"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZN25"
FT                   /protein_id="ACI53366.1"
FT                   /translation="MAKGRNGGSRRKDGVWDPLKSSSTDRQRAEAVPKTPQTMSPAYRL
FT                   AYVDEDFLCREELRPIRLQLELMKPEMMLTERGIKSTVVMFGGARIPAPGQSAWAARND
FT                   IQRVNLEAASVYYDEARKFARLCSKYSASFDFHEYVIVTGGGPGVMEAGNRGATDEGAP
FT                   SIGLNIVLPHEQAPNAYVTPELSFNFHYFAIRKMHFMVRAKAIAVFPGGFGTLDEFFEC
FT                   LTLIQTGRMERLPLILFGEAFWRNIINFDALAEFGTIAPDDVKLISFVDTAEAAWKIIQ
FT                   NFYEHRE"
FT   gene            complement(64581..65222)
FT                   /locus_tag="Rleg2_0064"
FT   CDS_pept        complement(64581..65222)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0064"
FT                   /product="Calcium-binding EF-hand-containing protein"
FT                   /note="SMART: Calcium-binding EF-hand-containing protein;
FT                   KEGG: rec:RHECIAT_CH0000463 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53367"
FT                   /db_xref="GOA:B5ZN26"
FT                   /db_xref="InterPro:IPR002048"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZN26"
FT                   /protein_id="ACI53367.1"
FT                   /translation="MYRNKLILAALSSTLIFGAAAGAGYAAPGDGPRQHAGMHGPHGPG
FT                   SAAFREITYVRMLKQFDANKDGKVSKEEATAGLDKVFAAIDTNNDGSLTPGEISAYQKT
FT                   QMQAMRDQRKQEAGDNKGDTAAATPDNDDQERPPRDGHGGHDGRDGHRWMRHGGTFMRA
FT                   SMMMHRVDTDQNGQISKQEAVAAFDKLFARMDSNKDGVISIDDMPDRPLL"
FT   sig_peptide     complement(65142..65222)
FT                   /locus_tag="Rleg2_0064"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.930 at
FT                   residue 27"
FT   gene            complement(65343..66056)
FT                   /locus_tag="Rleg2_0065"
FT   CDS_pept        complement(65343..66056)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0065"
FT                   /product="pyrimidine 5'-nucleotidase"
FT                   /note="TIGRFAM: HAD-superfamily hydrolase, subfamily IA,
FT                   variant 3; pyrimidine 5'-nucleotidase; PFAM: Haloacid
FT                   dehalogenase domain protein hydrolase; KEGG:
FT                   ret:RHE_CH00421 putative hydrolase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53368"
FT                   /db_xref="GOA:B5ZN27"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR010237"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZN27"
FT                   /protein_id="ACI53368.1"
FT                   /translation="MTKIDRTPDKADFAHVTDWVFDLDNTLYPHHVNLFAQIDKNMTAY
FT                   VAALLQMEREEARKLQKQYYLEHGTTLQGLMIHHGIDPNDFLEKAHAIDYTALTPQPEL
FT                   GAAIKALPGRKFIFTNGSVKHAEMTAGALGILEHFDDIFDIVAADYVPKPAQATYDKFT
FT                   ALKRVETSKAAMFEDLPRNLTVPKALGMQTVLLVPRNLEETLVEWWEKTSGEEDHIDFV
FT                   TDDLAAFLGKITAPG"
FT   gene            66160..67233
FT                   /locus_tag="Rleg2_0066"
FT   CDS_pept        66160..67233
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0066"
FT                   /product="methylated-DNA/protein-cysteine
FT                   methyltransferase"
FT                   /note="KEGG: ret:RHE_CH00423
FT                   methylated-DNA-[protein]-cysteine S-methyltransferase
FT                   protein; TIGRFAM: methylated-DNA/protein-cysteine
FT                   methyltransferase; PFAM: Ada metal-binding domain protein;
FT                   Methylated-DNA-[protein]-cysteine S-methyltransferase DNA
FT                   binding; SMART: helix-turn-helix- domain containing protein
FT                   AraC type"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53369"
FT                   /db_xref="GOA:B5ZN28"
FT                   /db_xref="InterPro:IPR001497"
FT                   /db_xref="InterPro:IPR004026"
FT                   /db_xref="InterPro:IPR008332"
FT                   /db_xref="InterPro:IPR014048"
FT                   /db_xref="InterPro:IPR016221"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR035451"
FT                   /db_xref="InterPro:IPR036217"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036631"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZN28"
FT                   /protein_id="ACI53369.1"
FT                   /translation="MLFERPDDDTLYDALIARSADYEGQAYVCVKTTGIFCRLTCPARK
FT                   PKRENTLFFETIAACMHSGFRPCRRCRPLEQPGREPIVDELLAALDAQPEVRWTEEEIV
FT                   RRGHDPLTVRRAFKRALGMTFHDIVRYIRLGEAARQLADGARVIDAQIDAGYESPSGFR
FT                   TAFQRLVGQAPALSQNRELLFADWFDTPLGPMIAVADKTHLHLLEFHDRKALPTELDAL
FT                   QKRVRSSVAIGRTPVIDQIEAEIRNYFEGRLTVFTTPLALGGTPFEKHVWAKLMEIPVG
FT                   KTRAYGDLAREMERPEVVRAVGRANGANQLAIIVPCHRILGADGSLTGYGGGLWRKQWL
FT                   LRHEEKIGTQAKMEETT"
FT   gene            67230..68000
FT                   /locus_tag="Rleg2_0067"
FT   CDS_pept        67230..68000
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0067"
FT                   /product="putative PEP phosphonomutase protein"
FT                   /note="KEGG: rec:RHECIAT_CH0000467 putative PEP
FT                   phosphonomutase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53370"
FT                   /db_xref="GOA:B5ZN29"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR039556"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZN29"
FT                   /protein_id="ACI53370.1"
FT                   /translation="MNQTEKAKAFHALHKKGDPIVLYNIWDAGTAKAVADAGAKALATG
FT                   SWSVAAAHGFADGEKLPMPVLVEMAKSITDVIDLPLSVDFEGAYSTEPEGAAANVARLV
FT                   EIGAIGINFEDRVDAGEGLYPVESQAARIRAIRAMADGKDIPFFINARTDLFLAEGDLA
FT                   KHAGLVDEAIERGRAYAAAGGNGFFVPGLIDPALIEKICAASSLPVNIMMRAGAPDVKT
FT                   LAKLGVGRISYGPGPYRSMMEKLKQEAAAIYSLL"
FT   gene            complement(68067..69215)
FT                   /locus_tag="Rleg2_0068"
FT   CDS_pept        complement(68067..69215)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0068"
FT                   /product="FMN-dependent alpha-hydroxy acid dehydrogenase"
FT                   /note="PFAM: FMN-dependent alpha-hydroxy acid
FT                   dehydrogenase; KEGG: ret:RHE_CH00425 L-lactate
FT                   dehydrogenase (cytochrome) protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53371"
FT                   /db_xref="GOA:B5ZN30"
FT                   /db_xref="InterPro:IPR000262"
FT                   /db_xref="InterPro:IPR008259"
FT                   /db_xref="InterPro:IPR012133"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR037396"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZN30"
FT                   /protein_id="ACI53371.1"
FT                   /translation="MRLTDCYNFHDFRRMAKQRLPGPIFDYIDGAADDEVTYRRNTAAF
FT                   EACDLVPDVLRGVAEVDMSVTVMGQKLAMPVYCSPTALQRLFHHQGERAVAAAAGKYGT
FT                   MFGVSSLGTISLEEARQISAGPQVYQFYFHKDRGLNHEMMARAKNAGVQAMMLTVDSIT
FT                   GGNRERDKRTGFAIPFKLNLAGMAQFAIKPSWAIDWLTHERFRLPQLENHVKMDGGSLS
FT                   ISRYFTEMLDPSMSWDDVAEMVRAWGGQFCLKGIMSVEDAKRAVEIGCTGIVLSNHGGR
FT                   QLDGSRSAFDQLAEIVDAVGDRIDVMMDGGVQRGTHVLKALSLGAKAVGLGRYYLFPLA
FT                   AAGRPGVERALETIRTEIERDMKLMGCTSVDQLTRRNLRFRS"
FT   gene            complement(69323..70285)
FT                   /locus_tag="Rleg2_0069"
FT   CDS_pept        complement(69323..70285)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0069"
FT                   /product="fatty acid desaturase"
FT                   /note="PFAM: fatty acid desaturase; KEGG: ret:RHE_CH00426
FT                   probable fatty acid desaturase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53372"
FT                   /db_xref="GOA:B5ZN31"
FT                   /db_xref="InterPro:IPR005804"
FT                   /db_xref="InterPro:IPR015876"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZN31"
FT                   /protein_id="ACI53372.1"
FT                   /translation="MSSISTGRMIDDSSDPVKGRVVWMPAKSVWISAMTMTAIIGGPLT
FT                   FTWSAFAVFILLTAMTICLGHSVGMHRLLIHRSFSTPLWIEHFLVYLGTLVGMAGPFGM
FT                   IYAHDIRDWAQRQRDCHDLYAHRRSFFTDAFWQMHCAVALNHPPRFVLDERERRDRFYR
FT                   FLEATWMAQQIPLALALLALGGLPWVVWGIAVRVSVSLTGHWLVGHFAHRAGHQGWSVD
FT                   DVAVQGYNLPHFGLVTFGESFHGNHHAFPESARLGIEPGQLDLGWHFIRVLSGLGLASA
FT                   IKLPHMIVPRQGLKRVNAAEASGGSHPPYQAAGQAKSRP"
FT   gene            70457..70822
FT                   /locus_tag="Rleg2_0070"
FT   CDS_pept        70457..70822
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0070"
FT                   /product="transcriptional regulator, ArsR family"
FT                   /note="PFAM: regulatory protein ArsR; Helix-turn-helix type
FT                   11 domain protein; KEGG: ret:RHE_CH00427 probable
FT                   transcriptional regulator protein, ArsR family"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53373"
FT                   /db_xref="GOA:B5ZN32"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZN32"
FT                   /protein_id="ACI53373.1"
FT                   /translation="MEDETFDDISEGSSVGAAQRVFHALSSAPRRKILAYLSASGLTAG
FT                   EIADRFSMSKPAVSQHLSILETAGLIKREKQGQFVHYSLIENNLVNTLNGFVQEVCPVG
FT                   RPIKKESQARIRAKELP"
FT   gene            complement(70998..71885)
FT                   /locus_tag="Rleg2_0071"
FT   CDS_pept        complement(70998..71885)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0071"
FT                   /product="acetylglutamate kinase"
FT                   /EC_number="2.7.2.8"
FT                   /note="KEGG: rec:RHECIAT_CH0000469 acetylglutamate kinase
FT                   protein; TIGRFAM: acetylglutamate kinase; PFAM:
FT                   aspartate/glutamate/uridylate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53374"
FT                   /db_xref="GOA:B5ZN33"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001057"
FT                   /db_xref="InterPro:IPR004662"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR037528"
FT                   /db_xref="InterPro:IPR041727"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5ZN33"
FT                   /protein_id="ACI53374.1"
FT                   /translation="MNESESELQARLLAKALPFMQRYENKTIVVKYGGHAMGNPELGKA
FT                   FASDIALLKQSGVNPIVVHGGGPQIGAMLNKMGIESKFEGGLRVTDQKTVEIVEMVLAG
FT                   SINKEIVALINQTGEWAIGLCGKDGNMVFAEKARKTVKDPDSNIERVLDLGFVGEVVEV
FT                   DRTLLDLLARSEMIPVIAPVAPGRDGATYNINADTFAGAIAGALNATRLLFLTDVAGVL
FT                   DKNGQLIKELSVAEAHALIADGTISGGMIPKVETCIDAIKAGVQGVVILNGKTAHSVLL
FT                   EIFTEHGIGTLIVP"
FT   gene            72029..72568
FT                   /locus_tag="Rleg2_0072"
FT   CDS_pept        72029..72568
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0072"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /note="TIGRFAM: RNA polymerase sigma factor, sigma-70
FT                   family; PFAM: sigma-70 region 2 domain protein; sigma-70
FT                   region 4 domain protein; Sigma-70 region 4 type 2; KEGG:
FT                   rec:RHECIAT_CH0000470 RNA polymerase sigma-70 factor
FT                   protein, ECF family"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53375"
FT                   /db_xref="GOA:B5ZN34"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZN34"
FT                   /protein_id="ACI53375.1"
FT                   /translation="MQGDEIADLIGRVALRDRRAFVALYNQTGPKLFAICLRILKDRTE
FT                   AEEALQEVYISIWQRAGSYQSATGSSSAWLSAIARNRSIDALRSRKPVADEIDSAYDLA
FT                   DAAPDPEMQTVTKDEGRRIDTCMEELEADRAVAVKRAYVEGLSYQELADQFGVPLNTMR
FT                   TWLRRSLLKLRECMER"
FT   gene            72565..73284
FT                   /locus_tag="Rleg2_0073"
FT   CDS_pept        72565..73284
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0073"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rec:RHECIAT_CH0000471 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53376"
FT                   /db_xref="GOA:B5ZN35"
FT                   /db_xref="InterPro:IPR018764"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZN35"
FT                   /protein_id="ACI53376.1"
FT                   /translation="MTSPDKSKGDRSRDEVLAGEYVLGVLSLQDRRVVEERMRHDRPFA
FT                   AIVSRWETNLSAFNDEYETASPNRETFKQIEARLFGDAEKPASFSQGLWNSAVFWRSLS
FT                   FACVVVAVSAVIFASGVVPEPQGPTPLVASLAGQNSAINLLASYELQSGRLKIVPVAAG
FT                   KPEEKSLELWLVPGSGLPKSLGVFQPGESGELVIPADLRSNLADGATLAVSLEPFGGSP
FT                   TGQATGPVIASGALRRP"
FT   gene            73426..73980
FT                   /locus_tag="Rleg2_0074"
FT   CDS_pept        73426..73980
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0074"
FT                   /product="beta-Ig-H3/fasciclin"
FT                   /note="PFAM: beta-Ig-H3/fasciclin; KEGG:
FT                   rec:RHECIAT_CH0000472 putative transforming growth
FT                   factor-induced protein (and secreted protein MPB70)"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53377"
FT                   /db_xref="InterPro:IPR000782"
FT                   /db_xref="InterPro:IPR036378"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZN36"
FT                   /protein_id="ACI53377.1"
FT                   /translation="MIKSVLRGFALATALSAVAFAAAKNPEVGGAPMFATKNIIENAVN
FT                   SKDHTTLVAAVKAAGLVSTLEGKGPFTVFAPTNEAFAALPKGTVETLLKPENKSTLTKV
FT                   LTCHVVAADAMAKTVAKMIKDDGGEHDIKTVGGCVLKAKESMGKITLTDENGGVSHVTI
FT                   ADVKQSNGVIHVVDKVLLPKM"
FT   sig_peptide     73426..73491
FT                   /locus_tag="Rleg2_0074"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.846 at
FT                   residue 22"
FT   gene            complement(74078..75154)
FT                   /locus_tag="Rleg2_0075"
FT   CDS_pept        complement(74078..75154)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0075"
FT                   /product="signal transduction histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase dimerisation/phosphoacceptor; KEGG:
FT                   rec:RHECIAT_CH0000473 probable two-component sensor
FT                   histidine kinase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53378"
FT                   /db_xref="GOA:B5ZN37"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011102"
FT                   /db_xref="InterPro:IPR011495"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZN37"
FT                   /protein_id="ACI53378.1"
FT                   /translation="MTDSKDQPLSPEGVGNLPHLAEALDDHRFRHFLDHVPFAVAVSEL
FT                   GDNEALIYVNLEFERLTALSAKQVEGKTWSELDLNSTAISGGATLTAAVTSAEEYIGAF
FT                   SLVAEPESTAIIDVWSNTIVNDDDTPLFRLVAFAARNEAAADQSFGELLTEKDVLLREL
FT                   QHRVKNNLQMITALIRMEARNAQQSEESERFARLAGRIEALALLYRSLSDEEKGATVDL
FT                   GTYVSQIAASVMAAHAVEGIRLDMKVDTWPVSVDVAMPAGLVINELLTNTLKHAFVGRD
FT                   GGEITLRCVVSDAGCRITVADNGVGLPQDVTWPHPGKLSAMIVQSLKQNARAKVEVTSS
FT                   PDAGVSVSLVFPIAEAAR"
FT   gene            complement(75420..75695)
FT                   /locus_tag="Rleg2_0076"
FT   CDS_pept        complement(75420..75695)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0076"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ret:RHE_CH00433 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53379"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZN38"
FT                   /protein_id="ACI53379.1"
FT                   /translation="MADEIKEIQSINTAWQIAIQEILRMVIRDMYHGGGEASFKTHIKR
FT                   IEEAAVDSIYTDLRLRGTDEWTEVLVKERASNFVTTLLTSFTYDRA"
FT   gene            complement(75696..75965)
FT                   /locus_tag="Rleg2_0077"
FT   CDS_pept        complement(75696..75965)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0077"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ret:RHE_CH00434 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53380"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZN39"
FT                   /protein_id="ACI53380.1"
FT                   /translation="MTETFSKSRQRAEIAFGNVQTQFFAKNKAVEELESDVQSQQAKTL
FT                   RLREARLSKGTQRPGLSNGRPCCKARPGRLTPHRADRELILKEA"
FT   gene            complement(76098..76307)
FT                   /locus_tag="Rleg2_0078"
FT   CDS_pept        complement(76098..76307)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0078"
FT                   /product="cold-shock DNA-binding domain protein"
FT                   /note="PFAM: Cold-shock protein DNA-binding; SMART: Cold
FT                   shock protein; KEGG: rec:RHECIAT_CH0000476 probable cold
FT                   shock protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53381"
FT                   /db_xref="GOA:B5ZN40"
FT                   /db_xref="InterPro:IPR002059"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012156"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZN40"
FT                   /protein_id="ACI53381.1"
FT                   /translation="MTTGTVKWFNSTKGFGFIQPDNGGADAFVHISAVERAGMRELVEG
FT                   QKIGFDLERDNKSGKMSACNLQNA"
FT   gene            complement(76667..77320)
FT                   /locus_tag="Rleg2_0079"
FT   CDS_pept        complement(76667..77320)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0079"
FT                   /product="GTP-binding protein HSR1-related"
FT                   /note="PFAM: GTP-binding protein HSR1-related; KEGG:
FT                   ret:RHE_CH00436 GTPase EngB"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53382"
FT                   /db_xref="GOA:B5ZN41"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR019987"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030393"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5ZN41"
FT                   /protein_id="ACI53382.1"
FT                   /translation="MPETEKPLFGHPWIFIRGVPSLNFLPPEGPLEVAFAGRSNVGKSS
FT                   LINALVGQKGLARTSNTPGRTQELNYFVPDGYSGESGDMPPMAIVDMPGYGYAQAPKEQ
FT                   VDKWTKLVFDYLRGRATLKRVYVLIDSRHGIKKNDDDVLDLLDKAAVSYQIVLTKTDKI
FT                   KAPAVPKLLAETAEKIRKRPAAYPGVLSTSSEKGDGLDDLRQAIGETVGVARWK"
FT   gene            complement(77463..79256)
FT                   /locus_tag="Rleg2_0080"
FT   CDS_pept        complement(77463..79256)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0080"
FT                   /product="60 kDa inner membrane insertion protein"
FT                   /note="PFAM: 60 kDa inner membrane insertion protein; KEGG:
FT                   rec:RHECIAT_CH0000478 inner membrane transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53383"
FT                   /db_xref="GOA:B5ZN42"
FT                   /db_xref="InterPro:IPR001708"
FT                   /db_xref="InterPro:IPR019998"
FT                   /db_xref="InterPro:IPR028053"
FT                   /db_xref="InterPro:IPR028055"
FT                   /db_xref="InterPro:IPR038210"
FT                   /db_xref="InterPro:IPR038221"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZN42"
FT                   /protein_id="ACI53383.1"
FT                   /translation="MEKNRNYFIAIALSVLIVLGWQFLYMNPRIEAQRKAQEAQKAQQK
FT                   TEQVQQPAANGAAPAPTSGTAPSGQAVATATLEQALAKNPRVVIDTPALSGSINLAGAR
FT                   LDDLKLKGYHETVDDSSPTITLFSPAETKDGYFTELGYIGSDATGNVPGASTLWTAPEG
FT                   AKLTDKTPVTLSYTNDKGLTFTRTISVDERYMFTVADKVENTGQAPVSLSSYGRVTRYN
FT                   KPTTPSVYVLHEGFIGVIGDDGLVETKYTAAEKEAVMPPKSTGGWLGITDKYWAATIIP
FT                   PQTSAYEARFSHFADGQPRYQADYKDDAFTVAPGQSIELKNLVFAGAKEVPVIDGYETS
FT                   YSIPKFDRLIDWGWFYFITKPMFKLMDFFYRFFGNFGVAILCTTIVVKALFFPLASKQY
FT                   ASMANMKRMQPKMEELKAKFADDRMGLQQATMQLYKEEKINPIAGCWPVALQIPIFFSL
FT                   YKVIYITIEMRHAPFFGWIKDLSAPDPTTIVNLFGLLPFEAPTILHLGVWPLIMGVTMF
FT                   LQMRMNPTPPDPTQAMIFTWMPLVFMFMLASFPAGLVIYWAWNNTLSVIQQSVIMKRQG
FT                   VKVELFDNLKGLFRRKTAPSK"
FT   gene            complement(79256..79657)
FT                   /locus_tag="Rleg2_0081"
FT   CDS_pept        complement(79256..79657)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0081"
FT                   /product="ribonuclease P protein component"
FT                   /note="TIGRFAM: ribonuclease P protein component; PFAM:
FT                   ribonuclease P protein; KEGG: rec:RHECIAT_CH0000479
FT                   ribonuclease P protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53384"
FT                   /db_xref="GOA:B5ZN43"
FT                   /db_xref="InterPro:IPR000100"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZN43"
FT                   /protein_id="ACI53384.1"
FT                   /translation="MAGELTTKKEKHTVGRLKSRPQFLAVREGEKRRGGLFLLEVLDRK
FT                   EPDSQARVGFTVTKKHGNAVERNRMRRRLKEAVRLHAGFAMQPGHDYVVVARRDVLEAS
FT                   FKELAAELKFRVETRPKPRRSGDGRPRNV"
FT   gene            complement(79679..79813)
FT                   /locus_tag="Rleg2_0082"
FT   CDS_pept        complement(79679..79813)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0082"
FT                   /product="ribosomal protein L34"
FT                   /note="PFAM: ribosomal protein L34; KEGG:
FT                   rec:RHECIAT_CH0000480 50S ribosomal protein L34"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53385"
FT                   /db_xref="GOA:B5ZN44"
FT                   /db_xref="InterPro:IPR000271"
FT                   /db_xref="InterPro:IPR020939"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5ZN44"
FT                   /protein_id="ACI53385.1"
FT                   /translation="MKRTYQPSKLVRKRRHGFRARMSTKGGRKVIAGRRAQGRKRLSA"
FT   gene            80232..82229
FT                   /locus_tag="Rleg2_0083"
FT   CDS_pept        80232..82229
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0083"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="PFAM: histidine kinase HAMP region domain protein;
FT                   chemotaxis sensory transducer; KEGG: rec:RHECIAT_CH0000481
FT                   methyl-accepting chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53386"
FT                   /db_xref="GOA:B5ZN45"
FT                   /db_xref="InterPro:IPR000727"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZN45"
FT                   /protein_id="ACI53386.1"
FT                   /translation="MKIRGKINLLVCVMGAVALLIGATALSAMHEYNRNLTAYEQAAAR
FT                   AYAGERLNRFVTAVVMEARGIYAAKTIKDTPNFAKGLLAGLDEIDKVIAGWAPLVPEDE
FT                   KGDFAKLVARAAEFRTFRMETARLGTEVGPEAASAQGNNDANRANRKAFQAEIDAVVAT
FT                   DKAALETVNTEIESFRTWVLMLVLSITGIGIAVGIGMGFYIGTSHLSRPIKRVTRAINE
FT                   VASGNFEAEVPFAGRQDEIGEMAAAVAVFKANGLAVQRLNAQETAMRAKSDDLQSSMSV
FT                   VVAAAAAGDFGHRISKDYEDENLNRFAGNINTLLSSVDAGIGETRRVIASLADGDLTQT
FT                   MNGSFQGAFAELQQNVNNTFVTLQATMREVRQTTEAMNGNTAELRNASDDLSKRTEQQA
FT                   AALEQTSAALDQITAVVQNSTERAHEATIMVSEAKDKSGASGVVVGNAVEAMGRIEQAS
FT                   REISQIINVIDEIAFQTNLLALNAGVEAARAGEAGKGFAVVAQEVRELAQRSAKAAKDI
FT                   KALITKSGNEVQVGVKLVQATGEALAEIGTRVIAINDHIHSIATAATEQSTGLKEVNTA
FT                   VNQMDQVTQQNAAMVEETSAATHRLSAEAGGLVRLISRFKLSDDAPAPVALVRNEPQRP
FT                   VASPARRAIAKVARAFGGNAAAAEQSWEEF"
FT   sig_peptide     80232..80315
FT                   /locus_tag="Rleg2_0083"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.472 at
FT                   residue 28"
FT   gene            82575..84107
FT                   /locus_tag="Rleg2_0084"
FT   CDS_pept        82575..84107
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0084"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase HAMP region domain protein; histidine
FT                   kinase A domain protein; KEGG: rec:RHECIAT_CH0000482
FT                   two-component sensor histidine kinase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53387"
FT                   /db_xref="GOA:B5ZN46"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZN46"
FT                   /protein_id="ACI53387.1"
FT                   /translation="MPVQDQGDNPSADIPAAGETARAPCPSAGMFGGMFGGLSGKLLWL
FT                   TVFFIMLAEILIFFPSVASMRIRWLEDRLNTAAAAAIVIDGLQPVELPRALQKETLEAT
FT                   GTKAIVLRKDGTSRLLATTDMPTSVDEAYDLTDVPPATAMRDALDTLIFGGSRMIRVYG
FT                   PVGDTNTGVEVVMKDRQLRTAMFAYSRNVLLLSVLISLFTATLIFFAINRILIGPIRRL
FT                   TGSMQQFSSDPENPAHIYIGDGGRDELAVAGRNLTSMQMELQKTLKQQKNLAALGLAVS
FT                   KINHDMRNILASAQLMSDRLVDVDDPMVKSFAPKLLRTIDRAVGYTTEVLSYGKASESA
FT                   PRRRHILLLELTQDVKDMLAIDPQSGIEFTEQIGADLKVDADGEQLFRVIHNLCRNALQ
FT                   ALTAPGEGAPGAVRRITVAAQRVGSVVSITVDDTGPGMPLKARQNLFAAFRGSARSGGT
FT                   GLGLTIARELVLAHGGTIALVEKPTVGTQFRIEIPDRPVSLEDYRSRTHSEK"
FT   gene            84230..84306
FT                   /locus_tag="Rleg2_R0001"
FT                   /note="tRNA-Arg1"
FT   tRNA            84230..84306
FT                   /locus_tag="Rleg2_R0001"
FT                   /product="tRNA-Arg"
FT   gene            complement(84335..84445)
FT                   /pseudo
FT                   /locus_tag="Rleg2_0085"
FT   gene            84528..84764
FT                   /locus_tag="Rleg2_0086"
FT   CDS_pept        84528..84764
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0086"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: atc:AGR_L_816 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53388"
FT                   /db_xref="GOA:B5ZN47"
FT                   /db_xref="InterPro:IPR002145"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZN47"
FT                   /protein_id="ACI53388.1"
FT                   /translation="MKNNVDISDDLSRRIDMLAERSNLTRSQIIEDALSHGRSLAWQEK
FT                   WIAGVQAGIEDADRGNFATDEEIAAVLNKYGQA"
FT   gene            84772..85044
FT                   /locus_tag="Rleg2_0087"
FT   CDS_pept        84772..85044
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0087"
FT                   /product="plasmid stabilization system"
FT                   /note="PFAM: plasmid stabilization system; KEGG:
FT                   atc:AGR_L_815 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53389"
FT                   /db_xref="InterPro:IPR007712"
FT                   /db_xref="InterPro:IPR035093"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZNM9"
FT                   /protein_id="ACI53389.1"
FT                   /translation="MRLVWTKRYLKELADINDYIGERNPRAAARVVNDIHSKTEKLLSA
FT                   NPFLGRAGEIRGTRELVIPATPYIHRCLPRSRRPYRSSVCPARRA"
FT   gene            85190..85843
FT                   /locus_tag="Rleg2_0088"
FT   CDS_pept        85190..85843
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0088"
FT                   /product="putative DNA methylase protein"
FT                   /note="KEGG: rec:RHECIAT_CH0000508 putative DNA methylase
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53390"
FT                   /db_xref="GOA:B5ZNN0"
FT                   /db_xref="InterPro:IPR002941"
FT                   /db_xref="InterPro:IPR017985"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZNN0"
FT                   /protein_id="ACI53390.1"
FT                   /translation="MAISELWTVSTRHQFPLPDFQNGDEIRFPGALVSALLDRFTKSGD
FT                   AVFDPFVGLGTTFFVCEQRGRIPYGTEADRQRYEWVKQRITTKHHLVCGDSAELAAFDF
FT                   PEMDFCITSPPYMPHWHKWNPLYNGDADYDGYDIYLKRMQEIYGRICKRMKTNAYLVVQ
FT                   ADNLTNEQFSPLVWDLGRALSEVMTLEGEIMVNWSEAVESGNQYTQCLVFQNAK"
FT   gene            complement(85896..86282)
FT                   /locus_tag="Rleg2_0089"
FT   CDS_pept        complement(85896..86282)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0089"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rec:RHECIAT_CH0000509 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53391"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZNN1"
FT                   /protein_id="ACI53391.1"
FT                   /translation="MRKVGMRKKSAMVDGQRLLALVSILLGSAVQAFPCDQPVVLSNWK
FT                   SCQIAPLSEEGGAADWKAVPEWTREKAISRFFLNDPRSLANHGLCNAKFHRVVVCWPGW
FT                   DEGDKNACSYHICDGASWERPKGT"
FT   sig_peptide     complement(86184..86282)
FT                   /locus_tag="Rleg2_0089"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.989) with cleavage site probability 0.988 at
FT                   residue 33"
FT   gene            complement(86544..87206)
FT                   /locus_tag="Rleg2_0090"
FT   CDS_pept        complement(86544..87206)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0090"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_A6246 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53392"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZNN2"
FT                   /protein_id="ACI53392.1"
FT                   /translation="MHNAKFIRTAAFSLCVAFQTFQAEQVMAASANDKFFDAALCKPPY
FT                   SMTSATEIYDAAEALAKPDTSSLGAAIYKIPSQIGRDGFKSTEVFFASNAVGILVEGQR
FT                   ADDLAKKYRLKPESSDLLGTSTKGYSRELPADQQPEPGLAGPGTVGGHPDDTSRNMGAG
FT                   RRLADRGGSGSRSGVRGLRRCHVGQTKPGRSAAGLYRSCDRSRNPNQGLRPFGPCWA"
FT   sig_peptide     complement(87120..87206)
FT                   /locus_tag="Rleg2_0090"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.924 at
FT                   residue 29"
FT   gene            87391..87570
FT                   /locus_tag="Rleg2_0091"
FT   CDS_pept        87391..87570
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0091"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: atc:AGR_L_287 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53393"
FT                   /db_xref="GOA:B5ZNN3"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZNN3"
FT                   /protein_id="ACI53393.1"
FT                   /translation="MIAAYIDEIIMFCAGLWMTSVGFGYLPLPGYSASPPLVRHFKWMG
FT                   PMLLVIAIVLAAAS"
FT   gene            87586..87882
FT                   /locus_tag="Rleg2_0092"
FT   CDS_pept        87586..87882
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0092"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53394"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZNN4"
FT                   /protein_id="ACI53394.1"
FT                   /translation="MNNMLACPSCGLDETESIVHLGSYILRCAACGEAIVATSSMGMFD
FT                   SDHAFSAFADPGPGKHPAPEMLIARGPLRQISTAISGAARNGTLIRLIPDPKG"
FT   gene            complement(87910..88785)
FT                   /locus_tag="Rleg2_0093"
FT   CDS_pept        complement(87910..88785)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0093"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: rec:RHECIAT_PC0000013 probable
FT                   transcriptional regulator protein, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53395"
FT                   /db_xref="GOA:B5ZNN5"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZNN5"
FT                   /protein_id="ACI53395.1"
FT                   /translation="MAQPRRKLPPLNALRAFEVSGRRLNFRAAAEELGVSQGAVAQQVR
FT                   ALEDQLGLMLFQRLPRGLALTPHGAAYLTDVTRAFDTLGEATGRLLARPDAVTISVTPT
FT                   VAAKLLIPRLAEFKSALPDVELRTVATEALSDFDRDQVDIAVRLTRRPFPASLEARLLF
FT                   RQELVAVASPYLVKGLPLPLTADALRKLPLLHDAVSPWPLVLRSREKLPGAVFNHTTLA
FT                   LDAALAGQGVALACRAFVAADLEAGRLVQVIDATTLIEPDYFLIRKRASSPRKAVDAVW
FT                   YWCAARLSVG"
FT   gene            88900..89604
FT                   /locus_tag="Rleg2_0094"
FT   CDS_pept        88900..89604
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0094"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   ret:RHE_PF00008 probable oxidoreductase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53396"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZNN6"
FT                   /protein_id="ACI53396.1"
FT                   /translation="MSKEKVALITAGGSGMGAAAARKLAADGYRIAVLSSSGKGEALAK
FT                   ELGGVGVTGSNLVNDDVKRLVDLAMERWGRIDALVNSAGHGPRAPILEITDEDWHKGIE
FT                   VYFLSAVRPIRLVAPIMEAQGGGAIVNISTAWAFEPSAMFPTSAFARAGLASFTKIFAD
FT                   TYAAKNIRMNNVLPGWIDSLPATDERRDSVPMGRYGTSEEIAATVAFLLSEGAGYITGQ
FT                   NIRVDGGITRSV"
FT   sig_peptide     88900..88965
FT                   /locus_tag="Rleg2_0094"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.992) with cleavage site probability 0.674 at
FT                   residue 22"
FT   gene            89609..90217
FT                   /locus_tag="Rleg2_0095"
FT   CDS_pept        89609..90217
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0095"
FT                   /product="pyridoxamine 5'-phosphate oxidase-related
FT                   FMN-binding"
FT                   /note="PFAM: pyridoxamine 5'-phosphate oxidase-related
FT                   FMN-binding; KEGG: rec:RHECIAT_PC0000011 putative
FT                   pyridoxamine 5'-phosphate oxidase-related FMN-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53397"
FT                   /db_xref="GOA:B5ZNN7"
FT                   /db_xref="InterPro:IPR000659"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="InterPro:IPR024624"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZNN7"
FT                   /protein_id="ACI53397.1"
FT                   /translation="MQTDHEAVPLTLADIDASAWRALETAASSPQSGFRFLNLCSVDAE
FT                   QKPQARMVVLRRADGSLRVLEFHTDTRSPKWLEFSANPHATVLGFCPQTRLQFRLQGTV
FT                   ELHAPGSDQANAAWDKLSPWTRTTYTGGPPGDECAFDVIDETALPKPADEAEGKPHFGL
FT                   LIFRARTLDWFQLRRQGNRRALSTYDETGALAACRWVNP"
FT   gene            complement(90249..91721)
FT                   /locus_tag="Rleg2_0096"
FT   CDS_pept        complement(90249..91721)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0096"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: atu:Atu4248 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53398"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZNN8"
FT                   /protein_id="ACI53398.1"
FT                   /translation="MKSSHWKRVVWFCVCAALSSPAWSDDGVTIPGYAPATGVERGYSV
FT                   QKATETDMSFWFDNSAASVTARGVFHPRMTVLSRDETGMRVRWSLNAELPEGTTGPADS
FT                   YQMNLLYRNSLAAYGTSTLELETDLNGFPSNPVGVDRILAHMREMAANGPGGAAAPPDN
FT                   GVNGIIGKIEQNPLLIVTALVPEAQLLATGQFYQDQLMQIGQAEAASRTEDYNGVNVPV
FT                   TSTWTLESTDATSRTATLSVSEEFDPAALSRSQEPATAKMMAAFPERVKNLTAEQLASI
FT                   KRAGKTRSVKFVVSLDDGSAVEATEIVSVTTGGFALRTYTHILREDMPARLPLPAVLTA
FT                   KVLQTPDLHVEPLPSAKAEPGILDELSTRPSPAESQETPVATENDVGEAIAPVSLEVKS
FT                   AEVARSAISYDRGLNIELTPESAAKFRDFTQAALGRQTQLLINDQVVMEPWMREPIMDG
FT                   RIVLAGTDGKDLEAMAEQLKVPGASIVVRLRP"
FT   sig_peptide     complement(91647..91721)
FT                   /locus_tag="Rleg2_0096"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 25"
FT   gene            91991..92578
FT                   /locus_tag="Rleg2_0097"
FT   CDS_pept        91991..92578
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0097"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rec:RHECIAT_CH0000510 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53399"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZNN9"
FT                   /protein_id="ACI53399.1"
FT                   /translation="MVEFNPRDKSRTSAGKTRAMVRKHTAPPGRSDDGSLRWQWLTIQL
FT                   LESPSFTTLSANACRAFFRIVIEHTAHAALENGKLVVTHPQFVSYGVTGEYVADALDEL
FT                   DYKGLIKIHRGRAGSGVAHPNRFTLTFVGDHEGAPATDDWKRCTVENCRKWSETDRKLA
FT                   ADKRGRVGRKKKTPLRNPEIPPLRDSEIRRAS"
FT   gene            complement(92772..93470)
FT                   /locus_tag="Rleg2_0098"
FT   CDS_pept        complement(92772..93470)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0098"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: Methyltransferase type 11; Methyltransferase
FT                   type 12; KEGG: bja:blr7575 O-methyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53400"
FT                   /db_xref="GOA:B5ZNP0"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZNP0"
FT                   /protein_id="ACI53400.1"
FT                   /translation="MASPWVNDALSHARSAFSNKINTDILEVGGGSRTHIPLEGARYTV
FT                   LDISKEQLERNRDASERILGDAQTIDYGDRRFDACVFWDVLEHLESPRSALLRAHDTLS
FT                   PGGLVFVKGPILNSAKGIFTDLTPWWTHVLFYRYVLRQKNAGKPGYAPFRVEHAAEASH
FT                   SEIAGTLKELGMDIVFIGEYVSTQVHALKDRIPPLYWLYEAFGLLLRTASAGKIGGRET
FT                   EFLIVAKCLR"
FT   gene            93637..93957
FT                   /locus_tag="Rleg2_0099"
FT   CDS_pept        93637..93957
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0099"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rec:RHECIAT_CH0000511 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53401"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZNP1"
FT                   /protein_id="ACI53401.1"
FT                   /translation="MMVGIFRALAVLAMMTALAGCIDHANDPVLLAVGVPVNPPAVAHG
FT                   ICMTDGNAMYDEARKQYQIRAQLTGYAQADELEAETIARAAAHRQYVACLSGQGYRTLY
FT                   AN"
FT   sig_peptide     93637..93714
FT                   /locus_tag="Rleg2_0099"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.967) with cleavage site probability 0.779 at
FT                   residue 26"
FT   gene            94148..94519
FT                   /locus_tag="Rleg2_0100"
FT   CDS_pept        94148..94519
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0100"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rec:RHECIAT_CH0000512 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53402"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZNP2"
FT                   /protein_id="ACI53402.1"
FT                   /translation="MKMFRLTPSTTALSAFLALASIAPAQAAPVQVVRPPDIQTVKMVQ
FT                   YKPHAGSWHGYQGFRTERPGTRRHSDGYWYPLAAFGVEPGTTGSIVRQPVNRPAAPEMC
FT                   NPTFSGSIGPGSMPCDNGY"
FT   sig_peptide     94148..94231
FT                   /locus_tag="Rleg2_0100"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 28"
FT   gene            94674..94970
FT                   /locus_tag="Rleg2_0101"
FT   CDS_pept        94674..94970
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0101"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rec:RHECIAT_CH0000513 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53403"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZNP3"
FT                   /protein_id="ACI53403.1"
FT                   /translation="MTTTFKTGLAAATLSAILGLSAFSATAAPLQSSATEQGATVRPVA
FT                   QETKVEHDRRTTGSIGERAENMGSTHYMMNPKKPLNMDCKLGFNPTSSSSCNY"
FT   sig_peptide     94674..94757
FT                   /locus_tag="Rleg2_0101"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.963 at
FT                   residue 28"
FT   gene            95258..95929
FT                   /locus_tag="Rleg2_0102"
FT   CDS_pept        95258..95929
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0102"
FT                   /product="Methyltransferase type 12"
FT                   /note="PFAM: Methyltransferase type 12; KEGG:
FT                   ret:RHE_CH00448 phospholipid N-methyltransferase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53404"
FT                   /db_xref="GOA:B5ZNP4"
FT                   /db_xref="InterPro:IPR001737"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZNP4"
FT                   /protein_id="ACI53404.1"
FT                   /translation="MTAKAACSDFLHFFRSWISNPLRVAAIAPSGDSLARIMTSEIAAL
FT                   DGPIIELGPGTGVFTRALLARGVSEADLTLIEYGPEFITALHARFPTARVLQMDAAHLA
FT                   HADIFEGEPVGAVVSGLPLLSMSPRKIASILAGAFAYMRPGGAVYQFTYGPRCPVPRPI
FT                   LDRLGLKAVRIGGTVRNLPPASVYRISRRKPLELSRERFSYRESEAELDDIAAFSNETG
FT                   G"
FT   gene            95949..96581
FT                   /locus_tag="Rleg2_0103"
FT   CDS_pept        95949..96581
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0103"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: bja:bll1252
FT                   transcriptional regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53405"
FT                   /db_xref="GOA:B5ZNP5"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="InterPro:IPR041347"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZNP5"
FT                   /protein_id="ACI53405.1"
FT                   /translation="MADSKRAATEGRRDRKRRQTRERIEQAAMSLFLQRGFEATTVEDI
FT                   TEAADVSKRSFFDYFPSKEEVVFAWQDSFADRLTAAVAARPAEEPLVAVVEAAITATVI
FT                   ASIDERGLALAELIHRTPALRARDQLKYARVEQKLAEALLLRKRNDPQERSRMRILAAV
FT                   VIGALRVGAELWQQRPPGAAPQDFAAEIFAELWSILAELGDEAKARL"
FT   gene            96796..97677
FT                   /locus_tag="Rleg2_0104"
FT   CDS_pept        96796..97677
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0104"
FT                   /product="aldo/keto reductase"
FT                   /note="PFAM: aldo/keto reductase; KEGG: ret:RHE_CH00449
FT                   probable oxidoreductase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53406"
FT                   /db_xref="GOA:B5ZNP6"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZNP6"
FT                   /protein_id="ACI53406.1"
FT                   /translation="MSSHNAAKSGTFKIGGEIAVNRLGFGAMRVTGKGIWGEPDDHAES
FT                   IRTLKRLPELGVNFIDTADSYGPDISEWLIKEALHPYGGKSVVATKGGLTRHGPDIWLP
FT                   VGRPEYLIQQAHKSLRNLGLEQIDLWQLHRIDPKVPAKEQFDAIKSLLDAGLIRHAGLS
FT                   EVSVADIEAASKHFKVATVQNRYNLVDRTSEDVLDYCAKHNIGFIPWFPLAAGDLAKSG
FT                   SLLDTIARKHNAAPSQIALAWVLKRSPVMLPIPGTSKVKHLEENVAAVDITLSDEEFSA
FT                   LDAEGRKAFKAA"
FT   gene            98282..99559
FT                   /locus_tag="Rleg2_0105"
FT   CDS_pept        98282..99559
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0105"
FT                   /product="protein of unknown function DUF900 hydrolase
FT                   family protein"
FT                   /note="PFAM: protein of unknown function DUF900 hydrolase
FT                   family protein; KEGG: rec:RHECIAT_CH0000517 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53407"
FT                   /db_xref="InterPro:IPR010297"
FT                   /db_xref="InterPro:IPR014586"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZNP7"
FT                   /protein_id="ACI53407.1"
FT                   /translation="MIGRWRGPRAALTGVLLAAFALAGCGGRPVGVMQAAGSVPPGTSK
FT                   VDLLVATTRAADDNPAVLFSGERGTGLTVNAVDVSIPPEANRKVGQVQWPKRLPADPLR
FT                   DFVTVSVDPLEGERAGETWLKGHMPKSRRVLVFVHGFNNRYEDAVYRFAQIVHDSHADV
FT                   APVVFTWPSRASIFDYNYDKESTNYSRDALEELLTRTAANPAVSDVTIMAHSMGTWLTV
FT                   EALRQMAIRNGHVASKINNVILASPDLDVDVFGRQFASLGKDRPHFTIFVSRDDRALAL
FT                   SRRISGNVDRLGQIDPSVEPYRSKLEAAGITVLDLTKLKGGDRLNHGKFAESPEVVKLI
FT                   GDRLIAGQTITDSNVGLGEAVGAVAMGAAQTAGSAVSVAVSTPIAIFDPRTRRNYDAQL
FT                   KRLGRSVDNTVGSVGDSVGAGLPESQ"
FT   sig_peptide     98282..98353
FT                   /locus_tag="Rleg2_0105"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.954) with cleavage site probability 0.391 at
FT                   residue 24"
FT   gene            99718..100968
FT                   /locus_tag="Rleg2_0106"
FT   CDS_pept        99718..100968
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0106"
FT                   /product="FAD dependent oxidoreductase"
FT                   /note="PFAM: FAD dependent oxidoreductase; KEGG:
FT                   rec:RHECIAT_CH0000518 probable D-amino acid dehydrogenase
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53408"
FT                   /db_xref="GOA:B5ZNP8"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZNP8"
FT                   /protein_id="ACI53408.1"
FT                   /translation="MAEETKKRVVVVGAGVIGASIAFELQRRGLAVTLIDKAEPGRGTS
FT                   YGNMASIALDFVAGSGPSIWRKMPGWLLDPEGPVWLRPSYAAKMLPWFLRFLAAGRPSR
FT                   LRAIEDAGMSLSQRALSDFRQMLEAIGAPELMTEEGCLAIYETEAEFAADRGHLAMMQR
FT                   YGLEFEVLSNGAIQYYEPALSPSIAKAVLLPDNKSIRDPYQLVVKLAEAAKAAGAAFVS
FT                   GAVRNIERRGDGTAVVLLEDGSRIEADSVVLAAGVHTRFLAEKLGEPIPLETERGYHTQ
FT                   IMKPGISMRYSMIWPARAFMVTPTAGGIRVGGNVELAGLDAAPDFRRPRVLVRHAQRAL
FT                   PGLKLEEATDWMGHRPALPDTIPIISPSSKMPGVFYATGHGHLGLTYAATTARLIGDMV
FT                   TGLKPPLDITPFRIDRY"
FT   gene            101022..102059
FT                   /locus_tag="Rleg2_0107"
FT   CDS_pept        101022..102059
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0107"
FT                   /product="proline racemase"
FT                   /note="PFAM: proline racemase; KEGG: ret:RHE_CH00452
FT                   probable proline racemase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53409"
FT                   /db_xref="InterPro:IPR008794"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZNP9"
FT                   /protein_id="ACI53409.1"
FT                   /translation="MRWKRTIQLLDVHAEGEIGRVAIGGVPKIPGETIAAQLHWLNTDP
FT                   KGDELRRFLCLEPRGAPIGSVNLLLPARHPEADAAFIILQPDQAHASSGSNSICVTTAL
FT                   LESGIVEMQEPETIVTLETAAGLVKATATCRDGRCEKVKLTMVPSFVHELDVEIDTPHW
FT                   GRIKADLCYGGIFYALVDVGQIGLTIEKANAAGLVQAGMILKELINRDIKVVHPEIPAI
FT                   SGVAYVMFRDSEADGTVRTCTTMWPGRADRSPCGTGNSANLAALHARGKAKVGDVFTSK
FT                   SIIGSEFEVGLQALTEVAGRPAVIPTITGRGFTFGLTQVALDPFDPHPGGFALTDVWGP
FT                   SAGEI"
FT   gene            complement(102095..102475)
FT                   /locus_tag="Rleg2_0108"
FT   CDS_pept        complement(102095..102475)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0108"
FT                   /product="TfoX domain protein"
FT                   /note="PFAM: TfoX domain protein; KEGG: ret:RHE_CH00453
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53410"
FT                   /db_xref="InterPro:IPR007076"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZNQ0"
FT                   /protein_id="ACI53410.1"
FT                   /translation="MGNEATRSLALEFASQIAPPGAIDIRRFFGGSALVRNGAQFGFVM
FT                   KGTLYLRVDATMRAEFEADGSEPFSYRAAGREVTVRRYYAVPAHVIDDPSLLRRCSERA
FT                   FDATTRPARKRSKATLAVSLPG"
FT   gene            complement(102468..102830)
FT                   /locus_tag="Rleg2_0109"
FT   CDS_pept        complement(102468..102830)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0109"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ret:RHE_CH00454 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53411"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZNQ1"
FT                   /protein_id="ACI53411.1"
FT                   /translation="MTPEALWNRYAAIWSLDADAREPEMSACLADDVTYCDPNGAIAGR
FT                   AGLAAYMAGFKESVPAGRFIILGVLHHNERSLARWELRHEDETVLQTGTSFAAMSDGRL
FT                   SAITGFFDPLAGRHHG"
FT   gene            complement(102827..103408)
FT                   /locus_tag="Rleg2_0110"
FT   CDS_pept        complement(102827..103408)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0110"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG:
FT                   rec:RHECIAT_CH0000523 probable transcriptional regulator
FT                   protein, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53412"
FT                   /db_xref="GOA:B5ZNQ2"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZNQ2"
FT                   /protein_id="ACI53412.1"
FT                   /translation="MGRTREFDEEAVLKGAMQAFRKHGYQGASIRDLEEATGLKGGSIY
FT                   HAFGDKAGLFDAAFRHYNRTVLEGRIERFAPPGSGVKGLRELFLSLLHEADNGSLGCLI
FT                   TNTAVEFGGDVNTHPRVEAALGLLRSTFRSRLCESSTLARDTDEAKADRTAVRLLALYQ
FT                   GLLVLIRGGEDKASLRQAIEDEFNQLETLL"
FT   gene            103672..104535
FT                   /locus_tag="Rleg2_0111"
FT   CDS_pept        103672..104535
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0111"
FT                   /product="alpha/beta hydrolase fold"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG:
FT                   bac:BamMC406_5269 alpha/beta hydrolase fold"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53413"
FT                   /db_xref="GOA:B5ZNQ3"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZNQ3"
FT                   /protein_id="ACI53413.1"
FT                   /translation="MNATIRYLRSATCYAEAPNLWVNVGETPFVYRDLGPQGGVPVILL
FT                   NHWGAVLDNFDPRIVDGLASKHHVIAIDYRGIGASGGTAPVTIDEMARDAIALIRALGF
FT                   KQVDLLGFSLGGFVAQDIVLKAPDLVRKLILTGTGPAGGKGIEKVGAVSWPLMIKGLLT
FT                   LRDPKTYLFFTSTANGRRAAKAFLDRLKERKAGRDKSPTPRAFLRQLKAIKAWGRQAPQ
FT                   DLGRITIPVLIANGDSDIMVPTVNSADMARRIPGAQLVTYNDAGHGGIFQNHADFVPKA
FT                   LSFLAA"
FT   gene            104569..105573
FT                   /locus_tag="Rleg2_0112"
FT   CDS_pept        104569..105573
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0112"
FT                   /product="Alcohol dehydrogenase zinc-binding domain
FT                   protein"
FT                   /note="PFAM: Alcohol dehydrogenase zinc-binding domain
FT                   protein; Alcohol dehydrogenase GroES domain protein; KEGG:
FT                   rec:RHECIAT_CH0000529 probable zinc-binding oxidoreductase
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53414"
FT                   /db_xref="GOA:B5ZNQ4"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZNQ4"
FT                   /protein_id="ACI53414.1"
FT                   /translation="MKAFVVDKYKKKGALRLASLPEPELQDNDVLVRVQATAVNLLDSK
FT                   LRDGEFKLILPYRPPFVLGHDVAGTVVRAGPRVRRLKVGDEVYARPRDHRVGTFAEFIA
FT                   IDEADLALKPNNLSMAEAASIPLVGLTAWQALVEVGKVKPGQKVFIQAGSGGVGTFAIQ
FT                   LAKHLGAMVATTTSAGNAELAKSLGADVIVDYKSQDFEKVLSGYDLVLNSQDPKTLEKS
FT                   LAVLKPGGRLISISGPPDPAFARELGLNLFLKLVLRLLSRGVRKKAKRLGIGYSFLFMR
FT                   AEGRQLNEITRLIEQGAIRPVVDKVFPFEKTGDALAYVETGRAKGKVVITVAD"
FT   gene            105645..106739
FT                   /locus_tag="Rleg2_0113"
FT   CDS_pept        105645..106739
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0113"
FT                   /product="NADH:flavin oxidoreductase/NADH oxidase"
FT                   /note="PFAM: NADH:flavin oxidoreductase/NADH oxidase; KEGG:
FT                   atc:AGR_pAT_653 GTN Reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53415"
FT                   /db_xref="GOA:B5ZNQ5"
FT                   /db_xref="InterPro:IPR001155"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZNQ5"
FT                   /protein_id="ACI53415.1"
FT                   /translation="MTSKTLFEPFVLGSLTLSNRIVMAPLTRNRAGAGFVPGDLIAEYY
FT                   AQRASAGLIISEATQISQQGQGYQDTPGIYTQAQIDGWRKVTDAVHAKGGHIFLQLWHV
FT                   GRVSHVDLQPNGQHPVAPSAIKAETKTFVNNSFVDVSAPRALELHEISGIVEDFRRAAA
FT                   NAIAAGFDGVEIHGANGYLLDQFARDGANTRTDAYGGSIENRARLMLEVTAAVIKEVGA
FT                   KRTGVRISPVSPANGISATDPQAQFNYIVEKLDEMGIAYLHVVEGATGGPRDVAPFDYE
FT                   ALRRRFSNTYIANNGYDRELATARLEQGLADLFAFGRPFIANPDFVERLKIGASLANLD
FT                   MATLYGGGAAGYTDYPEMAEPVSA"
FT   gene            complement(106754..107347)
FT                   /locus_tag="Rleg2_0114"
FT   CDS_pept        complement(106754..107347)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0114"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG:
FT                   rec:RHECIAT_CH0000530 putative transcriptional regulator
FT                   protein, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53416"
FT                   /db_xref="GOA:B5ZNQ6"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZNQ6"
FT                   /protein_id="ACI53416.1"
FT                   /translation="MRITKEKKQENYDRIISTASELFRERGFDGVGVAELMERAGLTHG
FT                   GFYNHFRSKEDLIAESTENGLNETLQRYAGYDVLAVMELYLAREHRDGRGQGCTAAALS
FT                   CDAARQPEETKAVFAAGVDRLVRAIEDGIARHHVSDTGDRAQAITILAQAVGAIVLSRA
FT                   CPDDSPLADELLDACRADCRDAIENRARDNRAAV"
FT   gene            107576..108286
FT                   /locus_tag="Rleg2_0115"
FT   CDS_pept        107576..108286
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0115"
FT                   /product="hydrolase or acyltransferase (alpha/beta
FT                   hydrolase superfamily)-like protein"
FT                   /note="KEGG: rde:RD1_2829 haloacetate dehalogenase H-1,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53417"
FT                   /db_xref="GOA:B5ZNQ7"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR000639"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZNQ7"
FT                   /protein_id="ACI53417.1"
FT                   /translation="MFDGFESGRVTVGETEIAYVAAGEGEPVLMLHGFPQTKALWARIA
FT                   PELVALGYRVICAGLRGYGASGKPLARADLANYSFRAMAADQLGLMKALGHARFHLVGH
FT                   DRGARVAYRLALDHPAAVASVTLMDIVPTAIMLTDLRRDVAQSYWHWFFLAQPAPFPER
FT                   MIEANPISFMKPASSDGARRVRRISMLNSSLLIGPHGMMPKRLPVAATITERRWPSISP
FT                   TIWRSRGDAYLRPL"
FT   gene            complement(108739..109794)
FT                   /locus_tag="Rleg2_0116"
FT   CDS_pept        complement(108739..109794)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0116"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: helix-turn-helix- domain containing protein
FT                   AraC type; KEGG: pol:Bpro_1392 transcriptional regulator,
FT                   AraC family with amidase-like domain"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53418"
FT                   /db_xref="GOA:B5ZNQ8"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZNQ8"
FT                   /protein_id="ACI53418.1"
FT                   /translation="MNADANLSDAPAIEPDYVRWLDGLWAERLLAARDRKADLSIGILL
FT                   WPSFPMMSLTGIVEPLRHAADFADNSRPLHCRWSIMGAPGHAAVASCGIRVQADAPYIN
FT                   PTDFDYIAVIGGLLPHLRAAPSKHRDYLRVAASAGVAVIGVCTGVFVLAQEGLLTGRKA
FT                   SVHPFHAEDFKIAFPRQAFSTRDDFLIENGRITVPGGVSILSLMTELIGTHCGPDRAAK
FT                   AVHQLSLTEHKGLSAFDQGRVSSFRHVEDSRIQRAVVLIESRKGRDVSPEQAASMIGLS
FT                   PRQFGRLFQQGIGMTPKRFIIETRLRYARFLVENSTLSMTQIAFETGFSDAAHFATAFR
FT                   QKFNQSPRQLR"
FT   gene            109957..110835
FT                   /locus_tag="Rleg2_0117"
FT   CDS_pept        109957..110835
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0117"
FT                   /product="extracellular solute-binding protein family 3"
FT                   /note="PFAM: extracellular solute-binding protein family 3;
FT                   KEGG: pol:Bpro_1391 extracellular solute-binding protein,
FT                   family 3"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53419"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZNQ9"
FT                   /protein_id="ACI53419.1"
FT                   /translation="MALSLSRRVVMCALLAGSFMASAPLANAFELAEQGKLTVAFTGDM
FT                   PGSGWQDGKLIGYDGEIMQRIADKLGLKIQPALMEWSGTIASVQSGRVDVMLGTMGWTE
FT                   KRTKIMTLSEPIHYFKNGIMQSNKTNWDKLSDLEGKKVGTITGFSFVPELKTIKGIDLS
FT                   LYDTSDAAVRDLIAGRIDAVIGDPPVVSYAIKQNSDWNMHFLAFTDNSPDFPLLTGLGQ
FT                   VVYGLNQKNDDLRQKMDAIIADMWKSCEMKEIGARYGLSADVWFKPVGANFRAGVDRPG
FT                   DYKLPSCAAGG"
FT   sig_peptide     109957..110043
FT                   /locus_tag="Rleg2_0117"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.954 at
FT                   residue 29"
FT   gene            110916..111668
FT                   /locus_tag="Rleg2_0118"
FT   CDS_pept        110916..111668
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0118"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: pol:Bpro_1390 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53420"
FT                   /db_xref="GOA:B5ZNR0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030679"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZNR0"
FT                   /protein_id="ACI53420.1"
FT                   /translation="MNALLSVAGLRKSYGPVEVLKGIDFTVAPGEKIALIGPSGSGKST
FT                   CLRCMNFLEKPNAGEISLDGERIGVRNGQVMRDRQLAPQRAEMGMVFQLFNLWPHLSVT
FT                   ENVAIAARKVRGLSAAEARELALEMLAKVHMTHRADASPLELSGGQQQRVAIARALAQK
FT                   PKLMLFDEPTSALDPELVHEVLKVMEELAAEGRTMLIVTHEIAFARDIADRVLFLDGGK
FT                   IVEAGPARQVITAPREARTQAFLNKIRH"
FT   gene            111674..112333
FT                   /locus_tag="Rleg2_0119"
FT   CDS_pept        111674..112333
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0119"
FT                   /product="polar amino acid ABC transporter, inner membrane
FT                   subunit"
FT                   /note="TIGRFAM: polar amino acid ABC transporter, inner
FT                   membrane subunit; PFAM: binding-protein-dependent transport
FT                   systems inner membrane component; KEGG: pol:Bpro_1389 amino
FT                   acid ABC transporter, permease protein, 3-TM region,
FT                   His/Glu/Gln/Arg/opine"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53421"
FT                   /db_xref="GOA:B5ZNR1"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZNR1"
FT                   /protein_id="ACI53421.1"
FT                   /translation="MSGFSLFFSVVQGLAAGLGVTVLVTLASLAFAIGIGFLLALVRQF
FT                   TAIRVVNLAIDAYCEILCNVPALTHLFILYFGLASIGVRLTSIAAAILGLGLIGAAITS
FT                   SIFRAGFASLPKGQAEASLAAGLTPLQTIFEILTPQAMRIALPALGNYAVQLLKDTSVV
FT                   SAIAAPEIMFFARSMVTSSFQTTMIYATAAALYLLLSLPLMQATKFLERRYGRLKG"
FT   sig_peptide     111674..111772
FT                   /locus_tag="Rleg2_0119"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.947) with cleavage site probability 0.642 at
FT                   residue 33"
FT   gene            112330..112989
FT                   /locus_tag="Rleg2_0120"
FT   CDS_pept        112330..112989
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0120"
FT                   /product="polar amino acid ABC transporter, inner membrane
FT                   subunit"
FT                   /note="TIGRFAM: polar amino acid ABC transporter, inner
FT                   membrane subunit; PFAM: binding-protein-dependent transport
FT                   systems inner membrane component; KEGG: pol:Bpro_1388 amino
FT                   acid ABC transporter, permease protein, 3-TM region,
FT                   His/Glu/Gln/Arg/opine"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53422"
FT                   /db_xref="GOA:B5ZNR2"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZNR2"
FT                   /protein_id="ACI53422.1"
FT                   /translation="MSGFFAPYRDYGGEWLPLLLRAMVNTAVLSVCAFALALVLGLLLS
FT                   LCQRSGLAALRHFAALYVTVVRGVPLLAVLFLLYFGLPGIGIVFDAFGAALAGLALCFA
FT                   AQIAELFRAGLKAIPAGQGEAALAVGLTPVQSFRLIIFPQVVRVILAPMIVTFVALLKD
FT                   SSLASLITVNELVLTGRAMATEYFLPLQIYVAVGLCYFAIAWPFSVVSRRLAVPAR"
FT   gene            113010..114233
FT                   /locus_tag="Rleg2_0121"
FT   CDS_pept        113010..114233
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0121"
FT                   /product="peptidase C26"
FT                   /note="PFAM: glutamine amidotransferase class-I;
FT                   Endoribonuclease L-PSP; peptidase C26; KEGG: rru:Rru_A0651
FT                   glutamine amidotransferase class-I"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53423"
FT                   /db_xref="GOA:B5ZNR3"
FT                   /db_xref="InterPro:IPR011697"
FT                   /db_xref="InterPro:IPR013813"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZNR3"
FT                   /protein_id="ACI53423.1"
FT                   /translation="MTTDMTVAPVTAFPAGPAGKARPFILITPDLGETPQQPTECEYVV
FT                   RSNYAEAITSAGGVPLILPYDAENIEAALALADGIVLTGSRPGAEVADRRRDFERQLVA
FT                   KALTRGKPLLGICHGMQLIGECLGGEFLSELPATGISHIPQDLPDELAHEIIVEPGSLL
FT                   AGWVGTGPTRVNSLHRHALSGHGRFRVIARAPDGIIEAFEGETEAFCLGVQWHPEYRLT
FT                   VLDLEIFKAFVARSAEAGESRRVEPGMSGSDAVHRRLAALGLTLPEAETPPGAFAGAVR
FT                   TGNIVTVSGQVPVAGGAVWRTGRLGADISIEEGRECARICLLNVLAQLERASGGFDKVR
FT                   GFVRLAGYVAATEDFTRHGAVADGASELLRDLFPDRWEHARIAIGVSSLPRGVPVEIEL
FT                   TALVGNEV"
FT   gene            114235..115458
FT                   /locus_tag="Rleg2_0122"
FT   CDS_pept        114235..115458
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0122"
FT                   /product="D-amino-acid dehydrogenase"
FT                   /EC_number="1.4.99.6"
FT                   /note="PFAM: FAD dependent oxidoreductase; KEGG:
FT                   dac:Daci_0069 D-amino-acid dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53424"
FT                   /db_xref="GOA:B5ZNR4"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZNR4"
FT                   /protein_id="ACI53424.1"
FT                   /translation="MARIAVIGAGVIGVSSAYLLAKAGHDVTLIDAAAEPGSGASAGNA
FT                   AQLSWAYGDAMASPGLLRHLPAIALGRDPAFRIRWQLDPDFFLWGLRFLANAPFSRWWS
FT                   NTRAILELAGESRRELASLLAETGLSFDYRLAGKLHLYPDQHSFAAAQSAVSRKNALGF
FT                   EQQMLSRAEAQEIEPALAGYQGEIAGAVYTPGDALGDAAGFCRQLTHHIAQHHRVSLLF
FT                   GRKVAGFSREADRLAAVRFDDREELAVDAAVVAAGAQVRLLAAELPEVRPVRPVRGYSL
FT                   TVPRTAAAPAISLTDVKRKLAFASIGDRFRVAGLADIERPGAGFDPARFEALRSAGAGV
FT                   LPHLFDNSVVLMRWSGERPMTPSSRPIIGPSEHLKGVYINTGHGMLGWTLALGSARKMV
FT                   DLIATQTR"
FT   sig_peptide     114235..114300
FT                   /locus_tag="Rleg2_0122"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.963) with cleavage site probability 0.942 at
FT                   residue 22"
FT   gene            complement(115473..115949)
FT                   /locus_tag="Rleg2_0123"
FT   CDS_pept        complement(115473..115949)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0123"
FT                   /product="RbsD or FucU transport"
FT                   /note="PFAM: RbsD or FucU transport; KEGG:
FT                   rec:RHECIAT_CH0000534 fucose dissimilation pathway protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53425"
FT                   /db_xref="GOA:B5ZNR5"
FT                   /db_xref="InterPro:IPR007721"
FT                   /db_xref="InterPro:IPR023750"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZNR5"
FT                   /protein_id="ACI53425.1"
FT                   /translation="MLKGLDPLLSPELLFTLRAMGHGDEIAIVDGNYPGVEHARRLIRL
FT                   DGHHLVPVLNAVLSVMPIDDFVPEAIFRSTVKAERDKLDPVHEEMIDCCARHEPHRQVV
FT                   PLLGPDFYGRVKAAHAVIQTSEPRLYANIILRKGVIYPKEPGTQSAAGVDPFVY"
FT   gene            complement(115933..117180)
FT                   /locus_tag="Rleg2_0124"
FT   CDS_pept        complement(115933..117180)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0124"
FT                   /product="ROK family protein"
FT                   /note="PFAM: ROK family protein; KEGG:
FT                   rec:RHECIAT_CH0000535 sugar transcriptional regulator
FT                   protein, ROK family"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53426"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZNR6"
FT                   /protein_id="ACI53426.1"
FT                   /translation="MSSLDGPEHTPVPPPILNPAGGANQVRVRAYNERLVLSLVRLYGA
FT                   LSKADIARRSGLSAQTVSVIMRVLEKEGLLSRGAPVRGRVGQPSIPMHLNADAVYSFGL
FT                   KMGRRSADLVLMDFVGRIRMQLHRTYAYPLPEEILAFVTSGIQELEDRLDDKQRGRIAG
FT                   LGIAAPFELWNWAEEVGAPPGAMEVWRDVDLQADIAARVSHPVFMQNDATSACGAELVF
FT                   GVGPSYPDFVYFFIGSFIGGGIVLNSAIFSGRTGTAGAIGPLPVRGKNGDTMQLLEIAS
FT                   IFVLENMLRERGIDPEPLWYSADDWVDFGEPMETWIQDSAKALAQAIVAAASIVDFSAA
FT                   VIDGGFPQWVRSRVVQATIDEAAKLDLQGVVMPEIIEGAVGAQARAIGGASLPIFARYL
FT                   TDQNVLFKEVDHAERT"
FT   gene            117408..118427
FT                   /locus_tag="Rleg2_0125"
FT   CDS_pept        117408..118427
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0125"
FT                   /product="periplasmic binding protein/LacI transcriptional
FT                   regulator"
FT                   /note="PFAM: periplasmic binding protein/LacI
FT                   transcriptional regulator; KEGG: rec:RHECIAT_CH0000536
FT                   fructose ABC transporter, substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53427"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZNR7"
FT                   /protein_id="ACI53427.1"
FT                   /translation="MKKSVLAFGALALGVAFSAPVMAADVSACLITKTDTNPFFVKMKE
FT                   GATAKAKELGVSLKSYAGKIDGDSESQVAAIESCIADGAKGILLTASDTKGIVPAVKKA
FT                   RDAGLLVIALDTPLEPADAADATFATDNLLAGKLIGQWAKETMGDKAKDAKVGFLDLTP
FT                   SQPTVDVLRDQGFMMGFGIDPKNPDKIGDEDDKRIVGHDVTNGNEEGGRKAMENLLQKD
FT                   PGINVIHTINEPAAVGAYQALKAVGMEKNVLIVSVDGGCPGVKSVKEGVIGATSQQYPL
FT                   LMASLGIEAIKKFADSGEKPKPTEGKSFFDTGVSLVTDKPVSGVKSIDTKEGTDKCWG"
FT   sig_peptide     117408..117479
FT                   /locus_tag="Rleg2_0125"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 24"
FT   gene            118583..119647
FT                   /locus_tag="Rleg2_0126"
FT   CDS_pept        118583..119647
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0126"
FT                   /product="Monosaccharide-transporting ATPase"
FT                   /EC_number="3.6.3.17"
FT                   /note="PFAM: inner-membrane translocator; KEGG:
FT                   ret:RHE_CH00466 fructose ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53428"
FT                   /db_xref="GOA:B5ZNR8"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZNR8"
FT                   /protein_id="ACI53428.1"
FT                   /translation="MTGTQEFERVLDGSDKSVASFEHQDVSLIKRAQHFLHSTPAAVPL
FT                   IVLVLAIIIFGATIGGRFFSSYTLTLILQQIAIVGILGAAQTLVILTAGIDLSIGVIMV
FT                   ISAVIMGNVAITYGIPTPIAVIGGLLVGGLCGLLNGFLVAYMKLPPFIVTLGTWNIVMA
FT                   TNFIYSANETIRDTDVDEQAPLLHLFAMSFKAGTAVLTLGVIAMVLLVLVLWYVLNHTA
FT                   WGRHVYAVGDDPEAAKLSGIQTKKVLLTVYTISGVIAAFAAWVSIGRNGSISPSSAVTD
FT                   YNLQAITATVIGGISLFGGRGSILGTLFGAMIVGVVSMGLNMLGADPQWKVLLTGVLII
FT                   AAVAIDQWIRKVSV"
FT   gene            119650..120447
FT                   /locus_tag="Rleg2_0127"
FT   CDS_pept        119650..120447
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0127"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: rec:RHECIAT_CH0000538 fructose ABC transporter,
FT                   ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53429"
FT                   /db_xref="GOA:B5ZNR9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZNR9"
FT                   /protein_id="ACI53429.1"
FT                   /translation="MAREPLLTAPLLTARGLVKRYGRVTALDNADFDLYPGEILAVIGD
FT                   NGAGKSSLIKAISGAVTPDEGVITLEGKQVQFRSPMEAREAGIETVYQNLALSPALSIA
FT                   DNMFLGREIRKPGMLGSMFRMLDRPAMEKLARNKLSELGLMTIQNINQAVETLSGGQRQ
FT                   GVAVARAAAFGSKVIIMDEPTAALGVKESRRVLELILDVRARGLPIVLISHNMPHVFEV
FT                   ADRIHIHRLGRRLTVIDPKEYTMSDAVAFMTGAKAVPTEPVAA"
FT   gene            120444..121076
FT                   /locus_tag="Rleg2_0128"
FT   CDS_pept        120444..121076
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0128"
FT                   /product="putative fructose transport system kinase"
FT                   /note="KEGG: ret:RHE_CH00468 putative fructose transport
FT                   system kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53430"
FT                   /db_xref="GOA:B5ZNS0"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZNS0"
FT                   /protein_id="ACI53430.1"
FT                   /translation="MTVSTEEIAGEVINRAGDSRRFLIGIAGPPGSGKSTMADNLAAAL
FT                   KARGESAAVLPMDGFHMDNAILIERGLLARKGIPETFDVRGFLDIVRAVRPADQEVLVP
FT                   VFDRSRELAIASARPIDPKDRFIIVEGNYLLFTEGKWAELDGIFDYTIMLAPPMEVLEE
FT                   RLWARWRGYNLSEEAASAKVYGNDLPNGRLILENRRPADVTLEIALA"
FT   gene            121254..122294
FT                   /locus_tag="Rleg2_0129"
FT   CDS_pept        121254..122294
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0129"
FT                   /product="dihydroorotase, homodimeric type"
FT                   /EC_number="3.5.2.3"
FT                   /note="KEGG: rec:RHECIAT_CH0000540 dihydroorotase protein;
FT                   TIGRFAM: dihydroorotase, homodimeric type; PFAM:
FT                   amidohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53431"
FT                   /db_xref="GOA:B5ZNS1"
FT                   /db_xref="InterPro:IPR002195"
FT                   /db_xref="InterPro:IPR004721"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5ZNS1"
FT                   /protein_id="ACI53431.1"
FT                   /translation="MQSITIRRPDDWHLHLRDGAMLEGVIADTSRTFARAIIMPNLVPP
FT                   VVTTSDATAYRERILKALPAGHRFQPLMTLYLTEHTSPDDVEAGARSGLITAVKLYPAG
FT                   ATTNSHGGVRDMEKAMPVLERMAAIGLPLCVHGEVTTPEVDIFDREAVFIDTVLDPLRR
FT                   RLPELKVTMEHVTTSDGIDYIKAAKANLAGSITSHHLIINRNAILVGGIRPHYYCLPVA
FT                   KRENHRLALRAAAVSGDARFFLGTDSAPHVDPLKECACGCAGIYTSINTMSCLAHVFEE
FT                   EDALDRLEAFTSLNGPAWYGLQPNEERITLSRQAEPVVFPAKIETGAGSVTVFDPMYPL
FT                   HWHVVA"
FT   gene            122474..123652
FT                   /locus_tag="Rleg2_0130"
FT   CDS_pept        122474..123652
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0130"
FT                   /product="diguanylate cyclase"
FT                   /note="TIGRFAM: diguanylate cyclase; PFAM: GGDEF domain
FT                   containing protein; KEGG: ret:RHE_CH00470 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53432"
FT                   /db_xref="GOA:B5ZNS2"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZNS2"
FT                   /protein_id="ACI53432.1"
FT                   /translation="MMLDYNSLLLALGVSTACLAVTLMGGWLVRRAETVLLTATVGLVF
FT                   VVSGIFVYSGYVDRPEIGFGIANFVLFHAGFATIWGAGRQFLTGRLPLPGIAIRALAAM
FT                   TFSIVPLLSGYDGLAFISDNLAIALLLFATARQYWLARAEAPAPILGITALYTLTGISF
FT                   VLCAAVLISDGKLVLGKAPSNWAEDLSLAVCIAGMTGIGALSLALHQWRLAARHRLEAI
FT                   TDPLTGLLNRRALFDQYGTRPMGSTTAVIVFDIDHFKSVNDRFGHASGDRVIKAFAAEL
FT                   ATHCRAGDIAARLGGEEFALVLKETMPGRAELAAERIRRAFEAREIEIDDEVLTCTVSV
FT                   GVAPGRAKSLDFDAMLSAADKALYAAKRGGRNRVELAGHLEAVPVEASRTAS"
FT   sig_peptide     122474..122551
FT                   /locus_tag="Rleg2_0130"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.992) with cleavage site probability 0.475 at
FT                   residue 26"
FT   gene            123840..124376
FT                   /locus_tag="Rleg2_0131"
FT   CDS_pept        123840..124376
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0131"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; KEGG: rec:RHECIAT_CH0000542 putative
FT                   glyoxalase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53433"
FT                   /db_xref="GOA:B5ZNS3"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZNS3"
FT                   /protein_id="ACI53433.1"
FT                   /translation="MRDFRDAKLMAKTLRQALADRDISLTHSETLEIVARQFGLEQWNI
FT                   LSAKIDAAGAPRSAIGIEPPMPIFRIFSVEKAMEFYCDFLGFHLDWEHRFGENFPLYCQ
FT                   VSRDGMALHLSEHSGDASPGAKAFVRVANVRAYHAELAGKDYHYMKPGVEEAPWGLEMT
FT                   VIDPFSNRIVFCEQR"
FT   gene            complement(124766..125248)
FT                   /locus_tag="Rleg2_0132"
FT   CDS_pept        complement(124766..125248)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0132"
FT                   /product="conserved hypothetical conserved membrane
FT                   protein"
FT                   /note="KEGG: ret:RHE_CH00472 hypothetical conserved
FT                   membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53434"
FT                   /db_xref="GOA:B5ZNS4"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZNS4"
FT                   /protein_id="ACI53434.1"
FT                   /translation="MQFVLILSLVAAAIGSGLVAGIFFAFSTFIMTAFSRIPAEQGIAA
FT                   MNSINVTIVRSPFMALFVPTAILCLVIAALALMNWRGGASALMLAGAALYVFASFLSTI
FT                   IFNVPMNDALEKVTVGGPEAAALWATYLKDWTWWNHVRTVASLLASVAFVRTLMMV"
FT   sig_peptide     complement(125141..125248)
FT                   /locus_tag="Rleg2_0132"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.997) with cleavage site probability 0.812 at
FT                   residue 36"
FT   gene            125346..126002
FT                   /locus_tag="Rleg2_0133"
FT   CDS_pept        125346..126002
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0133"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG:
FT                   rec:RHECIAT_CH0000544 putative transcriptional regulator
FT                   protein, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53435"
FT                   /db_xref="GOA:B5ZNS5"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR041674"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZNS5"
FT                   /protein_id="ACI53435.1"
FT                   /translation="MSEQPVATRRRNQQHPGQPRRIPSQQRGRDRFDKILAVASELIES
FT                   HGSDGLKMSEIVEKAGLSFGALYQYFPDKSAIIRTLAERFNEEGRRCVEAELAEVTDAA
FT                   ALTGALANIADEYYAFFRREPVMRDIWHATHTDKLLQQVDAEDMEFHARALLAVLVRLW
FT                   PDRDSGELLAIARLTMQLLAAAVRYAVSLGAKEGDAAIALFKKMQGLDIGRLLLE"
FT   gene            126073..126762
FT                   /locus_tag="Rleg2_0134"
FT   CDS_pept        126073..126762
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0134"
FT                   /product="orotate phosphoribosyltransferase"
FT                   /EC_number="2.4.2.10"
FT                   /note="KEGG: ret:RHE_CH00474 orotate
FT                   phosphoribosyltransferase; TIGRFAM: orotate
FT                   phosphoribosyltransferase; PFAM: phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53436"
FT                   /db_xref="GOA:B5ZNS6"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR004467"
FT                   /db_xref="InterPro:IPR023031"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5ZNS6"
FT                   /protein_id="ACI53436.1"
FT                   /translation="MIQTTFPDRAVMAELVAKMLWEIKAVHFNAAQPYKLASGMASPVY
FT                   IDCRKLLSFPRIRSTVMDFAASTLLRDAGFEQFDCIAGGETAGIPFAALLADRLGLPMI
FT                   YVRKQPKGHGRNAQIEGNMPEGSRVLVIEDLTTAGTSMFKFIDAVRAAGGIVDHGIALF
FT                   FYDIFGQQRFTDGKVRLHHIATWRNMLAVAKAQKLFDDKTLEEVEAFLDAPLAWSGLNG
FT                   GVSELSL"
FT   gene            126825..127751
FT                   /locus_tag="Rleg2_0135"
FT   CDS_pept        126825..127751
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0135"
FT                   /product="PfkB domain protein"
FT                   /note="PFAM: PfkB domain protein; KEGG:
FT                   rec:RHECIAT_CH0000546 fructokinase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53437"
FT                   /db_xref="GOA:B5ZNS7"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZNS7"
FT                   /protein_id="ACI53437.1"
FT                   /translation="MILCCGEALIDMLPRDTTLGEKGFAPYAGGAIFNTAIALGRLGIP
FT                   TAFFTGIADDMMGEILLATLKASNVDYSPCAITQRPSTIAFVKLVNGQATYAFYDEGTA
FT                   GRMITEADLPDLGDDCEALHFGAISLIPSPCGETYEALLDREAEKRVISLDPNIRPGFI
FT                   KDKPAHMARIKRMAAKSDIVKFSDEDLDWFGLAGDHDALAAHWLAHGAKLVVITKGAEG
FT                   ASGYTRERKVTVPSERVTVVDTVGAGDTFDAGVLASLKMDGLLTKPQVAALDEQAVRNA
FT                   LTLGAKAAAVTVSRAGANPPWAHEIGL"
FT   gene            complement(128036..129451)
FT                   /locus_tag="Rleg2_0136"
FT   CDS_pept        complement(128036..129451)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0136"
FT                   /product="alpha,alpha-trehalose-phosphate synthase
FT                   (UDP-forming)"
FT                   /EC_number="2.4.1.15"
FT                   /note="KEGG: rec:RHECIAT_CH0000547 trehalose-6-phosphate
FT                   synthase protein; TIGRFAM: alpha,alpha-trehalose-phosphate
FT                   synthase [UDP-forming]; PFAM: glycosyl transferase family
FT                   20"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53438"
FT                   /db_xref="GOA:B5ZNS8"
FT                   /db_xref="InterPro:IPR001830"
FT                   /db_xref="InterPro:IPR012766"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZNS8"
FT                   /protein_id="ACI53438.1"
FT                   /translation="MSRLIVVSNRVPVPSKDGGAAAGGLAVALQAALQERGGIWMGWSG
FT                   ESSGDREPGPLSQQQKGNITYALTDLTDTDVEEYYRGFANRVLWPICHYRLDLAEYGRK
FT                   EMAGYFRVNRFFAHRLAPLIEPDDIIWVHDYHLIPLAAELRQMGLKNRIGFFLHIPWPP
FT                   ADILVTMPVHEEIMRGLSHYDLVGFQTDYDLQNFAGYLRREGIGDDLGNGLFDSHGRVF
FT                   KAGAYPIGIETAGFAAFAEKAANNVMVQKTRRSIEGRDMIIGVDRLDYSKGIIERLEAF
FT                   ERFITSNPAYQNKVTFLQVTPKSRSEVPEYEQMQKMVAEQAGRVNGAIGTVDWVPIRYV
FT                   NRSISRNVLAGLFRLATIGLVTPLRDGMNLVAKEYVAAQDPDRPGVLVLSRFAGAAREL
FT                   KGALLVNPYDVEGTANAVAKGLAMSLAERRDRWRMMMDHLLSHDVSLWCKNFLGDLVAG
FT                   PELRPEHSSRTVS"
FT   gene            complement(129881..131506)
FT                   /locus_tag="Rleg2_0137"
FT   CDS_pept        complement(129881..131506)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0137"
FT                   /product="Glucose-6-phosphate isomerase"
FT                   /EC_number="5.3.1.9"
FT                   /note="PFAM: phosphoglucose isomerase (PGI); KEGG:
FT                   rec:RHECIAT_CH0000548 glucose-6-phosphate isomerase
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53439"
FT                   /db_xref="GOA:B5ZNS9"
FT                   /db_xref="InterPro:IPR001672"
FT                   /db_xref="InterPro:IPR018189"
FT                   /db_xref="InterPro:IPR023096"
FT                   /db_xref="InterPro:IPR035476"
FT                   /db_xref="InterPro:IPR035482"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5ZNS9"
FT                   /protein_id="ACI53439.1"
FT                   /translation="MNAIVEQLKSTAAATKATDLRAAFAADSERFSRFSVSLDDLLMDF
FT                   SKTAVNDDILKLLVKLAEEGGVEKKREEMFSGKVINFTEDRAVLHTALRNRSNTPVLVD
FT                   GKDVMPDVNAVLAAMGKFADGVRSGALKGATGKAITDVINIGIGGSDLGPVMATLALAP
FT                   FHDGPRAHFVSNIDGAHIADILKLVQPETTLFIVASKTFTTVETMTNAQTARNFIAKAL
FT                   GEAAVQHHFAAVSTALDKVAAFGIDSARVFGFWDWVGGRYSIWSAIGLPLMIAIGPENF
FT                   GKFLDGAHAVDNHFRQAPITENLPMLLGLIGFYHRNVLEYPTRAILPYDQRLSRFPAYL
FT                   QQLDMESNGKGVTINGTPVEGNSGPVVWGEPGTNGQHAFYQLIHQGTSIIPAEFMIAAN
FT                   AFEPELRHQHQLLISNVLAQSEALMKGRSFAEAKKQLTDKGMDDKKADFIAPHRVFTGN
FT                   RPSITFVYDKLTPYALGRLIALYEHRVFVEGVLFRINSFDQWGVELGKELATGLLPVVE
FT                   GKESAAGHDSSTQGLVAALSKLAK"
FT   gene            complement(131645..133345)
FT                   /locus_tag="Rleg2_0138"
FT   CDS_pept        complement(131645..133345)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0138"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="PFAM: AMP-dependent synthetase and ligase; KEGG:
FT                   ret:RHE_CH00478 acyl-CoA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53440"
FT                   /db_xref="GOA:B5ZNT0"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZNT0"
FT                   /protein_id="ACI53440.1"
FT                   /translation="MNSISVHPNGAKPEKPWLAAYPDVVPAELPPLEYASLAELLEKSC
FT                   ARFADRTAFASMGKAMSYRELESQTRKVAAWLQSTGLQKGDRVAVMMPNVLQNPVATYA
FT                   ILRAGLVVVNVNPLYTPRELEHQLRDSGAKAIFVLENFARTVEQVLNKTDLKHVVVTSL
FT                   GEMLGLKGLIVNFAVRKVKKLVPSWSIPQHKSFGQVLREGANKTLQPVTLAGSDIAFLQ
FT                   YTGGTTGVAKGAVLTHANLLANKLQLSLWLRSAFERKKQPEVLNFLCALPLYHIFALTV
FT                   NSLMGMSLGARNILIANPRDIPGLVKEFGKSDVHIFPGLNTLFNALMNNADFAKLDFSP
FT                   LIMSLGGGMAVQRPVAERWLKITGTAVTEGYGLSETSPVATANRFDSPEFTGSIGLPMP
FT                   STDLDIRDEDGKSLPLGEVGEICIRGPQVMAGYWQKPEETARVMTEDGYFRSGDMGFMD
FT                   ARGYTKIVDRKKDMILVSGFNVYPNEIEEIAAMHSGILEAAAIGVPDGHSGEAVKLFVV
FT                   RKDPKLTEAEVKAHCIANLTNYKRPRFIEFRTELPKSPVGKILRKDLRG"
FT   gene            133593..133985
FT                   /locus_tag="Rleg2_0139"
FT   CDS_pept        133593..133985
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0139"
FT                   /product="PRC-barrel domain protein"
FT                   /note="PFAM: PRC-barrel domain protein; KEGG:
FT                   rec:RHECIAT_CH0000550 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53441"
FT                   /db_xref="InterPro:IPR011033"
FT                   /db_xref="InterPro:IPR027275"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZNT1"
FT                   /protein_id="ACI53441.1"
FT                   /translation="MLNQETDANRRDPDAKSTHSLIASDRVEGTRVYGADGRHIGSIER
FT                   LIIGKLDGRVAYAVLSFGGFLGIGHDHYPLPWEKLNYDTQLDGYRIDLTKEQIEGAPSY
FT                   ADDDDSWYNDNGRRVYDYYGVPPYWM"
FT   gene            complement(134362..136818)
FT                   /locus_tag="Rleg2_0140"
FT   CDS_pept        complement(134362..136818)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0140"
FT                   /product="glycoside hydrolase family 2 sugar binding"
FT                   /note="PFAM: glycoside hydrolase family 2 immunoglobulin
FT                   domain protein beta-sandwich; glycoside hydrolase family 2
FT                   sugar binding; KEGG: rec:RHECIAT_CH0000551 beta-mannosidase
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53442"
FT                   /db_xref="GOA:B5ZNT2"
FT                   /db_xref="InterPro:IPR006102"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR036156"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZNT2"
FT                   /protein_id="ACI53442.1"
FT                   /translation="MIEKTELNSGWTLHCNDTGRPGLPETIPATVPGCVHLDLLANRLI
FT                   PDPYIDVNEITNDWIGKTDWTYRCTFEAAPDDDTVQELVFDGLDTIAVIALNGEEIGRS
FT                   FNMHRTYRFDISGLLKVGANDLAVSFRSAYAYGAEMEKHYGYRPNNYPGPGNLMRKMAC
FT                   NFGWDWGPTLVTAGLWKRVRLESWDQARLAETRVSATLAGGDGLVKVHARLARHGDAKP
FT                   CRLVATIGGVTTTVAIGAGEDTIAFELRLPSPKLWWPHHLGAQPLYPLTLELIDDAGGD
FT                   LLDSYQRALGFRSLRLDTSADAHGSAFTFVINDVPLFIAGANWIPDDCFPSRVTAGRYA
FT                   ARIDEAKAANIHMLRVWGGGIFERDEFYEACDRMGMLVWQDFLFACAAYPEEEPLKSEV
FT                   EAEVRDNVVRLMPHASLILWNGNNENIWGFDEWGWRPVIKADESWGLGYYLDLLPRLSA
FT                   ELDPDRPYYPGSPYSGSMEIAPNADAHGCKHIWDVWNDVGYEVYRDYVPRFCSEFGWQA
FT                   PAAWATIEESVHDQPLTPQSNGVFHHQKATQGNDKLIRGLSGHLPEPQTMDDWHFATQL
FT                   NQARAIRFGIEHMRSHRDICKGAVVWQFNDCWPVTSWAALDSAGRRKPLWYALRAAYDP
FT                   RLLTIQPRGDGLSAVAVNERTLFWRAKISGRRLRLDGSVLAEFEFWRLLCDRFEAKEFP
FT                   LPEDIVSPGLPKEEVVVVEMLDRRAFHYFVEDIELALPAPRLSVDVAASDGGFAVTVTA
FT                   ESFLKDLCLMADRLDPDAVVDTMLVTLLPGESHVFAVKTAKGISANDIVVGTVLRSAND
FT                   LVAGRQ"
FT   gene            complement(136828..137223)
FT                   /locus_tag="Rleg2_0141"
FT   CDS_pept        complement(136828..137223)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0141"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; KEGG: rec:RHECIAT_CH0000552
FT                   lactoylglutathione lyase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53443"
FT                   /db_xref="GOA:B5ZNT3"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZNT3"
FT                   /protein_id="ACI53443.1"
FT                   /translation="MAKMIHSMIRVLDEARSVEFYRKAFGLSVADRVDFETFTLIYLSS
FT                   AETGFELELTVNKGRSEPYDLGNAYGHLAISVEEVTVERERLSKLGLKPGQLVELNRDG
FT                   KLFGLFFFVSDPDGYKIEVLQRHGRFL"
FT   gene            complement(137268..138017)
FT                   /locus_tag="Rleg2_0142"
FT   CDS_pept        complement(137268..138017)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0142"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: rec:RHECIAT_CH0000553
FT                   probable proline/glycine betaine ABC transporter, permease
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53444"
FT                   /db_xref="GOA:B5ZNT4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZNT4"
FT                   /protein_id="ACI53444.1"
FT                   /translation="MKFLVANLFRLAALALLLILLFRTEWLSFLLVPLTSNNAPAVYTQ
FT                   NSLASLAAGHLQLVIGSIVCSAVLAVAGGIFVTRPSGADFLPLSRAIANAGQTFPPVAV
FT                   LALAVPATGFGAMPTLIALFLYGLLPIFENTVAGLKQVSPQVLDAADGMGMSATQRLLR
FT                   VELPLALPLILEGLKVATVINIGTATIGSTVAAKGLGEVIIAGLISDNTAFILQGGLIV
FT                   GLMAVLIYDAMGLVEAAITRRIGLRPA"
FT   gene            complement(138014..138958)
FT                   /locus_tag="Rleg2_0143"
FT   CDS_pept        complement(138014..138958)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0143"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: rec:RHECIAT_CH0000554 probable proline/glycine
FT                   betaine ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53445"
FT                   /db_xref="GOA:B5ZNT5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZNT5"
FT                   /protein_id="ACI53445.1"
FT                   /translation="MSMIEISNVTKRYGAATVVDNVSMRVEKGSITVIVGTSGSGKSTL
FT                   MRMINRLVPISEGEIFVGGQNVMDVEVTELRRRIGYAIQGHGLFPHRTVAQNIATVPQL
FT                   LDWDATRISRRVEELLGLFNLDPADFADKYPHQLSGGQQQRVGVARALAAEPELLLMDE
FT                   PFGALDPVIRGKAQDDLLAIQKQFGTTVILVTHDMDEAFHLGNQIAVMSEGRLLQCSTP
FT                   EKILTEPADPFVQQLTGTSDRALKLMSLLPLKESMEPAKSGLTYALSQSLSLRDALAEM
FT                   IWQGVGEATVQDGEKAPVGSISMSRLLELGRKA"
FT   gene            complement(138955..140121)
FT                   /locus_tag="Rleg2_0144"
FT   CDS_pept        complement(138955..140121)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0144"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: rec:RHECIAT_CH0000555
FT                   probable proline/glycine betaine ABC transporter, permease
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53446"
FT                   /db_xref="GOA:B5ZNT6"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZNT6"
FT                   /protein_id="ACI53446.1"
FT                   /translation="MEETSAVRRLDRLGVVLVAGGIAATALMPFIYVKANRIAAGKPML
FT                   LTQLLPQPSVITLTVLLILTALAALFLRQALARLVIATLCLAALIAAIGLVSAAATPPG
FT                   STVARMTPGGGFWVLFAVIGLIISDALVKIRLAPWMRVAALAAYTALLFAFLSSGLLDS
FT                   LSIMKEFSTRAPQFETEAISHLLLAFGSLAIAIILGLPLGVLCFWVPRLRAIVLQGLSL
FT                   IQTIPSLALFGLLMLPLGYLATHVPLASAIGIRGIGTAPALIALVLYSLLPIVANTVVG
FT                   LQGVDPSVRDAAAGMGLTRRQILTGIDMPLAFPVILTGIRIVLVQAIGMVTIAALIGGG
FT                   GFGIFIFQGLGQTAMDLVLLGAVPTVFFAFSSAVILDAVIDSIRGSAA"
FT   gene            complement(140209..141117)
FT                   /locus_tag="Rleg2_0145"
FT   CDS_pept        complement(140209..141117)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0145"
FT                   /product="Substrate-binding region of ABC-type glycine
FT                   betaine transport system"
FT                   /note="PFAM: Substrate-binding region of ABC-type glycine
FT                   betaine transport system; KEGG: ret:RHE_CH00485 probable
FT                   glycine betaine ABC transporter, substrate binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53447"
FT                   /db_xref="GOA:B5ZNT7"
FT                   /db_xref="InterPro:IPR007210"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZNT7"
FT                   /protein_id="ACI53447.1"
FT                   /translation="MLKKLALAVSLSAFAVGAAHAADVVVSSKIDTEGTLLGNVIALAL
FT                   EANGIKTQDRIALGATPVVRKAITAGEIDIYPEYTGNAGFFFNKADDAAWKNIDQGYEL
FT                   AKKLDYDANKIVWLTPSPANNTWALAVRNDVAEPNKLKSLTDFGKWIAGGGAAKLAASS
FT                   EFVNSAGALPAFQTTYGFQLKPDQMVVLSGGDTAATIKAAADQTNGVNTAMVYGTDGAI
FT                   EAAELTVLEDDKNVQQVYAPTPIIREEVLKANPKIEEVLSPIFKSLTADELRKLNAKIQ
FT                   VDGEPAKSVAEAYLKEKGFLK"
FT   sig_peptide     complement(141052..141117)
FT                   /locus_tag="Rleg2_0145"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 22"
FT   gene            141561..142802
FT                   /locus_tag="Rleg2_0146"
FT   CDS_pept        141561..142802
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0146"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: rec:RHECIAT_CH0000558 probable
FT                   transcriptional regulator protein, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53448"
FT                   /db_xref="GOA:B5ZNT8"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZNT8"
FT                   /protein_id="ACI53448.1"
FT                   /translation="MHLGALFISHHVLTSGSVRETARRFELSPSTVSTAIRHLETELAF
FT                   KLTERASGELVTLLASGRVLEGLEPITAAIGELGQFAGHDAAAADAYEAWASRIPLKIV
FT                   TIERFLEVADQGSINRAARRLRLGQPQLSLQLANLEKFLGGRLFERQAQGSVLTEEGRR
FT                   AYQIFTAISQAWNDLKSSADERYRRAARSLRIGSIIPTGSESWVARCLGSLVSEWNARR
FT                   SNNAISLVSMTADDLREALKSGRIDVAILDSVFGLESFRHRQLLQTDMVVIAPPDSTGT
FT                   TVADLVAGHAICMPSPRTGLGHAAMAFSDERAPDRRLRSRDITAADSLPVIVDLVANHG
FT                   YVSFLGRVSAMPIADKVRIVDLDEHLPMSYHVAFNHRKAAADACAVIIEAAARLTSEAV
FT                   AQTMARAEARESAA"
FT   gene            142799..143524
FT                   /locus_tag="Rleg2_0147"
FT   CDS_pept        142799..143524
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0147"
FT                   /product="CutC family protein"
FT                   /note="PFAM: CutC family protein; KEGG:
FT                   rec:RHECIAT_CH0000559 copper homeostasis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53449"
FT                   /db_xref="GOA:B5ZNT9"
FT                   /db_xref="InterPro:IPR005627"
FT                   /db_xref="InterPro:IPR023648"
FT                   /db_xref="InterPro:IPR036822"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZNT9"
FT                   /protein_id="ACI53449.1"
FT                   /translation="MTILLEVCVDSAEGLAAAIEGGAGRIELCSALELGGLTPLPSLMK
FT                   IAARAPIPIYAMIRPHAGPFIFGAADEEAMLLDIDAVRAAGLAGVVIGANRLDGTLDMP
FT                   LIHRLKAHAAGLGSTLHRAFDLVPDADQALEQAVELGVERILTSGCALKAPDGIETLQR
FT                   LSAKATGRISIMPGSGIRPANAGAILQATGAREVHGSCSLPVESADPRAVAFGFEAKSM
FT                   NKTDVAVVREMCRVIAAVG"
FT   gene            complement(143745..144761)
FT                   /locus_tag="Rleg2_0148"
FT   CDS_pept        complement(143745..144761)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0148"
FT                   /product="Alcohol dehydrogenase GroES domain protein"
FT                   /note="PFAM: Alcohol dehydrogenase zinc-binding domain
FT                   protein; Alcohol dehydrogenase GroES domain protein; KEGG:
FT                   rec:RHECIAT_CH0000560 probable Zn-dependent alcohol
FT                   dehydrogenase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53450"
FT                   /db_xref="GOA:B5ZNU0"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZNU0"
FT                   /protein_id="ACI53450.1"
FT                   /translation="MKAVVCREPGVLEIAERPSPAAPAPGWVRLAVSHVGICGTDYHIF
FT                   EGKHPFLEYPRVMGHEVSATVLEAGDGVAMAVGTPVIVNPYLSCGQCVACIKGKPNCCT
FT                   NIKVLGVHTDGAFCQEISVPAGNLYAAEGLSLEAAATVEFLAIGAHAVRRSMTGAGAKA
FT                   LVIGAGPIGLGAAIFSRIAGHDVTLLDTSAERLQMASDRFGFTSGIVANEQTADALREK
FT                   TDGDGFDVVFDATGYGPSMEKAFSFVAHGGALVLVSVVKDDIRFSDPEFHKREMTLIGS
FT                   RNATRADFEHVAASIAKGLVPVDKLITHRTTLADAPRDLARWAHEKSGLIKAVIRVG"
FT   gene            complement(144978..145952)
FT                   /locus_tag="Rleg2_0149"
FT   CDS_pept        complement(144978..145952)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0149"
FT                   /product="Monosaccharide-transporting ATPase"
FT                   /EC_number="3.6.3.17"
FT                   /note="PFAM: inner-membrane translocator; KEGG:
FT                   rec:RHECIAT_CH0000561 probable sugar ABC transporter,
FT                   permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53451"
FT                   /db_xref="GOA:B5ZNU1"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZNU1"
FT                   /protein_id="ACI53451.1"
FT                   /translation="MTATPTEIVAPPPRRKMNILFGLTLIGLLVFLWVVLGLVTPSFWT
FT                   PLNISNLLRQGAMTAILALGQTFVIITAGIDLSVGAIVGFCTVIIAWLLQAGVPLWGAI
FT                   ILTLAIGVAIGAFHGFGIVHMGLPPFIITLATLTSLRGIGLLITNGSTISITDESFSNF
FT                   ARADFLSIPSLFWMVILVAVPSFVFLHLSRWGRYLFAVGSNAEAARLSGVNVKGMIYLA
FT                   YILSAGFAAFVGVLLASRIAIGNATQADGWELQAIASSVIGGTSLFGAVGSVHGPLIGA
FT                   FILATINNGANLLNVNSFWQRIITGLLIIVIVFFDQLRRRKSN"
FT   gene            complement(146072..147625)
FT                   /locus_tag="Rleg2_0150"
FT   CDS_pept        complement(146072..147625)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0150"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: rec:RHECIAT_CH0000562 probable sugar ABC transporter,
FT                   ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53452"
FT                   /db_xref="GOA:B5ZNU2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZNU2"
FT                   /protein_id="ACI53452.1"
FT                   /translation="MIGLEEVSHRHDDSATLKEANRIPTGSPILELKGLQKNYGHVQAL
FT                   KPATLTFLAGEIHAIVGENGAGKSTLIKLLTGVITRTAGEVLWCGQPVGLSTPNEAIAR
FT                   GINAVHQEVVLCRHLTVAANLFLGDEVNRYGLMRKKQMEKLAQAVLDDLGFGLPAGALL
FT                   SSLTIGQQQLVATARAAMRGTQFLIFDEPTAYLTRQESAQLFKLIRRLQGEGVTIVYIS
FT                   HRMEEVFELADRVSVLRDGTHVGTRLIGETNDAELIALMINRSIEQIYHKEEIAIGETI
FT                   VEVRGLSGPGFEDVSLSVKAGQIVGLYGLIGAGRSEFALGLYGRQPTTAGDIQWMGKPV
FT                   DIKNERTAMELGIALAPESRRDQGLCLNLPIGLNINLPVFGRLSHGPVINHARESANAD
FT                   RQIRDLSIKTPSRRVPASSMSGGNQQKIVIGKWLSHGARLFIFDEPTVGVDVGTKAEIY
FT                   RLFAKLLKEGAGIILISSYLPEVYELADRLHVFRGGRIVASHDFHAATHEEVLSEAIGV
FT                   "
FT   gene            complement(147731..148720)
FT                   /locus_tag="Rleg2_0151"
FT   CDS_pept        complement(147731..148720)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0151"
FT                   /product="periplasmic binding protein/LacI transcriptional
FT                   regulator"
FT                   /note="PFAM: periplasmic binding protein/LacI
FT                   transcriptional regulator; KEGG: ret:RHE_CH00492 probable
FT                   sugar ABC transporter, substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53453"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZNU3"
FT                   /protein_id="ACI53453.1"
FT                   /translation="MTIVKSLLSRRAFTALAGAAVIATAMPVTSFAADVTIPIIVKDTT
FT                   SFYWQIVLAGARKAGKDLGVNVPELGAQAESDINGQISILENAVAGKPAAVVISPTEFK
FT                   ALGKPIDEAAKSVPIIGIDSGADSKAFKSFLTTDNVQGGRIAADGLAAAIKEMTGKEEG
FT                   EIVILTNLPGVGSLEQRREGFLDQIKTKHPGLKVIADKYGDGQATTGLNMMTDLITANP
FT                   KLVGVFASNLILAQGVGQAIAENKLGDKIKVIGFDSDDKTVGFLKDGAIAGLVVQDPYR
FT                   MGYDGIKTALAVSKGEKVEANVDTGANLVTKANMADPKIDALLNPKIK"
FT   sig_peptide     complement(148622..148720)
FT                   /locus_tag="Rleg2_0151"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 33"
FT   gene            complement(148926..149375)
FT                   /locus_tag="Rleg2_0152"
FT   CDS_pept        complement(148926..149375)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0152"
FT                   /product="RbsD or FucU transport"
FT                   /note="PFAM: RbsD or FucU transport; KEGG:
FT                   rec:RHECIAT_CH0000564 fucose dissimilation pathway protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53454"
FT                   /db_xref="GOA:B5ZNU4"
FT                   /db_xref="InterPro:IPR007721"
FT                   /db_xref="InterPro:IPR023750"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZNU4"
FT                   /protein_id="ACI53454.1"
FT                   /translation="MLKGIHPLLGPDLLHALKTMGHGDDIVIADANFPSGSMGPPVIRA
FT                   DGVSATDMAEAILAHMPLDTFVPETAWRMEVVGDPQAVPEVCAEFQKIVSRRAGDFAIV
FT                   PVERFAFYAMARKAAYIVATTEFRLYGNLILKKGVVHPHEVDLGQ"
FT   gene            complement(149385..150404)
FT                   /locus_tag="Rleg2_0153"
FT   CDS_pept        complement(149385..150404)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0153"
FT                   /product="Pyridoxal 4-dehydrogenase"
FT                   /EC_number="1.1.1.107"
FT                   /note="PFAM: aldo/keto reductase; KEGG:
FT                   rec:RHECIAT_CH0000565 putative L-fucose dehydrogenase
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53455"
FT                   /db_xref="GOA:B5ZNU5"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZNU5"
FT                   /protein_id="ACI53455.1"
FT                   /translation="MKTRRIGKTKLEVTEISFGAAALGGLYRACPREVAMDTLQAAWDS
FT                   GIRYFDVAPWYGLGLAERRVGDFLRDQADGSYVLSTKVGRLLRPVPTGSVPDYSYVDPL
FT                   SFDADYDYSYDGIMRSVEFSYARLGLNRIDILYVHDIGGYTHGAVKNAVYQKQLLDSGI
FT                   KALEELKSSGAIAAFGLGVNEVPVCLDVMRNADLDCILMAGRYTLLDRSAVAELLPLCQ
FT                   QRGTSLVVGGVFNSGILATGPVPGAHFDYMPADDEVLAKVGAMETIAKRHGVPLAAPAL
FT                   QFPLREPIVASVLIGTAKPSSLIRNMEIVEPRLADEIYAEFEPYTLVAPPLGAEAVRV"
FT   gene            complement(150444..151946)
FT                   /locus_tag="Rleg2_0154"
FT   CDS_pept        complement(150444..151946)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0154"
FT                   /product="Altronate dehydratase"
FT                   /EC_number="4.2.1.7"
FT                   /note="PFAM: D-galactarate dehydratase/Altronate hydrolase
FT                   domain protein; SAF domain protein; KEGG:
FT                   rec:RHECIAT_CH0000566 probable altronate dehydratase
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53456"
FT                   /db_xref="GOA:B5ZNU6"
FT                   /db_xref="InterPro:IPR007392"
FT                   /db_xref="InterPro:IPR013974"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZNU6"
FT                   /protein_id="ACI53456.1"
FT                   /translation="MDKLPWIILSAGDNVAVATAAIAPGSTVAGIETREKIDPGHKVAI
FT                   SDIPLGAAVVKYGQAIGRTTADVKAGDHVHSHNLHFENDRLAATANSAPETASNEDKAR
FT                   TFMGYRRADGRAATRNYIGIIASVNCSTTVCRAIADEANRTILPHYDGIDGFVPIVHDQ
FT                   GCGMSSTGDGMNVLHRTLAGYTRHVNFGGVLMIGLGCEVNQLTLYGQSGAGASKRHFNI
FT                   QDAGGSRRAVERAMGMLREIAADVGKEKRVPMSIGEIIIGLQCGGSDGFSGITANPALG
FT                   VAADLLAAAGGTAILSETSEIYGAEHLLRSRAVSDEVARKLDEKIAWWEDYVALHGASL
FT                   DNNPSPGNKRGGLTTILEKSLGAVAKGGRSPLTAVYGYAERVTAPGLVFMDTPGYDPVS
FT                   ATGQVAGGANMIAFTTGRGSCFGCRPAPSLKLSSNSALYASMEEDMDIDCGTIATGDAT
FT                   ISGKGREIFELIVDTASGKKTKSELFGYGDNEFVPWHLGATL"
FT   gene            152002..152166
FT                   /locus_tag="Rleg2_0155"
FT   CDS_pept        152002..152166
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0155"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53457"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZNU7"
FT                   /protein_id="ACI53457.1"
FT                   /translation="MLQLLNSGNTRCIGECALILFFIYNKHFQVNGNIDPVDEGGNEPQ
FT                   ATGNKLKVV"
FT   gene            152234..153133
FT                   /locus_tag="Rleg2_0156"
FT   CDS_pept        152234..153133
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0156"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="PFAM: regulatory protein GntR HTH; GntR domain
FT                   protein; KEGG: rec:RHECIAT_CH0000567 probable
FT                   transcriptional regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53458"
FT                   /db_xref="GOA:B5ZNU8"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZNU8"
FT                   /protein_id="ACI53458.1"
FT                   /translation="MARQNTVFKEAYNRYAVALRTDTALPSEPEIAAQLGVSRSTARAI
FT                   LTRLSEEGIIRWNKRQKTVLRQPTDRDLFPSEETDSLHDIIERSFMQRILADDAAPGMQ
FT                   INELELAREIGTGTTSVREFLIRFSRFGLIEKRPNSHWTLKGFTREFALELADVREMFE
FT                   LHSAAEFGRLARDSQAWIDLAAIRDEHHAMLADINQRFKDFSVLDERFHLLIHRASKNR
FT                   FIADFYDAIAIVFHYHYQWNKTAARERNERAIHEHLDYIAALESGDQTAIEKACRIHLR
FT                   SARQTLLQSLPQMATEGA"
FT   gene            153418..155442
FT                   /locus_tag="Rleg2_0157"
FT   CDS_pept        153418..155442
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0157"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SbmABacA family
FT                   protein; ABC transporter domain protein; SMART: AAA ATPase;
FT                   KEGG: rec:RHECIAT_CH0000570 probable ABC transporter,
FT                   ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53459"
FT                   /db_xref="GOA:B5ZNU9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZNU9"
FT                   /protein_id="ACI53459.1"
FT                   /translation="MSGAKLKPKSVDDTEPQGSETAAEEKPSTAEAVPPPDVPPPEVPP
FT                   PDVIEPGPELTPEEAEQARKKYLLKRFWISARHYWGRGGDKFAWPCTLGLLALIGINVG
FT                   FQYGINLWNRGIFDAIERHDAGTVYFLSAVFVPLVLGTVAVVTTQVALRMMIQRRWRSW
FT                   LTTAVIGRWLANGRYYQLNLIGGDHKNPEARISEDLRIATEAPVDFIAGVISAFLAAST
FT                   FIVVLWTIGGALTLPIAGFTVTIPGFLVVTAVLYAAITSSSMAFIGRRFVQVSEAKNQT
FT                   EAEFRYTLTHVRENGESIALLGGEEEERNDLHKTFTNVLGQWALLARQHMRTTLVSHGS
FT                   MLIAPVVPVLLCAPKFLEGSMTLGQVMQAASAFAIVQGAFGWLVDNYPRLADWNACARR
FT                   IASLMMSLDGLERAEQSDALGRIKRGETEGEVMLSLNDLSVSLDDGTAVVTETQVAIEP
FT                   GERVLVSGESGSGKSTLVRAIAGLWPWGDGSVNFHADRRLFMLPQRPYIPSGTLRRAVA
FT                   YPGAADSWTSDEIKAALDKVGLAYLNDKIEEDAPWDQTLSGGEKQRLAFARLLLHTPDI
FT                   IVLDEATSALDEKSQDRMMQMVIQELPEVTIISVAHRAELEVFHSRKITLERREGGAKL
FT                   VSDIDLIKRKRKRNLLSRVLENRRSPRKAGTAPNKTRSP"
FT   gene            complement(155475..155933)
FT                   /locus_tag="Rleg2_0158"
FT   CDS_pept        complement(155475..155933)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0158"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="PFAM: regulatory protein MarR; KEGG: cak:Caul_1741
FT                   transcriptional regulator, MarR family"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53460"
FT                   /db_xref="GOA:B5ZNV0"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZNV0"
FT                   /protein_id="ACI53460.1"
FT                   /translation="MGEDVLSTPGHLISLAARGFARLSEMRLKPLGFGVGQLPVLVALG
FT                   DRKASTQRDLARFARVEQPPMAQMLARMERDGLIERTRDPADGRSSHIVLTKAAREAMP
FT                   AAIAALFQGNSEALAGFTEAEADQLVDLLKRLIDKLDRIAGAEASAVD"
FT   gene            156055..156430
FT                   /pseudo
FT                   /locus_tag="Rleg2_0159"
FT   gene            complement(156462..157952)
FT                   /locus_tag="Rleg2_0160"
FT   CDS_pept        complement(156462..157952)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0160"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   ret:RHE_CH00498 putative multidrug transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53461"
FT                   /db_xref="GOA:B5ZNV1"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZNV1"
FT                   /protein_id="ACI53461.1"
FT                   /translation="MSNAAHRSNRVLVVATIMFATFMVAIEATIVATAMPRIVGQLGGF
FT                   SYYSWVFSAFLLAQSTTTVIYGKLSDIFGRKPVLIGGILIFLLGSLLCGLAWSMMSLVL
FT                   FRLLQGLGAGAIQPVTMTIIGDLFKLEERGRVQGAMATVWATSAVVGPLAGGIIVDNIS
FT                   WAWIFWINLPIGILSIIAFMIFLKEEVAHKQAKIDYLGSVLFSISIVALLVMLTETDAS
FT                   AWILLTLFAVFIIAGLLFLAQEKRAPEPIISIPLWSRRLIATSNAATLLAGMALIGLST
FT                   ILPIYVQGVLGRSPIVAGFTLTMLVVGWPLAVMLSSRFYKAFGIRRTLRVGSLLFPFGA
FT                   CFLLFLTPESSPALAGAGSFFMGFGMGLISLTSIVLVQDSVEWSMRGSATASIIFARSL
FT                   GNTLGATVLGAILNAGINHYAGGEAAAGLHEALNQPTGLSALAADPAIRAVFNAALHWS
FT                   FWGVVIVAVLTFFTTWLIPVGHGRKSEGAAVASEATSH"
FT   sig_peptide     complement(157869..157952)
FT                   /locus_tag="Rleg2_0160"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.828) with cleavage site probability 0.424 at
FT                   residue 28"
FT   gene            complement(158169..158534)
FT                   /locus_tag="Rleg2_0161"
FT   CDS_pept        complement(158169..158534)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0161"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ret:RHE_CH00499 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53462"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZNV2"
FT                   /protein_id="ACI53462.1"
FT                   /translation="MSCKLIAISLLSIGLAGSAVAQTAGGANSSGRLSVAPVIGGSGSS
FT                   GSGSAGTGSGGTGSAGSGSVGTDPGTTGSTSGNGGVELNSGRSTINPGGVNPDLKPRPG
FT                   CTAGSGDTSSGGEACPQ"
FT   sig_peptide     complement(158469..158534)
FT                   /locus_tag="Rleg2_0161"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.928 at
FT                   residue 22"
FT   gene            complement(159526..159999)
FT                   /locus_tag="Rleg2_0162"
FT   CDS_pept        complement(159526..159999)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0162"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rec:RHECIAT_CH0000575 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53463"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZNV3"
FT                   /protein_id="ACI53463.1"
FT                   /translation="MRTGFVSAVLFTFTLSTAQAADFPLASCAGWNGTLVNRTGTDSRN
FT                   AVMEGNVNQANFQEYCERDPGYETVAHGGKLTVEQCVAMYLKESGKDTYRSTADCRKGT
FT                   LSFFPASGEPLRATFPLPEDADVSCSSGMPPLIKQFTMLCPKAARKFKMLNDE"
FT   sig_peptide     complement(159937..159999)
FT                   /locus_tag="Rleg2_0162"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.998 at
FT                   residue 21"
FT   gene            complement(160649..160876)
FT                   /pseudo
FT                   /locus_tag="Rleg2_0163"
FT   gene            complement(161234..161309)
FT                   /locus_tag="Rleg2_R0002"
FT                   /note="tRNA-Thr3"
FT   tRNA            complement(161234..161309)
FT                   /locus_tag="Rleg2_R0002"
FT                   /product="tRNA-Thr"
FT   gene            complement(161431..162390)
FT                   /locus_tag="Rleg2_0164"
FT   CDS_pept        complement(161431..162390)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0164"
FT                   /product="2-nitropropane dioxygenase NPD"
FT                   /note="PFAM: 2-nitropropane dioxygenase NPD; KEGG:
FT                   rec:RHECIAT_CH0000578 probable dioxygenase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53464"
FT                   /db_xref="GOA:B5ZNV4"
FT                   /db_xref="InterPro:IPR004136"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZNV4"
FT                   /protein_id="ACI53464.1"
FT                   /translation="MALPPILSDKLRLPVIGSPLFIISHPRLTLAQCKAGVIGAFPALN
FT                   ARPESQLDEWLAEITEELAGHDAAHPDRPAAPFAVNQIVHMSNKRLEHDLSLCVKYKVP
FT                   IVISSLGAVPEVNAAVHSYGGIVLHDIINNRHAHSAIRKGADGLIAVAAGAGGHAGTLS
FT                   PFALIQEIREWFDGPLLLAGAISTGGAILAAEAMGADMAYIGSPFIATEEARATEAYKQ
FT                   AIVEGAAGDIVYSNYFTGVHGNYLKPSIVAAGMDPDNLPAADVSKMDFEQAVGGAKAWK
FT                   DIWGSGQGISAIKAVEPVAKLVDRLEAEYRAARTRLSL"
FT   gene            162677..163876
FT                   /locus_tag="Rleg2_0165"
FT   CDS_pept        162677..163876
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0165"
FT                   /product="putative regulator protein"
FT                   /note="KEGG: ret:RHE_CH00506 putative regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53465"
FT                   /db_xref="GOA:B5ZNV5"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZNV5"
FT                   /protein_id="ACI53465.1"
FT                   /translation="MSGLETAIRTALDNSDRDNPEVRARIYQSARQALEAGLRKQDITD
FT                   TEVVAHHRHRLESTIHAIESEERDRLHPRQRPPEVPVPPVVEMPAPPVHQADVADIDNH
FT                   IDSPVAAGETRAPEVAHSRGDDFSLHNVRAGSADHLAAAPVGEERLARGERAAGMDFRP
FT                   ERAAGRRKPRKFFSRLLVWCVLLAFIGIGAWWAHTSGLLLTAAERDTSVANPPASTQPE
FT                   DFTGNDDSAGNAAPHTDEPVTIDPQNSFSADWIPVFKPDDADKVQSGPRARTEKIAEND
FT                   GPAVRLISESGAADGNISISVPASVLQQLAGKSSTIALTLQSTTDEPTQVTVECNFQSL
FT                   GNCARHRFNVTREKSDALLQVKFDRSLAPNAPGTLTINSDLDGKARGINLFAIRILPGQ
FT                   "
FT   gene            complement(163967..164848)
FT                   /locus_tag="Rleg2_0166"
FT   CDS_pept        complement(163967..164848)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0166"
FT                   /product="protein of unknown function DUF344"
FT                   /note="PFAM: protein of unknown function DUF344; KEGG:
FT                   ret:RHE_CH00507 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53466"
FT                   /db_xref="GOA:B5ZNV6"
FT                   /db_xref="InterPro:IPR016898"
FT                   /db_xref="InterPro:IPR022486"
FT                   /db_xref="InterPro:IPR022488"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZNV6"
FT                   /protein_id="ACI53466.1"
FT                   /translation="MAETVENRAVELEIRGKKRTFDVDDPTLPDWVDEHALESGDFPHK
FT                   KKLKEEDYVEQLEKLQVELVKVQFWLQASGKRVMALFEGRDAAGKGGAISASSENMNPR
FT                   LARVVALTKPTEREQGQWYFQRYVAQFPTAGEFVLFDRSWYNRAGVEPVMGFCTPQQYE
FT                   DFLKQAPQLEKIIAHEGIFFFKFYLDIGREMQLKRFHDRRHDPLKVWKLSSMDIAALTK
FT                   WDDYSEKRDRMLKETHTDFAPWTVIRANDKRRTRLELIRHMLNRMDYDGKDEKALGEVD
FT                   KEIIGSGPGFLK"
FT   gene            165090..166313
FT                   /locus_tag="Rleg2_0167"
FT   CDS_pept        165090..166313
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0167"
FT                   /product="histidine kinase"
FT                   /EC_number="2.7.13.3"
FT                   /note="KEGG: rec:RHECIAT_CH0000582 phosphate regulon,
FT                   two-component sensor histidine kinase protein; TIGRFAM:
FT                   phosphate regulon sensor kinase PhoR; PFAM: ATP-binding
FT                   region ATPase domain protein; histidine kinase A domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53467"
FT                   /db_xref="GOA:B5ZNV7"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR014310"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZNV7"
FT                   /protein_id="ACI53467.1"
FT                   /translation="MARIRRERPVLLAAILSALAALAAGMNKWVVLGLLLVMIVTALFN
FT                   EAPVIKDEPAEPVEIAPEVPPSRLPEVSATLSGLDIPVMVLSDDASVLFQNRAAEKAFG
FT                   EVALGAHISARLRSPGVLDMVRETIATNAPNQIEHAERLPSERVYIVRSAPIEFSAEEG
FT                   ARERYFILSFRDISEVRRIDRMRSDFVANASHELRTPLASLRGFIETIQGPAKNDLKAQ
FT                   ARFLAIMFDQTTRMSRLVDDLLSLSRLELKSHIAPDEKIDLVPLLGHVRDALVPLASDV
FT                   GVDINLHLPDGKVEVLGDRDELVQVFENLMENACKYGQEGKTVDVWLKNGAGQPVEVSI
FT                   VDKGPGIPAEHVPRLTERFYRVSIEDSRSKKGTGLGLAIVKHILTRHRARLIVKSEVGK
FT                   GTDFTVRF"
FT   sig_peptide     165090..165161
FT                   /locus_tag="Rleg2_0167"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.983 at
FT                   residue 24"
FT   gene            166693..167727
FT                   /locus_tag="Rleg2_0168"
FT   CDS_pept        166693..167727
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0168"
FT                   /product="phosphate ABC transporter, substrate-binding
FT                   protein"
FT                   /note="KEGG: rec:RHECIAT_CH0000584 phosphate ABC
FT                   transporter, substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53468"
FT                   /db_xref="InterPro:IPR024370"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZNV8"
FT                   /protein_id="ACI53468.1"
FT                   /translation="MNTFKLTVAALAATAAFAGAAVARDQIQVAGSSTVLPYAKIVAES
FT                   FGETFTNFKTPVVESGGTGAGLKEFCKGVGEDTIDIANASRPINKNEAEACKAAGVTDI
FT                   QEVKIGYDGIVFATDASNPDVAYVPADIYKALAAQVVVDGKLVANPYKKWSEVNPKLPA
FT                   VDIAAYIPGEKHGTREVFEQNVLAAGCKASGALDVIAKEIADKAAQTKACVAVRKDGAA
FT                   VDIDGDYPETLARIAANKTGVGVFGLSFYENNADKLKVASMSGIVPSTETIANGTYPVS
FT                   RPLFFYVKKAHLGAVPGLKEYVNFFVSDQMIGPDSPLVEYGLVAAPDAERDAIRKDVEA
FT                   GKSM"
FT   sig_peptide     166693..166764
FT                   /locus_tag="Rleg2_0168"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.983 at
FT                   residue 24"
FT   gene            167896..169377
FT                   /locus_tag="Rleg2_0169"
FT   CDS_pept        167896..169377
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0169"
FT                   /product="phosphate ABC transporter, inner membrane subunit
FT                   PstC"
FT                   /note="TIGRFAM: phosphate ABC transporter, inner membrane
FT                   subunit PstC; PFAM: binding-protein-dependent transport
FT                   systems inner membrane component; KEGG:
FT                   rec:RHECIAT_CH0000585 phosphate ABC transporter, permease
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53469"
FT                   /db_xref="GOA:B5ZNV9"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR011864"
FT                   /db_xref="InterPro:IPR022182"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZNV9"
FT                   /protein_id="ACI53469.1"
FT                   /translation="MSTSIILLCLVAIGAAAYLVARSRASALAGGRSSALHSRPAYYGA
FT                   YAAIWAVLPALIVLCVWLSVSPRIIQSSVRSHFPDDVKAQAGVEQDLGYSMVATVARGL
FT                   TMLSADEIAAVAGDPAALQAKLSEKGVPLAGQPLPYMLDAAKTLNAKSMTSRLSMTAVV
FT                   FILAIAGAFYALRAIAPRFRARNRVERVMLWGLLLASSIAILTTIGIVFSMLSEAARFF
FT                   AAVPAADFFFGTVWDPRFAGAGSSSFGQFGLIPLLLGTLYIGLVAMLVAVPVGLFAAIY
FT                   MAEYASPKLRGVAKPLLEVLAGIPTIVYGFFALVTVGPFLRDFSAQISGLLSGNYTNFI
FT                   QAQSVLTAGIVMGIMLIPYVSSLSDDIITAVPRTLRDGSLGLGATRSETIKKVVLPAAL
FT                   PGIVGALLMTASRAIGETMIVVLAAGVAARIQINPFEPMTTVTVKIVNQLTGDLEFTSP
FT                   QTLVAFALGITLFCITLCLNIYALYIVRKYREQYE"
FT   sig_peptide     167896..167961
FT                   /locus_tag="Rleg2_0169"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.997) with cleavage site probability 0.281 at
FT                   residue 22"
FT   gene            169374..170696
FT                   /locus_tag="Rleg2_0170"
FT   CDS_pept        169374..170696
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0170"
FT                   /product="phosphate ABC transporter, inner membrane subunit
FT                   PstA"
FT                   /note="TIGRFAM: phosphate ABC transporter, inner membrane
FT                   subunit PstA; PFAM: binding-protein-dependent transport
FT                   systems inner membrane component; KEGG:
FT                   rec:RHECIAT_CH0000586 phosphate ABC transporter, permease
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53470"
FT                   /db_xref="GOA:B5ZNW0"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR005672"
FT                   /db_xref="InterPro:IPR024573"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZNW0"
FT                   /protein_id="ACI53470.1"
FT                   /translation="MTDIVSSQSGVTVSKAPARRDIGIKRRYAAERRFQAYGIAAIAFG
FT                   LIFLFILLWTVIGKGYTAFQQTAITLPIEFTEKAIDPSNKRATDPSVLIAANYPVLLRD
FT                   AIVKQLNINASSKPDVRDASAMLSKGAPIQLRDMVVADPSLIGKTVNVTVLADANVDSA
FT                   NKGQIDLTVDEKNRKVNDKQVGWMNELKASGALHKQFNTGLFVNGNSSRPEAAGLGVAL
FT                   IGSLYLMLIVLVLALPIGVAASIYLEEFAPKNRLTDLIEVNINNLAAVPSIVYGLLGLS
FT                   VFINFVGLPRSASLVGGLVLTLMTLPTIIIATRAALRAVPPSIRAAALGLGASKMQMVF
FT                   HHVLPLAMPGILTGTIIGLAHALGETAPLLLIGMVAFVANAPTTPLDPSTALPVQVYMW
FT                   ANEAERAFVERTSGAIIVLLLFLIVMNMGAILLRRRFERRW"
FT   gene            170712..171527
FT                   /locus_tag="Rleg2_0171"
FT   CDS_pept        170712..171527
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0171"
FT                   /product="phosphate ABC transporter, ATPase subunit"
FT                   /note="KEGG: rec:RHECIAT_CH0000587 phosphate ABC
FT                   transporter, ATP-binding protein; TIGRFAM: phosphate ABC
FT                   transporter, ATPase subunit; PFAM: ABC transporter related;
FT                   SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53471"
FT                   /db_xref="GOA:B5ZNW1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005670"
FT                   /db_xref="InterPro:IPR015850"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZNW1"
FT                   /protein_id="ACI53471.1"
FT                   /translation="MNMLTEAAVEKALDQKMSNVPYKMIGQDVSVYYGEKRALFDVNLN
FT                   IRENTVTALIGPSGCGKSTFLRSLNRMNDTIDGCRVTGKITLDTDDIYDPDIDVVELRA
FT                   RVGMVFQKPNPFPKTIYENVSYGPRIHGLAKSKADLDQIVETSLQRAGLWNEVKDRVHE
FT                   SGTGLSGGQQQRLCIARAVAVSPEVILMDEPCSALDPIATAKVEELIHELRENYTIVIV
FT                   THSMQQAARVSQRTAMFHLGNLVEENDTDKMFTNPDDPRTQDYIMGRFG"
FT   gene            171572..172285
FT                   /locus_tag="Rleg2_0172"
FT   CDS_pept        171572..172285
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0172"
FT                   /product="phosphate uptake regulator, PhoU"
FT                   /note="TIGRFAM: phosphate transport system regulatory
FT                   protein PhoU; PFAM: PhoU family protein; KEGG:
FT                   rec:RHECIAT_CH0000588 phosphate uptake transcriptional
FT                   regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53472"
FT                   /db_xref="GOA:B5ZNW2"
FT                   /db_xref="InterPro:IPR026022"
FT                   /db_xref="InterPro:IPR028366"
FT                   /db_xref="InterPro:IPR038078"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZNW2"
FT                   /protein_id="ACI53472.1"
FT                   /translation="MASTHIYSAYDDDLKFLSRRISEMGGLAEQMVAESVRALVNGDTA
FT                   LAQKVISDDVILDHAEREIGDKAIVTIARRQPMAADLREIMGSIRIAADLERVGDLGKN
FT                   TAKRVIAVQSTGVPRKLARGLEHLSELALVQLKEVLDVYTTRAADKASAIRERDNEIDA
FT                   MYTSLFRELLTYMMEDPRNITSCTHLLFCAKNIERIGDHATNIAETIYYMATGAQPEGD
FT                   RPKDDSANTVGAVTE"
FT   gene            172420..173103
FT                   /locus_tag="Rleg2_0173"
FT   CDS_pept        172420..173103
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0173"
FT                   /product="two component transcriptional regulator PhoB,
FT                   winged helix family"
FT                   /note="TIGRFAM: phosphate regulon transcriptional
FT                   regulatory protein PhoB; PFAM: response regulator receiver;
FT                   transcriptional regulator domain protein; KEGG:
FT                   rec:RHECIAT_CH0000589 phosphate regulon, two-component
FT                   response regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53473"
FT                   /db_xref="GOA:B5ZNW3"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR011879"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZNW3"
FT                   /protein_id="ACI53473.1"
FT                   /translation="MIPRVAVVEDEEALSVLLRYNLEAEGFEVDTILRGDEAEIRLQER
FT                   TPDLLILDWMLPGVSGIELCRRLRMRPETERLPIIMLTARGEESERVRGLSTGADDYVV
FT                   KPFSTPELVARVKAMLRRARPEVLSTVLKCGDIELDRETHRVHRKSREVRLGPTEFRLL
FT                   EFLMSSPGRVFSRSQLLDGVWGHDIYVDERTVDVHVGRLRKALNFSNMQDVIRTVRGAG
FT                   YSMEA"
FT   gene            complement(173381..173914)
FT                   /locus_tag="Rleg2_0174"
FT   CDS_pept        complement(173381..173914)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0174"
FT                   /product="GcrA cell cycle regulator"
FT                   /note="PFAM: GcrA cell cycle regulator; KEGG:
FT                   rec:RHECIAT_CH0000590 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53474"
FT                   /db_xref="InterPro:IPR011681"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZNW4"
FT                   /protein_id="ACI53474.1"
FT                   /translation="MNWTDERVEKLKKLWAEGLSASQIAAQLGGVSRNAVIGKVHRLSL
FT                   PGRAKAGGTAATARTPKRTTSAPRAPNFASRITTRTVTRQQGATMLKEEIEIETVEEME
FT                   YVPKGNVVVPISRRLGLTELTERTCKWPVGDPLKDDFHFCGCESPDNSPYCGYHQKLAY
FT                   QPVNERRRAAARAS"
FT   gene            174340..175539
FT                   /locus_tag="Rleg2_0175"
FT   CDS_pept        174340..175539
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0175"
FT                   /product="acetylornithine and succinylornithine
FT                   aminotransferase"
FT                   /EC_number="2.6.1.11"
FT                   /note="KEGG: rec:RHECIAT_CH0000591 acetylornithine
FT                   transaminase protein (diaminobutyrate--pyruvate
FT                   aminotransferase); TIGRFAM: acetylornithine and
FT                   succinylornithine aminotransferase; PFAM: aminotransferase
FT                   class-III"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53475"
FT                   /db_xref="GOA:B5ZNW5"
FT                   /db_xref="InterPro:IPR004636"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZNW5"
FT                   /protein_id="ACI53475.1"
FT                   /translation="MAEAAPLYDTYSRAPLRFERGEGVWLITESGERYLDFGAGVAVTS
FT                   VGHSNPHVVGALKEQADKVWHLSNIYEIPGQERLAKRLTEATFADKVFFTNSGAEALEC
FT                   AIKTARRYQFSKGHPERFHIITFEGAFHGRTLATIAAGGQEKYLEGFGPKAPGFDQVAF
FT                   GDIDAVRAAITDATAAILIEPVQGEGGVRPATPEFMKALRQLCDENGLLLILDEVQTGV
FT                   GRTGKLFAHEWSGITPDIMAVAKGIGGGFPLGACLATSEAASGMKAGTHGSTYGGNPLA
FT                   MAVGGAVLDIILADGFLQQVRDVALVFRQGLASLKDRYPDVIEDIRGEGLLLGVKAAVP
FT                   SADLLQAIRAAHLLGVPAGDNVIRLLPPLVVTAEEAREGLARIERAAESIRASKVKKTA
FT                   "
FT   gene            175576..176490
FT                   /locus_tag="Rleg2_0176"
FT   CDS_pept        175576..176490
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0176"
FT                   /product="ornithine carbamoyltransferase"
FT                   /EC_number="2.1.3.3"
FT                   /note="KEGG: ret:RHE_CH00517 ornithine
FT                   carbamoyltransferase; TIGRFAM: ornithine
FT                   carbamoyltransferase; PFAM: aspartate/ornithine
FT                   carbamoyltransferase Asp/Orn-binding region;
FT                   aspartate/ornithine carbamoyltransferase carbamoyl-P
FT                   binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53476"
FT                   /db_xref="GOA:B5ZNW6"
FT                   /db_xref="InterPro:IPR002292"
FT                   /db_xref="InterPro:IPR006130"
FT                   /db_xref="InterPro:IPR006131"
FT                   /db_xref="InterPro:IPR006132"
FT                   /db_xref="InterPro:IPR024904"
FT                   /db_xref="InterPro:IPR036901"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZNW6"
FT                   /protein_id="ACI53476.1"
FT                   /translation="MAPKHFLDLSAVTSADLRTIMNDALARKQAFKAGKGDKPLAGKML
FT                   AMIFEKPSTRTRVSFDVGMRQLGGETLFLSGTEMQLGRAETIGDTAKVLSRYVDAIMIR
FT                   TTEHSRLKELAEHATVPVINALTDDTHPCQIMADIMTFEEHRGPIKGKTIAWTGDGNNV
FT                   LHSLVEGAARFGYRMNMAVPLGSEPKDHYLNWARNEGAEIMLCHDADRAVDGVDCVVTD
FT                   TWVSMNQEHRARGHNVFQPYQVNAALMAKAGSDALFMHCLPAHRGEEVTDEVIDGPQSV
FT                   VFDEAENRLHAQKSILAWCLGAI"
FT   gene            176578..177570
FT                   /locus_tag="Rleg2_0177"
FT   CDS_pept        176578..177570
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0177"
FT                   /product="Hsp33 protein"
FT                   /note="PFAM: Hsp33 protein; KEGG: rec:RHECIAT_CH0000593 33K
FT                   chaperonin (heat shock protein 33) protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53477"
FT                   /db_xref="GOA:B5ZNW7"
FT                   /db_xref="InterPro:IPR000397"
FT                   /db_xref="InterPro:IPR016153"
FT                   /db_xref="InterPro:IPR016154"
FT                   /db_xref="InterPro:IPR023212"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZNW7"
FT                   /protein_id="ACI53477.1"
FT                   /translation="MAEAAAALGQFDFAGDDHVVPFQVEGLDVRGRAVQLGPMLDAILE
FT                   RHHYPAPVARLLAEVVVLTVLLGTSLKFDGKFTVQTKGDGPVDLLVADFSTPENVRAYA
FT                   RFDQALLNKAIAAGETEPEQLLGRGVLAFTIDQGKFGQPYQGIVALDGTTLEDIAGVYF
FT                   RQSEQIPTRVRLAAAELFDRDDAGKPRHRWRAGGLVAQFLPEAPERMRQPDLHGGDGDT
FT                   GSGPHGEDDSWAEARSLVETIDADELTDPLVGTERLLFRLFHERGVRVYEPRAVFDRCS
FT                   CSRDKIKGVLKGFTAEEIEASQEDGEIAVTCEFCSTTYRFEPAELQPVE"
FT   gene            177691..178278
FT                   /locus_tag="Rleg2_0178"
FT   CDS_pept        177691..178278
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0178"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rec:RHECIAT_CH0000594 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53478"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZNW8"
FT                   /protein_id="ACI53478.1"
FT                   /translation="MRLLYFVLACIAAIPRIALAGDQAIQWKEVGGWSVALDPTLGNGC
FT                   FVLTSFDDGTIFRLGFNYTKKESPFYILLGNSNWKSLESGKQYPVELSLDRSKWTAQAT
FT                   GLDIDGLKSLWIDFKDAGLVEEFARKLSFRASFNGKEIVALSLKNSVKATDELLACQKA
FT                   VNAAVAQKPAPPQSKDPFEANPGTQASDPFDL"
FT   sig_peptide     177691..177753
FT                   /locus_tag="Rleg2_0178"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 21"
FT   gene            complement(178621..179013)
FT                   /locus_tag="Rleg2_0179"
FT   CDS_pept        complement(178621..179013)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0179"
FT                   /product="ApaG domain protein"
FT                   /note="PFAM: ApaG domain protein; KEGG: ret:RHE_CH00521
FT                   ApaG"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53479"
FT                   /db_xref="InterPro:IPR007474"
FT                   /db_xref="InterPro:IPR023065"
FT                   /db_xref="InterPro:IPR036767"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5ZNW9"
FT                   /protein_id="ACI53479.1"
FT                   /translation="MYRALTKDIEVVVEPFYLEEQSDPEDDRYVWGYRIVISNNSAIAV
FT                   RLVNRYWNITDQNGQVDEVTGPGVVGEQPRLSPGDTYEYSSGCPLDTPSGLMFGHYQME
FT                   TDEGEMFDVDIPAFSLDSPGLLRVLN"
FT   gene            complement(179370..180554)
FT                   /locus_tag="Rleg2_0180"
FT   CDS_pept        complement(179370..180554)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0180"
FT                   /product="O-succinylhomoserine sulfhydrylase"
FT                   /EC_number="2.5.1.48"
FT                   /note="KEGG: rec:RHECIAT_CH0000596 O-succinylhomoserine
FT                   (thiol)-lyase protein; TIGRFAM: O-succinylhomoserine
FT                   sulfhydrylase; PFAM: Cys/Met metabolism
FT                   pyridoxal-phosphate-dependent protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53480"
FT                   /db_xref="GOA:B5ZNX0"
FT                   /db_xref="InterPro:IPR000277"
FT                   /db_xref="InterPro:IPR006234"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZNX0"
FT                   /protein_id="ACI53480.1"
FT                   /translation="MSKTWRPATQLVHGGTLRSQYGETSEAIYLTQGFVYETSEAAEAR
FT                   FKGETEGYIYARYGSPTNDMFEKRMCMLEGAEDARATASGMAAVSAAILCQVKAGDHIV
FT                   AARALFGSCRWVVETLAPKYGVECTLVDGRDLANWEKAIRPNTKVFFLESPTNPTLEVV
FT                   DISGVAKLANQIGAKVVVDNVFATPLFQKPLELGAHIVVYSATKHIDGQGRCLGGVVLA
FT                   DKDWIDENLHDYFRHTGPAMSPFNAWTLLKGIETLPLRVKQQTGNAAKIADFLAEQSKV
FT                   AKVIYPGRKDHPQADIIAKQMTGGSTLVAFELKGGKEAAFALQNALDIVKISNNLGDSK
FT                   SLITHPATTTHKNLTEEARAELGISPGTVRLSAGIEDTDDLIEDFAKALAKVSA"
FT   gene            180749..181843
FT                   /locus_tag="Rleg2_0181"
FT   CDS_pept        180749..181843
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0181"
FT                   /product="2-deoxycytidine 5-triphosphate deaminase"
FT                   /note="PFAM: 2-deoxycytidine 5-triphosphate deaminase;
FT                   KEGG: ret:RHE_CH00524 2'-deoxycytidine 5'-triphosphate
FT                   deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53481"
FT                   /db_xref="GOA:B5ZNX1"
FT                   /db_xref="InterPro:IPR010550"
FT                   /db_xref="InterPro:IPR033704"
FT                   /db_xref="InterPro:IPR036157"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZNX1"
FT                   /protein_id="ACI53481.1"
FT                   /translation="MMARETGILADRAISALFETGRLISERELDRDQIQPASLDLRLGA
FT                   KAFRVRASFMPGPSHLVSDKLDRLSLHVIDLTEGAVLETGCVYIVPLIESLALPADMSA
FT                   SANPKSSTGRLDIFTRVITDYAQEFDKIPAGYSGPLYLEISPRTFPIVVRRGSRLSQIR
FT                   FRVGQALLGEPELLKLHESETLVASKQPNVSGGGIALSIDLAGDEDGLIGYRGKHHTAV
FT                   VDVDKKAQHDIFDFWEPLYSRGRNELILDPDEFYILVSREAVHVPPDYAAEMTPFDPLV
FT                   GEFRVHYAGFFDPGFGHAPAGGRGSRAVLEVRSHEVPFILEDGQIVGRLVYEHMQEKPT
FT                   SLYGSGLGSNYQAQGLKLSKHFRI"
FT   gene            181903..181976
FT                   /locus_tag="Rleg2_R0003"
FT                   /note="tRNA-Gly1"
FT   tRNA            181903..181976
FT                   /locus_tag="Rleg2_R0003"
FT                   /product="tRNA-Gly"
FT   gene            complement(182128..183549)
FT                   /locus_tag="Rleg2_0182"
FT   CDS_pept        complement(182128..183549)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0182"
FT                   /product="putative transcriptional regulator"
FT                   /note="KEGG: aha:AHA_3580 ATP-dependent DNA helicase RecG"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53482"
FT                   /db_xref="InterPro:IPR007421"
FT                   /db_xref="InterPro:IPR025831"
FT                   /db_xref="InterPro:IPR038461"
FT                   /db_xref="InterPro:IPR038475"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZPG5"
FT                   /protein_id="ACI53482.1"
FT                   /translation="MFQTQTLNQTAVQDILTLDESHFIDFKAIEIAPAKLTKTISAFAN
FT                   TSGGEVYIGISEVEGEDGKTVEWRGFDKPESANAIVQVLENLGPLANNYMAEFLRSETE
FT                   IGYVLHLTVLKTQDIIIASDGKVYVRRSAQSLPVGNDAALERLRYEKGIKSFEDEILNE
FT                   GHKEISNSNTVLEFLLETIPTGEPEDWLSKQRVLVDSKPTVAGILLFSDNPQSILPKRS
FT                   AIKILRYQTKKEAERDFLAFDPLTMEGPLYNLIYDSVDKVKEIIEGIEKLGADKMEKVS
FT                   YPQDALHELLTNAVLHRDYNIAADVQVKIFDNRIEIESPGRLPGHVTPKNIRKTQFARN
FT                   PKIVRLINKFRNPPNKDVGEGLNTAFEAMGKLRLKPPVIEEREGYVVVTLRHESLGSPE
FT                   QMVMDYLKDESEITNLIARELTGIKSENSMKSVFYRLRETGQLEQVPKVAGKKPAWRIP
FT                   LQVSAEPKDNLDEAQ"
FT   gene            complement(183875..184153)
FT                   /locus_tag="Rleg2_0183"
FT   CDS_pept        complement(183875..184153)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0183"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rec:RHECIAT_CH0000599 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53483"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZPG6"
FT                   /protein_id="ACI53483.1"
FT                   /translation="MKPALIGLIGTLILTGCSTVTYSGPGLEPIPGSITYNGQPRSKLT
FT                   KSPVGSAFPHDFIDQYGRQVEETYIIQPDRSLIIAHRRYKPIRFFGD"
FT   sig_peptide     complement(184082..184153)
FT                   /locus_tag="Rleg2_0183"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.927) with cleavage site probability 0.885 at
FT                   residue 24"
FT   gene            184518..184898
FT                   /locus_tag="Rleg2_0184"
FT   CDS_pept        184518..184898
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0184"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; KEGG: ret:RHE_CH00531 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53484"
FT                   /db_xref="GOA:B5ZPG7"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZPG7"
FT                   /protein_id="ACI53484.1"
FT                   /translation="MRLNHLDFHVPDIAATADFFIRHFGLRLKDMRGNNGLAILEDDAG
FT                   LEIVLSHAIAKFGTADQVELQRQTYHIGFILPERADVDRVHAGLVADGVAFSGPPAAMR
FT                   GGWLFYCTAPGNILVEVGWRPG"
FT   gene            complement(185104..187113)
FT                   /locus_tag="Rleg2_0185"
FT   CDS_pept        complement(185104..187113)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0185"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="PFAM: histidine kinase HAMP region domain protein;
FT                   chemotaxis sensory transducer; KEGG: rec:RHECIAT_CH0000601
FT                   methyl-accepting chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53485"
FT                   /db_xref="GOA:B5ZPG8"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZPG8"
FT                   /protein_id="ACI53485.1"
FT                   /translation="MLKHLKIRTKIISVVALLGLITMAGLVYVIAEFRRADAAYSAFID
FT                   HEAMASMQSARASASVVASVLQVSLLADMKPDTPAFQTTLATPSKLPQARERMKDALAL
FT                   VPSRKQAIDEIQAGIDEIETLANKIIEQSKAKDGAGAQANVALINAKLNALTPKMIANN
FT                   DAMMAMLNDGGDALSASVNGRIVFCLVLIGIAVLAAVGFSVIVAQMGIAGPMTRLNLRM
FT                   TRLAEGDTASEVGGLDRGDEVGQMAKAVSIFRDNAIERGRIEARAEADRNLSDGERRER
FT                   EAQRTREASELEGAVTALGDGLRRLAAGDLASHIDQPFVAHLDALREDFNNSVEKLNEA
FT                   LHTVGANARAIGAGANEIRSSADELSRRTEQQSASVEETAAALEEITTTVRDAAKRAEE
FT                   ASQLVARTRLGAEKSGEIVRKAVSAMQQIEKSSGEISNIIGVIDDIAFQTNLLALNAGV
FT                   EAARAGEAGKGFAVVAQEVRELAQRSAKAAKEIKDLITNSGTHVQTGVSLVGETGKALD
FT                   SIVQEVQEINQHVHAIAEASREQSIGLQEINTAVNTMDQGTQQNAAMVEQSTAASHSLA
FT                   TEATALNNLLGQFRLTGTGGFAAAAPISSTRPPAAAPRAAARPVAKAPAVRVAREGTAR
FT                   PTASPARALSQTLANAFGATNSAPKGQDGDWTEF"
FT   sig_peptide     complement(187024..187113)
FT                   /locus_tag="Rleg2_0185"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.995) with cleavage site probability 0.418 at
FT                   residue 30"
FT   gene            187652..188527
FT                   /locus_tag="Rleg2_0186"
FT   CDS_pept        187652..188527
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0186"
FT                   /product="extracellular solute-binding protein family 3"
FT                   /note="PFAM: extracellular solute-binding protein family 3;
FT                   KEGG: rec:RHECIAT_CH0000603 probable amino acid ABC
FT                   transporter, substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53486"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZPG9"
FT                   /protein_id="ACI53486.1"
FT                   /translation="MTQSKLASLTLKGFFAFGLLLAALFCGFAASAQQATPSLPLLFDA
FT                   RERLARPDLSSLVRLRFLTSVDFPPFNFTDQNGKLSGFNVDLAREICSELEISDKCQIQ
FT                   AIPFADLKDALAASQGDAVIAGLAVTPELRRQFVFSRPYLMLPARFVRNLAVPLDGKTA
FT                   AALSAHPVGVVRGTVHEAMLAAFFPAIKAQAFDTKDALLAALKDRKVDAAFADALQLSF
FT                   WVSSPASAKCCALFDGPYLSEHFLGEGMTIMLRQKDSVLTSAIDHALATLSRNGRLQEI
FT                   YLRYFPYGLY"
FT   sig_peptide     187652..187750
FT                   /locus_tag="Rleg2_0186"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.620 at
FT                   residue 33"
FT   gene            complement(188538..188951)
FT                   /locus_tag="Rleg2_0187"
FT   CDS_pept        complement(188538..188951)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0187"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ret:RHE_CH00534 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53487"
FT                   /db_xref="InterPro:IPR029024"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZPH0"
FT                   /protein_id="ACI53487.1"
FT                   /translation="MNKPLSAHDALIYVMVMASAVDSTMNDREMERIGQLIGFLPVFRD
FT                   FDDDKLISVARDCASLLAGPEGLDVVLETVRDTLPAKLYDTAYALAVEVASADLSVKAE
FT                   ELRLLSLLRDRLGLDKLTCAAIERSAIARFRKG"
FT   gene            complement(189034..189750)
FT                   /locus_tag="Rleg2_0188"
FT   CDS_pept        complement(189034..189750)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0188"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rec:RHECIAT_CH0000605 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53488"
FT                   /db_xref="InterPro:IPR035437"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZPH1"
FT                   /protein_id="ACI53488.1"
FT                   /translation="MRPAAVFTGLIGMVVVAGLLMAGEARLRGGTAGDEAVSAEETATT
FT                   ADSPAPAREPAAISDDRAEVIVRSTEPAAQPAPPSSGPADGMAPKPAENEKRAETAAGQ
FT                   TESPAAKKPMELARPAVENAGLLSFGERKLLIAGIAPTPADKICGPTGRQWPCGMMAKT
FT                   ALRQLLRNRSIACDLDTAEWKDTATTACRLGTQDLGTWLAENGWAEAAAGSPLASAAEK
FT                   ARQAGKGLYGDDPRRR"
FT   sig_peptide     complement(189682..189750)
FT                   /locus_tag="Rleg2_0188"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.994) with cleavage site probability 0.992 at
FT                   residue 23"
FT   gene            complement(189762..190439)
FT                   /locus_tag="Rleg2_0189"
FT   CDS_pept        complement(189762..190439)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0189"
FT                   /product="putative phage repressor"
FT                   /note="PFAM: peptidase S24 and S26 domain protein; KEGG:
FT                   rec:RHECIAT_CH0000606 putative phage-related
FT                   transcriptional regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53489"
FT                   /db_xref="GOA:B5ZPH2"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="InterPro:IPR039418"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZPH2"
FT                   /protein_id="ACI53489.1"
FT                   /translation="MLSHDQIWGAIDRLAERHELTPSGLARRAGLDPTSFNKSKRLSAD
FT                   GRLRWPSTESIAKVLDATGASVEQFLAFLQPDAGFSKRPAGQSDGAFPPQGSSIPLLGF
FT                   AQAGAGGFFDDGGFPAGQGWDVVEFPAAPAQKSAVYALEVQGESMMPLYRDGDVLIVEP
FT                   GAQVRRNDRVVVRTCEGEVMAKVLLRQSPRSIELMSLNPEHPNRTLELSDVDWIARIIW
FT                   ASQ"
FT   gene            complement(190553..191200)
FT                   /locus_tag="Rleg2_0190"
FT   CDS_pept        complement(190553..191200)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0190"
FT                   /product="two component transcriptional regulator, LuxR
FT                   family"
FT                   /note="PFAM: regulatory protein LuxR; response regulator
FT                   receiver; Sigma-70 region 4 type 2; KEGG:
FT                   rec:RHECIAT_CH0000607 probable two-component response
FT                   regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53490"
FT                   /db_xref="GOA:B5ZPH3"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZPH3"
FT                   /protein_id="ACI53490.1"
FT                   /translation="MQEQTIIIADDHPLFRDALRQAVIGMEGRQAIVEAGDFAAARKAA
FT                   GAHAEADLMLLDLAMPGVSGFSGLMALRSEFASLPIIIVSATDDATTIRRALELGASGF
FT                   ISKSAGIDDIRRSIQTVLAGDIATPENYRGGQEQDPDVADLIHRLHTLTPQQSRVLTML
FT                   GEGLLNKQIAYELGVSEATIKAHVSAILLKLDVDSRTQAVIQLGKINMAMVA"
FT   gene            complement(191294..191692)
FT                   /locus_tag="Rleg2_0191"
FT   CDS_pept        complement(191294..191692)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0191"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rec:RHECIAT_CH0000608 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53491"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZPH4"
FT                   /protein_id="ACI53491.1"
FT                   /translation="MKILVLTLGVLLLPFGAAAAEADASRFQLEKSGDHFVRLDRQTGA
FT                   MSICQDKDGALVCRMAADERAAYEDELDRLSERVTKLEQGGPIQRALPSDAEVDRSISI
FT                   MEKMMKSFMGMVKEFQAEENANPLPQKT"
FT   sig_peptide     complement(191633..191692)
FT                   /locus_tag="Rleg2_0191"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.931 at
FT                   residue 20"
FT   gene            191816..192169
FT                   /locus_tag="Rleg2_0192"
FT   CDS_pept        191816..192169
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0192"
FT                   /product="protein of unknown function DUF952"
FT                   /note="PFAM: protein of unknown function DUF952; KEGG:
FT                   rec:RHECIAT_CH0000609 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53492"
FT                   /db_xref="InterPro:IPR009297"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZPH5"
FT                   /protein_id="ACI53492.1"
FT                   /translation="MSVTPTLYKIVTETLWHQARQTGIFHGAGIDLKDGFIHFSTAEQV
FT                   KQTAALHFTGQAGLLLIAVNGGRFGDKLVFEPSRGGDLFPHLYADLPLEAVLWEAPLPL
FT                   DQAGAHIFPELQP"
FT   gene            192166..193254
FT                   /locus_tag="Rleg2_0193"
FT   CDS_pept        192166..193254
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0193"
FT                   /product="Dihydroorotate oxidase"
FT                   /EC_number="1.3.98.1"
FT                   /note="PFAM: dihydroorotate dehydrogenase; KEGG:
FT                   rec:RHECIAT_CH0000610 dihydroorotate dehydrogenase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53493"
FT                   /db_xref="GOA:B5ZPH6"
FT                   /db_xref="InterPro:IPR001295"
FT                   /db_xref="InterPro:IPR005719"
FT                   /db_xref="InterPro:IPR005720"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5ZPH6"
FT                   /protein_id="ACI53493.1"
FT                   /translation="MIDPFKRLARKGLFLFDPETAHGMSIAALKSGLVPACQITPDPRL
FT                   CQTVAGLTFENPLGMAAGYDKNAEVPEALLKLGFGFTEIGTVTPKPQAGNPRPRIFRLV
FT                   EDEAVINRLGFNNEGHEAAFGRLAALSGRGIVGVNIGANKDSEDRIADYVAGIRRFHSV
FT                   ARYFTANISSPNTPGLRDLQARESLAALLSSVLAARDEVAAASGRKVPVFLKIAPDLTE
FT                   EGMDDIAAEALAHALDGLIVSNTTLSRDGLKDQRQAKETGGLSGVPLFEKSTAVLARMR
FT                   KRVGAALPIIGVGGVSSAETALEKIRAGADLVQLYSCMVYEGPGLPGDIVRGLSKLMDR
FT                   EKAAGIGELRDSRLDYWAARKV"
FT   gene            complement(193230..194570)
FT                   /locus_tag="Rleg2_0194"
FT   CDS_pept        complement(193230..194570)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0194"
FT                   /product="MATE efflux family protein"
FT                   /note="TIGRFAM: MATE efflux family protein; PFAM: multi
FT                   antimicrobial extrusion protein MatE; KEGG:
FT                   rec:RHECIAT_CH0000611 DNA-damage-inducible F protein (Na+
FT                   driven multidrug efflux pump)"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53494"
FT                   /db_xref="GOA:B5ZPH7"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZPH7"
FT                   /protein_id="ACI53494.1"
FT                   /translation="MDTHNNRFAFEVTHRLVLSIAIPMTLGFMTTPMLGLTNTAVVGRI
FT                   GDPEALAGLAIGAMLFDLIMGSFNFLRASTTGLTAQAYGRRDQHEQQAVFSRALISALG
FT                   CGLALLCLSPLLNAAGLRLMGAEGAIAEATSTYFSIRILAAPAALANYAILGFVLGRGQ
FT                   GKIGLLLQAIINGINILLSIYLGLTLGWGVAGVAWGTMAGETAGALAGLFIVLSGFAKA
FT                   ERPAWAEISSRHRLAELFALNRDILIRTFVLIGAFTIMTRIGTSFGAVTLAANAVLMNF
FT                   VLLSSYYLDGLANAAEQITGRAIGARYRPAFDRGLKLTILWSFGLAAIVSAFFFLAGPW
FT                   LISVLTTSPEVRQAAAAYLPWAAVTGLTGALAFLMDGVFIGATWSAEMRNRMLMSFAGY
FT                   LLMLAVFVPLFGNHGLWLAMNAFLLFRGFFLALLVKPRADQTFRAAQ"
FT   gene            complement(194600..195097)
FT                   /locus_tag="Rleg2_0195"
FT   CDS_pept        complement(194600..195097)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0195"
FT                   /product="SCP-like extracellular"
FT                   /note="PFAM: SCP-like extracellular; KEGG:
FT                   rec:RHECIAT_CH0000612 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53495"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR014044"
FT                   /db_xref="InterPro:IPR035940"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZPH8"
FT                   /protein_id="ACI53495.1"
FT                   /translation="MTSIDLSRRSLLILSGLSLAAGIAGCTTTPRLAGTPSNGEDETAS
FT                   VLPLVNQLRAKNGLPPLAVDPAASTAALFQAKRMASAGKMAHLMGLTDSFGARVKASGV
FT                   RLPAAENIASGQQSVDAVVTAWINSPHHLENMLGRYDGLGVAVAHNSSSRNLPYWAMVL
FT                   SS"
FT   sig_peptide     complement(194996..195097)
FT                   /locus_tag="Rleg2_0195"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.983 at
FT                   residue 34"
FT   gene            complement(195099..195365)
FT                   /locus_tag="Rleg2_0196"
FT   CDS_pept        complement(195099..195365)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0196"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rec:RHECIAT_CH0000613 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53496"
FT                   /db_xref="GOA:B5ZPH9"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZPH9"
FT                   /protein_id="ACI53496.1"
FT                   /translation="MSDQVNRFLGDSLARTLIKLVVVSLIVGFVMTVFGLTPWNIIYGF
FT                   RDFILEIWHRGFSALGRVGDYLLLGATIVIPLFVILRLFSYRR"
FT   gene            195540..196472
FT                   /locus_tag="Rleg2_0197"
FT   CDS_pept        195540..196472
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0197"
FT                   /product="Methyltransferase type 12"
FT                   /note="PFAM: TPR repeat-containing protein;
FT                   Tetratricopeptide TPR_2 repeat protein; Methyltransferase
FT                   type 12; KEGG: rec:RHECIAT_CH0000614 probable
FT                   methyltransferase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53497"
FT                   /db_xref="GOA:B5ZPI0"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZPI0"
FT                   /protein_id="ACI53497.1"
FT                   /translation="MQPHQLSSGDVIADRRADYARMLDEGGEPEAAAELMEQALELVPG
FT                   WAAGWYRLATYREKAGSGEAAIEAYRNTLALDPDDIFGAALKLALLGDAATPDRPPSRY
FT                   VERLFDDYADRFESALVEKLDYTVPQKLAALVASTGRHYACAVDLGCGTGLLGPEIHGR
FT                   VSRLEGFDLSQNMLAKAAEKGIYDHLAQADLSLAPDLSGLFAEAGRGRADLVTAADVLM
FT                   YLGNLESVFAIIEDLAGAGADIAFSVEDAGDSGGFHLAPSLRYAHSEAYVRLLLARHGL
FT                   DILKIVKTVIRKDGGKPVAGILFLTRKAA"
FT   gene            196681..197316
FT                   /locus_tag="Rleg2_0198"
FT   CDS_pept        196681..197316
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0198"
FT                   /product="protein of unknown function DUF161"
FT                   /note="PFAM: protein of unknown function DUF161; KEGG:
FT                   ret:RHE_CH00545 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53498"
FT                   /db_xref="GOA:B5ZPI1"
FT                   /db_xref="InterPro:IPR003740"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZPI1"
FT                   /protein_id="ACI53498.1"
FT                   /translation="MTQRINALGFWNTSATRHAPIEDVQGIFSGSLVAALGLYVLASAG
FT                   LLTGSTAGVAFLLHYAFGVNFGLAFFLLNLPFFWLSWKRLGMAFTIKTFIAIGLTSVLS
FT                   DVQSRFFSISSIHPAWAALLGGLLLGFGVLALYRHRASLGGVGILGVYVQERFGIRAGL
FT                   VQLAIDLCVLAAAFFVTTPPVVFYSVLGAVVLNLFVAINHRADRYIAL"
FT   gene            complement(198412..198873)
FT                   /locus_tag="Rleg2_0199"
FT   CDS_pept        complement(198412..198873)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0199"
FT                   /product="alkylhydroperoxidase like protein, AhpD family"
FT                   /note="TIGRFAM: alkylhydroperoxidase like protein, AhpD
FT                   family; PFAM: Carboxymuconolactone decarboxylase; KEGG:
FT                   rec:RHECIAT_CH0000617 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53499"
FT                   /db_xref="GOA:B5ZPI2"
FT                   /db_xref="InterPro:IPR003779"
FT                   /db_xref="InterPro:IPR004675"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZPI2"
FT                   /protein_id="ACI53499.1"
FT                   /translation="MQPRFNFAKAAPDAYKAVAALEQYVQSSGLERRFIHLIKLRASQI
FT                   NGCAYCVDMHVKEARHDGLSEQWINLMCVWRESPIYDARERALLGWVDAVTNLAKSGAP
FT                   DADYEALKAHFSEEEMTKITVAIGAINIWNRLAVGFRSQHPIDAAVKAA"
FT   gene            complement(198895..199395)
FT                   /locus_tag="Rleg2_0200"
FT   CDS_pept        complement(198895..199395)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0200"
FT                   /product="transcriptional regulator, BadM/Rrf2 family"
FT                   /note="TIGRFAM: transcriptional regulator, Rrf2 family;
FT                   PFAM: protein of unknown function UPF0074; Helix-turn-helix
FT                   type 11 domain protein; KEGG: rec:RHECIAT_CH0000618
FT                   putative transcriptional regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53500"
FT                   /db_xref="GOA:B5ZPI3"
FT                   /db_xref="InterPro:IPR000944"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR030489"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZPI3"
FT                   /protein_id="ACI53500.1"
FT                   /translation="MKMSDGVEQAIHSVAMLAGLSEGGVLSAAALAEFHGVSTSYLLKH
FT                   LQALSGAGILDTVPGPRGGYRLAKAPEEISLLDILLAVEGPAPAFRCAEIRQRGPNPVS
FT                   DRLFAKPCNISAAMLRAERVYRAELAKTSIADLGIELTAIDDGSIAARGCAFLEIHERK
FT                   TAR"
FT   gene            199525..200157
FT                   /locus_tag="Rleg2_0201"
FT   CDS_pept        199525..200157
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0201"
FT                   /product="protein of unknown function DUF161"
FT                   /note="PFAM: protein of unknown function DUF161; KEGG:
FT                   rec:RHECIAT_CH0000619 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53501"
FT                   /db_xref="GOA:B5ZPI4"
FT                   /db_xref="InterPro:IPR003740"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZPI4"
FT                   /protein_id="ACI53501.1"
FT                   /translation="MAANAFTGLLNSSADRHSLFDDAQGIVAGSMLAVLGVSLLSGAGL
FT                   LAGGTAGLAFLAHYATGFSFGLCFFAVNLPFYYLAFRRMGPAFTIKTFAAIALTSILSE
FT                   FVPGFIGIGHVNPIAGALFGGLVIGAGMLALFRHRASLGGIGILALYIQDRLGWRAGLV
FT                   QLGFDCLILALSFLVASPSIIACSVLGAVVFNLTLAINHRKDRYIAV"
FT   gene            200206..202731
FT                   /locus_tag="Rleg2_0202"
FT   CDS_pept        200206..202731
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0202"
FT                   /product="DEAD/H associated domain protein"
FT                   /note="PFAM: helicase domain protein; DEAD/DEAH box
FT                   helicase domain protein; DEAD/H associated domain protein;
FT                   SMART: DEAD-like helicases; KEGG: rec:RHECIAT_CH0000620
FT                   ATP-dependent RNA/DNA helicase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53502"
FT                   /db_xref="GOA:B5ZPI5"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR013701"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR017170"
FT                   /db_xref="InterPro:IPR026362"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZPI5"
FT                   /protein_id="ACI53502.1"
FT                   /translation="MDQIDSEARALLPAAFTRWFAEKGWRPRAHQLELLSRAEAGESTL
FT                   LIAPTGAGKTLAGFLPSLTDLTRRGRIPPGSAFTGIHTLYVSPLKALAIDIERNLMKPV
FT                   EEMGLPVTVENRTGDTPNAKRQRQKLNPPDILLTTPEQVALLLANREAERFFKDLKYVV
FT                   LDELHSLVTSKRGHMLSLGLARLRRLAPGLQTIGLSATVAEPMDLQKWLVAQQEGSGQE
FT                   GREHHAGLVVVEGGAKPDISILSTEERIPWAGHSAKYAIPDVYNQLVDHQTTLLFVNTR
FT                   SQAEMLFQELWTINDDNLPIALHHGSLDVAQRRKVEAAMAENRLRAVVATSTLDLGIDW
FT                   GDVDLVIHVGAPKGASRLAQRIGRANHRMDEPSKAILVPANRFEVMECQAALDANYIGA
FT                   QDTPPVGRGALDVLAQHVLGMACAEPFDMLELYDEIISASPYADLSWETFERIVDFVAT
FT                   GGYALRTYERYARIRKTKEGRWRVSNPAVAQQYRLNLGTIVESPMLNIRMVKRGEGGRI
FT                   GRGGATLGKVEEYFLEQLSPGDTFVFSGKVLRFEGIRENECLASQAFSLDPKIPSYNGG
FT                   KFPLSTYLAEQVRAMIADPDRWRHLPDQVRDWLSLQNDKSMLPKRDEFLIETFPRGSRG
FT                   YMVAYPFEGRLAHQTLGMLLTRRLERAGAKPLGFVATDYSLAVWGLEDMGMMIANGRLS
FT                   LSDLFDEDMLGDDLEAWLDESFLLKRTFRNCAVIAGLIERRHTGKEKSGRQITVSADLI
FT                   YDVLRSHEPDHILLQATRQDAATGLLDIGRLGDMLRRIRGHITHRPLDHISPLAVPVML
FT                   EIGREAVPGEAHDALLAEAADDLIAEAMA"
FT   gene            202753..203481
FT                   /locus_tag="Rleg2_0203"
FT   CDS_pept        202753..203481
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0203"
FT                   /product="putative phosphoesterase protein"
FT                   /note="KEGG: rec:RHECIAT_CH0000621 putative phosphoesterase
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53503"
FT                   /db_xref="GOA:B5ZPI6"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR024173"
FT                   /db_xref="InterPro:IPR026336"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZPI6"
FT                   /protein_id="ACI53503.1"
FT                   /translation="MINRLALARDISGLAAIPGIETSVHGIAAVCDPLGALYLPDAGLL
FT                   VVSDLHLEKGAAFARRGMMLPPYDTLATLTVLAAVIARYDPKLVVSLGDNFHDRIGSKH
FT                   LPEDFRALIVVMARGREWIWVNGNHDPDGVVDLPGASVDEMHYAGLTFRHEPRNGLQSG
FT                   EIAGHLHPSATVRRRDRSIRRPCFATDGARLLMPAFGVMSGGLDLGHQAMKGLFDKGSL
FT                   IAHLLGRDRIYSVRYGNLRG"
FT   gene            complement(203713..204294)
FT                   /locus_tag="Rleg2_0204"
FT   CDS_pept        complement(203713..204294)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0204"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ret:RHE_CH00551 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53504"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZPI7"
FT                   /protein_id="ACI53504.1"
FT                   /translation="MRTRIVLTAVGLALLAGCATAPKQTRNICAVFDERDGLFSSWQSA
FT                   AERTEKKYGVPVPILMATMYTESGFQPYARPPRTKLFGFIPWTRPSTAYGYSQALDGTW
FT                   DHYQSQTGNWTARRANFADAIDFIGWYHAQNSAETGIPLNDAYNLYLAYYSGPTGYKRG
FT                   DWRSNGQLQQTAQKFARMAGTYQQQLRGCD"
FT   sig_peptide     complement(204232..204294)
FT                   /locus_tag="Rleg2_0204"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.951) with cleavage site probability 0.671 at
FT                   residue 21"
FT   gene            complement(204323..205309)
FT                   /locus_tag="Rleg2_0205"
FT   CDS_pept        complement(204323..205309)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0205"
FT                   /product="alpha/beta hydrolase"
FT                   /note="KEGG: mag:amb4148 predicted alpha/beta hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53505"
FT                   /db_xref="GOA:B5ZPI8"
FT                   /db_xref="InterPro:IPR017208"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZPI8"
FT                   /protein_id="ACI53505.1"
FT                   /translation="MAEGADLPLAEERDERPALDTPVEIRCSDGVMLGGHIWTSGDAKA
FT                   RASVIINPATGVLARYYHRYAQFLAAHGFDVLTYDYRGIGLSRPARLRGCGYRWREWGE
FT                   KDFDAALRFVDGRADQPLYIVGHSIGGFLPGLSKHAGRIDRMLTMGAQYAYWRDYAPAR
FT                   RMRLLMKWHVAMPALTALFGYFPGKRLGWLEDLPAGVAHEWSFRRARMEMSHPAAERDE
FT                   VLKRFAAVTAPILAVAMSDDELGTVPAIRRTLAYYRNAQIDEVLLQPADLGFEAIGHFG
FT                   LFHSRHCEGFWRDSVLWLRDGIHPWPAQAALQKTSYSTKNRFLTFTS"
FT   gene            complement(205416..205979)
FT                   /locus_tag="Rleg2_0206"
FT   CDS_pept        complement(205416..205979)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0206"
FT                   /product="bifunctional deaminase-reductase domain protein"
FT                   /note="PFAM: bifunctional deaminase-reductase domain
FT                   protein; KEGG: rec:RHECIAT_CH0000623 putative dihydrofolate
FT                   reductase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53506"
FT                   /db_xref="GOA:B5ZPI9"
FT                   /db_xref="InterPro:IPR002734"
FT                   /db_xref="InterPro:IPR024072"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZPI9"
FT                   /protein_id="ACI53506.1"
FT                   /translation="MDIRKLVVWNLMTLDGYFEGTKPWDIDFHNLAWGPELQHFAEQFG
FT                   EEGDLLVFGRKTYEGMASYWPTAESEDTIKAYMNGIAKIAVSRTMTEPGWNNARVVSDP
FT                   IPELTRLKQEDGKTIFIFGSAELADSLLKAGLIDEVRVCVVPVILGGGNPLFKPAAGQV
FT                   PLKLIESSTTQGGAVILRYEPVKA"
FT   gene            complement(206149..206949)
FT                   /locus_tag="Rleg2_0207"
FT   CDS_pept        complement(206149..206949)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0207"
FT                   /product="conserved hypothetical protein"
FT                   /note="PFAM: conserved hypothetical protein; KEGG:
FT                   rec:RHECIAT_CH0000624 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53507"
FT                   /db_xref="GOA:B5ZPJ0"
FT                   /db_xref="InterPro:IPR019088"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZPJ0"
FT                   /protein_id="ACI53507.1"
FT                   /translation="MRLLAAVLTLLCLLPAAAGAQWLPGQSTEAVREGLEIGTSTSEIA
FT                   ITSDFHGADLTIFGALSNTDQLLLAIGQYDVVVVLEGPRQDATVRKKERVFGIWVNTRS
FT                   MTFESVPHSYSMSSSRMIDDLTTPLELTDQGIGIDHIPLTPVGFVGDGSNLGEFRDAFR
FT                   RLQQGGGFYDRNPSGVRFVSSNLFKASLRLPANIPNGVHTVRAYLFKSGILVTEESLPL
FT                   RVIKTGIEQMITDAAHGQPILYGCASVLLALITGWGASLIFRKD"
FT   sig_peptide     complement(206887..206949)
FT                   /locus_tag="Rleg2_0207"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.969 at
FT                   residue 21"
FT   gene            complement(206949..207872)
FT                   /locus_tag="Rleg2_0208"
FT   CDS_pept        complement(206949..207872)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0208"
FT                   /product="protein of unknown function DUF81"
FT                   /note="PFAM: protein of unknown function DUF81; KEGG:
FT                   ret:RHE_CH00554 putative permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53508"
FT                   /db_xref="GOA:B5ZPJ1"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZPJ1"
FT                   /protein_id="ACI53508.1"
FT                   /translation="MTIYLPIAELSVNIFIILGMGAAVGFLSGMFGVGGGFLITPLLIF
FT                   YNIPPVVAVATGANQVVASSISGAITHFRRGTLDVKLGTVLLVGGLTGATVGIWIFSLL
FT                   RAIGQLDLIISLMYVIFLGTVGGLMLLESINAMRRAARNEPPAPRKPGHQHWVHRLPLK
FT                   VRFKKSKIFLSVIPIVALGFAIGILTSIMGVGGGFIMVPAMIYLLRIPTNVVVGTSLFQ
FT                   IIFVTAYTTIVQAATNFSVDIVLAFILMVAGVIGAQYGVRVGQKLRGEQLRALLGLLVL
FT                   AVGLRLAIALVVTPADIYSVVIGAHN"
FT   gene            complement(208425..212207)
FT                   /locus_tag="Rleg2_0209"
FT   CDS_pept        complement(208425..212207)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0209"
FT                   /product="Peptidoglycan-binding domain 1 protein"
FT                   /note="PFAM: Peptidoglycan-binding domain 1 protein; Sel1
FT                   domain protein repeat-containing protein; KEGG:
FT                   rec:RHECIAT_CH0000627 putative hemaglutinin protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53509"
FT                   /db_xref="InterPro:IPR002477"
FT                   /db_xref="InterPro:IPR006597"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR036365"
FT                   /db_xref="InterPro:IPR036366"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZPJ2"
FT                   /protein_id="ACI53509.1"
FT                   /translation="MNGSRSNPSRQSDRTSLDALNRTIEGLEARIEGLMGSGREQRPRT
FT                   ATAERGPYAGSNTPRPARAPIEPRPDPLAEIRQRQRALEAGRERPYGREPAPQLRDPAP
FT                   RPAPQAAPAFRAGDDTMTEIAQALVNLRQDLKRDISEGVTREMNALRTELREIKTNAGD
FT                   GRFADDMRADMGRLAQSITQLTGRSSAPEATGLREDFEELRSLMDGLAREDSLRHMENR
FT                   WDGFESRLAALDTEGLQEELVSLAYRLDDIKRHIGGMGESPAVRALEDKLIAIATAMEQ
FT                   FGSMIQPHDRVMSEQFAAMDMRLDEISRAIAASGRAAANDPGLMQRLEGRLSALADQID
FT                   LMSHDAANRATPDDELALRLEALTSRVEELTKAEATSRLDERLEHLSYLLEHTQKAAPQ
FT                   PDLTGPLSDISRKIDALENGAVNDVLAQRLDYLARRIDEMAHQPPAPAVTVDDGAFRRL
FT                   EGRLSDIAARLEESTAAAPTDPHALKNLEDQIANLSALMSEPRESAAIPADLDRRMGAI
FT                   EDYMATSDEYIIEAARQAAEAVVEAYSRNGAAQGGVPAADMSALTALAEDLRHLEDISR
FT                   DSEERTHKTFKALHETLVHIADRLDGMEERGRPAAQMPLAEVDFDVDPYALMVAEAEMN
FT                   KAPAAVATAKASPVIRTAEVAAEPAAPAQATAMSGTSAIAIEAATRTPEAATPALVQAP
FT                   AKASLLASLGKRLRPGKKTESRATERPMIDPAPSIDPADVVPTDASNELLEPGSGAPDV
FT                   KKILERVRASQSAARGKPAAETDRADYIAAARRAAQAAAMEVDANPKQAAVKGEKKAAD
FT                   KAGKISDKTDKAGKTSAFSRYRRPILLAVGAVLLAIMAFPLARTLTSGESAPQAPAEVS
FT                   ALTGATESPQPASPEVTPAQPENNAADMAAPATEATPPAGEQAQPQAAPPVAGDHLTDA
FT                   TPLDGEGAATLAPAAPSGAAQETSGFVPNTPAASGPQAAITIPDTIQPKSLADAAQGGD
FT                   ALALFEIGARYSDGRNGIAVDQKQAAGWYQLSADKGFAPAQYRLGSMYEKGNGVERDIA
FT                   KAKGFYEQAANQGNASAMHNLAVLYASGALGQQDYATAASWFTKAANLGITDSQFNLAI
FT                   LCARGNGVPADLEESYKWFAIAAKAGDKDAAQKRDEVANAMKPDQLERARAKADLWKPE
FT                   PLDHRSNTIDIPDEWAGTGLKTASVDMKKAVRNIQAILNNNGFDAGTPDGEMGAKTVTA
FT                   IKNFQKSIGQEPDGKVTDATVKALLERNKQGAKAI"
FT   gene            complement(212536..212901)
FT                   /locus_tag="Rleg2_0210"
FT   CDS_pept        complement(212536..212901)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0210"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; KEGG: rec:RHECIAT_CH0000628 putative
FT                   lactoylglutathione lyase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53510"
FT                   /db_xref="GOA:B5ZPJ3"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZPJ3"
FT                   /protein_id="ACI53510.1"
FT                   /translation="MPRLDHVTIETRDAPRMIGFFKTVLGVEEGYRPPFPSPGHWLYLD
FT                   DRPVIHLSLTSRSSDFPLGIFNHIAFSLYEFAPALERIKASGYRYEYYDIPDTDLGQVF
FT                   VYGPEGVKIELQYKRPA"
FT   gene            complement(212986..213687)
FT                   /locus_tag="Rleg2_0211"
FT   CDS_pept        complement(212986..213687)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0211"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   acr:Acry_1425 short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53511"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZPJ4"
FT                   /protein_id="ACI53511.1"
FT                   /translation="MSDFPYASALIVGAGSGISASLARQLSALGVKVGLAARNIEKLQA
FT                   LLEETGASAFSADVSQPASVAALFEEAAATIGGPDVVIFNAGARVRGPLAELDPDEVEK
FT                   AIATTAFGGFLVAQQAAQHMIPRGRGAIFFTGASASVKGFAQSAPFAMGKFALRGLAQS
FT                   AARELGPMGIHVAHFVIDGGVRSEIRPDRAEKPDGTLLPDAIAQTYIDVLRQHRSAWSL
FT                   EVEVRPWTENF"
FT   sig_peptide     complement(213616..213687)
FT                   /locus_tag="Rleg2_0211"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.913) with cleavage site probability 0.844 at
FT                   residue 24"
FT   gene            complement(213763..214452)
FT                   /locus_tag="Rleg2_0212"
FT   CDS_pept        complement(213763..214452)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0212"
FT                   /product="putative DNA glycosylase protein"
FT                   /note="KEGG: rec:RHECIAT_CH0000629 probable DNA glycosylase
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53512"
FT                   /db_xref="GOA:B5ZPJ5"
FT                   /db_xref="InterPro:IPR005019"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZPJ5"
FT                   /protein_id="ACI53512.1"
FT                   /translation="MISFEAIRQRAEQRKGGAAVLQAMLEKHRPDHERLRAMPDDRILA
FT                   DMTRRIFYSGFVQKVIDAKWPGFEAAFSGFDPATLNIAPDDYWHELTSDERIIRNGAKI
FT                   MSVRANAAFVRELAKEHGSAGAFFADWPREDQIGLLDLLSKRGSRLGGMTGQYFLRGIG
FT                   RDSFVATMDVLACLRSAGVPLSASGTAKKDQPLIQQAFNQWAEETGLSFIHLSRISAYS
FT                   IDAGGPH"
FT   gene            214691..216487
FT                   /locus_tag="Rleg2_0213"
FT   CDS_pept        214691..216487
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0213"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein; KEGG:
FT                   ret:RHE_CH00557 acyl-CoA dehydrogenase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53513"
FT                   /db_xref="GOA:B5ZPJ6"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR020953"
FT                   /db_xref="InterPro:IPR025878"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZPJ6"
FT                   /protein_id="ACI53513.1"
FT                   /translation="MPVYKAPVNDTLFVLNDVLGLERYNNLPGFADATPDMIEAILGEA
FT                   AKVAEEVLFPVNYSGDQEGCTRHDDASVSTPKGFQDAYKAYRDGGWIGLAVPEEFGGQG
FT                   LPYTLHTAVGEYTSAANMSLMMYPGLTQGAIAAILVHGSTEQKATYLPKMVDGAWTGTM
FT                   NLTEPHCGTDLGMLRTKAVPQADGSYKIAGQKIFISAGEHDLADNIVHLVLARIEGAPE
FT                   GTKGISLFIVPKFLVGKDGALGARNAVTCGAIEHKMGIHANATCVMNYDEATGFLIGAE
FT                   NRGLNAMFVMMNEARLMVGLQGIAISEIAYQNAANYARDRIQGRSLSGPKAPDKKADPI
FT                   IVHPDIRRTLMTIRAFNEAGRAFLLWTALKSDIAHRATDDKERQTADDILGLVTPILKG
FT                   VMTDKGFDHAVMAQQVFGGHGYIEEHGMSQYVRDARIAMIYEGANGIQALDLVGRKLAL
FT                   NGGRAAMALFKEIGDFCEENRSDEKLSFFTKHLKKGLNDVQAATMWFMQNAMAKPDNAG
FT                   AGSTDYMHLFGLVVLGYMWAKMAKAAEDGLASGDGAREDFLRNKLITAKFFMERIMPET
FT                   ALRKARIEAGADTMMELAAEAF"
FT   gene            216691..217899
FT                   /locus_tag="Rleg2_0214"
FT   CDS_pept        216691..217899
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0214"
FT                   /product="acetyl-CoA acetyltransferase"
FT                   /EC_number="2.3.1.16"
FT                   /note="KEGG: rec:RHECIAT_CH0000631 acetyl-CoA
FT                   C-acyltransferase protein (3-ketoacyl-CoA thiolase);
FT                   TIGRFAM: acetyl-CoA acetyltransferase; PFAM: Thiolase"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53514"
FT                   /db_xref="GOA:B5ZPJ7"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020610"
FT                   /db_xref="InterPro:IPR020613"
FT                   /db_xref="InterPro:IPR020615"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZPJ7"
FT                   /protein_id="ACI53514.1"
FT                   /translation="MTEVFIYDHVRTPRGRGKKDGALHEVPSVRLAAKTLEAIRDRNGL
FT                   DTATVDDIIMGCVDPVMDAGAVIPKAAAFEAGYSTRAPGMQISRFCASGLDAVNFAAGK
FT                   IAQGADDIVIAGGVESMSRVGLGMSGGAWFMDPSVNFPAYFMPQGVSADLIATKYGFSR
FT                   TDVDAYAVESQKRAGHAWAQGWFDRSVVPVKDQNGLTILDKDEHMRPGTDMQALASLNP
FT                   SFQMPGEMGGFEAVGIQAHPEIERINYVHHAGNSSGIVDGAGVVLLGSKAGGESMGLKP
FT                   RARIKAFANIGSDPALMLTGPVDVTEKLLKRTGMRLADIDLFELNEAFAAVVLRYMQAF
FT                   DIDHDTINVNGGAIAMGHPLGATGAMILGTVLDELERRDLNTALVTLCIGAGMGTATVI
FT                   ERV"
FT   gene            217902..218285
FT                   /locus_tag="Rleg2_0215"
FT   CDS_pept        217902..218285
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0215"
FT                   /product="Cupin 2 conserved barrel domain protein"
FT                   /note="PFAM: Cupin 2 conserved barrel domain protein; KEGG:
FT                   bac:BamMC406_6039 cupin 2 conserved barrel domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53515"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZPJ8"
FT                   /protein_id="ACI53515.1"
FT                   /translation="MSFNTGTIETEYAEVTEHWSPRVIADLNGQSVKLAKVQGQLTWHS
FT                   HRDEDELFLIWKGALTIEYRDRPRVHLKAGDFHVVPKGVEHNPVAEEECWIVLFEPSQT
FT                   KHTGDVVTEKTKTVDAQRSHLPA"
FT   gene            218302..220515
FT                   /locus_tag="Rleg2_0216"
FT   CDS_pept        218302..220515
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0216"
FT                   /product="3-hydroxyacyl-CoA dehydrogenase NAD-binding"
FT                   /note="PFAM: Enoyl-CoA hydratase/isomerase;
FT                   3-hydroxyacyl-CoA dehydrogenase domain protein;
FT                   3-hydroxyacyl-CoA dehydrogenase NAD-binding; KEGG:
FT                   ret:RHE_CH00559 enoyl-CoA hydratase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53516"
FT                   /db_xref="GOA:B5ZPJ9"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR006108"
FT                   /db_xref="InterPro:IPR006176"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZPJ9"
FT                   /protein_id="ACI53516.1"
FT                   /translation="MTYINFTLETDADGIALVTWDMPGKSMNVFTSEVMAELDAIIDAT
FT                   TADAAVKGVVFTSGKSSFSGGADLSMIKSMFGSYQDEKEKSPETAVQTLFGLVGRMSGL
FT                   FRKLETSGKPWVSAINGTCMGGAFELSLACHGRVASNAKSVKIALPEVKVGIFPGAGGT
FT                   QRVPRLANAQDALQMMTTGQSLSGSRAKAMNLVHQVVEPDQLIPAAKQMIKDGLKPVAP
FT                   WDEKGFKLPGGGIWTPASAQLWPAAPAILRRETSGNYPAALAILKCVYEGLQLPFDTGL
FT                   KIEQRYFTEVLQTREAFSMIRSLFISMQELGKGARRPAGIPKTELKHVGVVGAGFMGAS
FT                   IAYVTAAAGLAVTLIDRDMEAAAKGKAVCEGLVKDSVGKGRFTQDEAAALLARITPSAN
FT                   YADLAAAGLVIEAVFEDREVKKAVIEAVEAVLPEGAIFASNTSTLPISGLAKNSKRPAD
FT                   FIGIHFFSPVEKMMLTEVILGKATGDKALAVALDYVAAIKKTPIVVNDTRGFFVNRCVL
FT                   RYMSESYDMLIEGVPPTMIENAAKMAGMPVGPLALNDEVAIDLSLKILKATVADLGEEA
FT                   IDPRHMDLISRMVEKEGRFGRKNSKGFYDYPPKPAKKSLWPELKTLYPQRRADEVDVNV
FT                   LKQRFLVTIALEAARTVEEGIVTDPREADVGSILGFGFAPYTGGALSYIDGMGAKAFVE
FT                   LAEKLAGTYGDHFKPTPLLKDMAAKGETFYGRFDPYAGAKVAA"
FT   gene            220987..221196
FT                   /locus_tag="Rleg2_0217"
FT   CDS_pept        220987..221196
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0217"
FT                   /product="cold-shock DNA-binding domain protein"
FT                   /note="PFAM: Cold-shock protein DNA-binding; SMART: Cold
FT                   shock protein; KEGG: rec:RHECIAT_CH0000633 cold shock
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53517"
FT                   /db_xref="GOA:B5ZPK0"
FT                   /db_xref="InterPro:IPR002059"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012156"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019844"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZPK0"
FT                   /protein_id="ACI53517.1"
FT                   /translation="MSTGTVKWFNATKGFGFIQPDDGAADVFVHISAVERAGMRDLKDG
FT                   QKLSYELVRDNKSGKMSADRLQAA"
FT   gene            complement(221642..222085)
FT                   /locus_tag="Rleg2_0218"
FT   CDS_pept        complement(221642..222085)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0218"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="PFAM: regulatory protein MarR; KEGG:
FT                   rec:RHECIAT_CH0000634 probable transcriptional regulator
FT                   protein, MarR family"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53518"
FT                   /db_xref="GOA:B5ZPK1"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZPK1"
FT                   /protein_id="ACI53518.1"
FT                   /translation="MEGNAFSAFAITALRLAGHLTAAGDQLAKPAGQTSARWQVLAAAR
FT                   RGDMSVAQIARALGLARQGVQRLADVLEGEGLIAYADNPQHQRAKLVQLTADGAARLGV
FT                   IEVAQAGWADGLGAAFTATELDTARAVMARVMEMLEAEEASRG"
FT   sig_peptide     complement(222017..222085)
FT                   /locus_tag="Rleg2_0218"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.803) with cleavage site probability 0.528 at
FT                   residue 23"
FT   gene            222200..222604
FT                   /locus_tag="Rleg2_0219"
FT   CDS_pept        222200..222604
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0219"
FT                   /product="glutathione-dependent formaldehyde-activating
FT                   GFA"
FT                   /note="PFAM: glutathione-dependent formaldehyde-activating
FT                   GFA; KEGG: rec:RHECIAT_CH0000635 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53519"
FT                   /db_xref="GOA:B5ZPK2"
FT                   /db_xref="InterPro:IPR006913"
FT                   /db_xref="InterPro:IPR011057"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZPK2"
FT                   /protein_id="ACI53519.1"
FT                   /translation="MKKTYKGSCHCGKVHYEVDMDLDEGTGRCNCSICAKRRYWGANVK
FT                   PEDFRLMCDEAETSDYQFNTMSGHHRFCRTCGVPAFGDGYVEAIGGAYVSINIACLDDI
FT                   TPEELAALSVRYYDGRHDAWWNEPEVTSYL"
FT   gene            222688..223152
FT                   /locus_tag="Rleg2_0220"
FT   CDS_pept        222688..223152
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0220"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rec:RHECIAT_CH0000636 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53520"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZPK3"
FT                   /protein_id="ACI53520.1"
FT                   /translation="MKDEANARHEEEAIIAMLMMRAKALGEKNAEEALSYEAEDSVEFS
FT                   LAPPLVINGKDEAGVQAWFDTWEGPIGGEVRDARLTVGGDVAFWSGLTRMTGTKTDGTE
FT                   VDLWFRQTLGLVKRDGRWLVVHQHASVPFAMDGSGRALLDLKPESAGPAE"
FT   gene            223415..225772
FT                   /locus_tag="Rleg2_0221"
FT   CDS_pept        223415..225772
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0221"
FT                   /product="methyl-accepting chemotaxis sensory transducer
FT                   with Cache sensor"
FT                   /note="PFAM: histidine kinase HAMP region domain protein;
FT                   Cache domain protein; chemotaxis sensory transducer; KEGG:
FT                   atc:AGR_C_3943 methyl-accepting chemotaxis protein McpU"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53521"
FT                   /db_xref="GOA:B5ZPK4"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR033479"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZPK4"
FT                   /protein_id="ACI53521.1"
FT                   /translation="MLFKSTTSRNLFSVAACGVIAVIVASGAIFYRSYTEIRSGSIEQM
FT                   RQIATSEALKVEKNIGGTVHIVDGLNAVLTTMKEMGDTDRAKADKVLHNMLQANPPVLG
FT                   IWTGWEPNAFDGKDKDYVGKEGHDTTGRYVPYWVRSGGQITHTALTDYTVAGAGDYYQL
FT                   PFTQRKTVIIEPYSYAIDGKDVLMTSVTEPVVIDGKAVGVAGLDLSLQDTAKALSASRP
FT                   MGAGFLGLVTSAGKIVSHPDASLIGKSLSETGAKTADWDHLIANPGLEREVTDEDGNVS
FT                   LAIAIAVKLAEGSNWYAVVSVPKATLFAPLYAVVRDAIVATSLAAVLLGLAGWLIARRF
FT                   VGRISGVIAETAAIAAGKLDVTLKDGEAKDEIGDLSRSLKALLESNRDRARLEAEAEEN
FT                   RALQERERAERARIDQAQEADVKFAVGELALGLAKLAEGDMTSALEHPFAATLDETRIN
FT                   FNESVVKLRSALVSFSQNAEVIQSGTEEIRSAADDLARRTEQQAASVEQTAAALEQITT
FT                   SVKDSTARAEEAGSMVVRTKENAERSGQIVQRAVEAMNDIEQSSKSISNIIGVIDEIAF
FT                   QTNLLALNAGVEAARAGEAGKGFAVVAQEVRELAQRSAGAAKEIKALISASGGQVRHGV
FT                   ALVRETGDALDGIVEEVQQIDRNVHAIVQSAREQSTGLQEINTAVNQMDQATQKNAAMV
FT                   EESNAAAHTLATEVSALSGRLGQFRLDTGTGMTSALSRSNAPRPLAAPKIVSSHATIPV
FT                   PSPARALKKTLAAALGGGSKAAAPADHGWEDF"
FT   sig_peptide     223415..223498
FT                   /locus_tag="Rleg2_0221"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.992) with cleavage site probability 0.768 at
FT                   residue 28"
FT   gene            complement(225833..227026)
FT                   /locus_tag="Rleg2_0222"
FT   CDS_pept        complement(225833..227026)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0222"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   rec:RHECIAT_CH0000637 probable transporter, permease
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53522"
FT                   /db_xref="GOA:B5ZPK5"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZPK5"
FT                   /protein_id="ACI53522.1"
FT                   /translation="MVTAAKSTENAQQPSISFHALTLAAFFGASAAPTPLYRIYQENFS
FT                   LSPVLITVVFAVYAFALLAALLTAGSLSDHLGRKPVIFFALVLEIVAMGLFVVASGPGW
FT                   LIAARIVQGIATGIAGASLGAALVDVDRAKGQIVNSIAPLCGMAVGAVGTSALIQYGPF
FT                   PMHLTYALLLLAFTLLAAAIWLTHETGGTRPGALGSLIPRVAIPAHAKRPLSLVTPINI
FT                   ANWTLAGFYLSLVPSLVASTTGSSAPLTGGAVVTALMASGAITVYLRRVKSASANLGFG
FT                   VSAKTLGILTVVAGVHLANVPLLLIGTVFTGAGFGTNFLGSIGTIMPLAKADERAGLLS
FT                   VFYIQSYLAFSLPAILAGFLAKSAGYALTTDIYATVILLLMGAGLLGLRAGRRKAAA"
FT   sig_peptide     complement(226931..227026)
FT                   /locus_tag="Rleg2_0222"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.753) with cleavage site probability 0.753 at
FT                   residue 32"
FT   gene            227190..227747
FT                   /locus_tag="Rleg2_0223"
FT   CDS_pept        227190..227747
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0223"
FT                   /product="putative transcriptional regulator, TetR family"
FT                   /note="KEGG: ret:RHE_CH00565 probable transcriptional
FT                   regulator protein, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53523"
FT                   /db_xref="GOA:B5ZPK6"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011075"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZPK6"
FT                   /protein_id="ACI53523.1"
FT                   /translation="MAVKENLRPGGRSARVQASVHKAVRDLLAGMNRAEVTIPLIAASA
FT                   GVTPSTIYRRWGDLQELLADVAVERLRPDMQPVDAGSGKADLQAWAEQYAEEMSSGPGR
FT                   EMIRDVLAAQAGANACKCSEYTLQQIVVIAERAKARGELFPDVDRVMDEVVAPIMYRIL
FT                   FGEVPDAARVRDLVSRVMTATD"
FT   gene            complement(227757..231260)
FT                   /locus_tag="Rleg2_0224"
FT   CDS_pept        complement(227757..231260)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0224"
FT                   /product="multi-sensor hybrid histidine kinase"
FT                   /note="PFAM: response regulator receiver; ATP-binding
FT                   region ATPase domain protein; histidine kinase A domain
FT                   protein; PAS fold-4 domain protein; KEGG:
FT                   rec:RHECIAT_CH0000639 probable two-component sensor
FT                   histidine kinase/response regulator hybrid protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53524"
FT                   /db_xref="GOA:B5ZPK7"
FT                   /db_xref="InterPro:IPR001734"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR038377"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZPK7"
FT                   /protein_id="ACI53524.1"
FT                   /translation="MLPGWVIFASAFGYLLLLFAVASYGDHKKRGPGGLEGGWPVVYAL
FT                   SLAIYCTSWTYFGSVGLAAQRGLEFAGIYIGPILVFTLGMPLLRRIIELAKAEKLTSVA
FT                   DFVAARYGKNPTVATIVALISLIGTIPYIALQLKAISSTVSAMVNPSDYGIGSGNLYFL
FT                   DLPLVATLVLACFAIMFGTRHTDATEHQDGLILAVSMESVVKLVAFLTAGICVIWFLFD
FT                   GPTDLWQKTVDNGLVMSALSYHTPISRWMTLILLSAFAIILLPRQFHVTVVENRTPKQL
FT                   KLAGFLFPTYLIAINLFVLPVAIGGLLTFGGAGNADFYMLSLPLAGEMPVVSLITFIGG
FT                   FSAATAMVIVDSVALSIMVSNDIIMPIFLRRKLAGRASQRDNFAKTLLNIRRSAIFAVL
FT                   LFGYAYYRSTDSTAGLASIGLLSFAAIAQIAPALFGGLIWRRANARGAILGLSSGFVIW
FT                   IYLLFLPSLGGPDYSYVASAVLGFIFPGTTLFAAPDADPLVNATVMSLLVNTAFFIVGS
FT                   LTRNARPLERIQAGIFVKRHSRSQFATRGWKTRISVGDLKAAISRYLGEERMQRSLTTY
FT                   EQSSGRKLEDDQPADMALIHFSEQLLGSAIGSSSARLVLSLILQKIEDASSDTAWLLDQ
FT                   ASEALQYNQDMLQTALSQMDQGIAVFDSSNRLTIWNRRFRQLLDLPESAGQVGFPLADI
FT                   VTTLSERGDIAPGDLNQTVRHFLTLDKPFALVLSGGERIIEVRSNAMPDKGIVATFTDI
FT                   TQRVSADQALKQANETLEQRVAERTAELTRVNHELAEARAAADEANIGKTRFFAAAGHD
FT                   ILQPLNAARLYSSALVERMAQSDNSPIVRNIDSALESVETILGAVLDISRLDTGAMRPR
FT                   LAAVALSDLLERIETDFAPIAREKQLKLVVMPTSLRVRSDPNLLRRLVQNLVSNAIKYT
FT                   ITGKVLVGARRRGNQVIIQVIDSGIGIPPSKFRTVFKEFARLDEGAKTASGLGLGLSIV
FT                   DRIARVLNHPVELHSTHGRGTEFRIAMPLDISRPAEAAAAVTPTERPGQPLKGLKILCI
FT                   DNEPKILEGMRLLLSGWGCEVKALDSLADVISGDGRDGPPDLAIADYHLDDGTGIAAIL
FT                   HLRRQFGADIPALLVTADRTPEVRSEAERYGIAVQHKPVRPAALRAYITQVSGLKRAAA
FT                   E"
FT   sig_peptide     complement(231183..231260)
FT                   /locus_tag="Rleg2_0224"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.741) with cleavage site probability 0.544 at
FT                   residue 26"
FT   gene            231481..231918
FT                   /locus_tag="Rleg2_0225"
FT   CDS_pept        231481..231918
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0225"
FT                   /product="large conductance mechanosensitive channel
FT                   protein"
FT                   /note="TIGRFAM: large conductance mechanosensitive channel
FT                   protein; PFAM: large-conductance mechanosensitive channel;
FT                   KEGG: rec:RHECIAT_CH0000640 large-conductance
FT                   mechanosensitive channel transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53525"
FT                   /db_xref="GOA:B5ZPK8"
FT                   /db_xref="InterPro:IPR001185"
FT                   /db_xref="InterPro:IPR019823"
FT                   /db_xref="InterPro:IPR036019"
FT                   /db_xref="InterPro:IPR037673"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5ZPK8"
FT                   /protein_id="ACI53525.1"
FT                   /translation="MLNEFKAFIARGNVMDLAVGVIIGGAFGGIVKSLVDDLIMPIVGA
FT                   IFGGFDFSNYFLPLSSAVNAPTLAAARAQGAVFAYGSFLTVLINFLILAWIIFLMVKGV
FT                   NYLRLQVERQEKAAPEELPPPPADVQLLTEIRDLLATRPTA"
FT   gene            232195..233361
FT                   /locus_tag="Rleg2_0226"
FT   CDS_pept        232195..233361
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0226"
FT                   /product="aminotransferase class I and II"
FT                   /note="PFAM: aminotransferase class I and II; KEGG:
FT                   ret:RHE_CH00568 aspartate aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53526"
FT                   /db_xref="GOA:B5ZPK9"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZPK9"
FT                   /protein_id="ACI53526.1"
FT                   /translation="MSIVKSLSPRAMAAPESGIVEVVNYARGREGLLPLWVGEGDLPTP
FT                   DFISRAAMDALASGETFYTWQRGIPELRQALSDYYSRHFGIRLPVEHFYVTGSGMQAIQ
FT                   IAVQTLTSPDDELVYLTPAWPNIAAALEIAGARSVGVELQFEGGKWAVDLDRVEAAITP
FT                   KTRGIFINTPSNPTGWTATKKDLADILALARRHDLWIMADEIYALYYFAGGRAPSFLDV
FT                   MEPADKIIFVNSFSKNWSMTGWRVGWIVAPPEMGQVLENLIQYSTSGVAQFMQKGAVAA
FT                   LDQGDDFVAANIAKAARSRDILCDALVATNRVETLKPDGALYAFLKIDGVTDSRSAAID
FT                   IVDKTGVGLAPGTAFGAGGELFLRACFLRDPDQVAVAAERLCDYILRR"
FT   gene            233555..234589
FT                   /locus_tag="Rleg2_0227"
FT   CDS_pept        233555..234589
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0227"
FT                   /product="UDP-glucose 4-epimerase"
FT                   /note="TIGRFAM: UDP-glucose 4-epimerase; PFAM:
FT                   NAD-dependent epimerase/dehydratase; short-chain
FT                   dehydrogenase/reductase SDR; 3-beta hydroxysteroid
FT                   dehydrogenase/isomerase; polysaccharide biosynthesis
FT                   protein CapD; dTDP-4-dehydrorhamnose reductase; Male
FT                   sterility domain; KEGG: rec:RHECIAT_CH0000642 UDP-glucose
FT                   4-epimerase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53527"
FT                   /db_xref="GOA:B5ZPL0"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR005886"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZPL0"
FT                   /protein_id="ACI53527.1"
FT                   /translation="MAVLVTGGAGYIGSHMVWALLDAGEDVVVLDRLSTGFRWAVAPAA
FT                   RFYLGDVADPDVLKKIFIENDIEAIIHFAGSAVVPVSVADPLSYYDNNSGKTRALLSAS
FT                   VEAGIRNFVFSSTAAVYGQQKTDLPVKETASLNPENPYGQSKLMTEFMLRDAASAYDFN
FT                   YVALRYFNVAGADPDHRAGQSTSGATHLIKVACEAALGRRDSVSVYGIDYPTHDGTGVR
FT                   DYIHVTDLVDAHLKALQHLRRGKGSLVANCGYGSGYSVLDVLNMVTRLHGHSFKIHMAP
FT                   RRAGDSASVVADASLARQVLDWKPRHDSLETIVQSSLDWELFLSNRNVDDLHSIHRALA
FT                   AASF"
FT   gene            234691..236652
FT                   /locus_tag="Rleg2_0228"
FT   CDS_pept        234691..236652
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0228"
FT                   /product="diguanylate cyclase/phosphodiesterase"
FT                   /note="TIGRFAM: diguanylate cyclase; PFAM: GGDEF domain
FT                   containing protein; EAL domain protein; KEGG:
FT                   rec:RHECIAT_CH0000643 putative sensory box/GGDEF family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53528"
FT                   /db_xref="GOA:B5ZPL1"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZPL1"
FT                   /protein_id="ACI53528.1"
FT                   /translation="MKKFLASLQLQKDNPTLLTAQFRALSSQIPILYVLLVINALAVAI
FT                   THLESAPLWLSLYIPVALSIVCVFRLCWWEIRGKENVTAERAYRLMKITISGAAILTIA
FT                   FGGWAIALYQYGDASQQGQIAYFLVVTGISCIFCLMHLPMAAALTTVITFSAMIATFMF
FT                   SGNPVFVATAVSGLFLIVPFLRVIDSYFQNFVGLVQLTEELKQKRAEAEELNLVNSRNA
FT                   LQDQLTGLANRRSFFLSLEKRLQKDPSAPPVLGILDLDGFKPVNDVFGHAAGDLVLKET
FT                   ARRFAALVGEAGIVSRLGGDEFGIIFPCSMTRQAIADLGQALCAAVRDPYEIPDGSVRV
FT                   FGSCGIVYPEIGRYTAEDLYEKADFALYQVKSKRSSGVEFFSAEHEKILTQRHLIELEL
FT                   QANDFASELKLEYQPIVELKSGRVVGYEALARWDSARFGRISPEAFIPAAERTAVIGRM
FT                   TRILFAKALEALAIIPRHLKLSFNLSARDICDHETSMALLGMITRSGIDPRRIEFEITE
FT                   TALLSDFDTADKVIAMLRAAGISIALDDFGTGYSSLSHIHRLGFDKLKIDKAFVMNFDR
FT                   DARCMNITRSVANLCQNLGIASVAEGVESEGIAEGLKAMGVRLAQGYHFSRPLPLELAI
FT                   DYAARCEAEAIARNSLSA"
FT   gene            236780..237832
FT                   /locus_tag="Rleg2_0229"
FT   CDS_pept        236780..237832
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0229"
FT                   /product="Enoyl-CoA hydratase/isomerase"
FT                   /note="PFAM: Enoyl-CoA hydratase/isomerase; KEGG:
FT                   ret:RHE_CH00571 enoyl-CoA hydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53529"
FT                   /db_xref="GOA:B5ZPL2"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR032259"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZPL2"
FT                   /protein_id="ACI53529.1"
FT                   /translation="MQDGEVIIEQRGTAGIIRLNRPRALNSLTLPMIRAITEALDGFAA
FT                   DAAVASVVVAGEGERGFCAGGDIRALHESAHAGDGLASAFWREEFRLNHQIAVYPKPYV
FT                   ALMDGITMGGGVGLSSHGRHRIVTERTRLAMPETGIGYVPDVGATWLLPKAPGEAGTWL
FT                   GLTGLDIGAADAIHAGLADRQIAAARLGSVIEALSALPRGSASSDVDALLQGLAEPAGE
FT                   SRLKQNAAMIDRAFRFDSVEEILAALAGEEGDFAAETRRVLSTRSPTSLKLALALLRAG
FT                   RRSASLAECLGRELGACLQMLDNPDFFEGIRAAVIDKDRNPKWSPASVEAVEPAMVERF
FT                   LKPAEPPLSL"
FT   gene            complement(237843..239903)
FT                   /locus_tag="Rleg2_0230"
FT   CDS_pept        complement(237843..239903)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0230"
FT                   /product="UvrD/REP helicase"
FT                   /note="PFAM: UvrD/REP helicase; KEGG: ret:RHE_CH00573
FT                   ATP-dependent DNA helicase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53530"
FT                   /db_xref="GOA:B5ZPL3"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR013986"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZPL3"
FT                   /protein_id="ACI53530.1"
FT                   /translation="MYLEKLNPQQRMAVEHGTLTDGSHIAGPLLVIAGAGSGKTNTLAH
FT                   RVAHLIVKGADPRRILLMTFSRRAAAEMARRVERICRDVLGANAGVMADALNWSGTFHG
FT                   IGARLLRDYAQQIGLDADFTIHDREDSADLINLIRHDLGFSKTESRFPAKGTCLAIYSR
FT                   AVNSETALDQVLRDAFPWCAAWEKQLRELFACYVEAKQSQNVLDYDDLLLYWAQMVGES
FT                   VIAEDIGSRFDHVLVDEYQDTNRLQASILMALKPQGQGLTVVGDDAQSIYSFRAATVRN
FT                   ILDFPAAFSPAANIVTLDRNYRSTQPILAAANAVIDLASERFTKNLWTERQSAERPRLV
FT                   TVRDEADQARYVADMVLDNREEGLTLKQQAVLFRASHHSGPLEVELTRRNIPFVKFGGL
FT                   KFLDSAHVKDMLAALRFAQNPRDRVAGFRLMQILPGVGPSTAQKALDLMAEDASPITAL
FT                   AAMPAPPRSGEDWTDFVSMLQEMKSGKAGWPAEIELARQWYAPHLERLHEDAATRQADL
FT                   LQLEQIAGGYASRERFLTELTLDPPDATSDQAGVPLLDEDYLILSTIHSAKGQEWTRVF
FT                   MLNVVDGCIPSDLAVGASAEIEEERRLLYVAMTRARDGLDLVVPQRFFTYGQNAQGDRH
FT                   VYASRSRFIPATLLQFFEACSWPQVKSEAAAQAQARQVRIDVGARMRGMWR"
FT   gene            complement(240009..240290)
FT                   /locus_tag="Rleg2_0231"
FT   CDS_pept        complement(240009..240290)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0231"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rec:RHECIAT_CH0000647 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53531"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZPL4"
FT                   /protein_id="ACI53531.1"
FT                   /translation="MKVLLPALFPGALFAVALLAGCSSADSPALDPIPGSITYGGQPRT
FT                   KLTKSPVGSAVHHQFYDGTGQRVEETYILQPDRSLKLVRRVVGPDFPD"
FT   sig_peptide     complement(240213..240290)
FT                   /locus_tag="Rleg2_0231"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.988 at
FT                   residue 26"
FT   gene            240465..240725
FT                   /locus_tag="Rleg2_0232"
FT   CDS_pept        240465..240725
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0232"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rec:RHECIAT_CH0000648 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53532"
FT                   /db_xref="InterPro:IPR007055"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZPL5"
FT                   /protein_id="ACI53532.1"
FT                   /translation="MIGFPGFTDHDESGRQGHGEAATRASVESALHAAADLDAEEITVD
FT                   MLGSYVILDGFVRRRGDVERAIAIAESIVGQGYVHCRLLRR"
FT   gene            240784..241044
FT                   /locus_tag="Rleg2_0233"
FT   CDS_pept        240784..241044
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0233"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rec:RHECIAT_CH0000649 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53533"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZPL6"
FT                   /protein_id="ACI53533.1"
FT                   /translation="MQSLPRLWALTMISAGVFAGSAYASLETGTNYSALPKDQVALNEY
FT                   TGAVACTPAEPQYLPSFIRAGDGTIIGVGYIEVESEGGADC"
FT   sig_peptide     240784..240858
FT                   /locus_tag="Rleg2_0233"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.994 at
FT                   residue 25"
FT   gene            complement(241314..241556)
FT                   /locus_tag="Rleg2_0234"
FT   CDS_pept        complement(241314..241556)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0234"
FT                   /product="protein of unknown function DUF982"
FT                   /note="PFAM: protein of unknown function DUF982; KEGG:
FT                   ret:RHE_CH00575 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53534"
FT                   /db_xref="InterPro:IPR010385"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZPL7"
FT                   /protein_id="ACI53534.1"
FT                   /translation="MATEKWDSPVKVGFEDADARTVSGPFDALKCLADFWPNSRGLRYI
FT                   KARSTCRAALDGRKSVEEARAEFLAAAEEAKLKLH"
FT   gene            241815..242207
FT                   /locus_tag="Rleg2_0235"
FT   CDS_pept        241815..242207
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0235"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rec:RHECIAT_CH0000651 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53535"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZPL8"
FT                   /protein_id="ACI53535.1"
FT                   /translation="MGLDRKLIQAAFLSGGLAMPAFAGGAEISDEDALLARISTEIIPR
FT                   IQLEYVQTAIGQFTAAMDIAAFRARLILDEALQQWYVEGIYDGVPTRVTADLLERWALS
FT                   PSMPYYLEAIDIPDCAHGSVLLPNCR"
FT   sig_peptide     241815..241886
FT                   /locus_tag="Rleg2_0235"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.792 at
FT                   residue 24"
FT   gene            complement(242257..242331)
FT                   /locus_tag="Rleg2_R0004"
FT                   /note="tRNA-Thr2"
FT   tRNA            complement(242257..242331)
FT                   /locus_tag="Rleg2_R0004"
FT                   /product="tRNA-Thr"
FT   gene            242488..242682
FT                   /locus_tag="Rleg2_0236"
FT   CDS_pept        242488..242682
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0236"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rec:RHECIAT_CH0000653 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53536"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZPL9"
FT                   /protein_id="ACI53536.1"
FT                   /translation="MNDKSETGQQSRKQAIEAQAKLRRERAAEKLRENLSKRKQQVRAR
FT                   RSGQADETNGLPAAKMDES"
FT   gene            242789..244081
FT                   /locus_tag="Rleg2_0237"
FT   CDS_pept        242789..244081
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0237"
FT                   /product="UDP-N-acetylglucosamine
FT                   1-carboxyvinyltransferase"
FT                   /note="TIGRFAM: UDP-N-acetylglucosamine
FT                   1-carboxyvinyltransferase; PFAM: EPSP synthase
FT                   (3-phosphoshikimate 1-carboxyvinyltransferase); KEGG:
FT                   rec:RHECIAT_CH0000654 UDP-N-acetylglucosamine
FT                   1-carboxyvinyltransferase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53537"
FT                   /db_xref="GOA:B5ZPM0"
FT                   /db_xref="InterPro:IPR001986"
FT                   /db_xref="InterPro:IPR005750"
FT                   /db_xref="InterPro:IPR013792"
FT                   /db_xref="InterPro:IPR036968"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5ZPM0"
FT                   /protein_id="ACI53537.1"
FT                   /translation="MDRIRIVGGNELNGIIPISGAKNAALPLMIASLLTSDTLTLENVP
FT                   HLADVELLMRILGNHGVDVAVNGRRERQEDSYSRTIHFTCRTIVDTTASYELVSKMRAS
FT                   FWVIGPLLAREGHCRVSLPGGCAIGTRPVDLFIEGLTALGATMEIDAGYINAKAPNGGL
FT                   IGARYTFPKVSVGATHVVMMAATLARGTTVIGNAAREPEVVDLANCLNAMGAKISGAGT
FT                   ATITIEGVTSLSGARHRVLPDRIETGTYAMAVAMAGGDVVLENTDVALLDTALETLRRA
FT                   GADISATNNGMRVKRNGAGIKPVDIVTDPFPGFPTDLQAQFMALMTRSSGISHVTETIF
FT                   ENRFMHVQELARLGARITLSGQTAKIEGVQRLRGAPVMATDLRASVSLVIAGLAAEGET
FT                   TVSRVYHLDRGFERLEEKLTRCGAVVERISE"
FT   gene            244175..244606
FT                   /locus_tag="Rleg2_0238"
FT   CDS_pept        244175..244606
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0238"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rec:RHECIAT_CH0000655 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53538"
FT                   /db_xref="InterPro:IPR021335"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZPM1"
FT                   /protein_id="ACI53538.1"
FT                   /translation="MTELKLVALDDEDLAIISAHMQDSVFKVGDIDWSPRDAQFALAVN
FT                   RFVWEGAERKRKGFERRRAALVFKRVLAVRSLGIDRGKRDEVLSLLALRFEQKGEGPEG
FT                   TIELSLSGTASIALDVECIEVQLADIGGAWEASSKPRHL"
FT   gene            244671..245969
FT                   /locus_tag="Rleg2_0239"
FT   CDS_pept        244671..245969
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0239"
FT                   /product="Histidinol dehydrogenase"
FT                   /EC_number="1.1.1.23"
FT                   /note="PFAM: histidinol dehydrogenase; KEGG:
FT                   rec:RHECIAT_CH0000656 histidinol dehydrogenase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53539"
FT                   /db_xref="GOA:B5ZPM2"
FT                   /db_xref="InterPro:IPR001692"
FT                   /db_xref="InterPro:IPR012131"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR022695"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZPM2"
FT                   /protein_id="ACI53539.1"
FT                   /translation="MAIWLDQASEGFEQRFATFLTTKREVSEDVNTVVRAIIDDVRARG
FT                   DVALAEYSLKFDGIDFATVPMRVTPEEFDAAIEAVPPEVLGALKLAALRIESHHRRQLP
FT                   KDDIYEDDMGVGLGSRWTAIEAVGLYVPGGTASYPSSVLMNAVPAKVAGVDRIVIAVPA
FT                   TGGAVNPAVLAAARLVGVTEVYRVGGAQAIAALAYGTETIAPVAKITGPGNAYVAAAKR
FT                   HVFGTVGIDMIAGPSEVLVIADKDNNPDWIAADLLAQAEHDASAQAILITDDAEFGKAV
FT                   EQAVERQLKTLNRAETAAASWRDFGAVILVADLKQAIPLANRIAAEHLELAVADPDRLL
FT                   DGIRNAGAIFIGAHTPEVIGDYVGGSNHVLPTARSARFSSGLSVLDFVKRTSILRLGPQ
FT                   QLRTLGPAAIALAVSEGLDAHARSVAIRLNLER"
FT   gene            245974..246447
FT                   /locus_tag="Rleg2_0240"
FT   CDS_pept        245974..246447
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0240"
FT                   /product="conserved hypothetical protein"
FT                   /note="PFAM: conserved hypothetical protein; KEGG:
FT                   rec:RHECIAT_CH0000657 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53540"
FT                   /db_xref="InterPro:IPR008321"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5ZPM3"
FT                   /protein_id="ACI53540.1"
FT                   /translation="MAAGDFRLCDVVLDDTIGRSTPDVEHERAVAIFDLIEENSFAPIG
FT                   HAGGPYRLNISLVDSKLVFAIRTEEGIDVATHILSLTPFRRIVKDYFMICESYYEAIRS
FT                   ATPSRIEAIDMGRRGIHNEGSQTLKDRLTGKIEVDFDTARRLFTLVCVLYWRG"
FT   gene            246453..246929
FT                   /locus_tag="Rleg2_0241"
FT   CDS_pept        246453..246929
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0241"
FT                   /product="protein tyrosine phosphatase"
FT                   /note="SMART: low molecular weight phosphotyrosine protein
FT                   phosphatase; KEGG: rec:RHECIAT_CH0000658 putative arsenate
FT                   reductase (phosphatase) protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53541"
FT                   /db_xref="InterPro:IPR023485"
FT                   /db_xref="InterPro:IPR036196"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZPM4"
FT                   /protein_id="ACI53541.1"
FT                   /translation="MDRAADVEEGKRPGAILFMCGMNAIRSPMAEAIARSILPSNTYIR
FT                   SAGVRAGERDPFVDVVLDEIGLSLGRRLPQTLEELEDDYFDLIITLSPQAHHAALELTR
FT                   SNAIDVVYWPTMDPTVVSGTREQILESYREVRDYLTGLIESRLLKRNGIAAQSA"
FT   gene            247053..247271
FT                   /locus_tag="Rleg2_0242"
FT   CDS_pept        247053..247271
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0242"
FT                   /product="translation initiation factor IF-1"
FT                   /note="TIGRFAM: translation initiation factor IF-1; PFAM:
FT                   RNA binding S1 domain protein; S1 IF1 family protein; KEGG:
FT                   rec:RHECIAT_CH0000659 translation initiation factor IF-1
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53542"
FT                   /db_xref="GOA:B5ZPM5"
FT                   /db_xref="InterPro:IPR004368"
FT                   /db_xref="InterPro:IPR006196"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZPM5"
FT                   /protein_id="ACI53542.1"
FT                   /translation="MPKEEVLEFPGIVTELLPNATFRVKLENEHEIIAHTAGRMRKNRI
FT                   RVLAGDKVLVEMTPYDLTKGRITYRFK"
FT   gene            247327..247947
FT                   /locus_tag="Rleg2_0243"
FT   CDS_pept        247327..247947
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0243"
FT                   /product="maf protein"
FT                   /note="TIGRFAM: maf protein; PFAM: Maf family protein;
FT                   KEGG: ret:RHE_CH00585 Maf-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53543"
FT                   /db_xref="GOA:B5ZPM6"
FT                   /db_xref="InterPro:IPR003697"
FT                   /db_xref="InterPro:IPR029001"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZPM6"
FT                   /protein_id="ACI53543.1"
FT                   /translation="MALKYKLILASGSPRRVDLLNQAGIEPSRLMPMDIDETPKKSEHP
FT                   RSLARRLSAEKAEAALAAIKSDITWKGSYILSADTVVAVGRRILGKAEFADEALSSLHL
FT                   LSGRNHLVYTGVCLVTPDRKIRQKIVETKVRFKRLSGFEIENYLASGQWRGKAGAYGIQ
FT                   GLAGTFVQKMVGSYTNVVGLPLYETIVLLTGEGFDVHSRWPEG"
FT   gene            247986..248198
FT                   /locus_tag="Rleg2_0244"
FT   CDS_pept        247986..248198
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0244"
FT                   /product="protein of unknown function DUF329"
FT                   /note="PFAM: protein of unknown function DUF329; KEGG:
FT                   rec:RHECIAT_CH0000661 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53544"
FT                   /db_xref="GOA:B5ZPM7"
FT                   /db_xref="InterPro:IPR005584"
FT                   /db_xref="InterPro:IPR013088"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5ZPM7"
FT                   /protein_id="ACI53544.1"
FT                   /translation="MPEDNKAAAKVEPLRKARPCPECGKPSHREHYPFCSNRCREVDLS
FT                   RWLTGAYAIPVADDETKAEYPDEEN"
FT   gene            248378..248453
FT                   /locus_tag="Rleg2_R0005"
FT                   /note="tRNA-Phe1"
FT   tRNA            248378..248453
FT                   /locus_tag="Rleg2_R0005"
FT                   /product="tRNA-Phe"
FT   gene            complement(248535..248813)
FT                   /locus_tag="Rleg2_0245"
FT   CDS_pept        complement(248535..248813)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0245"
FT                   /product="transposase IS3 family protein"
FT                   /note="PFAM: transposase IS3/IS911 family protein; KEGG:
FT                   gdi:GDI1077 putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53545"
FT                   /db_xref="GOA:B5ZPM8"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZPM8"
FT                   /protein_id="ACI53545.1"
FT                   /translation="MGKRKFDDDQITGILKEHQAGVTVADVCHRYGISEPTFYRWQSLQ
FT                   SGNVGLHARRLRALEEENQKLKKLLAECMLSAATLSEMLAKTTKGRH"
FT   gene            complement(248821..250263)
FT                   /locus_tag="Rleg2_0246"
FT   CDS_pept        complement(248821..250263)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0246"
FT                   /product="type I secretion membrane fusion protein, HlyD
FT                   family"
FT                   /note="TIGRFAM: type I secretion membrane fusion protein,
FT                   HlyD family; PFAM: secretion protein HlyD family protein;
FT                   KEGG: rec:RHECIAT_CH0000667 putative protein secretion
FT                   protein, HlyD family"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53546"
FT                   /db_xref="GOA:B5ZPM9"
FT                   /db_xref="InterPro:IPR010129"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZPM9"
FT                   /protein_id="ACI53546.1"
FT                   /translation="MTLVPLDAPPAKFSNSSRMGQRFAHRWTATARQTAYPPVIEQKQR
FT                   GPAAPSPMPVLRGVVWTGNLLILVFVVGLGIWSALAPLHSAAVASGVIEPETSRKTIQH
FT                   LEGGIVRRILVRNGDTVMAGQIVIELDDTKSRSERDSIQGQLWDAEGSRARLLAEQTGG
FT                   DHVAYPDDLRAAMDKYPSVSAILTGQQKIFEARRRVMQAEIQIGNEKIAQVRQEIVGLG
FT                   AQKAALADRAAISQEELEQVTILTAKGLERRSRLLNLEREKADLDGQQGQVGAQIARAY
FT                   QVISESQVDLAKLESDRLSEVAQGMRDTESRIMQLRERLRAIDDQLSRTDIRAPEDGTI
FT                   MNLRIHTSGGVIGAGEPLVDLLPRSDRLIVSAHVRPEDINLVHAGLEAQVHLLPYNQRR
FT                   VPLLKGRVEYVSADRLTDTQSGQPYYAATIRVTDERLAKMRDVELVAGMPAQTLIETGK
FT                   SSVALYAVRPLLDSFNRAFRED"
FT   gene            complement(250278..251993)
FT                   /locus_tag="Rleg2_0247"
FT   CDS_pept        complement(250278..251993)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0247"
FT                   /product="type I secretion system ATPase"
FT                   /note="KEGG: rec:RHECIAT_CH0000668 putative protein ABC
FT                   transporter protein; TIGRFAM: type I secretion system
FT                   ATPase; PFAM: ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53547"
FT                   /db_xref="GOA:B5ZPN0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010128"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZPN0"
FT                   /protein_id="ACI53547.1"
FT                   /translation="MTTISIKPPRPPTQLVVALRACAGAFGLVFLYSCGYNLFLLTPSI
FT                   YLLQIYDRVLSSRSVDTLLMLTMIIAIAVLVGSTLDIVRRAALSRIGSWLDHRLRPMVL
FT                   TASFEYAARADTGAASECYRDLAALRQFLDSPASSLLFDVPWAPVFLLLLFLVHPLLGT
FT                   IGLLCAVALLLFALATELATRAPLAHANLALSRSYLRFASALKNIEVIRAMGMQDGAAL
FT                   IVYRDAEMARRAQDIAMHRTEIILGFSKSIRTLAQILMMGSATWLVLVNSGSPGIIFVA
FT                   SLLLGRGLAPIEGAIGAWRSFMFARNAFNRLNRMLITIASECDARMVPLPEPNGLVLDN
FT                   VSYFKPFADRPILTDITLRLAPGDCIALIGPSGSGKSTLGRIMAGVVPATSGYALLGGV
FT                   DISALRLCGGTCHVGYLPQDIELFGGAIKDVIGRLDGGDPGKAIDAAKLVGLHDAIMRL
FT                   PQGYETDIGEGGNLLLRAQRQQLGLARAAYGNPSLIVLDDPNSSLDYDGERMLFTAIER
FT                   MRSRGMTVVIITHRMGILPVTNKIAIMRNGTVAAFGDSERIYETYLQPPARTGS"
FT   gene            complement(252087..252662)
FT                   /locus_tag="Rleg2_0248"
FT   CDS_pept        complement(252087..252662)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0248"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rec:RHECIAT_CH0000669 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53548"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZPN1"
FT                   /protein_id="ACI53548.1"
FT                   /translation="MPIPQISDTIHLSHPDAGDANAGNGGDGHNDGNINYNPVAYVDPV
FT                   QKVYGATTDVHNGDHVWQTADWDAGHGGSGGFTEAQNGFLAKISNHGDGGAGGDSNSNG
FT                   SQGNSSGGDTAAVAAATTATQYTQLMADQHATILAGVGGNGGNGNMAHGGDISSALVHT
FT                   DPETTTVTNSLDHFINAFGHIDVDHLGS"
FT   gene            253137..254225
FT                   /locus_tag="Rleg2_0249"
FT   CDS_pept        253137..254225
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0249"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rec:RHECIAT_CH0000670 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53549"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZPN2"
FT                   /protein_id="ACI53549.1"
FT                   /translation="MAEPRPLLEDLPKAGTDQHLAANVAAGHLALVPTWLPLDVASAPS
FT                   HTSAGSGGDGISEGVISSNALAVFMPSNAAIAGPHSSADAFQGNDALINQHPTEMAGIG
FT                   GNGGSGNVAIGSGDGATHAGSGGNGLFYGGLVSTEVAVFAPVNTAVAAGPGAEAHAEQS
FT                   NNAMFLQGATQMGGIGGSGGDHNVATHGSSMSPGTALTLTGDYYAGHGGDGYFVGSMVD
FT                   VSIAIFSPINIAIGAAGGSAEAHQTNNVIFDQGTVQIAGMGGNGGGFNLSSDTIFTGNH
FT                   AGGGGGDGSSTGAMVDVNFGYFHPINIAVPAGGTADAQQIDHVLYDQHALQLAGIAGHG
FT                   GEGNLTDAHSALVDDILTFMHS"
FT   gene            254938..255720
FT                   /locus_tag="Rleg2_0250"
FT   CDS_pept        254938..255720
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0250"
FT                   /product="two component transcriptional regulator, LuxR
FT                   family"
FT                   /note="PFAM: regulatory protein LuxR; KEGG:
FT                   rec:RHECIAT_CH0000671 putative transcriptional regulator
FT                   protein, LuxR family"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53550"
FT                   /db_xref="GOA:B5ZPN3"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZPN3"
FT                   /protein_id="ACI53550.1"
FT                   /translation="MNDCWVAHNLGSTQVSDSAGTKRRRNAPTVIIIEHSTLARTTVVK
FT                   LLERELAGWNLIDLSSTESLDRALGAEVRLIALDLAGRGVESASLRDDLAAITARFPEV
FT                   PITLLSSTDDAIIARQALKIGIRGFFSTSLPIDIALAGLRLVLAGGTFFPQLLGAATNG
FT                   SNGSNEHSPARNEAEKSLDERTQYLALAEFTPREADVLAELQSGCSNKVIAGKLNLSGH
FT                   TVKMHLQHIMRKLQAQNRTEVVARLIQRAASGPDASPS"
FT   gene            complement(255890..257872)
FT                   /locus_tag="Rleg2_0251"
FT   CDS_pept        complement(255890..257872)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0251"
FT                   /product="diguanylate cyclase"
FT                   /note="TIGRFAM: diguanylate cyclase; PFAM: GGDEF domain
FT                   containing protein; histidine kinase HAMP region domain
FT                   protein; KEGG: rru:Rru_A2661 putative diguanylate cyclase
FT                   (GGDEF domain)"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53551"
FT                   /db_xref="GOA:B5ZPN4"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZPN4"
FT                   /protein_id="ACI53551.1"
FT                   /translation="MSGTGMSALLRIAFRPTVKRKTRHTLAARALRLAALRIALVCACA
FT                   GGVSYFINHSALEQSVRSQLSLSTEQALQRESLPFREVKDLEKNFLAEFDRIYAIPEAR
FT                   QSLARNFDDIFYRHEDGSYTQRPGLFEGEPLPDGRRFPGMSATYAPDVTPDADVKTRFA
FT                   LSYLLSYQFGSAAKGRLFNFYGVVPEKGFPIYQAADIAKVFKYEGPDALKLETFEFFSR
FT                   GFGGPQNETFFTRIYWDPSNNAWMTTIATADAPDASGKHRIMACVDVLLDDLMKRTANP
FT                   TLPGARATIFAADNQGTLIFDGKYTDAITASAGEASISSLEIADYQPLLKASQAIGAGS
FT                   VSLIESTSEITAVGRIPDTPWVLAVHYPKSLMRPAILTNLGIVVAVGLLTLFVELFILR
FT                   SILQKQVAEPLVRLIHATQLVGRSGVTVANDALPTHSDDEIGELARDFASMAARVHTAH
FT                   EALEGKIRDRTSELERLNQKLLTISQTDEMTGVANRRRFDEVLASELAGLGQGQDLLML
FT                   AMVDADWFKGYNDRYGHPAGDACLKEIARVLERNTRSKQDVVARYGGEEFAIIARIASA
FT                   SNAPVIGQALCSAMATVKLAHEGSPFGHVTLSVGIALAAPDQNISPEALLLEADRALYR
FT                   AKQAGRNQAVVAEPSADMQIQQIGA"
FT   gene            258350..258544
FT                   /locus_tag="Rleg2_0252"
FT   CDS_pept        258350..258544
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0252"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: smd:Smed_1691 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53552"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZPN5"
FT                   /protein_id="ACI53552.1"
FT                   /translation="MRKKKAIVEAALESEYERQPLGIMNTEQALELEDAEGLVFSHPDK
FT                   EAGVTDHFVDQEQLRRLVQ"
FT   gene            complement(258566..259291)
FT                   /locus_tag="Rleg2_0253"
FT   CDS_pept        complement(258566..259291)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0253"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR
FT                   domain protein; KEGG: acr:Acry_1654 short-chain
FT                   dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53553"
FT                   /db_xref="GOA:B5ZPN6"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZPN6"
FT                   /protein_id="ACI53553.1"
FT                   /translation="MDFNGKTVIVTGAGKGIGREIARMLVERGADVVALTRSAADVDAL
FT                   REEAGCRAIQVDLADVDATRKAAIAALPADFLINCAGTTELQPFLETTVEAFDRLVAVN
FT                   TRAPMIVAQEYARFLIKEGRKGAIVNVSSVASFVGIPDHAAYCASKGGLDGLTRVMAKE
FT                   LAPHGIRANGVHPTVTLTPMAVKAWSDPEKAAGMMQRIPVGRFAEPSDVAEVVLFLLSD
FT                   EAAMVNGISMPVDGGYMIA"
FT   gene            complement(259302..260363)
FT                   /locus_tag="Rleg2_0254"
FT   CDS_pept        complement(259302..260363)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0254"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; TOBE domain protein;
FT                   Transport-associated OB domain protein; SMART: AAA ATPase;
FT                   KEGG: rsq:Rsph17025_3579 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53554"
FT                   /db_xref="GOA:B5ZPN7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005116"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040582"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZPN7"
FT                   /protein_id="ACI53554.1"
FT                   /translation="MANVQVSDVTKRYGALQVMHGVSVDIEDGEFVVLVGPSGCGKSTL
FT                   LRMIAGLETVSGGDIRIGGRVVTNAPPKERDIAMVFQSYALYPHKTVAENMGFPLKMAK
FT                   RPKAEIDEKVGRAAEILDLTRYLDRYPKQLSGGQRQRVAMGRAIVRDPQVFLFDEPLSN
FT                   LDAKLRVTMRVEIKELHQRLKTTTVYVTHDQIEAMTMANKIVVMRDGRVEQIGKPLDLY
FT                   DFPVNLFVAGFIGSPSMNFLQGRVATRDGRKVVVTDQGVALPLDNTNADDGRTVTYGIR
FT                   PEHITIGDDGVPVEVSVFEPTGSETLIFGRTQGVPIDALIRERIEVDPGRTVYFHIDPR
FT                   RAHIFDRETGQRL"
FT   gene            complement(260416..260622)
FT                   /locus_tag="Rleg2_0255"
FT   CDS_pept        complement(260416..260622)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0255"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rsq:Rsph17025_3581 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53555"
FT                   /db_xref="GOA:B5ZPN8"
FT                   /db_xref="InterPro:IPR018678"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZPN8"
FT                   /protein_id="ACI53555.1"
FT                   /translation="MSSQSENNQRKPGFLPIETNWFDRLFISVVIWVALSLFWMRFIEP
FT                   FGPSVWVAAAISAVLGAYIVWKG"
FT   gene            complement(260627..261463)
FT                   /locus_tag="Rleg2_0256"
FT   CDS_pept        complement(260627..261463)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0256"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: rsq:Rsph17025_3582
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53556"
FT                   /db_xref="GOA:B5ZPN9"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZPN9"
FT                   /protein_id="ACI53556.1"
FT                   /translation="MKTQTPWLPVVLWILISLATLFPIYWLFVISVKQPFDLFSTPDVV
FT                   LRSFFWKNYQDVLTNPTLRGYMLNSMIISSGNALLVTTLGFFACYALTRFDLAGKESIF
FT                   FWTITNRMAPPAVFLLPLFLLLTQVYKIGDFSLADSRLGMILVYCSFNLPFAIWTLRPT
FT                   VEGIPKELDEAAYMDGASPWTVLYDIVFPLARPGLAVTLILTWVFAWNEYLLAATLTNF
FT                   NARTLTTGLSEYVTTTGTAWGIMAAISMLTLVPALIVFSVVQRHIVAGLTFGAVKG"
FT   gene            complement(261468..262343)
FT                   /locus_tag="Rleg2_0257"
FT   CDS_pept        complement(261468..262343)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0257"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: rec:RHECIAT_PA0000142
FT                   putative sugar ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53557"
FT                   /db_xref="GOA:B5ZPP0"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZPP0"
FT                   /protein_id="ACI53557.1"
FT                   /translation="MHSQKLGWLLLSPTIVILGLFGIFPFIYVLWVSFHAWNPFAANPG
FT                   MVFNWADNYRRLVFDAQFLASLGITLTFVFFAVVSELVLGYVLAQALLKDFPGKAVFRT
FT                   IHTLPLIMAPIIVGSVWKLMTTPSIGIIPYLLRSWFGYDLNIGQSAVAAFTVTVIMDIW
FT                   HWTPLVTLSLIAALVSLPPDPFEQAQIDGAGKSQIFWHITLPLIRPALLATVFIRLMDA
FT                   LRTVDEVLMLTGGGPGSSTRYIGVHIFKEVFPKTNYGYGSAISVIVLYLTIVVCWLLYV
FT                   GLIAPRVKRG"
FT   gene            complement(262438..263871)
FT                   /locus_tag="Rleg2_0258"
FT   CDS_pept        complement(262438..263871)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0258"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   KEGG: rsq:Rsph17025_3584 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53558"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZPP1"
FT                   /protein_id="ACI53558.1"
FT                   /translation="MHYALKASALALTLGLATTASPAWADFWSDAGAKYKGVTLHGVTE
FT                   STPPSNYIKNVLAPEFEKKTGIKVEIETTSWDQMYDKAIKDMEAKTGIYDMVYIEQDII
FT                   YSYLARNFLVDITKTLKDQPDLKAPTYDDANFTSFADYFKDANGDLFGTPMEAFLKTYL
FT                   YRKDLFDDPKIKEAFKKETGKDLKPATTHEEYTQIAEFFTKYGKDNGMELWGTTAQAHT
FT                   GHPASWYEFFESIVPTFGVYNWGIDAKNNYAATVEHGGTMNGDKAKAALKYWLHLRDIA
FT                   PPESTQSTWTETATTFAAGRVAQGLIYGENAAWIASDEAQSKVVGKVGFALPPLEPGVL
FT                   DDAKAGKGYIGYYDGGAFGVPITSKNKEASLLFLEFIGQNEVQPDWAIAAPRITNKATF
FT                   DDPKVKEMDTKLGGFYTMLKDEGKLFAGAPPYPFHAQVREATAPIFYDILTGKIAPDEG
FT                   LDQMAAKAEEELTSLGYRK"
FT   sig_peptide     complement(263794..263871)
FT                   /locus_tag="Rleg2_0258"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 26"
FT   gene            264166..265050
FT                   /locus_tag="Rleg2_0259"
FT   CDS_pept        264166..265050
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0259"
FT                   /product="Xylose isomerase domain protein TIM barrel"
FT                   /note="PFAM: Xylose isomerase domain protein TIM barrel;
FT                   KEGG: mlo:mll3595 similar to D-tagatose 3-epimerase-related
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53559"
FT                   /db_xref="GOA:B5ZPP2"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZPP2"
FT                   /protein_id="ACI53559.1"
FT                   /translation="MRRLGIHSFVWTGGQTQEGLEMALNKTAEHGYRTIEFAYLRPEKF
FT                   NLDRLAKVAQSLDVEIGVTMGLPLDKDVSSEDAAAVSAGRQTLADAVRAVRDIGGNKLG
FT                   GILYSAHTKYNRQPTKKGWDNSVAAITATGEVARQANVDLVLEVVNRFETNLLNTTAQG
FT                   LKFISETGSQHVRLHLDTFHMNIEEANPAAAIRLAGDKIGYFHIGESNRGYLGDGVIDF
FT                   DRIFDALLDIGYERDIVFESFSTTVVDEGLSLACAIWRDTWEDNDLLAAHAKRYIELKY
FT                   DEAKRRRATNARP"
FT   gene            265112..266326
FT                   /locus_tag="Rleg2_0260"
FT   CDS_pept        265112..266326
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0260"
FT                   /product="ROK family protein"
FT                   /note="PFAM: ROK family protein; KEGG: sme:SMc03816
FT                   putative transcription regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53560"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZPP3"
FT                   /protein_id="ACI53560.1"
FT                   /translation="MNDTVSIGSSPRRIRQNNIVAALQTIYVHRSLSRADLARKLGMNR
FT                   SSSGEIVAELTEGGFVQESEESGKQRLEHSRAGRPGIMLELVPDAAFFVGIEIGVEHIS
FT                   AVVVDLSAEVRACRKVAFDTPSSTVEEAVAQGIELIVGAMAKRMIDRCKGLGLSTPSHV
FT                   RPDGFVTLAPIIGWRDVPLKDIARSAFPAAVPIAVENDANAFAIGDSYRHGVAGVTLFL
FT                   LMETGVGGGIMIDGKLFRGGHGLAGEIGHTLVPGSGGQKLEQLIGREVLIGQYREAVGR
FT                   EDADLQDFLGGVRDRVPAAVNIAETWSRHLAYALLQACRLLDPDRIVLGGSVAPLYPMV
FT                   AARVAVHMSEGQNIAFPTPEIVVDDDAEFDSAFGAACMLHRRFLSLENEEFGSEDSAPV
FT                   QSALS"
FT   gene            266358..267335
FT                   /locus_tag="Rleg2_0261"
FT   CDS_pept        266358..267335
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0261"
FT                   /product="PfkB domain protein"
FT                   /note="PFAM: PfkB domain protein; KEGG: rsq:Rsph17025_3586
FT                   tagatose-6-phosphate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53561"
FT                   /db_xref="GOA:B5ZPP4"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZPP4"
FT                   /protein_id="ACI53561.1"
FT                   /translation="MASILAPDALGPTVCVGEILVEIVATTVGNGFLEAQPLVGPFASG
FT                   APAIFISQCGRLGGQAAMVGAVGVDDFGRVNTDRLKRDGVDISAISIDPDYPTGSAFVR
FT                   YRKDGSRDFVYNIATSAAARFGWSGMVADLIDRTGHLHVMGSALSVPSARAVIDKAVDI
FT                   VKARGGTLSVDPNLRKELKLDEDTERRFAKLVAAADLLLPSGEELERAAGVEGEAEAIQ
FT                   RLFEMGVKEIVLKRGAVGATYFAHQGDRIDAPAFAVQEVDPTGAGDCFGGAYLTCRRLG
FT                   MSPQQALTYASAAGARNVTVLGPMEGAGTRGELDAFIASTERRP"
FT   gene            267335..268630
FT                   /locus_tag="Rleg2_0262"
FT   CDS_pept        267335..268630
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0262"
FT                   /product="Tagatose-6-phosphate kinase"
FT                   /EC_number="2.7.1.144"
FT                   /note="PFAM: D-tagatose-bisphosphate aldolase class II
FT                   accessory protein AgaZ; KEGG: rsq:Rsph17025_3587
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53562"
FT                   /db_xref="GOA:B5ZPP5"
FT                   /db_xref="InterPro:IPR012062"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZPP5"
FT                   /protein_id="ACI53562.1"
FT                   /translation="MQVHLDELARLRIEGDPKGVTSVCSAHPIVLRAALRHGRQQKSTV
FT                   LIEATCNQVNHLGGYTGMTPSDFASLVMRIAAEEGCSEKLIVLGGDHLGPNPWRDRPAE
FT                   EAMAEAETMVAAYVEAGFRKIHLDASMGCKGEPTALDDETTAHRAARLAAVAEASARKT
FT                   GGAMPVYVIGTEVPPPGGADHALTTIEPTAAAAALKTIAIHRRIFAEAGLGQAFGRAIG
FT                   LVVQPGVEFGNHNVIFYDNSKIEALQSVLTEEPQFVFEAHSTDYQGTGPLSALVKDGFP
FT                   ILKVGPELTFVLREALYALDAIASDLLADYGQRPLYAAMEALMLAQPDNWRRHYHGTEA
FT                   ELRWLRHYSLSDRIRYYWASAEAQEAVQRLCEALWGQSVPLPLFWQHMPAAQHFADAPL
FT                   DPDEVLIWRVTKSLADYHAACGVGKNEQSKSG"
FT   gene            268643..269368
FT                   /locus_tag="Rleg2_0263"
FT   CDS_pept        268643..269368
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0263"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR
FT                   domain protein; KEGG: ret:RHE_PF00005 ribitol
FT                   2-dehydrogenase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53563"
FT                   /db_xref="GOA:B5ZPP6"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZPP6"
FT                   /protein_id="ACI53563.1"
FT                   /translation="MTELDGKIAAVTGAASGIGLASTEAMLAAGARVVLVDRDEKALEA
FT                   VCSRLGERAIPLVINLLNPNECAGLLEGVLAKTGKLDILHANAGTYIGGDLVETDLETI
FT                   DRMLNLNVNVVIKNVHNVIPHMIERGTGDIVVTSSVAGHSAIPWEPVYSSSKWAMTCFV
FT                   QTMRRQLLKNGIRVGSVSPGPVISALLADWPEENLRKAKEAGALIEPKEVADAIIFMLT
FT                   RPRNVTIRDIVVLPSAFDI"
FT   gene            269380..270153
FT                   /locus_tag="Rleg2_0264"
FT   CDS_pept        269380..270153
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0264"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR
FT                   domain protein; KEGG: sme:SMc02339 putative oxidoreductase
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53564"
FT                   /db_xref="GOA:B5ZPP7"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZPP7"
FT                   /protein_id="ACI53564.1"
FT                   /translation="MSYQKKFRLDGERAVVTGGGRAIGLCCTEALAEAGAAVVVIERSE
FT                   ADARQALALRDKGYDIDVRVGDVTDAGRMDAIANELADGGRPATILVNNAGIGQSGIPA
FT                   EDLTDADWLRMMDVNLNGVFWCSRAFGRHMVSMKRGAIVNLGSMSGHICNRPQPQTAYN
FT                   VSKAAVHHLTRSLAAEWAQHGIRVNAVAPTYIETPMVVAVEANRERIPLWLADTPMGRM
FT                   GTPEEVASAVLFLATGAASLMTGAIVNVDAGFTCW"
FT   gene            270311..271135
FT                   /locus_tag="Rleg2_0265"
FT   CDS_pept        270311..271135
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0265"
FT                   /product="deoxyribose-phosphate
FT                   aldolase/phospho-2-dehydro-3-deoxyheptonate aldolase"
FT                   /note="PFAM: deoxyribose-phosphate
FT                   aldolase/phospho-2-dehydro-3-deoxyheptonate aldolase; KEGG:
FT                   sus:Acid_7869 deoxyribose-phosphate
FT                   aldolase/phospho-2-dehydro-3-deoxyheptonate aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53565"
FT                   /db_xref="GOA:B5ZPP8"
FT                   /db_xref="InterPro:IPR002915"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZPP8"
FT                   /protein_id="ACI53565.1"
FT                   /translation="MKSARLNRLFGVSGNCFDVAIDHGMFNERTFLAGIENMKTAIEVI
FT                   AQAAPDAIQLPPGTAPLLQAIPGKHRPALVLRTDIANIYGNPLPSQLFSEMIDRAVEQG
FT                   VSLDAACVVVNLLMLPDQPEVYRACVRNVNSLKRECEIYGMPLMVEPLVMQDNSKGAYM
FT                   VDGAIDKILPLVRQAAELGADIIKADPCDNVEEYHRVVEIAQGLPVLVRGGGRVSDQEI
FT                   LIRTKQLMEQGARGIVYGRNVIQHHNPGGMTKALMAIVHDKASVEQASLHIG"
FT   gene            271156..272310
FT                   /locus_tag="Rleg2_0266"
FT   CDS_pept        271156..272310
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0266"
FT                   /product="oxidoreductase domain protein"
FT                   /note="PFAM: oxidoreductase domain protein; KEGG:
FT                   tle:Tlet_0392 oxidoreductase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53566"
FT                   /db_xref="GOA:B5ZPP9"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZPP9"
FT                   /protein_id="ACI53566.1"
FT                   /translation="MTNIFRFGVIGCGLMGREFASAAARWLHLADVKARPEIVAVCDTN
FT                   ATLLDWFRDHVPTVRQFTADYKELLANPEVDAVYCAVPHVLHQQFYIDVLKAGKHLLGE
FT                   KPFGMDAAQNRAITAVLAEHPELMVRCSSEMPFFPGAQKVIALAKSGEMGEILEVEAGF
FT                   LHSSDIDRQKPINWKRMADINGDYGCMGDLGMHVLHVPLRLGWRPTTLHAQLVKKVTER
FT                   PDGKGGTLPCTTWDNATISSRVRAGDQDFPMVLKTWRIAPGESNTWYIRVLGMKKSAFF
FT                   STKSPRQWQWMDYNGGAQAWSTEDLGYNSLFPAITGKIFEFGFADAIQQMWAAFIDELA
FT                   GGDANGFGCATPAEAEAHHAVLTAALKSGREDVVVPVDYDGASV"
FT   sig_peptide     271156..271224
FT                   /locus_tag="Rleg2_0266"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.930) with cleavage site probability 0.882 at
FT                   residue 23"
FT   gene            272313..272390
FT                   /pseudo
FT                   /locus_tag="Rleg2_0267"
FT   gene            272390..273442
FT                   /locus_tag="Rleg2_0268"
FT   CDS_pept        272390..273442
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0268"
FT                   /product="PfkB domain protein"
FT                   /note="PFAM: PfkB domain protein; KEGG: spe:Spro_1034 PfkB
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53567"
FT                   /db_xref="GOA:B5ZPQ0"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZPQ0"
FT                   /protein_id="ACI53567.1"
FT                   /translation="MRTGEEVDHRGALKQGGIVCAGNFIVDRVHTLSYWPEQGNLAHIL
FT                   HQDLGVGGGAANVVTDLASLGFPGRLAAAGCIGADQDGEIVKARLAAAGVDTGGLTALA
FT                   DRMTAHTHVMNVPGQNRTFFYHGGASDAVTDKLISPATFAEAGYRLFYLGYLMLLPGLD
FT                   RIGADGSSGASRLLEAARRAGLTTCVDFVSSEDPEFAAKVGVALPFCDFLIINEMEAGR
FT                   ATGVVVRDAKGDLIEAELLKAGERLLAAGVAKGAIIHAPEICFWFASGAAPIMTRSRPV
FT                   DPNDIVSTVGAGDAFCAAVLYGLHENWPVEQICTVAHAAAAYCLTGATATDGIPDMSIL
FT                   FREAKDTNPT"
FT   gene            273546..274337
FT                   /locus_tag="Rleg2_0269"
FT   CDS_pept        273546..274337
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0269"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase;
FT                   short-chain dehydrogenase/reductase SDR; KR domain protein;
FT                   KEGG: rsh:Rsph17029_1731 sorbitol dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53568"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZPQ1"
FT                   /protein_id="ACI53568.1"
FT                   /translation="MTDTETGRRLSGKVALVTGGASGIGKAVCQRFAAEGAKVVVADLD
FT                   AGKCVAVAEAIGADAWGVALDVTRQDSIEDAVRFSIAAAGKIDILVNAAGIYEVESILE
FT                   ISRERTAKVFQVNIEGLIFMTQVVARHMVERGEGGRIINFSSQAGRRGEGPAVAYCASK
FT                   AAVISITQSCALELIRYGINVNAIAPGVVDTPMWDIVDAKLGSREGLQPGEVKARVAAA
FT                   VPAGRFGAAEEQAAMAAFLAGPDAAYIVAQCYNVDGGNVMS"
FT   gene            274394..275404
FT                   /locus_tag="Rleg2_0270"
FT   CDS_pept        274394..275404
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0270"
FT                   /product="Alcohol dehydrogenase GroES domain protein"
FT                   /note="PFAM: Alcohol dehydrogenase zinc-binding domain
FT                   protein; Alcohol dehydrogenase GroES domain protein; KEGG:
FT                   rec:RHECIAT_CH0003132 probable L-iditol 2-dehydrogenase
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53569"
FT                   /db_xref="GOA:B5ZPQ2"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZPQ2"
FT                   /protein_id="ACI53569.1"
FT                   /translation="MRAVRLESIGSLTMRSVERPVAGRGELLVRVAAAGICGSDRHMYK
FT                   GEYPTAIPVTLGHEFCGIVEEIGDGVTRFAGGELVTVDPNIACGTCPACTRARPNLCER
FT                   LTAIGVTRDGGFAEYVAVPHAQAFILPVGLDPVHGAFSEPLACCIHAIDKAGIRPGDNV
FT                   AILGGGVIGLLMVQLARLAGAGEIILITRQQSRRQAALRLGVTHAFDPNSSDTVASVRE
FT                   VTKGGADVVIECAGVSDTLQSGLKMARRGGAFVLFGVTPAGVEVPVLPFDLLINEVDIR
FT                   PAYLNPFTHSRAAAMVASGALELDALVTRTIGLEEVADVVVNAPLPGEIKVIVRP"
FT   gene            complement(275401..276429)
FT                   /locus_tag="Rleg2_0271"
FT   CDS_pept        complement(275401..276429)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0271"
FT                   /product="transcriptional regulator, LacI family"
FT                   /note="PFAM: regulatory protein LacI; periplasmic binding
FT                   protein/LacI transcriptional regulator; KEGG: psb:Psyr_2154
FT                   regulatory protein, LacI:periplasmic binding protein/LacI
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53570"
FT                   /db_xref="GOA:B5ZPQ3"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR001761"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZPQ3"
FT                   /protein_id="ACI53570.1"
FT                   /translation="MTTSIRHIAKLAGTSVSSVSRVLNNSGYASPELRHRVEAAIRTLN
FT                   YTPSKGARMLRGAPSRMIGLMLPSIDVPFFGILAHAIEQELFQHGYQTLICSTAENMDH
FT                   EARYISMLLAQRVDGVIVASAFGSIEHFGVLRDAGIPIIAIDRELSGIADDAVMADHEE
FT                   GGRLMARHLIGLGHRAIAIVGAPAHSQPIQLRLQGITAEMAKDGITPAVVAMAEEHSFA
FT                   ETYRLARELLASRPEITAIIGTTDVSAIAAIHAVQDRGFSVPNDYSVVGFDDLPEAAYV
FT                   FPRLTTVAQPIRNVGQQAARLLETLVEDQQTGDGSRAAAIVKVPVTLITRDSTGPVRST
FT                   ML"
FT   gene            276578..277228
FT                   /locus_tag="Rleg2_0272"
FT   CDS_pept        276578..277228
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0272"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ots:OTBS_0057 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53571"
FT                   /db_xref="GOA:B5ZPQ4"
FT                   /db_xref="InterPro:IPR002472"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZPQ4"
FT                   /protein_id="ACI53571.1"
FT                   /translation="MSDTVILFHGIARTKKSMGKLAAFLSDKGYRVVNVGYPSTRFSIG
FT                   DLVDIVRPQIDAAAKEAGDGHVHFIGYSMGGLLIRAFLRNHRPSNLGRVVMVGTPNNGS
FT                   EIADFLKTWPLYRKFYGPAGQQLITDQTAMTTLFGTVDYELGIIAGNRTIDPVSSLIIG
FT                   LRIPNDGKVSVESTRLHGAAAHIVIPANHTFLPVNKTMWRQALSFLQDGRFAS"
FT   gene            277328..278473
FT                   /locus_tag="Rleg2_0273"
FT   CDS_pept        277328..278473
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0273"
FT                   /product="putative polysaccharidase protein"
FT                   /note="KEGG: rec:RHECIAT_CH0000690 probable
FT                   polysaccharidase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53572"
FT                   /db_xref="InterPro:IPR006626"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="InterPro:IPR039448"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZPQ5"
FT                   /protein_id="ACI53572.1"
FT                   /translation="MPAILRKKIHGAATRGQVIDGAADVGVAYQVFSDTVVEDVIVKNS
FT                   PRGFKFHNGWNLIVRRCETENVNGDGIYLTKTTHVLLENNRIAAAPGEGADCCQFAYQN
FT                   SDDNISSDITIRGNLFLQSPTSTSNKGALVCDKTRRYLVEYNFIGGKNFSFSSIGDDAV
FT                   VRSNIMRDGRMNDYSFGYGIGDKADHNGHHVYDNWIENTNRGISLSGFSDQEQAFRKDI
FT                   DIHDNVISQCDIAFFANRPWSGSVRRNIFLRCKEDIVLKGKGKATAGDVDGNYSNDGSF
FT                   LNVTPPPLVFKPDGKASVSSGQWSSEPDEIRIQWRDKGIDIPGANRPSIAAAPGMELSC
FT                   VLLARKGQNWMLAIAETVYDDFTPRAWQEHRLPWQKRYLSI"
FT   gene            complement(278535..279869)
FT                   /locus_tag="Rleg2_0274"
FT   CDS_pept        complement(278535..279869)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0274"
FT                   /product="O-antigen polymerase"
FT                   /note="PFAM: O-antigen polymerase; KEGG:
FT                   rec:RHECIAT_CH0003464 putative exopolysaccharide production
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53573"
FT                   /db_xref="GOA:B5ZPQ6"
FT                   /db_xref="InterPro:IPR007016"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZPQ6"
FT                   /protein_id="ACI53573.1"
FT                   /translation="MTIEDAGLARNHYPAGYHRRSVPRWRVRRDVLAKLVLTIAFYASL
FT                   WRATSMWYGLPANFEDGAAVDPLPMKLMLYSLIPLSGLYFLLEQRQFLRVFSRISPFIV
FT                   VVGISCLTSIVFSIERGASVKGLAAVIVLAIPPLLYRARYGNVEAFRIIGRFAIAAAFI
FT                   NVLYTVAFPQFAIMRGSYAGMVKGAFYHKNTLGQFCSVSFVCLLSTEKLGRLRYSTLIR
FT                   WAAMLCLLALIVATKSSTAVVLTMFGSVMLYGIRIIHIYPNRLFRSFVVFLLFVIVGFA
FT                   ASFVYLGVASAVAEAFGKDITFSGRTNIWEQLLPLIWDRPITGYGFAMFRQPEVMEEYV
FT                   KVTFDARSTHNTYLELALNIGIPGVTAWTLFLVTRLFRKMTIVDRDPAESGARRKEIVI
FT                   IILIMLGAMTEAGMMLAPFILWPHMVIALSELRPRLRTNRNLHQT"
FT   gene            280353..281156
FT                   /locus_tag="Rleg2_0275"
FT   CDS_pept        280353..281156
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0275"
FT                   /product="Ku protein"
FT                   /note="TIGRFAM: Ku protein; PFAM: Ku domain protein; KEGG:
FT                   rec:RHECIAT_CH0000691 putative DNA helicase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53574"
FT                   /db_xref="GOA:B5ZPQ7"
FT                   /db_xref="InterPro:IPR006164"
FT                   /db_xref="InterPro:IPR009187"
FT                   /db_xref="InterPro:IPR016194"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZPQ7"
FT                   /protein_id="ACI53574.1"
FT                   /translation="MARQTFWKGYLKLSLVTAAVSLTPATTESNKVRFHVLNRQTKNRV
FT                   ESRYVDSVTHKPVPDRDQVKGYPRGEDDYVLLEDEEIEEVGLESTRTIDIDSFVPRGSI
FT                   DWIWYDKPHFLAPEDKVGVEAFCVIREAMKANDVVGIARLVLYRRERAVLLEPQGKGII
FT                   LWTLRYGDEVREPVAELDSKAEIDSKLLTLMKQLVKEETKDWSPAMVQDPIQKRLKSMI
FT                   RGKQKSLKKAAPAKKPAPVKSTGNVINIMDALKKSLAADDGRKPH"
FT   sig_peptide     280353..280436
FT                   /locus_tag="Rleg2_0275"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.807) with cleavage site probability 0.712 at
FT                   residue 28"
FT   gene            complement(281193..282047)
FT                   /locus_tag="Rleg2_0276"
FT   CDS_pept        complement(281193..282047)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0276"
FT                   /product="Ku protein"
FT                   /note="TIGRFAM: Ku protein; PFAM: Ku domain protein; KEGG:
FT                   rec:RHECIAT_CH0000693 putative DNA helicase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53575"
FT                   /db_xref="GOA:B5ZPQ8"
FT                   /db_xref="InterPro:IPR006164"
FT                   /db_xref="InterPro:IPR009187"
FT                   /db_xref="InterPro:IPR016194"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZPQ8"
FT                   /protein_id="ACI53575.1"
FT                   /translation="MAARASWKGHLKVGDLACAVGLYTAISSSDRVSFNIINRRTGHRV
FT                   ERQFIDSETGKPVERDDQVKGYQLENGDYIVIEGDEIAALMPESDKVLNIKAFIAYDGI
FT                   DKLYFDRPYYLAPVDEHDEEALALIARGMLDGKVAALAEAVLFRRNRTLLIRPQGDHIV
FT                   ATMLNFDYEVRSAESVFDDIPDIKFDKEMLELAGHILKTKQGSFEPSEYEDRYEAALVE
FT                   LVKAKIEGRAPPKKKQPPERKVVDLMEALRQSAGVSGKATAKKAPAKKAPARSDSRGTK
FT                   KAS"
FT   gene            complement(282066..282299)
FT                   /locus_tag="Rleg2_0277"
FT   CDS_pept        complement(282066..282299)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0277"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rec:RHECIAT_CH0000694 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53576"
FT                   /db_xref="InterPro:IPR018691"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZPQ9"
FT                   /protein_id="ACI53576.1"
FT                   /translation="MADITYQVVPHDNGWAYKLGDTLSETYATADEAIVHARDAASRQK
FT                   IGDGDALLAYPAPDGRGWAFQELETDKSNSRL"
FT   gene            complement(282314..282574)
FT                   /locus_tag="Rleg2_0278"
FT   CDS_pept        complement(282314..282574)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0278"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ret:RHE_CH00619 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53577"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZQ96"
FT                   /protein_id="ACI53577.1"
FT                   /translation="MPHVHSMDRQGRQMDARDRLIVALYAQLKAERETRETLEWAIRNG
FT                   AVSREVLEAIAADPVPVVTSEDIASVEKIIALDERRKPNRN"
FT   gene            282720..283148
FT                   /locus_tag="Rleg2_0279"
FT   CDS_pept        282720..283148
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0279"
FT                   /product="OsmC family protein"
FT                   /note="PFAM: OsmC family protein; KEGG:
FT                   rec:RHECIAT_CH0000696 putative stress-induced protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53578"
FT                   /db_xref="InterPro:IPR003718"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR036102"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZQ97"
FT                   /protein_id="ACI53578.1"
FT                   /translation="MVDLKARPRPTGATAALGRTGFPHVTSATKGEIDIVTAPSQPGFN
FT                   PLDLLYASLSACLVLSARMAASQMGVLDKISDITAEVTGEKATEGLSRVARFNIAFSIK
FT                   GDIDDETRQNIVHAAEDEICTVSNTIRGNPDFSTTISA"
FT   gene            283249..284685
FT                   /locus_tag="Rleg2_0280"
FT   CDS_pept        283249..284685
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0280"
FT                   /product="FAD dependent oxidoreductase"
FT                   /note="PFAM: FAD dependent oxidoreductase; KEGG:
FT                   ret:RHE_CH00621 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53579"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR038732"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZQ98"
FT                   /protein_id="ACI53579.1"
FT                   /translation="MQSKPFPKSERPVVAIIGGGVSGAGVAYHLARADCGEAPVILVFE
FT                   PRAELGRGLAYDTDDPAHRINVPAAKMSLQPDDLGEFQAWIEARDAVAGDSKAKQPDGS
FT                   LFPRRQLFGEYVASLLKPLLEDGRVRHCRVAVTGVERRAGRWTIRDDKGGVTEADIVAI
FT                   ATSHPAPAAPGRLASRLAGHPRFIADTTKPGALDVIRPHDRVLVIGNGLTAADVIASLA
FT                   ERGHEGPVMAISRRGLRSRGHAPVPQPLFGDFLADAGHSAGSLLARIRIAIDAAKAEGI
FT                   SWHGVIDQVRAQGYDLWQALPVAERRRLVRHLRPYWDVHRFRIAPQVEAVLDAAIAAGR
FT                   LEILAGSVADARIEGEFILCTLQPRHQRQPLERSYDAVIVTTGPAHGGILETQPWLSAL
FT                   AANGHLSLDPTGLGLACTGHSEAIGLSGEADPSLLISGPLARGTFGELMGLPQVTEHAF
FT                   FVANEIAAKLRVNATNTHPA"
FT   gene            284828..285721
FT                   /locus_tag="Rleg2_0281"
FT   CDS_pept        284828..285721
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0281"
FT                   /product="protein of unknown function DUF6 transmembrane"
FT                   /note="PFAM: protein of unknown function DUF6
FT                   transmembrane; KEGG: rec:RHECIAT_CH0000698 putative
FT                   transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53580"
FT                   /db_xref="GOA:B5ZQ99"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZQ99"
FT                   /protein_id="ACI53580.1"
FT                   /translation="MSQAASTLSEASPSNRLALAALILGGAAIGGSPIFVRLSEVGPMA
FT                   TAFWRVALALIPIFVVSLMKKHAGPKPQSLSDYGMLILPGVMLSLDLAAWHLSLTMTSV
FT                   ANATLLANLAPVFVTVIAFVFFRARPSGVFLLGLVLALAGVVILKGGPAAIGNGDLGGD
FT                   GIAMIAAFFYACYILAIGRLRSRFDTIRIMLWSTASAAVFIFPIALIHEGHMLPASLYG
FT                   WSILFGLAFISHAGGQVAITYALAYLPPAFSSLTLLLQPVVAAILAWALLNEAIGTMQA
FT                   LGGAVVLAGIMVARRG"
FT   gene            complement(285829..287385)
FT                   /locus_tag="Rleg2_0282"
FT   CDS_pept        complement(285829..287385)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0282"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="PFAM: phospholipase/Carboxylesterase;
FT                   Glyoxalase/bleomycin resistance protein/dioxygenase; KEGG:
FT                   rec:RHECIAT_CH0000699 putative glyoxalase/bleomycin
FT                   resistance protein/dioxygenase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53581"
FT                   /db_xref="GOA:B5ZQA0"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZQA0"
FT                   /protein_id="ACI53581.1"
FT                   /translation="MVSGIHHVTAVTRKVQANVDFYAGFLGLRLVKQTAGYEDATQLHL
FT                   FYGDAVGTPGSLLTFLAWEDGAPGRAGYGQISEISLSIDPASIGYWLTRAMSFGLRSEG
FT                   PADEFGEPVLRLKDPDNIILKLAGAKSLTSPAAWHGASIPAEHIIQRVRGATMLTEKPA
FT                   ESRSFIESHFGYRFQANRGTIDRLVSQSGDVIDVRDARGFWAGAPGTGTIDHVAFRAAD
FT                   EEALHSVRKALEATDASPTNLHDRKYFRSLYAREPGGTLIELATDKPGMIVDEEQAALG
FT                   TKLFAPPEAITNLHDLKVVLPQFAMPGQPRINYRELPFVHRFYTPPDPDGSVFVLLHGS
FT                   GGNETTLMPLLNKAAPRATLLGVRGRATEEGFPRWYKRITPFSFDQNDIKTEAEAFAAF
FT                   IEGAVKSYGLDPQKVVYVGYSNGANLLNSLLYLHPNLVHKAVLLRSMPVLSDYPHADLK
FT                   GTDLLVISGKTDAYGKYASELEDRLKSSGATVDSDVIPGGHDLGDADVPIIQKWLLQEN
FT                   R"
FT   gene            complement(287470..289065)
FT                   /locus_tag="Rleg2_0283"
FT   CDS_pept        complement(287470..289065)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0283"
FT                   /product="response regulator receiver sensor hybrid
FT                   histidine kinase"
FT                   /EC_number="2.7.13.3"
FT                   /note="PFAM: response regulator receiver; ATP-binding
FT                   region ATPase domain protein; histidine kinase A domain
FT                   protein; KEGG: rec:RHECIAT_CH0000700 probable two-component
FT                   sensor histidine kinase/response regulator hybrid protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53582"
FT                   /db_xref="GOA:B5ZQA1"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZQA1"
FT                   /protein_id="ACI53582.1"
FT                   /translation="MAEECSILIIDDNIDDREVYRRILGRVSSTAYSVLEAETGEEGLA
FT                   LNGRKRPNCILLDYSLPGRNGLGVLADILENDPAANVIMLTGQGSETVAVEVMKSGARD
FT                   YLTKDSLSPETLHRCIQNAIMHGMLEAQLEQKRQSLEIFTRAMAHDLKEPLRTIKSFSR
FT                   ILHGSAALPADDRELLDYVLSAADHMEDLIVKVSGFTRLEASGGPELKPVSLSAVLDQV
FT                   EDNLRQQTESRGAMIIRGALPEVMGDATLLTQLLQNLVSNAIRYCEQKVPEVTISGEAH
FT                   GDFCRLTVRDNGPGIDPQHRELIFQPFKRLVGRGIEGTGLGLAICRRIAQLHGGSIWCE
FT                   AEDGPGATFVLDVPLAETRPEPPAAAAIPHSGKPAEQPGEGEGRLAEVLLVEDSPADIQ
FT                   LLKIKLMRREKVNFNLHVATNGREAMRLLEERAGIAEVPQIDLMLLDINMPIMDGFEVL
FT                   RALSTDVRLNQIPVCILSTSSDETDRQRARNLGARAYMVKPPTLQQLEEALEYVDHLEL
FT                   LQRGDSLALCAEQN"
FT   gene            complement(289070..289495)
FT                   /locus_tag="Rleg2_0284"
FT   CDS_pept        complement(289070..289495)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0284"
FT                   /product="response regulator receiver protein"
FT                   /note="PFAM: response regulator receiver; KEGG:
FT                   rec:RHECIAT_CH0000701 probable two-component response
FT                   regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53583"
FT                   /db_xref="GOA:B5ZQA2"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZQA2"
FT                   /protein_id="ACI53583.1"
FT                   /translation="MQQRDTQPILIVEDSEDDFEATMRAFKRTNLRNSIRWAASGQEAL
FT                   DMLAVMVPKPGLILLDLNMPGLDGRKTLEAIKSNAGWRKIPVVILTTSDDERDIEGCYA
FT                   LGANTYVQKPVDLDGLFAAIQRLKEYWFEIAILPLED"
FT   gene            complement(289482..291623)
FT                   /locus_tag="Rleg2_0285"
FT   CDS_pept        complement(289482..291623)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0285"
FT                   /product="multi-sensor signal transduction histidine
FT                   kinase"
FT                   /note="KEGG: rec:RHECIAT_CH0000702 probable two-component
FT                   sensor histidine kinase protein; TIGRFAM: PAS sensor
FT                   protein; PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase A domain protein; PAS fold-3 domain
FT                   protein; PAS fold-4 domain protein; PAS fold domain
FT                   protein; SMART: PAS domain containing protein; PAC
FT                   repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53584"
FT                   /db_xref="GOA:B5ZQA3"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZQA3"
FT                   /protein_id="ACI53584.1"
FT                   /translation="MQDSGNVDLQDQRQRQRYRGFAIAVGCLMFLLGMSALAGWLLQIQ
FT                   VIISLVPGFPSMAFNTALCFVLSGLGLAASTLAARRFLVAATVMTGIAAAIAAARLLEI
FT                   VTIGRTFHNIDLLITRFVIPPDFIAQIGGGMGPNTALVFLIANLSLLFSLYVERRSQVV
FT                   QELTSYIVITLGMIALASYVTDAEQGYRWGPYAAMALHTAVGMVIFGSGLLARSWWMQP
FT                   ANRAQIPLWIPAAVCFTGLLVDLYTPLGVANGILYVPLVLTALWFGNRNAPLFFAFACT
FT                   VLLMLGFFAVRHNEAAFWQEIANRTITAATLWLIAILVFYFMRNNHNLETERVRFGALV
FT                   RGTPDAVIVIDESGTIRSFNPAAESMFGYTPQETIGRNIKMLMPEPYHSEHDGYLAHYR
FT                   KTGEERIIGTTRMVSGRRRNGIVFPIDVSISAVSTGDAKIFVGIVRDISERARQEERMK
FT                   TTLAQLEAYTAELERSNHDLDEFAYIASHDLKEPLRGLHNHSRFLLEDYEDKLDDDGVR
FT                   RLNRLVRLSQRMEKLVNDLLYFSRLGRQQLAVKRSDIGLIVKDVVATMELLLEERHAKV
FT                   IIDGQLPDVVCDAPRLTEVFRNLITNAIKYNDKPAPLVSIGYLDRFVGQDGTIARNVFF
FT                   VRDNGKGIPQEFHEDIFRIFKRLEKSQDSDDGTGAGLTFVRKIIARHNGDIWLESEVGT
FT                   GTTFYFTLGKKREGQNAAA"
FT   sig_peptide     complement(291507..291623)
FT                   /locus_tag="Rleg2_0285"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.628) with cleavage site probability 0.627 at
FT                   residue 39"
FT   gene            291817..292194
FT                   /locus_tag="Rleg2_0286"
FT   CDS_pept        291817..292194
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0286"
FT                   /product="response regulator receiver protein"
FT                   /note="PFAM: response regulator receiver; KEGG:
FT                   rec:RHECIAT_CH0000703 putative two-component response
FT                   regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53585"
FT                   /db_xref="GOA:B5ZQA4"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZQA4"
FT                   /protein_id="ACI53585.1"
FT                   /translation="MPTIIYVDDSRDDLFYLDYTRRKQQIDVDLFCFSTAETALAALEQ
FT                   RAAEGWALPELLVADLYMPLDSGIALVTRLRLDDRFKAMRLAICSGSDAAEDRARSLEA
FT                   GADAYLEKPLDLAGIILNLEL"
FT   gene            292669..293373
FT                   /locus_tag="Rleg2_0287"
FT   CDS_pept        292669..293373
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0287"
FT                   /product="transcriptional regulator, LuxR family"
FT                   /note="PFAM: regulatory protein LuxR; Sigma-70 region 4
FT                   type 2; KEGG: ret:RHE_CH00628 putative transcriptional
FT                   regulator protein, LuxR family"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53586"
FT                   /db_xref="GOA:B5ZQA5"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZQA5"
FT                   /protein_id="ACI53586.1"
FT                   /translation="MNNAPAIPFHAGPELSRAINRTDFFRLLKSAAQHYNFDNFALARI
FT                   SETSAPFGERDIVITNVAERRVGLFITTLKEALGTVRAKSAQFLATPVHGRSVRPEDYR
FT                   SDLVFNEFLSGVFLFIPLFTPEGRRYCLVLSGERQEPDQSEIADMLLDAMRIFDKLYEE
FT                   ILTQEMSGRLTQREQEIVKWTSEGKTSAEIAIILGLSEHTVNSHITAAARKLDAVNRVH
FT                   MVAIALRNGLVT"
FT   gene            293405..293842
FT                   /locus_tag="Rleg2_0288"
FT   CDS_pept        293405..293842
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0288"
FT                   /product="response regulator receiver protein"
FT                   /note="KEGG: rec:RHECIAT_CH0000705 putative two-component
FT                   response regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53587"
FT                   /db_xref="GOA:B5ZQA6"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZQA6"
FT                   /protein_id="ACI53587.1"
FT                   /translation="MTTETVRKNAVKVLFVDDEFIEFRALKKKIADLSEPAVEVEYSPS
FT                   IGDALEKIRLARFDLILLDNRLLPNADFRETVPELRGIGYTGPIGVVSTDISGGYFQEF
FT                   PDYGVDFRIGKDEIDAQTLQHIIREYVNYDVPDFWKDDYSI"
FT   gene            complement(293862..294572)
FT                   /locus_tag="Rleg2_0289"
FT   CDS_pept        complement(293862..294572)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0289"
FT                   /product="histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase A domain protein; KEGG: ret:RHE_CH00630
FT                   putative two-component sensor histidine kinase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53588"
FT                   /db_xref="GOA:B5ZQA7"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZQA7"
FT                   /protein_id="ACI53588.1"
FT                   /translation="MSSNPTRRPEEDDSSEERIKRFLATASHDLQSPLRHIAMYAELLL
FT                   DDLEGTLDGEQLQSLRMIMEKAQAAQRLTKALMSLAGGAPQVTPEEVDLQALAENVWGE
FT                   LTDEIAVSDATLESQGLPSLRTDPALLGLVLRHLLTNALTYRSEAPLHVVISAEREMAD
FT                   WFIRISDNGAGIDPAYRERIFEPFWKLPKVGTVPGAGLGLTTAREFLAALGGDLSLEHS
FT                   DQNGSRFLIRLSVA"
FT   gene            complement(294745..297294)
FT                   /locus_tag="Rleg2_0290"
FT   CDS_pept        complement(294745..297294)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0290"
FT                   /product="protein-export membrane protein SecD"
FT                   /note="TIGRFAM: protein-export membrane protein, SecD/SecF
FT                   family; protein-export membrane protein SecF;
FT                   protein-export membrane protein SecD; PFAM: SecD/SecF/SecDF
FT                   export membrane protein; KEGG: ret:RHE_CH00631 bifunctional
FT                   preprotein translocase subunit SecD/SecF"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53589"
FT                   /db_xref="GOA:B5ZQA8"
FT                   /db_xref="InterPro:IPR005665"
FT                   /db_xref="InterPro:IPR005791"
FT                   /db_xref="InterPro:IPR022645"
FT                   /db_xref="InterPro:IPR022646"
FT                   /db_xref="InterPro:IPR022813"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZQA8"
FT                   /protein_id="ACI53589.1"
FT                   /translation="MRTSPWLVFTYTVIILLGLLIALPNVLPQSVLQRVPAWLPHEQVS
FT                   LGLDLRGGSHLVLEVDEADLTKERLQSLLQDARRVLREKGIQPKAVVRSQNQIVVTLAD
FT                   ATQSDAAVTDLKTLANPISTGLSAGQSDLDVLANGATITIGFSKAGISANVDNAVQQSL
FT                   EVIRQRVDQVGVSEPTIQRIGANRVLVQLPGAQDPTRLRQLLGSTAKMSFHMLSPNNQP
FT                   GPGVTMLKDDEGRTYPVLDRVELSGDRLSDARVSFDPNTHEPIVSFRFDSAGASRFADI
FT                   TRQNVGNPFAIVLDDKVLSAPVIREPITGGSGQISGNFSADSATTLAAMLRAGALPAKL
FT                   TVIEERTVGADLGADAIKMGIYSGIVGFILVAVFIFVLYGTWGVLANIALLIHTILTFS
FT                   ALTLVGATLTLPGIAGVVLGIGLAVDANVLINERIREETRKGKGAFAAIDTGFNRAYST
FT                   IIDGNMTALIAAAILFFFGSGPVRGFAVTMALGLIISMFTSVAFVRVAMIEITRRRKFK
FT                   VLNIRPLIPFSPYDKHIEFMKARFFGVTVSALLSIASVVLFIHPGLNYGVDFRGGIQMS
FT                   VKTQGVADLAKFREGLDSLGLGEITLQSFGDKSSILVRAQRQEGGEEAQTAAVTKLKAE
FT                   VAKIDPTATVEGTDVIGPKVSGELAWAGILSVVIASLAMLIYIWVRFEWPFAVGAIVTL
FT                   VLDVTKAIGFFAITGLDFNLTAIAAILTLVGYSVNDKVVVYDRMRENMRLYKSMPLREI
FT                   IDKSINETLARSLYTNATAFLALVPMAIWGGSAVSSFAIPMVFGILVAGASSIFIAAPI
FT                   LLFLGDWRRRHAKVAAATDGAVEIIPPEQGRPRKSAS"
FT   gene            complement(297378..297758)
FT                   /locus_tag="Rleg2_0291"
FT   CDS_pept        complement(297378..297758)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0291"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rec:RHECIAT_CH0000708 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53590"
FT                   /db_xref="GOA:B5ZQA9"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZQA9"
FT                   /protein_id="ACI53590.1"
FT                   /translation="MELDQHHLTSRVAASLLVAILAYIGLLVGGNLVISPVAAVNTLSS
FT                   SGRDPQPPQLTARDAVRGVLATERRLAPKQAAHDGGSPALAAAPVIDLAGWTIAAAFPA
FT                   FDAPRHAAVSRTHQPRGPPAAA"
FT   gene            complement(297813..299633)
FT                   /locus_tag="Rleg2_0292"
FT   CDS_pept        complement(297813..299633)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0292"
FT                   /product="sodium/hydrogen exchanger"
FT                   /note="PFAM: TrkA-N domain protein; sodium/hydrogen
FT                   exchanger; KEGG: rec:RHECIAT_CH0000709 probable cation
FT                   efflux system protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53591"
FT                   /db_xref="GOA:B5ZQB0"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZQB0"
FT                   /protein_id="ACI53591.1"
FT                   /translation="MPHDTPLISTIVGGLVLAFIFGAFAHRLRMPPLVGYLIAGVLVGP
FT                   HTPGYVADQSLAPELAEIGVILLMFGVGLHFSLKDLLSVRGIAVPGAIAQIAFATLLGW
FT                   GLGAFLGWPTGGSLVFGLALSVASTVVLLKALQERRLVETERGRIAVGWLIVEDLAMVL
FT                   ALVLIPAAASIGGEGHAPVEPLSAGLNRLFGLDLGIGGMIAMTLVKVALFVALMLVFGR
FT                   KLIPWTMHRIAHTGSRELFRLGVLAIALGVAFGAAKLFGVSLALGAFFAGMVLAESELS
FT                   HRAAQESLPLRDAFAVLFFVSVGMLFDPNILIDRPLPILATIFIIVIGKSVAALLIVLA
FT                   FKKPLGTALTISASLGQIGEFSFILAALGVELGLLPEEGRDLILAGAIISIILNPLLFF
FT                   LCDRMRPMLEGAKREEAVVESAPSPDAAAAHEEVPPEDDEVHPTALRGHAILVGYGRVG
FT                   SIVGQNLKSSATPFLVIEDSDKRIGELRAQGVETLMGNAVMRETLDLANLSGARSIAIA
FT                   IPNAFEACRIAEQARSVNPSILIVARAHSDAEVDELKHYGADTVIMGEREIALGMVDRL
FT                   AQVHHDSVPYEDGHGPDTIMTADEPPPPKE"
FT   sig_peptide     complement(299556..299633)
FT                   /locus_tag="Rleg2_0292"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.949) with cleavage site probability 0.949 at
FT                   residue 26"
FT   gene            299713..299967
FT                   /locus_tag="Rleg2_0293"
FT   CDS_pept        299713..299967
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0293"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ret:RHE_CH00634 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53592"
FT                   /db_xref="GOA:B5ZQB1"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZQB1"
FT                   /protein_id="ACI53592.1"
FT                   /translation="MGQGARETILTPALCRAARGLLDWTQTDLAERAAVSRSTIRDYEG
FT                   RRHDIHRATEAQLRLAFEEGGVRFVEIEGAGTGLCLPAA"
FT   gene            complement(299992..301413)
FT                   /locus_tag="Rleg2_0294"
FT   CDS_pept        complement(299992..301413)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0294"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rec:RHECIAT_CH0000711 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53593"
FT                   /db_xref="GOA:B5ZQB2"
FT                   /db_xref="InterPro:IPR038731"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZQB2"
FT                   /protein_id="ACI53593.1"
FT                   /translation="MSPRSGLLIVLGFTLWRVVTLAFDRTDLFVDEAQYWFWAQNLDLG
FT                   YYSKPPMIAWVIRGMTELSGSDAIYWIRLSGPLIHMAAALVLMKVAKRFVGPEIEGWTG
FT                   AAYITLPGVALSSVFFSTDVILLFFIAITLLAYFGLTQRRSLGLALVMGLGVGLAFLTK
FT                   YAVLFVVPGGALALLLIPAARIAVRDFIIAVAVAAVVALPNLWWNLQHNNTTVRHTQDI
FT                   AHWSDLGINLRRGLEFFSAQFGVVGPIIFFAMLWAVYRMIRGRSDDREKMLVWLSMPVV
FT                   VLITLQATVAKAYANWAVTAYVAGTILAVWLLYRMWPKGLRLSLGINGIASLLFPLATI
FT                   FPQQLLLPNGDEVMKRYLGRAEVSRETAALAAQAGTDIIVTDDRDMVADLFYTLRDASY
FT                   RIYARAPAGLPESYYEQEFALPADITGKVLYLTIGPLSCASETPEVVKNWQPTEGYYKG
FT                   KSLSVYKVSAACLAP"
FT   sig_peptide     complement(301345..301413)
FT                   /locus_tag="Rleg2_0294"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.881) with cleavage site probability 0.878 at
FT                   residue 23"
FT   gene            302041..303669
FT                   /locus_tag="Rleg2_0295"
FT   CDS_pept        302041..303669
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0295"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="PFAM: chemotaxis sensory transducer; KEGG:
FT                   rec:RHECIAT_CH0000713 methyl-accepting chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53594"
FT                   /db_xref="GOA:B5ZQB3"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR009050"
FT                   /db_xref="InterPro:IPR012292"
FT                   /db_xref="InterPro:IPR039379"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZQB3"
FT                   /protein_id="ACI53594.1"
FT                   /translation="MPSDQARGAQAGSLRDRLRFAGLDADQCELVRRNRPALEAHLKAG
FT                   LRDLFHRFQSFPDAARNFDSERQVERLHDLQSSHWDVLTDARFDSLYAERVKVLSDTES
FT                   KIGLDPRWHVAGHGVMLEHVVAGLAEEIAGRPLLPSAKRRTREISDLMTAIIRLVMVDV
FT                   EIAVSLRFNAQRAAQSRALADQRTDNEAEIVRIFGDVIEGLSARDLTRRAPVDGAHAAT
FT                   AAALNGALDGLQVEFAAITERTLKAEAATGSLAGLSRQFAGTASGQADRLQLSAAALAG
FT                   IAASVRDGAADSRAAEQAVASTRAAVEESGEVVGRAISAMADIEQSAEKIGQIIGTIDE
FT                   IAFQTNLLALNAGIEAARAGDSGRGFAVVAQEVRALAQRSAEAAREIKTLVTTTKAQVD
FT                   AGVQMVGRTQDSIGSIVRQVTDINAAISGIATRTGEHASSLDSVTSDVKGLGGEVAGSA
FT                   GLAERSAEGADHLHTVIVELGQTIREFRIARENVNAGRPAPVRVTPPRAIEAAARPAVA
FT                   EDEYENDDFSLPQPFASVGGGRNVY"
FT   gene            303733..304029
FT                   /locus_tag="Rleg2_0296"
FT   CDS_pept        303733..304029
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0296"
FT                   /product="chemotaxis protein CheX"
FT                   /note="KEGG: rec:RHECIAT_CH0000714 chemotaxis protein CheX"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53595"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZQB4"
FT                   /protein_id="ACI53595.1"
FT                   /translation="MVAKKSGKTLDLTAVLDLNEASALRDKLLSLRGSGLSIDASGVER
FT                   IGALCAQVLMSAEKTWEQDKQPFTFSKVSDAFQKTMQLVGVNIDHLLAKEIRQ"
FT   gene            304026..304391
FT                   /locus_tag="Rleg2_0297"
FT   CDS_pept        304026..304391
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0297"
FT                   /product="response regulator receiver protein"
FT                   /note="PFAM: response regulator receiver; KEGG:
FT                   rec:RHECIAT_CH0000715 chemotaxis two-component response
FT                   regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53596"
FT                   /db_xref="GOA:B5ZQB5"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZQB5"
FT                   /protein_id="ACI53596.1"
FT                   /translation="MKKKVLTVDDSRTIRNMLLVTLNNAGFETIQAEDGVEGLEVLEES
FT                   NPDVIVTDINMPRLDGFGFIEGVRRNEKYRAIPILVLTTESDAEKKNRARQAGATGWIV
FT                   KPFDPAKLIDAIERVTA"
FT   gene            304409..306700
FT                   /locus_tag="Rleg2_0298"
FT   CDS_pept        304409..306700
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0298"
FT                   /product="CheA signal transduction histidine kinase"
FT                   /note="PFAM: CheW domain protein; ATP-binding region ATPase
FT                   domain protein; Signal transducing histidine kinase
FT                   homodimeric; Hpt domain protein; KEGG:
FT                   rec:RHECIAT_CH0000716 chemotaxis two-component sensor
FT                   histidine kinase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53597"
FT                   /db_xref="GOA:B5ZQB6"
FT                   /db_xref="InterPro:IPR002545"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004105"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR008207"
FT                   /db_xref="InterPro:IPR036061"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036641"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR037006"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZQB6"
FT                   /protein_id="ACI53597.1"
FT                   /translation="MDMNEIKEIFFQECEEQLAELESGLLKMNDGDRDPETVNAVFRAV
FT                   HSIKGGAGAFGLDDLVAFAHVFETTLDCVRSNKLEPTQDVLKVMLKSADVLADLTNAAR
FT                   DGGSVDESRSRGLVKELEALANGELPSPSAAAEAPAPKAAAKPAAAAPAPAPKPTDDSG
FT                   FQPVPFSFDDFGGEGDAGSGMPAYEIIFKPRYELYSKGNDATLLLRDLSRLGEMTIFCN
FT                   SDELPGLDELDPEGAYFFWNITIKTDKGEDAIRTVFEFAEWDCELTVKPVEEARAEATS
FT                   NDELPMVPVPFDLSILDEAGAAEDVSGTAAAETAAAVAAAETASNVTQMAAAAARVEKK
FT                   ESAAAAAAAASAAAAQNNAAGAGQTIRVDLDRVDRLINLVGELVINQAMLSQSVIENDT
FT                   TGTSSINMGLEELQQLTREIQDSVMAIRAQPVKPVFQRMSRIVREIADMTGKSIRLITE
FT                   GENTEVDKTVIDKLAEPLTHMIRNAVDHGIETPEKRAAAGKNTEGTVRLTAKHRSGRIL
FT                   IELADDGAGINREKVRQKAIDNDLIPADSNLSDEEIDNLIFLPGFSTADKISDISGRGV
FT                   GMDVVKRSIQALGGRINITSKPGHGSVFTMSLPLTLAVLDGMVVTVAGQTLVVPLTAIV
FT                   ETLQPEASAIHSFGANHRLISIRNSFCPLVDVGRILNFRATQANPVEGVALLVESEGGG
FT                   QRALMVDAIQGQRQVVIKSLEANYTHVPGIAAATILGDGRVALILDVDAVVGASRGQSL
FT                   KAEMSLAAVG"
FT   gene            306705..307172
FT                   /locus_tag="Rleg2_0299"
FT   CDS_pept        306705..307172
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0299"
FT                   /product="CheW protein"
FT                   /note="PFAM: CheW domain protein; KEGG:
FT                   rec:RHECIAT_CH0000717 chemotaxis signal transduction
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53598"
FT                   /db_xref="GOA:B5ZQB7"
FT                   /db_xref="InterPro:IPR002545"
FT                   /db_xref="InterPro:IPR036061"
FT                   /db_xref="InterPro:IPR039315"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZQB7"
FT                   /protein_id="ACI53598.1"
FT                   /translation="MSYAVKNLNEGDRELIAFRIGDQEFCVNIMSVREIRGWTPATTMP
FT                   HSPGYMLGVINLRGAVLPIIDLAARLGMKPADPTARHVIIVAQVRRKVVGLLVDAVSDI
FT                   LTVTDETIQPTPEISSELERQFARGILAIDKRMICLIELESLFPETESEAA"
FT   gene            307169..308077
FT                   /locus_tag="Rleg2_0300"
FT   CDS_pept        307169..308077
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0300"
FT                   /product="MCP methyltransferase, CheR-type"
FT                   /EC_number="2.1.1.80"
FT                   /note="PFAM: MCP methyltransferase CheR-type; KEGG:
FT                   rec:RHECIAT_CH0000718 methyl-accepting chemotaxis protein
FT                   O-methyltransferase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53599"
FT                   /db_xref="GOA:B5ZQB8"
FT                   /db_xref="InterPro:IPR000780"
FT                   /db_xref="InterPro:IPR022641"
FT                   /db_xref="InterPro:IPR022642"
FT                   /db_xref="InterPro:IPR026024"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR036804"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZQB8"
FT                   /protein_id="ACI53599.1"
FT                   /translation="MNAMGAKDQRQGSDEVLASGEYPLTRRDLTEIAAMIYSDAGIFLN
FT                   ETKASLVYSRLSKHIRNLGLSGFREYCELVASPAGAAPRREMLSHLTTNFTRFFRENHH
FT                   FDHLRDHVLPELLQRAKSGGRVRIWSAASSDGQEPYSIALTVLSLMPNVADYDFKILAT
FT                   DIDPKILAIARAGAYDENALETVSPAMRKQWFSEVEIQGRRKFQVDDRVKRLITYNELN
FT                   LMAQWPFKGKFDVIFCRNVVIYFDEPTQMKIWQRFAGLLPEGGHLYIGHSERVSGEAKH
FT                   VFDNIGITTYRYTAKGLGRKA"
FT   gene            308074..309117
FT                   /locus_tag="Rleg2_0301"
FT   CDS_pept        308074..309117
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0301"
FT                   /product="response regulator receiver modulated CheB
FT                   methylesterase"
FT                   /EC_number="3.1.1.61"
FT                   /note="PFAM: CheB methylesterase; response regulator
FT                   receiver; KEGG: rec:RHECIAT_CH0000719 chemotaxis-specific
FT                   methylesterase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53600"
FT                   /db_xref="GOA:B5ZQB9"
FT                   /db_xref="InterPro:IPR000673"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR008248"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR035909"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZQB9"
FT                   /protein_id="ACI53600.1"
FT                   /translation="MSAPARVLVVDDSPTMRGLITAVLSSDPEVNVIGQAGDALEAREA
FT                   IKRLNPDVVTLDIEMPNMNGLDFLEKIMTLRPMPVIMVSTMTHRGAEASLAALEIGAFD
FT                   CVGKPAPGELRPFGDLAEKVKAAARTQRQFSQPVAAPAPPPSVADFRVGRKIVAIGSST
FT                   GGVEALIAVLQKFPANCPPTVITQHMPPTFTKSFAERLNRLCAPVVQEATDGARLEIGK
FT                   IYLAPGGERHLQVSNASAPCCRLVDRAPVNGHRPSVDVLFDSVAELAGRNAVGVILTGM
FT                   GRDGAAGLLKMRHAGARTLGQNEKTCVVYGMPRVAHELGAVEQQLPLSAIGEEILKMTA
FT                   ARKEGTE"
FT   gene            309119..309508
FT                   /locus_tag="Rleg2_0302"
FT   CDS_pept        309119..309508
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0302"
FT                   /product="response regulator receiver protein"
FT                   /note="PFAM: response regulator receiver; KEGG:
FT                   rec:RHECIAT_CH0000720 chemotaxis two-component response
FT                   regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53601"
FT                   /db_xref="GOA:B5ZQC0"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZQC0"
FT                   /protein_id="ACI53601.1"
FT                   /translation="MSIAEKIKVLIVDDQVTSRLLLSDALTQLGFKQITSAGDGEQGMK
FT                   IMAEQPHHLVISDFNMPKMDGIGFLQAVRTNPNTKKAAFIILTAQGDRALVQKAAQLGA
FT                   NNVLAKPFTIEKMKAAIEAVFGALK"
FT   gene            309505..310059
FT                   /locus_tag="Rleg2_0303"
FT   CDS_pept        309505..310059
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0303"
FT                   /product="CheD"
FT                   /note="stimulates methylation of MCP proteins; PFAM: CheD
FT                   family protein; KEGG: rec:RHECIAT_CH0000721 chemotaxis
FT                   protein CheD"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53602"
FT                   /db_xref="GOA:B5ZQC1"
FT                   /db_xref="InterPro:IPR005659"
FT                   /db_xref="InterPro:IPR011324"
FT                   /db_xref="InterPro:IPR038592"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5ZQC1"
FT                   /protein_id="ACI53602.1"
FT                   /translation="MMTEGAARRVHIIQGEYKVLSDPNAVLSTILGSCVAACLRDPVAG
FT                   IGGMNHFLLPGSATSPTSGGDATRYGVHLMELLINGLLKQGARRDRLEAKIFGGAKTIS
FT                   TFSNVGEQNAAFAMQFLRDEGIPVVGSSTGGDHGRKLEFWPVSGRARQYPLTGAETQRT
FT                   VALEQRPAAPPKPVETSIEFF"
FT   gene            310076..310465
FT                   /locus_tag="Rleg2_0304"
FT   CDS_pept        310076..310465
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0304"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rec:RHECIAT_CH0000722 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53603"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZQC2"
FT                   /protein_id="ACI53603.1"
FT                   /translation="MTFNSVMEPPAPVEALSDILMRIVSELHDVAYLIERIEPQLLDLG
FT                   GAEILNSPDAMKVMQGIDLAVQKSRGLAEFIDTITGEIPHGWAVDVATALSLVKLAEMQ
FT                   KALGGATRHGHSQPLSKAAGDFDFF"
FT   gene            310576..312267
FT                   /locus_tag="Rleg2_0305"
FT   CDS_pept        310576..312267
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0305"
FT                   /product="flagellar M-ring protein FliF"
FT                   /note="TIGRFAM: flagellar M-ring protein FliF; PFAM:
FT                   secretory protein YscJ/FliF family protein; Flagellar
FT                   M-ring domain protein; KEGG: rec:RHECIAT_CH0000723
FT                   flagellar M-ring protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53604"
FT                   /db_xref="GOA:B5ZQC3"
FT                   /db_xref="InterPro:IPR000067"
FT                   /db_xref="InterPro:IPR006182"
FT                   /db_xref="InterPro:IPR013556"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZQC3"
FT                   /protein_id="ACI53604.1"
FT                   /translation="MNLLNQLVQIFKNFGSLGRTRLMILGGVGAVSIAIVLAAALFVNK
FT                   PAQETLYVGLDSPDLNQISMALAEANVDFQVGTDGTSISVPAGMTGKARLLLAERGLPN
FT                   SANAGYELFDNVGSLGLTSFMQEVTRVRALEGEIARTIQSISGITAARVHIVMPEVGNF
FT                   RKAEQKPTASVMIRASATTGRSAATSIRHLVASAVPGLDVDDVTILDSAGQLLASGDEA
FT                   SNSSLNRSLNIVQNVQQEVESNIDKALAPFLGMDNFRSSVTADLNTDAQQIQETTYDPE
FT                   SKVERSVRSTKEAQQSQQKQSDSATTVEQNIPQAAPEAGGSAGPESQDKSDKREEQTNY
FT                   EINSRTTATTRNSYKVEKLSIAVVVNKGRIAKMVGEPADQAKIDAYLAEMQKIVASASG
FT                   IDAKRGDVVTVTAMDFLENQLLEDATGGVRVMDMLSRNLAGIINSLAFVAVAFVVVWMG
FT                   LRPLVRSVSGNGSSSVLGDATPEAAGLELPDFAPAAGASGGALMDGFGSDFGFDSTEDL
FT                   LSLGDDDGNFNRRVKEGPERKLSRMVEINEERAAKILRKWAIDEAA"
FT   sig_peptide     310576..310692
FT                   /locus_tag="Rleg2_0305"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.914) with cleavage site probability 0.792 at
FT                   residue 39"
FT   gene            312610..313356
FT                   /locus_tag="Rleg2_0306"
FT   CDS_pept        312610..313356
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0306"
FT                   /product="transcriptional regulator, LuxR family"
FT                   /note="PFAM: regulatory protein LuxR; Bacterio-opsin
FT                   activator HTH domain protein; KEGG: rec:RHECIAT_CH0000724
FT                   probable transcriptional regulator protein, LuxR family"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53605"
FT                   /db_xref="GOA:B5ZQC4"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZQC4"
FT                   /protein_id="ACI53605.1"
FT                   /translation="MDMDVIQASKGERQMSNFASAVVPDLLPRDQLLQRLHGVANTGRL
FT                   QSGLRALTEYVGASHYLLARCDLLQESGLDFIVSSDWPFDLVRDIANDLVRGYARSTEL
FT                   EKCMQVFQPNFALMPDSADVPDGASRQYCSVTFNVGRSRLALMFLFGEGFILSPERLRD
FT                   VGLLAGYVASFLRCGGTRVDRDFELTDRELECLFWIAEGKTSDEIAMILGISRNTINNY
FT                   ITSVMRKTATKTRSEAIAFAVRNNLV"
FT   gene            313365..314111
FT                   /locus_tag="Rleg2_0307"
FT   CDS_pept        313365..314111
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0307"
FT                   /product="transcriptional regulator, LuxR family"
FT                   /note="PFAM: regulatory protein LuxR; KEGG:
FT                   rec:RHECIAT_CH0000725 probable transcriptional regulator
FT                   protein, LuxR family"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53606"
FT                   /db_xref="GOA:B5ZQC5"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZQC5"
FT                   /protein_id="ACI53606.1"
FT                   /translation="MAHPSARTMSSAEQSRMVRVNRISSRSDLFPRLIAMQKLADAHGF
FT                   AIFRVSGSGIPAKQRLVCELENWGSSNAGFGKAFTDAYGDALLEHIEKSLLPLSWAGGC
FT                   DRAAPGPADFAPFMTRLQDGIVPFSGLAFPVRLGAVGNGFIVFTGDEIDPSSDTIVELH
FT                   GRCCHIMMDLLSLDERRTAAAEALSEREIACLQLAGDGRISEEIADKLGLSVHTVNAYL
FT                   GSATIKLDSVNRIQAIAKAIRLGYIS"
FT   gene            complement(314159..314602)
FT                   /locus_tag="Rleg2_0308"
FT   CDS_pept        complement(314159..314602)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0308"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rec:RHECIAT_CH0000726 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53607"
FT                   /db_xref="InterPro:IPR017024"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZQC6"
FT                   /protein_id="ACI53607.1"
FT                   /translation="MKKCPHSTQREKILAVAISPVATELRLLDASDLISLLRFEYYGNL
FT                   SDLVASAAELFFHPGTVNFGLGGNYTLEWGGKPEVVLDLEIKPRGVTVYAQLTLAEDHA
FT                   GIEINHIAFQDPSADPDENTRFLEKSLRESRYSVSQAPRALAS"
FT   gene            complement(314608..315687)
FT                   /locus_tag="Rleg2_0309"
FT   CDS_pept        complement(314608..315687)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0309"
FT                   /product="flagellar biosynthetic protein FlhB"
FT                   /note="TIGRFAM: flagellar biosynthetic protein FlhB; PFAM:
FT                   type III secretion exporter; KEGG: ret:RHE_CH00650
FT                   flagellar biosynthesis protein FlhB"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53608"
FT                   /db_xref="GOA:B5ZQC7"
FT                   /db_xref="InterPro:IPR006135"
FT                   /db_xref="InterPro:IPR006136"
FT                   /db_xref="InterPro:IPR029025"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZQC7"
FT                   /protein_id="ACI53608.1"
FT                   /translation="MADDDKDSKTEAPTAKKQTDAAEKGNVPFSRELSIFATILATYIY
FT                   LVFFLPDSVGHMAETLRDIFDQPDQWKIETGPDVLSLFVKLGWAIAALLAPAFILFMVF
FT                   GIASSIFQNLPTPVLERIRPQASRISPVKGWERLFSLPGLIEFGKSLFKVVVVGVILFF
FT                   VLRSEYFSSIDAMFSDPQTILVRISTAMRKIIIVVLIATAIVAIVDVFWTRHHWFTELK
FT                   MTRHEIKEENKQAQGDPFVKGRQRSLMRDRARRRMISNVHRATLVIANPTHYAVALRYA
FT                   REENDAPVVLAKGQDLIALKIREIAEKNGIPVFEDPPLARSMFAQVSVDTVIPSVFYKA
FT                   VAELIHRVYAADAKNKRVR"
FT   gene            complement(315920..316960)
FT                   /locus_tag="Rleg2_0310"
FT   CDS_pept        complement(315920..316960)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0310"
FT                   /product="flagellar motor switch protein FliG"
FT                   /note="PFAM: flagellar motor switch protein FliG; KEGG:
FT                   rec:RHECIAT_CH0000728 flagellar motor switch protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53609"
FT                   /db_xref="GOA:B5ZQC8"
FT                   /db_xref="InterPro:IPR000090"
FT                   /db_xref="InterPro:IPR011002"
FT                   /db_xref="InterPro:IPR023087"
FT                   /db_xref="InterPro:IPR028263"
FT                   /db_xref="InterPro:IPR032779"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZQC8"
FT                   /protein_id="ACI53609.1"
FT                   /translation="MMDFDDFGGALAGKPLTQAEKAAAVLLAMGKGVAGRLLKYFTQAE
FT                   LQTIISSAQSLRAIPPDELLMLVSEFEDLFTEGAGLMDNAKAIEAILEEGLTPDEVDSL
FT                   LGRRTAFQAYETSIWDRLSEAEPTFIAQFLLREHPQTVAYILSMMPSNFGAKVLLQLPD
FT                   NRRADIMNRTVNMKTVSPKAAQIIENQVMTLLAEVEAERNAAGSTKVADLMNELDKPQV
FT                   DTLLTSLESISRESVNKVRPKIFLFEDLMYMPQRSRVLLLNDISTDVLTVSLRGSPPEI
FT                   RESVLSAISPRQRRMIESDLQSGMGGVNPREIAIARRAVAQEAIRLANSGQIELKEKEG
FT                   DASAAA"
FT   gene            complement(316989..317576)
FT                   /locus_tag="Rleg2_0311"
FT   CDS_pept        complement(316989..317576)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0311"
FT                   /product="flagellar motor switch protein FliN"
FT                   /note="TIGRFAM: flagellar motor switch protein FliN; PFAM:
FT                   surface presentation of antigens (SPOA) protein; KEGG:
FT                   rec:RHECIAT_CH0000729 flagellar motor switch protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53610"
FT                   /db_xref="GOA:B5ZQC9"
FT                   /db_xref="InterPro:IPR001172"
FT                   /db_xref="InterPro:IPR001543"
FT                   /db_xref="InterPro:IPR012826"
FT                   /db_xref="InterPro:IPR036429"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZQC9"
FT                   /protein_id="ACI53610.1"
FT                   /translation="MATKKTQQNRDLSLDMPGSEADLDQAIDDLRGVLKQDADGDLPQF
FT                   GDDLQNDAFAAGTDLAAFGGEISDSPFGGDDFGGDFGAGNAGAAAGMDFGSTPAFDASP
FT                   APLGSALNSNFELIMDIPIDVQIMLGTSRMQVSGLMNLNEGATIALDKKIGEPVEIMVN
FT                   GRRIARGEITVLDNDDTRFGVKLIEVLSTKKA"
FT   gene            complement(317642..318592)
FT                   /locus_tag="Rleg2_0312"
FT   CDS_pept        complement(317642..318592)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0312"
FT                   /product="surface presentation of antigens (SPOA) protein"
FT                   /note="PFAM: surface presentation of antigens (SPOA)
FT                   protein; KEGG: rec:RHECIAT_CH0000730 flagellar C-ring motor
FT                   switch protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53611"
FT                   /db_xref="InterPro:IPR001543"
FT                   /db_xref="InterPro:IPR028976"
FT                   /db_xref="InterPro:IPR036429"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZQD0"
FT                   /protein_id="ACI53611.1"
FT                   /translation="MTMSNASHDKPAMDPALLAKLTGGLGDKGRVAKICSSFGEIYSEF
FT                   FPDVIKSETGLEVTVNYLGCEIGYKNHLIDDLSSNVTLVDVTLRNWSQNITIACGNGFV
FT                   ITLMEHLLGATADTIEEPADRLLSIIEMDLAVMVFDKIAKVLRSAVNAPGGFEPSLSVP
FT                   HALEMRARPPEDRPDEFAAAINMSITLAGIVSEFSLMVPQTALLKTKVTPPKPKRQAGG
FT                   SSAEWTEQLGDQVRRSHVTLEAKIRLQDLTLRTISKLMVGDVIPFRDHGDVRVEVSANS
FT                   KELYVCEFGRSGENYMVRVKDTMNSDDELIRHLMN"
FT   gene            complement(318593..319465)
FT                   /locus_tag="Rleg2_0313"
FT   CDS_pept        complement(318593..319465)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0313"
FT                   /product="chemotaxis motility protein"
FT                   /note="KEGG: rec:RHECIAT_CH0000731 chemotaxis motility
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53612"
FT                   /db_xref="GOA:B5ZQD1"
FT                   /db_xref="InterPro:IPR000540"
FT                   /db_xref="InterPro:IPR002898"
FT                   /db_xref="InterPro:IPR022522"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZQD1"
FT                   /protein_id="ACI53612.1"
FT                   /translation="MNIIIGFIVTCGCVIGSFMAMGGHVDALFQPFEFVIIGGAGLGSF
FT                   IMANPMKVVKDSGKALGEAFKHAVPKERNYLDTLGVLYSLMRDLRTKSRNEIEAHIDNP
FT                   AESTIFQSAPTVLKNKELTAFICDYVRLIIIGNARSHEIEALMDEELNTIMHDKMKPYH
FT                   AIQIMGDSFPAIGIVAAVLGVIKAMAHINDSPEVLGHLIGSALVGTFLGILLSYCVCSP
FT                   LVSQIKIVRNKQHRLYVIVKQTLLAYMNGSVPQVALEYGRKTISAYERPSIDAVEQEMM
FT                   NPGGENKAA"
FT   sig_peptide     complement(319397..319465)
FT                   /locus_tag="Rleg2_0313"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.944) with cleavage site probability 0.850 at
FT                   residue 23"
FT   gene            319721..320455
FT                   /locus_tag="Rleg2_0314"
FT   CDS_pept        319721..320455
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0314"
FT                   /product="flagellar basal body rod protein"
FT                   /note="PFAM: flagellar basal body rod protein; protein of
FT                   unknown function DUF1078 domain protein; KEGG:
FT                   ret:RHE_CH00655 flagellar basal body rod protein FlgF"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53613"
FT                   /db_xref="GOA:B5ZQD2"
FT                   /db_xref="InterPro:IPR001444"
FT                   /db_xref="InterPro:IPR010930"
FT                   /db_xref="InterPro:IPR012836"
FT                   /db_xref="InterPro:IPR020013"
FT                   /db_xref="InterPro:IPR037925"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZQD2"
FT                   /protein_id="ACI53613.1"
FT                   /translation="MQSGLYVSLSSQMALEKRLNTIADNMANVNTTGFRATEVKFDEMV
FT                   AATKNKLNTKVAFVSQGNDYLNESNGELQHTGNMLDFAIKGDAWFSLDTPAGRVLTRDG
FT                   RFTLKDTGELVSIRGYPVLDAGGAPIQLNSKGGEPAVGTDGIIYQGDRQVGSLGLFEAD
FT                   ISKGYLRYENSGIMTTDQPRAVVDRFNVGVEQGYLENSNVNAMREITQLIEVNRAFESV
FT                   SSLMRDSEDSFKEAVQTLGGSR"
FT   gene            320551..321948
FT                   /locus_tag="Rleg2_0315"
FT   CDS_pept        320551..321948
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0315"
FT                   /product="flagellar protein export ATPase FliI"
FT                   /EC_number="7.1.2.2"
FT                   /note="KEGG: ret:RHE_CH00656 flagellum-specific ATP
FT                   synthase; TIGRFAM: ATPase, FliI/YscN family; flagellar
FT                   protein export ATPase FliI; PFAM: H+transporting two-sector
FT                   ATPase alpha/beta subunit central region; SMART: AAA
FT                   ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53614"
FT                   /db_xref="GOA:B5ZQD3"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005714"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR022426"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032463"
FT                   /db_xref="InterPro:IPR040627"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZQD3"
FT                   /protein_id="ACI53614.1"
FT                   /translation="MSTTLLSEDGLSPKLAHLAGLVERYASPEFSVAHGGRVQTIAAGH
FT                   YTVRGLSRHVRLGEFVAHKSATGIHLGEVVRVEPDLIYVCPIEPGEPIGIHDTVIRKGA
FT                   FRISPSDSWCGRTVNSLCEPIDGLGPIAEGLDRRSISNTAPPSMTRKRVEAGFKTGVRA
FT                   IDIFSPLCLGQRLGIFAGSGVGKSTLLSMLARADAFDKVVIALVGERGREVREFIEDTL
FT                   GSNMKKAIAVVATSDESPMLRKMAPLTAVTIAEHFRDKGENVLFIVDSVTRFAHAIREV
FT                   ATASGEPPIARGYPASVFTELPRLLERAGPGPEGAGTITAIISILVDGDNHNDPIADST
FT                   RGILDGHIVLQRSLAEEGRYPPIDPLASISRLARKAWTPDQEKLVSRLKVLIHRFEETR
FT                   DLRLIGGYRQGADPDLDMAVKQVPIIYDVLKQSPGDRDSPDAFADLAGALKAAAGVGNQ
FT                   GGAIQRR"
FT   gene            321951..322493
FT                   /locus_tag="Rleg2_0316"
FT   CDS_pept        321951..322493
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0316"
FT                   /product="conserved hypothetical conserved membrane
FT                   protein"
FT                   /note="KEGG: rec:RHECIAT_CH0000734 hypothetical conserved
FT                   membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53615"
FT                   /db_xref="GOA:B5ZQD4"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZQD4"
FT                   /protein_id="ACI53615.1"
FT                   /translation="MAEFDDERIASPKQRGKAARLDRFLTFAGLALAGASAFFPWYVFF
FT                   NEDKFGINIAASDNSRELPDWPARNVFSVSPLAMVNKNEPDKKEPPIDPLTTATVSDLG
FT                   KEREGRPILEDQPFPGKSSFRLLHVSNGRALIEDTSGMYVVRVGSILPDQSRLATIEQR
FT                   EGKWMIVTSKGETYQNN"
FT   gene            322660..323052
FT                   /locus_tag="Rleg2_0317"
FT   CDS_pept        322660..323052
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0317"
FT                   /product="flagellar basal-body rod protein"
FT                   /note="KEGG: rec:RHECIAT_CH0000735 flagellar basal-body rod
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53616"
FT                   /db_xref="GOA:B5ZQD5"
FT                   /db_xref="InterPro:IPR006300"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZQD5"
FT                   /protein_id="ACI53616.1"
FT                   /translation="MQPIQLFDLASRQAEWLTIRQQVVAGNIANANTPKFRAKDVTPFD
FT                   AVLDKSDITMARTNPAHLSGNDFSASGDIDVKDASLDQEIGVQESGNTVGLAEELSKSG
FT                   DIKRQYDLNTSLVSSFNRMMLMTVRK"
FT   gene            323058..323474
FT                   /locus_tag="Rleg2_0318"
FT   CDS_pept        323058..323474
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0318"
FT                   /product="flagellar basal-body rod protein FlgC"
FT                   /note="TIGRFAM: flagellar basal-body rod protein FlgC;
FT                   PFAM: flagellar basal body rod protein; protein of unknown
FT                   function DUF1078 domain protein; KEGG:
FT                   rec:RHECIAT_CH0000736 flagellar basal-body rod protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53617"
FT                   /db_xref="GOA:B5ZQD6"
FT                   /db_xref="InterPro:IPR001444"
FT                   /db_xref="InterPro:IPR006299"
FT                   /db_xref="InterPro:IPR010930"
FT                   /db_xref="InterPro:IPR019776"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZQD6"
FT                   /protein_id="ACI53617.1"
FT                   /translation="MDPLSAAMKIAGSGLEAQSTRLRIVSENIANARSTGDTPGADPYR
FT                   RKTITFGQQMDRASGVETVDVKKVGVDEGDFSTEFDPSNPAADQKGVVKLPNVNILVEM
FT                   ADMREANRSYDANLQTIKQTRDLISSTIDLLKSQ"
FT   gene            323477..323818
FT                   /locus_tag="Rleg2_0319"
FT   CDS_pept        323477..323818
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0319"
FT                   /product="flagellar hook-basal body complex protein FliE"
FT                   /note="PFAM: flagellar hook-basal body complex protein
FT                   FliE; KEGG: rec:RHECIAT_CH0000737 flagellar hook-basal body
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53618"
FT                   /db_xref="GOA:B5ZQD7"
FT                   /db_xref="InterPro:IPR001624"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5ZQD7"
FT                   /protein_id="ACI53618.1"
FT                   /translation="MISSVQNVSNLSMTRALGAVDTENSASSSAATMPGTAGAANNMSF
FT                   ASVMGNMASDAVSSLKGAESMSFAGIKGTATTREVVDSMLQAEQTLQTAIAIRDKVVSA
FT                   FLEVTKMQM"
FT   gene            323838..324626
FT                   /locus_tag="Rleg2_0320"
FT   CDS_pept        323838..324626
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0320"
FT                   /product="flagellar basal-body rod protein FlgG"
FT                   /note="TIGRFAM: flagellar basal-body rod protein FlgG;
FT                   PFAM: flagellar basal body rod protein; protein of unknown
FT                   function DUF1078 domain protein; KEGG:
FT                   rec:RHECIAT_CH0000738 flagellar basal-body rod protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53619"
FT                   /db_xref="GOA:B5ZQD8"
FT                   /db_xref="InterPro:IPR001444"
FT                   /db_xref="InterPro:IPR010930"
FT                   /db_xref="InterPro:IPR012834"
FT                   /db_xref="InterPro:IPR019776"
FT                   /db_xref="InterPro:IPR020013"
FT                   /db_xref="InterPro:IPR037925"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZQD8"
FT                   /protein_id="ACI53619.1"
FT                   /translation="MRALAIAATGMDAQQTNLEVIANNIANINTTGFKRARAEFSDLLY
FT                   QTERAKGVANRANQAVVPEGANIGLGVQTSAVRNLHLQGELTQTGNDLDVALIGKGFFQ
FT                   IQSTDGTTLYTRAGAFNKNDQGQLVTIDGYEVLPGITIPTGSTELTISRSGQVSAKLPG
FT                   AADATVLGQLTLADFVNEAGLQPLGDNLFQETAASGEAVVGNPDEEGFAYMKQGYLESS
FT                   NVDPVKEITELISAQRAYEMNSKVITTADEMASIVSKNLK"
FT   gene            324643..325125
FT                   /locus_tag="Rleg2_0321"
FT   CDS_pept        324643..325125
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0321"
FT                   /product="flagella basal body P-ring formation protein
FT                   FlgA"
FT                   /note="TIGRFAM: flagella basal body P-ring formation
FT                   protein FlgA; KEGG: rec:RHECIAT_CH0000739 flagellar
FT                   basal-body rod protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53620"
FT                   /db_xref="GOA:B5ZQD9"
FT                   /db_xref="InterPro:IPR017585"
FT                   /db_xref="InterPro:IPR039246"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZQD9"
FT                   /protein_id="ACI53620.1"
FT                   /translation="MMFCRAGHISGWVAAATIAVAGIFLPADVDAGMGYAVVPTTIIYP
FT                   GDTLSASQLQEVEVTNPNLSGDFAKTISQVEGLVSKRTLLPGRTISVSGLREPYTVTRG
FT                   SSIRLVFSLGAMTISAAGSPLEDGATGQLIRARNMDSGVIVSGTVLADGTVHVRAK"
FT   gene            325122..326243
FT                   /locus_tag="Rleg2_0322"
FT   CDS_pept        325122..326243
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0322"
FT                   /product="flagellar P-ring protein"
FT                   /note="PFAM: flagellar P-ring protein; KEGG:
FT                   rec:RHECIAT_CH0000740 flagellar basal body P-ring protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53621"
FT                   /db_xref="GOA:B5ZQE0"
FT                   /db_xref="InterPro:IPR001782"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5ZQE0"
FT                   /protein_id="ACI53621.1"
FT                   /translation="MKLFFRFLTLVAVLAMSLADVAPAWALTSRIKDIASLQAGRDNQL
FT                   IGYGLIVGLQGTGDGFRASPFTEQSMRAMLQNLGISTQGGQSNAKNTAAVMVTANLPPF
FT                   ASPGSRIDVTVSSLGDATSLRGGTLVMTSLSGADGQIYAVAQGAAIVTGFQAQGQAATV
FT                   TEGVTTAGRVPGGAIIERELPSRFKDSVNLVLQLRNPDFSTAIRIADIVNGYASARFGG
FT                   PVAEAKDSQEVVIQKPRTADLTRLMADIENLIVETDTPAKVVINERTGTIVIGSDVRVS
FT                   PVAVSYGTLTVQVTETPQIIQPEPFSQGRTAVQPQTDIAAEQTGGRVAIIDGPDLRTLV
FT                   AGLNNIGVKPDGIIAILQGIKSAGALQAELVLQ"
FT   sig_peptide     325122..325202
FT                   /locus_tag="Rleg2_0322"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.723 at
FT                   residue 27"
FT   gene            326240..326779
FT                   /locus_tag="Rleg2_0323"
FT   CDS_pept        326240..326779
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0323"
FT                   /product="putative exported flagella related protein"
FT                   /note="KEGG: rec:RHECIAT_CH0000741 putative exported
FT                   flagella related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53622"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZQE1"
FT                   /protein_id="ACI53622.1"
FT                   /translation="MIKIIKDMTVLQLLRRLALPAAGLVLLSIPGAFAQEHAPAGDITS
FT                   QDEVKQFCTNIADPARDQRYLLQKQELEKLRADIDARMAEMDKRKAEYQDWLKRRDDFL
FT                   KQAEAGLTEIYKKMKPDSAALQLQDMKIEVASAVIMRLGPRQSSLILNEMDPKKAAAIA
FT                   SVIASASDPNTSKDPS"
FT   sig_peptide     326240..326344
FT                   /locus_tag="Rleg2_0323"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.993 at
FT                   residue 35"
FT   gene            326776..327492
FT                   /locus_tag="Rleg2_0324"
FT   CDS_pept        326776..327492
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0324"
FT                   /product="flagellar L-ring protein"
FT                   /note="PFAM: flagellar L-ring protein; KEGG:
FT                   rec:RHECIAT_CH0000742 flagellar L-ring protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53623"
FT                   /db_xref="GOA:B5ZQE2"
FT                   /db_xref="InterPro:IPR000527"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZQE2"
FT                   /protein_id="ACI53623.1"
FT                   /translation="MNMRFPAAIAVLALLAGCQSPTAVSEIGRAPSMSPIGSGLAYGQT
FT                   PQMALYPKQPRAVAQGYSLWSDSQAALFKDARALNVGDILTVDIQINDKGSFDNETNRS
FT                   RKNSSGMNWDVNAQIFGWTPESKTDLTYGSDTSTDGKGKIERTDKLTLLVAAVVTGILE
FT                   NGNLVISGSQEVRLNQELRILNVAGIVRPQDVNAENQISYDKIAEARISYGGRGRLMEV
FT                   QQPPRGQQAVDLFSPL"
FT   sig_peptide     326776..326853
FT                   /locus_tag="Rleg2_0324"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.543 at
FT                   residue 26"
FT   gene            327505..328011
FT                   /locus_tag="Rleg2_0325"
FT   CDS_pept        327505..328011
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0325"
FT                   /product="flagellar basal body-associated protein FliL"
FT                   /note="PFAM: flagellar basal body-associated protein FliL;
FT                   KEGG: rec:RHECIAT_CH0000743 flagellar biosynthesis
FT                   transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53624"
FT                   /db_xref="GOA:B5ZQE3"
FT                   /db_xref="InterPro:IPR005503"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZQE3"
FT                   /protein_id="ACI53624.1"
FT                   /translation="MAEPDASAGQPKKKSGTLMMIIGIAVLTLLGAGGGWAVGTIVAPN
FT                   IKGAKEAEQAKDAEAKKKAEEGLAHISTEANNVVQLEPITSNLAYPSENWVRLEVALLF
FT                   NGPPDVKVSEDIHQDILAYIRTVSLQQIEGPRGFQYLKDDIQERVDLRSQGRVSKVMFR
FT                   TFVIE"
FT   gene            328008..328745
FT                   /locus_tag="Rleg2_0326"
FT   CDS_pept        328008..328745
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0326"
FT                   /product="flagellar biosynthetic protein FliP"
FT                   /EC_number="3.1.1.3"
FT                   /note="KEGG: ret:RHE_CH00667 flagellar biosynthesis protein
FT                   FliP; TIGRFAM: flagellar biosynthetic protein FliP; PFAM:
FT                   type III secretion system inner membrane P protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53625"
FT                   /db_xref="GOA:B5ZQE4"
FT                   /db_xref="InterPro:IPR005837"
FT                   /db_xref="InterPro:IPR005838"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZQE4"
FT                   /protein_id="ACI53625.1"
FT                   /translation="MIRLIVFLAAMMAVPELAVAQQLPTDLLNVPVDGSVAAWIIRTFG
FT                   LLTILSVAPGILIMVTSFPRFIIAFSILRSGMGLSSTPSNMILLSLSLFMTFYVMSPTF
FT                   DQAWQNGVQPLLANQINETEAVQRIAEPFRTFMAANTRDKDLALFVDLARERGQTIQTT
FT                   DPIDYRVLIPAFMISEIRRGFEIGFLVVLPFLVIDLIVATITMAMGMMMLPPTSISLPF
FT                   KILFFVLIDGWNLLVGSLVRSFN"
FT   sig_peptide     328008..328070
FT                   /locus_tag="Rleg2_0326"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.967 at
FT                   residue 21"
FT   gene            complement(328842..330815)
FT                   /locus_tag="Rleg2_0327"
FT   CDS_pept        complement(328842..330815)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0327"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rec:RHECIAT_CH0000745 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53626"
FT                   /db_xref="GOA:B5ZQE5"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR029489"
FT                   /db_xref="InterPro:IPR037919"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZQE5"
FT                   /protein_id="ACI53626.1"
FT                   /translation="MRASAIDSHARTFPLRSWVLNSKVSFSAASRDYQAGRYTQSLATL
FT                   NQLMDIQQGAKTYALLAKNLVQLGFKADAAKAYGLAGNCDGPNAYEYQKQAAKLHYEIG
FT                   NEDDALLIAMRNLAKAQDDAELAFIITAIYLKRQQRDIIRPFKTVLSQSSNPDHMRLAA
FT                   LQLSDDLNDATNQSLSRNLFKRFPGNLAFRFLHLVFAREFNEFEEARKHQGVIDAALAK
FT                   GDVEILRKDNPFYHLHWCGNEDFNRYATIGTTPLNPERVAFRRNQPHTWSDKIRIGYMS
FT                   SDFWDRHATMKLLQRILELHDKDRFEVTLFCHTGPEYLKHNVTDRSRWGRIVDVHGFSD
FT                   QAVLAVVREHNIDIMVDLKGHTSGSRATAFNLPLAPVHVGWLGFPGSTVNVDLDYVIGD
FT                   HSVLPEVAKPFYHEKFCRLPESYQPNDPMHRPKPRPVTREQLGLPEEAFIFASFNGNRK
FT                   ITPEVVNSWCRILKRAPNSVLWLMANSPRNQANLLKHFQTAGISSKRIIFCPRAPYEQH
FT                   IDRQQAADLGIDTFPVNGHTTTSEQLWGGLPVLTVKGTNFASRVSESLLRAIDLPELVA
FT                   GDLQAYEDMAVELAQNPGRIAEYKAHLKEKRYIAPLFDAERFCNHLEQAYEIMAERGKQ
FT                   RLAPEHMDIAALPPRTAPFGAE"
FT   gene            331191..332096
FT                   /locus_tag="Rleg2_0328"
FT   CDS_pept        331191..332096
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0328"
FT                   /product="flagellin domain protein"
FT                   /note="PFAM: flagellin domain protein; KEGG:
FT                   rec:RHECIAT_CH0000747 flagellin C protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53627"
FT                   /db_xref="GOA:B5ZQE6"
FT                   /db_xref="InterPro:IPR001029"
FT                   /db_xref="InterPro:IPR001492"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZQE6"
FT                   /protein_id="ACI53627.1"
FT                   /translation="MTSINTNTSAQAALQTLRSVNQGLNQTQNHVSSGYRVEKASDNAA
FT                   YWSIATTMRSDNKALSAVSDALGVGAAKVDTAYTAMDSAIDVVGDIKAKLVAATENGVD
FT                   KAKVQEEIGQLQEQLKSIAQSASFNGENWVAGADGTKSVVSSFVRDGSNAVSVTTTDYV
FT                   LDDGSAGNVLFGMSNGTVETSSGILGTSNGATGSIYSMDITNFTAGQIQTALTNVEAAL
FT                   KSMTSAGAALGSLSSRIDSQDSFVSALSDSIDSGVGRLVDANMEEESSKLSALQTQQQL
FT                   AIQSLSIANSSSQNILSLFR"
FT   gene            332378..333286
FT                   /locus_tag="Rleg2_0329"
FT   CDS_pept        332378..333286
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0329"
FT                   /product="flagellin domain protein"
FT                   /note="PFAM: flagellin domain protein; KEGG:
FT                   ret:RHE_CH00670 flagellin C protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53628"
FT                   /db_xref="GOA:B5ZQE7"
FT                   /db_xref="InterPro:IPR001029"
FT                   /db_xref="InterPro:IPR001492"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZQE7"
FT                   /protein_id="ACI53628.1"
FT                   /translation="MTSINTNNAAMAALQTLRGINQGLQTTQAHVSSGYRVGQASDNAA
FT                   YWSIATTMRSDNKALSAVSDALGLGAAKVDTAYSAMDSAIDVVGDIKAKLVAATENGVD
FT                   KAKVQEEISQLQQQLLSVAQSASFSGENWVAGADGTKNVVASFVRDGSNAVSVVMTDYV
FT                   LDDGSAGNVLFGMSNGAVETSSGILGTSNGATGSVYAMDITNFTLGEIQSALTNVEAAL
FT                   KSMTSAGAALGSISKRIELQENFVSALSDSIDSGVGRLVDADMEEESSKLSALQTQQQL
FT                   AVQSLSIANSSSQTILTLFRG"
FT   gene            333533..334444
FT                   /locus_tag="Rleg2_0330"
FT   CDS_pept        333533..334444
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0330"
FT                   /product="flagellin domain protein"
FT                   /note="PFAM: flagellin domain protein; KEGG:
FT                   ret:RHE_CH00671 flagellin C protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53629"
FT                   /db_xref="GOA:B5ZQE8"
FT                   /db_xref="InterPro:IPR001029"
FT                   /db_xref="InterPro:IPR001492"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZQE8"
FT                   /protein_id="ACI53629.1"
FT                   /translation="MTSILTNVAAMAALQTLRGINDGLEATQNRVSSGYRVEKASDNAA
FT                   YWSIATTMRSDNKALSAVSDALGLGAAKVDTAYSAMDSAIDIISEIKAKIVAATEKGVD
FT                   KTKVQEEIGQLQQQLLSIAQSASFSGENWVAGADGTKSVVSTFVRDGSGNVSVKTTDYI
FT                   LDSSSTGNVLFGMDSVGSIETSSGIIGTSYGTIGSIYSMDISSFGSVEISMALTSIEAG
FT                   LDAMTKAASQLGSISTRIELQENFVGALSDSIDSGVGRLVDANMEEESSKLTALQTQQQ
FT                   LAIQSLSIANSSAQNILTLFRS"
FT   gene            334744..335706
FT                   /locus_tag="Rleg2_0331"
FT   CDS_pept        334744..335706
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0331"
FT                   /product="flagellin domain protein"
FT                   /note="PFAM: flagellin domain protein; KEGG:
FT                   ret:RHE_CH00672 flagellin C protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53630"
FT                   /db_xref="GOA:B5ZQE9"
FT                   /db_xref="InterPro:IPR001029"
FT                   /db_xref="InterPro:IPR001492"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZQE9"
FT                   /protein_id="ACI53630.1"
FT                   /translation="MTVKITSAAAVNALAVLRSINKEASQTQQQVSSGYRIETAADDAS
FT                   YWSVATVMRSDSTNLGTIGDALGLGAAKVDATYTAMNSAIDLMGQIRAKLVAAREPGTD
FT                   KDKINAEIDEYKQQLQTIVESTSFAGENWLLNGNTTAPPTWSVISSFVRAPTGEYQART
FT                   IDFPSSQTILVDKNNASGGLFTKAVDANAINNSGATARNYYLLNANSTTPATGTEIAID
FT                   KNTTDAQLTDMLDVTDSLLSSLTTTAASIGVMKTRIDDQIDYTADLSDSIDKSVGALVD
FT                   TDMDEASIRQKAIETQKQMAVEAISILNTASSKILILLE"
FT   gene            335906..336535
FT                   /locus_tag="Rleg2_0332"
FT   CDS_pept        335906..336535
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0332"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rec:RHECIAT_CH0000751 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53631"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZQF0"
FT                   /protein_id="ACI53631.1"
FT                   /translation="MSITLSRYLKDFGEPEPSVPIIEMDDFGGDGFPEMPSEPVIDVEA
FT                   ERRDAYAQGHAAATADLTEKYEAEAQTLAEVHARELEELKLRYEVEAAAVIASRIRDIA
FT                   EEVAQLVSAGAAIAIAPVMTEALAARAAESLAVLLRDAILEGAAGAIVVRGPSRLFELL
FT                   ATELGEHAEAVRHVETDDIDLAVEIGESVIVTRMSAWAASLKKVLE"
FT   gene            336532..337875
FT                   /locus_tag="Rleg2_0333"
FT   CDS_pept        336532..337875
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0333"
FT                   /product="OmpA/MotB domain protein"
FT                   /note="PFAM: OmpA/MotB domain protein; KEGG:
FT                   rec:RHECIAT_CH0000752 chemotaxis motility protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53632"
FT                   /db_xref="GOA:B5ZQF1"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR025713"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZQF1"
FT                   /protein_id="ACI53632.1"
FT                   /translation="MSEGENHHHGKNEIIIVKRHGGGDHDGSHGGAWKIAYADFMTAMM
FT                   AFFLVMWLVNAANEETKASVATYFNPIKLSDEKPTEKGLKKPVDNAEGEEKQEKSKQKE
FT                   ENPNDGKASADGDDQTSTSGDQTNYSEADFFENPYSVLAEIAQEVGQQANVSAKGDGGA
FT                   QDSGPATGADGGEAYRDPFDPDFWTKQVEVTTAGKSAPPGKSDEQAAESATTEIAKVED
FT                   MKPIPLTTDQKAAQEAKGAAEATDGKAPDDKKSGDKKAEDKKAPAQKDAAQKDADHQKD
FT                   ADKSAAETEQQQQKEAEQLQAQIAQRIGGIAGKLAEGLTVTASEGGLLVSISDQSDDSM
FT                   FDIGSAVPRQEMVLAMEKIGAILKERGGAVAIRGHTDGRQYKGAQNENWRLSMDRAQSA
FT                   YYMLVRGGLDEKRISQVSGFADRRLKLPSDPFNATNRRIEILVQADRG"
FT   gene            337880..339175
FT                   /locus_tag="Rleg2_0334"
FT   CDS_pept        337880..339175
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0334"
FT                   /product="chemotaxis motility protein"
FT                   /note="KEGG: rec:RHECIAT_CH0000753 chemotaxis motility
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53633"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZQF2"
FT                   /protein_id="ACI53633.1"
FT                   /translation="MARRQHRYVGFVALGLAMLSPAAAKAQDPDDLAPYKMLRSLQFVQ
FT                   DSVVSGDHSAGEMQRFMLGTIDERLRSVDTSVFDDDRNVDAALIYAMSGGNPQTLEYLI
FT                   AHDVNGHFDNRVTDVLRKYLSGKGLLVAKTLEETAREYRDKKIGPYLALIGGNVLIATN
FT                   PTDALDLYDQARLAAPGTIVEEAALRRSVAICVDKGMLDRGMAYSQRYIRRFLHSPYAS
FT                   QFADLFVTLVVGHDHDVKPQDVIDILSFMDAPRQREVYLRIARAAAIAGKPQLAHMAVE
FT                   RVQSLGAGTDNAFGPLADFYGGMAGLPTEDIDQAAKNVSGIAGNTLSPRDQALQEAARS
FT                   VAEQILRAPDPASLTQASDPNTSDQEITSEKAAAIAPQPGAPGALPEPVPGGVASTGQS
FT                   QGTDPSFNAFVTTNRSKLDEIDGLLAQEGNEQ"
FT   sig_peptide     337880..337960
FT                   /locus_tag="Rleg2_0334"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.888 at
FT                   residue 27"
FT   gene            339172..340599
FT                   /locus_tag="Rleg2_0335"
FT   CDS_pept        339172..340599
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0335"
FT                   /product="chemotaxis motility protein"
FT                   /note="KEGG: rec:RHECIAT_CH0000754 chemotaxis motility
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53634"
FT                   /db_xref="InterPro:IPR021136"
FT                   /db_xref="InterPro:IPR038610"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZQF3"
FT                   /protein_id="ACI53634.1"
FT                   /translation="MMDMSVLGGAAGADPAAAAKSAGPMSKDDAAGQKNGFSDALAKAS
FT                   NDADDAQPEQGAVTDTGTEKVARTIRSRSGAKPLIDLGDAALKAQAEVQPETIANVVAA
FT                   KPVKAAVKMPADLPFGKLDAKDSSAEEVVQAAKGGKHAKADALETDTDKDSEDDDGGIS
FT                   DVLGLLKQDPADGAVALSAAAGVHHASAQADDVKPADKKIEGIDAKAGGYASDALAAVS
FT                   GNVDSGKADEVKVPGSENAEAADGRTFRISRADGRGVSMDVHLGTDQAGSQDGKKKADV
FT                   ENVSVLESRRYIGLMQNSNSAAVTAALSGDSEWARAMEPSSALSNAAEWTSTGKVVNTL
FT                   KIQMNPLDLGMVTATMRLSGDTLNVDLKVETGAAYRQMKEDHGKILEALRSQGYAVDNV
FT                   TISMAPVERSDAGSQAGSQGQASQQQSLAQQGQGGEARERHNQTAQRADGGFNGAGETG
FT                   IEDVSAGRSGGTGGVYL"
FT   gene            340547..341104
FT                   /locus_tag="Rleg2_0336"
FT   CDS_pept        340547..341104
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0336"
FT                   /product="Lytic transglycosylase catalytic"
FT                   /note="PFAM: Lytic transglycosylase catalytic; KEGG:
FT                   ret:RHE_CH00677 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53635"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZQF4"
FT                   /protein_id="ACI53635.1"
FT                   /translation="MKTFLLAAAAALAAFTSEAKASTGACEREIQSAAAKYGIPEGILY
FT                   SVGLTETGRKGSLYPYAMNVEGKAIFPPSEQDAMRQFDVARSSGAKLIDIGCMQINHYY
FT                   HGENFGSAEDMFDPHRNVEYAAKFLRNLHDRHETWTMAVARYHAGPNNDPAQKQYVCRV
FT                   IANLVATGYGKWTPNASNFCRN"
FT   sig_peptide     340547..340606
FT                   /locus_tag="Rleg2_0336"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.565 at
FT                   residue 20"
FT   gene            341385..342056
FT                   /locus_tag="Rleg2_0337"
FT   CDS_pept        341385..342056
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0337"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: transcriptional regulator domain protein;
FT                   KEGG: rec:RHECIAT_CH0000756 probable two-component response
FT                   regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53636"
FT                   /db_xref="GOA:B5ZQF5"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZQF5"
FT                   /protein_id="ACI53636.1"
FT                   /translation="MIVVVDERELVKDGYTSLFGREGIPSTGFDPAEFGEWVQTAADSD
FT                   IAAVEAFLIGQGQRSLELPRAIRDRSMAPVIAVSDQPSLENTLALFDCGVDDVVRKPVH
FT                   PREILARAAAIRRRLKAIANYTEIGGIRVFSDGRDPEINGEVFALPRRERRILEYLIAN
FT                   RGRRVTKTQIFNAIYGIFDEEVEENVVESHISKLRKKLRKKLGVDPVDSKRFLGYCIDW
FT                   A"
FT   gene            342182..343483
FT                   /locus_tag="Rleg2_0338"
FT   CDS_pept        342182..343483
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0338"
FT                   /product="protein of unknown function DUF1078 domain
FT                   protein"
FT                   /note="PFAM: flagellar basal body rod protein; protein of
FT                   unknown function DUF1078 domain protein; flagellar basal
FT                   body FlaE domain protein; KEGG: rec:RHECIAT_CH0000757
FT                   flagellar hook protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53637"
FT                   /db_xref="GOA:B5ZQF6"
FT                   /db_xref="InterPro:IPR001444"
FT                   /db_xref="InterPro:IPR010930"
FT                   /db_xref="InterPro:IPR011491"
FT                   /db_xref="InterPro:IPR019776"
FT                   /db_xref="InterPro:IPR020013"
FT                   /db_xref="InterPro:IPR037058"
FT                   /db_xref="InterPro:IPR037925"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZQF6"
FT                   /protein_id="ACI53637.1"
FT                   /translation="MSIFGSMKTAVSGMNAQANRLSTVADNIANVNTTGYKAVSTSFSS
FT                   LVLPSSGGNYNSGGVQSSVRQAVSDQGDISYTTSGTDLAISGDGFFIVQGADGTPVLTR
FT                   AGDFTKDDEGNLVNAAGFQLMGYSYDSGSPAVVVNGFDGLVPVNVSQDGLTAIASTSGV
FT                   FKGNLDSNAKIPVAPATAPSANLGTTTTDTKKVSMVAYDRLGNKVMYDFYFTKASVAAA
FT                   PPPAPPATAATWEVAMFRNANAAVGGTTSFPYTAGGAVGNGTLTFDSNGKMTSSGAVNI
FT                   TDGVTGQTIAMDFSGLTQLGADFSGTGTPNGQAATPVKDVTIDGDGIVYAKYEDGSTKP
FT                   LYRIPLANVASPDKLTLMSGNVYSANGQSGVTVTGFPQTNGLGTIKSGALEGSNVDLAG
FT                   ELTEMIESQRSYTANSKVFQTGSDIMDVLVNLKR"
FT   gene            343503..344990
FT                   /locus_tag="Rleg2_0339"
FT   CDS_pept        343503..344990
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0339"
FT                   /product="flagellar hook-associated protein FlgK"
FT                   /note="TIGRFAM: flagellar hook-associated protein FlgK;
FT                   PFAM: protein of unknown function DUF1078 domain protein;
FT                   KEGG: rec:RHECIAT_CH0000758 flagellar hook-associated
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53638"
FT                   /db_xref="GOA:B5ZQF7"
FT                   /db_xref="InterPro:IPR002371"
FT                   /db_xref="InterPro:IPR010930"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZQF7"
FT                   /protein_id="ACI53638.1"
FT                   /translation="MSLTSALNTAQNIFNNTGTQSSVVSNNISNAGNKDYVRRQAMLTT
FT                   SLNGAQVVKIDRAQEDALLRQYLKTSSQDSAQQALLGGLEDLKSIMGGNDYETSPSTYL
FT                   GVFQQKLQAFRTTPGSTVAAQGAITAAQDVANSLNNASQSVQDVRATADKQIATDVDKL
FT                   NTLLSDFEKANNAVKTATASGADASGALDEREKALKQISQIVGVNATTRDNNDMVLSTT
FT                   DGTILFETIPRKVTFKSQDVYNATITGNSVYIDGVALARGSGSTTTAQGSLQSLLQVRD
FT                   EIAPNFQKQLDEVARGLVSLFKEQNTAGPPAYVPGLFTWSGGTVDTGGTAIAGMASTIT
FT                   VSSRVITSQGGDPMRLRDGGINVNGVVLNPTGLSGYTTELDRLYTALGSDIDFDPAAGP
FT                   AVGFDATTGIDSNVSIMEYATNSLGWLEQYRSNATTAAENSSAALSRSDEAYSNETGVN
FT                   LDEELTLLLDIEQSYKAATKILNAVDEMLKSLLDIAS"
FT   gene            344994..346046
FT                   /locus_tag="Rleg2_0340"
FT   CDS_pept        344994..346046
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0340"
FT                   /product="flagellar hook-associated 3 family protein"
FT                   /note="PFAM: flagellar hook-associated 3 family protein;
FT                   KEGG: rec:RHECIAT_CH0000759 flagellar hook-assosiated
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53639"
FT                   /db_xref="GOA:B5ZQF8"
FT                   /db_xref="InterPro:IPR001029"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZQF8"
FT                   /protein_id="ACI53639.1"
FT                   /translation="MKSSFISSSAIQNAMRLTIRQGQNQMTKATMEATTGVYADIGVSL
FT                   GGNAARSVDFTRETDRIDSIKASNSLVAARMESSQLGLSKMKDVGDGLVSKLTALQGSH
FT                   DPGSVTVAIQSATSALSTMMDTANTMVNGEYLFSGINTDVQPLTDKTTATSAAIVTALN
FT                   SYAAGLAPPKAVSALTGAEMETFITGTVEPMFSQANWTNATTGWSQASSQNMTSRISNS
FT                   EVIESSTNANSEGMRYMALASVMTSALLGQNLSSDAMSTVSKQAITYTTKATSGLVTQA
FT                   SQLGLSQERVKKSNDALDAQSNIIKNKLVDLQGVDPYEASTLVKTLETQLETAYTIVSK
FT                   IQQLSLVNYL"
FT   gene            346083..346430
FT                   /locus_tag="Rleg2_0341"
FT   CDS_pept        346083..346430
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0341"
FT                   /product="flagellar FlaF family protein"
FT                   /note="PFAM: flagellar FlaF family protein; KEGG:
FT                   ret:RHE_CH00682 flagellar biosynthesis regulatory protein
FT                   FlaF"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53640"
FT                   /db_xref="GOA:B5ZQF9"
FT                   /db_xref="InterPro:IPR010845"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZQF9"
FT                   /protein_id="ACI53640.1"
FT                   /translation="MYQFSYAEVMQDSVADAKEREWQVLDRSIDLLSLAREKEKYGREA
FT                   IEALFYTRRVWISFIEDLKHPDNQLEIELRANLISIAIWILKECDRIRKRLSNNYQGII
FT                   DVTTIIRDGLK"
FT   gene            346427..346876
FT                   /locus_tag="Rleg2_0342"
FT   CDS_pept        346427..346876
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0342"
FT                   /product="flagellar FlbT family protein"
FT                   /note="PFAM: flagellar FlbT family protein; KEGG:
FT                   rec:RHECIAT_CH0000761 flagellin synthesis regulator
FT                   (repressor) protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53641"
FT                   /db_xref="GOA:B5ZQG0"
FT                   /db_xref="InterPro:IPR009967"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5ZQG0"
FT                   /protein_id="ACI53641.1"
FT                   /translation="MKSTLRISLKAGERIFINGAVLRVDRKVALEFLNDVTFLLENHVL
FT                   QPEGATTPLRQLYFIAQMILINPEGKDHSTAMFRKSITMLLSCFKNEEILAELKRIDAL
FT                   VSTGRAFDALKAIRGLYAIEDNILNNHEMPPTMVEQIRREIAPWR"
FT   gene            346867..347310
FT                   /locus_tag="Rleg2_0343"
FT   CDS_pept        346867..347310
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0343"
FT                   /product="flagellar hook capping protein"
FT                   /note="PFAM: flagellar hook capping protein; KEGG:
FT                   ret:RHE_CH00684 flagellar basal body rod modification
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53642"
FT                   /db_xref="InterPro:IPR005648"
FT                   /db_xref="InterPro:IPR037925"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZQG1"
FT                   /protein_id="ACI53642.1"
FT                   /translation="MAVDATSSVTSAGTTSTTNSAQQKATLNYDNFLQLLIAQMKNQDP
FT                   TDPVDASEQMSQLASFSQVEQTIQTNTKLDTLLSSSSLTQASSYVGKYMESADGTVKGT
FT                   IESVKVYSDGIIATTTNGGKILVQAGITVADKAPTTTSGSSDT"
FT   gene            347398..347664
FT                   /locus_tag="Rleg2_0344"
FT   CDS_pept        347398..347664
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0344"
FT                   /product="flagellar biosynthetic protein FliQ"
FT                   /note="TIGRFAM: flagellar biosynthetic protein FliQ; PFAM:
FT                   export protein FliQ family 3; KEGG: rec:RHECIAT_CH0000763
FT                   flagellar biosynthesis transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53643"
FT                   /db_xref="GOA:B5ZQG2"
FT                   /db_xref="InterPro:IPR002191"
FT                   /db_xref="InterPro:IPR006305"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZQG2"
FT                   /protein_id="ACI53643.1"
FT                   /translation="MNEADALDLFQAAIWTVLIAAGPAVIAAMVVGLIIALIQALTQVQ
FT                   EATLTFVPKIVAVLITVGVTAPFVGSQVSIFTNLVFSRIQSGF"
FT   gene            347753..349840
FT                   /locus_tag="Rleg2_0345"
FT   CDS_pept        347753..349840
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0345"
FT                   /product="flagellar biosynthesis protein FlhA"
FT                   /note="TIGRFAM: flagellar biosynthesis protein FlhA; PFAM:
FT                   type III secretion FHIPEP protein; KEGG:
FT                   rec:RHECIAT_CH0000764 flagellar biosynthesis transmembrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53644"
FT                   /db_xref="GOA:B5ZQG3"
FT                   /db_xref="InterPro:IPR001712"
FT                   /db_xref="InterPro:IPR006301"
FT                   /db_xref="InterPro:IPR042193"
FT                   /db_xref="InterPro:IPR042194"
FT                   /db_xref="InterPro:IPR042196"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZQG3"
FT                   /protein_id="ACI53644.1"
FT                   /translation="MAQPPALPLPKVAPSLRDVGFALGIIGIICILFLPIPPFLIDMGL
FT                   AFSIAFSVLILMVALWIQKPLDFSSFPTILLIATMTRLALNIATTRVILSHGNEGHDAA
FT                   GGVIAGFASLVMSGDFVIGLIVFLILITINFIVITKGATRIAEVGARFTLDAIPGKQMS
FT                   IDADLSAGIIDEREAQRRRRELEEESSFFGAMDGASKFVRGDAVAGLIITAINVFGGII
FT                   IGYFRHGMPIGEAADVFVKLSVGDGLVSQMPALIVSLAAGLLVSRGGTTGSTDQAVVNQ
FT                   LSGYPRALSVSAVLMFVLALMPGLPFVPFVILGSLLAFGAWFIPRQVEAENKLRREQEE
FT                   KKVVQSKELEKDSVKAVLRTSEIELALGKMVSTRLLGAHQELAFRVGKMRKKFATQYGF
FT                   VVPEIKVTDDIAIAEKSYQIRIHGTTVASNLLRVGEVLVVTGAGRRPSIPGDEIREPAF
FT                   GMPAVSILENFADDLKREGFQPIDNVSVVLTHMSEVIRNNLPQLLSYKDVKVLIDRLDP
FT                   EYKKLADEICSSHMSYSGLQAVLKLLLAERVSIRNLHLILEAVAELAPHVRKTEQIVEH
FT                   VRIRMAQQLCGDLADNGVLRVLRLGSKWDLAFHQALKRDAKGEVIEFDIDPRNLEEFSE
FT                   QATKVIREFMDRGLPFALVTSPETRSYVRMIIERLFATLPVLSHVELAKGIEIKILGSI
FT                   S"
FT   gene            349837..350589
FT                   /locus_tag="Rleg2_0346"
FT   CDS_pept        349837..350589
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0346"
FT                   /product="type III secretion system inner membrane R
FT                   protein"
FT                   /note="PFAM: type III secretion system inner membrane R
FT                   protein; KEGG: ret:RHE_CH00687 flagellar biosynthesis
FT                   protein FliR"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53645"
FT                   /db_xref="GOA:B5ZQG4"
FT                   /db_xref="InterPro:IPR002010"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZQG4"
FT                   /protein_id="ACI53645.1"
FT                   /translation="MITDPQGTVLALFLVFCRIGGCVLALPGFSSARVPEQLRVFIALA
FT                   LSIAVMPLLWDTVYPAVHTGSGTYIGLIVSESLIGVMYGMLARIYTLGMQFAATIIATM
FT                   VGYTQPGSADIIEDTPESSLSGFITFAGIMILFIMDFHHIVFRALIDSYTTMPFGGLMQ
FT                   MRATLISFSDTLEQTTYIMLRLSSPFLIYGLIFNVSIGFINKLAPQIPVYFISTPYLLM
FT                   GGLFLVYFSIAALVSQFGQSFGSIYIGR"
FT   gene            350594..351007
FT                   /locus_tag="Rleg2_0347"
FT   CDS_pept        350594..351007
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0347"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rec:RHECIAT_CH0000766 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53646"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZQG5"
FT                   /protein_id="ACI53646.1"
FT                   /translation="MIDKNRSQKLKRLLSVQRHIERMAENDLAETSRQRIEVNAAMDDV
FT                   ILALGSMDPVHHAFSQNYADRFGRLSIKDLQLTGMQEVHEMRLARERAKGDRFEEGMKE
FT                   ALEAERREADDNAVYDVIDQQFATPASSKLRNP"
FT   gene            351039..351602
FT                   /locus_tag="Rleg2_0348"
FT   CDS_pept        351039..351602
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0348"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ret:RHE_CH00689 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53647"
FT                   /db_xref="InterPro:IPR019301"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZQG6"
FT                   /protein_id="ACI53647.1"
FT                   /translation="MAISPPSDLVLDVVKAADPMEVQAAQEKLKANRAAFAATSLAENG
FT                   KGFSNTVDVLDHISQKSGLNNIQNRTKAEEVPESYRKFEAMVLQNFVKSMLPNESEDVY
FT                   GKGATGDIWKGMMAEQLGNTMAKGDGIGIAKQMYAEQLRRQEGKIVNASTDNDDRNTAL
FT                   SMIDDFQRKTFGTPTAEAKTDRTG"
FT   gene            351727..352092
FT                   /locus_tag="Rleg2_0349"
FT   CDS_pept        351727..352092
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0349"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ret:RHE_CH00690 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53648"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZQG7"
FT                   /protein_id="ACI53648.1"
FT                   /translation="MEIVSNEYRIKSVLGRLEMIIDNENTRIGSDPQFDLKVSNAHKSR
FT                   CLYELSMLFRDTDPAELAAAHLDQLHGLKKKLVLNARRVEAHLEAVRAVADLLKNAVQD
FT                   ADADGTYSQEQFAARGN"
FT   gene            352092..352631
FT                   /locus_tag="Rleg2_0350"
FT   CDS_pept        352092..352631
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0350"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ret:RHE_CH00691 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53649"
FT                   /db_xref="GOA:B5ZQG8"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZQG8"
FT                   /protein_id="ACI53649.1"
FT                   /translation="MIKLVLTGVWVCAITLASVYFSVYLATAPAPAATDSKQSALELVK
FT                   GETITVPIIGNGAITGYFLGRVSFMMNKEMLKGVTLPLAEMTTDELFSLLVGNKMVDIA
FT                   HIKSFDPKAFREEIKKGMNERLGGEYVADVMLEQLDYLSKEDVKESSAGAPKKVGTPVK
FT                   IVETAPPGDAPAPAAH"
FT   sig_peptide     352092..352175
FT                   /locus_tag="Rleg2_0350"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.938) with cleavage site probability 0.396 at
FT                   residue 28"
FT   gene            352919..353758
FT                   /locus_tag="Rleg2_0351"
FT   CDS_pept        352919..353758
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0351"
FT                   /product="glycosyl transferase, WecB/TagA/CpsF family"
FT                   /note="TIGRFAM: glycosyl transferase, WecB/TagA/CpsF
FT                   family; PFAM: glycosyl transferase WecB/TagA/CpsF; KEGG:
FT                   rec:RHECIAT_CH0000770 N-acetyl mannosamine transferase
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53650"
FT                   /db_xref="GOA:B5ZQG9"
FT                   /db_xref="InterPro:IPR004629"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZQG9"
FT                   /protein_id="ACI53650.1"
FT                   /translation="MNLIANFAVLASRRTIFDLPVCDLGWDDALVFINELASIPVGQTV
FT                   VCFVNAHNMLTALHDDEYYRIMSHNLVLPDGIGLNIASQIAHGSPFPANLNGTDFVPAF
FT                   LTFMEAPRRIGLIGGTRSVVEAAAENFRRHTPWHEFVVVSDGYFDKVDSTEVTEEIERQ
FT                   KLDILIVGMGTPLQEKWVHDHIRADHARLVLTVGALFDFVSGAVPRAPRTVRMMRLEWA
FT                   YRLLQEPTRLWRRYVIGIPVFLFHVLRYRFRRRERILSHPEEHSTALQPRSEHKKAS"
FT   gene            353905..355710
FT                   /locus_tag="Rleg2_0352"
FT   CDS_pept        353905..355710
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0352"
FT                   /product="putative succinoglycan biosynthesis transport
FT                   protein"
FT                   /note="KEGG: ret:RHE_CH00693 putative succinoglycan
FT                   biosynthesis transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53651"
FT                   /db_xref="GOA:B5ZQH0"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZQH0"
FT                   /protein_id="ACI53651.1"
FT                   /translation="MYDIRARSTFHDRPATRPAAAAPARAHDDRYGLPGGVPRSNRPDI
FT                   APPEAELLRAIGRALEEQRAKAARTAPLVDRIETILGNHLRAANDIGYPLPQEQPHGDE
FT                   PAAQADAPLISPEPLAALVKEPAEPRPVAPPRRVAGSALVMTVAAATMIGACLPVLMPA
FT                   SPALYRAEATLAVKTDAASRAAFTEAAAKGLMSARVVASTVAALKLDHDPEFAGQRANA
FT                   LGVALDLLSATGAAADPASRAEATLKHSVEILPDAAAGTILVRVTTGDSGKSTRIAARL
FT                   AEAVSPANGTGGNTESDAALRKAYDEAKAELAAFTAKSGEGNVKVAVDLRRQIDRLDAD
FT                   LKQADQTILEAKAQADRLKAAKLAGVLDGSLPSDMLSPALQDWRDKYAVAKTALAQLSA
FT                   ELGPRHPRLLQQQAETDGLKENMGKELARLAQAANAAAKLAVDARKGLNDRRNTLIAQS
FT                   RDTGVDLARLTELSEKAAAARSRLDDTASALAGTAGDGHITLMKPALATAVSAPDGLTG
FT                   RSLAGAAAGLAAGLAAAFLLRLRKPLAAAEEEMPPSQALSQPLSSPAPQPVPAELDEME
FT                   ALRSEISGLRDRLLVHGLDARQPLR"
FT   gene            355831..356730
FT                   /locus_tag="Rleg2_0353"
FT   CDS_pept        355831..356730
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0353"
FT                   /product="Methenyltetrahydrofolate cyclohydrolase"
FT                   /EC_number="3.5.4.9"
FT                   /note="PFAM: tetrahydrofolate dehydrogenase/cyclohydrolase;
FT                   KEGG: rec:RHECIAT_CH0000772 folD1"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53652"
FT                   /db_xref="GOA:B5ZQH1"
FT                   /db_xref="InterPro:IPR000672"
FT                   /db_xref="InterPro:IPR020630"
FT                   /db_xref="InterPro:IPR020631"
FT                   /db_xref="InterPro:IPR020867"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZQH1"
FT                   /protein_id="ACI53652.1"
FT                   /translation="MTTVIDGKNVAASVIQTVKSATAALEKSSGVTTGLAVVIVGDDPA
FT                   SHAYVGSKGRMAKECGFKSVQHTLPAETSQEELAALVATLNADPSIHGILVQLPLPKPL
FT                   DSEPIIQSILPEKDVDGLSIANAGKLAIGDLKTGLVSCTPAGAMVFVRRTHGEDLSGLN
FT                   AVVIGRSNLFGKPMAQLLLNANATVTIAHSRTKNLAEVCRNADILVAAVGRPEMVKADW
FT                   VKPGATVIDVGINRVPAPERGEGKTRLVGDVAFDEVFAVASTITPVPGGVGPMTIAMLM
FT                   ANTVIAAHRAAGQTPPQF"
FT   gene            complement(356858..357886)
FT                   /locus_tag="Rleg2_0354"
FT   CDS_pept        complement(356858..357886)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0354"
FT                   /product="transcriptional regulator, LacI family"
FT                   /EC_number="5.1.1.1"
FT                   /note="KEGG: ret:RHE_CH00695 transcriptional regulator
FT                   protein, LacI family; PFAM: periplasmic binding
FT                   protein/LacI transcriptional regulator; SMART: regulatory
FT                   protein LacI"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53653"
FT                   /db_xref="GOA:B5ZQH2"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZQH2"
FT                   /protein_id="ACI53653.1"
FT                   /translation="MNLKQLSELLGLSQTTVSRALNGYPEVNEATRERVLQAVKETGYR
FT                   PNKAAQRLATGKAGSIGLVMPTAPGHQSDVHFGEFLAGLGEEAVRHDFHFVIMPADPDD
FT                   EVAALRRLAISGNVDALFVAYMRGHDPRLPMLKSLSMPYVVHGRSFGSEPDYPFLDIDN
FT                   EGAFYDATRLLLQLGHTRFALMNGPMHLDFAIRRKNGVIAALAERGLALDEDCISHALM
FT                   TDEQGLLAMEHFLQLPERPTAILCASTVLALGAIRAVNQAGLRLGEDISLIAHDDVLPL
FT                   LKPENFSVPLTTTRSSLRAAGVRIAQRLIGTVKQAGPFPEQELWKTELIVRASTGPAPQ
FT                   QL"
FT   gene            358184..359545
FT                   /locus_tag="Rleg2_0355"
FT   CDS_pept        358184..359545
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0355"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   KEGG: ret:RHE_CH00696 alpha-glucoside ABC transporter,
FT                   substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53654"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZQH3"
FT                   /protein_id="ACI53654.1"
FT                   /translation="MKKSFLMGVAVAALFAGAASAADLKFAPGQDAKFNWKSYDEFKAA
FT                   HADLKGQPLTIFGPWRGEDEAFFMSVLAYFTEATGIDAKYSSSENYEQQIVIDTQAGSP
FT                   PNIAVLPQPGLFADLASKGFLTPLGDENSKWIKDNYGAGDSWVGYGTYKGKDGKEAFYA
FT                   FPYKADVKSLVWYVPENFEEAGYKIPSTMEELHALTDQIVKDGGVPWCIGLGSGGATGW
FT                   PATDWVEDIMLRTQPPEAYDKWTTNELKFTDPAVVAAIDEFGKFAKNEKYVDGGVAAVA
FT                   STDFRDSPKGLFAVPPKCYMHHQASFIPSFFPEGTKLGQDADFFYMPTFASHPELGKPV
FT                   LGAGTLVSITKDSKAARAFIDFLKTPIAHEVWMAQSSFLTPYKGVSTEAYANPQMKKEG
FT                   EILTSATTFRFDGSDLMPGKIGAGAFWTGMVDFVGGKSAEEAAGEIQSAWDGIK"
FT   sig_peptide     358184..358249
FT                   /locus_tag="Rleg2_0355"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 22"
FT   gene            359732..360745
FT                   /locus_tag="Rleg2_0356"
FT   CDS_pept        359732..360745
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0356"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: ret:RHE_CH00697
FT                   alpha-glucoside ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53655"
FT                   /db_xref="GOA:B5ZQH4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZQH4"
FT                   /protein_id="ACI53655.1"
FT                   /translation="MLLQIVSALGVVVVAVLACSAYFYFSNKILDLALPVKDGDIRAAS
FT                   RNLNRRALVRPWLFVGPALFLLVVYLVYPVVATFILSFYDRAGEQFVGVANYQWALGDR
FT                   EFRQSIFNNILWLAVVPAACTFFGLVIAVMTDRIWWGNIAKSIVFMPMAISFVGASVIW
FT                   KFIYEYRGGNDVQIGLLNAIVQTFGGTPEVWISVPFWNNFFLMVILIWIQTGFAMVILS
FT                   AALRGIPEETIEAAVIDGANGWQIFWRIMVPQVWGSIAVVWTTITILVLKVFDIVLTMT
FT                   NGQWQSMVLANLMFNWLFRGGGDSGRSAVIAIIIMLAVTPIMVWNVRRANRELKGH"
FT   sig_peptide     359732..359788
FT                   /locus_tag="Rleg2_0356"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.834) with cleavage site probability 0.534 at
FT                   residue 19"
FT   gene            360747..361910
FT                   /locus_tag="Rleg2_0357"
FT   CDS_pept        360747..361910
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0357"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: ret:RHE_CH00698
FT                   alpha-glucoside ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53656"
FT                   /db_xref="GOA:B5ZQH5"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZQH5"
FT                   /protein_id="ACI53656.1"
FT                   /translation="MTAVGSYFKIGPARLFVHAAVLLIVIVWLIPTLGIFVSALRDKDQ
FT                   IVVSGWWTAFVGSTQTVAVRLGTPDQQQQEGATYVITGNVLEGQTGRSVKAFGNRVQQP
FT                   AAFEAGQTADLGDGESLQINSDGSYRYMKNAAFSPDERPRRIYASVSAPPEFTLQNYKT
FT                   VLTGEGIGQSFINSLTVTIPATIIPILIAAFAAYALSWMEFPGRALLIALVVGLIVVPL
FT                   QMSLIPLLRLYNEIGNLLGQPSKTYPGIWLAHTAFGMPLAIYLLRAYIAGLPKEIIESA
FT                   RVDGATDFEIFTRIVLPLSFPALASFAIFQFLWVWNDLLVAMVFLGTDKDHLVLTGSLN
FT                   ALLGSRGGNWEILTASAFVTIIVPLLVFFGLQRYLVRGLLAGSVKGG"
FT   gene            361945..363597
FT                   /locus_tag="Rleg2_0358"
FT   CDS_pept        361945..363597
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0358"
FT                   /product="alpha amylase catalytic region"
FT                   /note="PFAM: alpha amylase catalytic region; SMART: alpha
FT                   amylase catalytic sub domain; KEGG: ret:RHE_CH00699
FT                   alpha-glucosidase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53657"
FT                   /db_xref="GOA:B5ZQH6"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZQH6"
FT                   /protein_id="ACI53657.1"
FT                   /translation="MNVASQSISTPDKDWWRGAVIYQIYPRSYQDSNGDGIGDLKGITA
FT                   RLPHVASLGVDAIWISPFFTSPMRDFGYDVSDYENVDSIFGTLVDFDTMIAEAHRLGIR
FT                   VMIDLVISHSSDQHPWFVQSRSSKTNAKADWYVWADAKPDGTPPNNWLSIFGGSAWAWD
FT                   PTRMQYYLHNFLTSQPDMNLHNPEVQDRLLDVVRFWLNRGVDGFRLDTINFYFHDPLLR
FT                   DNPALAPERRNASTAPAVNPYNFQEHVYDKNRPENLAFLKRFRAVLEEFPAIAAVGEVG
FT                   DSQRGLEIVGEYTSGNDKMHMCYAFEFLAPDPLTAERVEEVMQDFEAAAPDGWACWAFS
FT                   NHDVMRHVSRWGGLVADHDAFAKLYASLLLTLRGSVCLYQGEELALTEADLAYQDLQDP
FT                   YGIQFWPEFKGRDGCRTPMVWDSQVAQGGFSTVKPWLPVPVEHILRAVSVQQGDEASVL
FT                   EHYRRFIAFRKLHPAFAKGEIEFEEPQGDALVFTREYGNEKLLCIFNMSPAETGVTLPG
FT                   GEWQALTGHGFISNNYGDKIDIPAWGAYFARLA"
FT   gene            363619..364707
FT                   /locus_tag="Rleg2_0359"
FT   CDS_pept        363619..364707
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0359"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; TOBE domain protein;
FT                   Transport-associated OB domain protein; SMART: AAA ATPase;
FT                   KEGG: rec:RHECIAT_CH0000779 alpha-glucoside ABC
FT                   transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53658"
FT                   /db_xref="GOA:B5ZQH7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040582"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZQH7"
FT                   /protein_id="ACI53658.1"
FT                   /translation="MTGLTLKDIRKSYGSVDVLHGIDLDIKQGEFIVFVGPSGCGKSTL
FT                   LRMIAGLEAITGGEMYIDGHLVNDVPPSKRGIAMVFQSYALYPHMTVFDNMAFGMKIAG
FT                   ESKQEIDRRVKAAAESLQLTKYLDRLPKALSGGQRQRVAIGRAICRDPKVFLFDEPLSN
FT                   LDAALRVATRIEIARLNEQMADTTMIYVTHDQVEAMTLADRIVVLSAGNIEQVGAPLEL
FT                   YERPANLFVAKFIGSPAMNIIPATVAATGNQTTVTLTGGMSVTLDVATGASEKGKQASF
FT                   GVRPEDLRIADGADYLFEGEVSIVEALGEVTLLYIEGLVPGEPIVVKLPGIYDVKKGQK
FT                   MRFAADRQKLHLFDATGHSYRK"
FT   gene            364885..365238
FT                   /locus_tag="Rleg2_0360"
FT   CDS_pept        364885..365238
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0360"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rec:RHECIAT_CH0000780 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53659"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZQH8"
FT                   /protein_id="ACI53659.1"
FT                   /translation="MYDREQRFKMEDTMNAARIEYTEKGVMHAASRRCDIVRISMSSAT
FT                   LAILTQFNLPKQFYLDIPDARITKVGCILMKVNANNTIEVRFLRLLTQKELNKIFVYST
FT                   HPAHRDYVLDIRA"
FT   gene            complement(365317..367140)
FT                   /locus_tag="Rleg2_0361"
FT   CDS_pept        complement(365317..367140)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0361"
FT                   /product="6-phosphogluconate dehydratase"
FT                   /EC_number="4.2.1.12"
FT                   /note="KEGG: rec:RHECIAT_CH0000783 phosphogluconate
FT                   dehydratase protein; TIGRFAM: 6-phosphogluconate
FT                   dehydratase; PFAM: dihydroxy-acid and 6-phosphogluconate
FT                   dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53660"
FT                   /db_xref="GOA:B5ZQH9"
FT                   /db_xref="InterPro:IPR000581"
FT                   /db_xref="InterPro:IPR004786"
FT                   /db_xref="InterPro:IPR020558"
FT                   /db_xref="InterPro:IPR037237"
FT                   /db_xref="InterPro:IPR042096"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZQH9"
FT                   /protein_id="ACI53660.1"
FT                   /translation="MSAHARISAITDRIVERSKPTRERYLERLRAAASKGVQRSVLGCA
FT                   NLAHGFAVCSPADKDALAGDHIPNLGIITAYNDMLSAHQPFETYPAIIREAAAEAGGVA
FT                   QVAGGVPAMCDGVTQGQPGMELSLFSRDLIAMSAGVGLSHNMFDAALFLGVCDKIVPGL
FT                   VIAALSFGHLPSIFVPAGPMTTGLPNDEKSRVRQLFAEGKVGRAELLEAESKSYHGPGT
FT                   CTFYGTANSNQMLMEIMGFHLPGSSFINPGTPLREALTREAAKRALAITALGNEFTPAG
FT                   EMIDERSVVNGVVGLHATGGSTNHTLHLVAMARAAGIQLTWQDIAELSEVVPLLARVYP
FT                   NGLADVNHFQAAGGMGFLIKELLKHGLVHDDVRTVFGRGLQAYTVDARLGENGTVRREP
FT                   SPEKSVDPKVLSSIETPFQANGGLKMLRGNLGKAVIKISAVKPERHIIEAPAIIFHSQQ
FT                   ELQDAFKEGKLNRDFIAVVRFQGPKANGMPELHKLTPPLGVLQDRGFRVALLTDGRMSG
FT                   ASGKVPAAIHVTPEAVDGGPIARIREGDIIRLDAIKGTLELLVDAADMAEREPVTVDLS
FT                   DNEFGMGRELFAPFRRAVGASDQGASVLFHH"
FT   gene            complement(367218..367916)
FT                   /locus_tag="Rleg2_0362"
FT   CDS_pept        complement(367218..367916)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0362"
FT                   /product="6-phosphogluconolactonase"
FT                   /note="TIGRFAM: 6-phosphogluconolactonase; KEGG:
FT                   rec:RHECIAT_CH0000784 6-phosphogluconolactonase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53661"
FT                   /db_xref="GOA:B5ZQI0"
FT                   /db_xref="InterPro:IPR005900"
FT                   /db_xref="InterPro:IPR006148"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="InterPro:IPR039104"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZQI0"
FT                   /protein_id="ACI53661.1"
FT                   /translation="MASTLHSFASPADLAGSLAEKVADTLSAAISARGTASIAVSGGST
FT                   PKAFFQVLSTRDIAWDKVTITLVDERFVPADNARSNHMLVDANLLQNKAKSARFVPLYQ
FT                   PAASVEEAARLATEKSAEIGIPFDVVILGMGGDGHTASFFPGGSNLATALDASTPRGVI
FT                   TMEAEGAGEPRLTFTFSSLQDAALLVLHIEGEGKKDVLAKAEGSGDEADMPIRAILRRA
FT                   TSPVEIYWAP"
FT   gene            complement(367927..369402)
FT                   /locus_tag="Rleg2_0363"
FT   CDS_pept        complement(367927..369402)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0363"
FT                   /product="glucose-6-phosphate 1-dehydrogenase"
FT                   /EC_number="1.1.1.49"
FT                   /note="KEGG: ret:RHE_CH00704 glucose-6-phosphate
FT                   1-dehydrogenase; TIGRFAM: glucose-6-phosphate
FT                   1-dehydrogenase; PFAM: glucose-6-phosphate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53662"
FT                   /db_xref="GOA:B5ZQI1"
FT                   /db_xref="InterPro:IPR001282"
FT                   /db_xref="InterPro:IPR019796"
FT                   /db_xref="InterPro:IPR022674"
FT                   /db_xref="InterPro:IPR022675"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZQI1"
FT                   /protein_id="ACI53662.1"
FT                   /translation="MSSQIIPVEPFDYVVFGGSGDLAERKLLPALYHRQIEGQFSEPTR
FT                   VIGASRSPLSHEEYRKFAKDALNEHLKKGEYDEAEVEKFCARLYYVSVDARTDTGWDQL
FT                   KKLLDEGKERVRAFYLAVAPGIFGDISQKIHDHKLITKSTRIVVEKPIGRDLASALQLN
FT                   DTIGRAFKEEQIFRIDHYLGKETVQNLMALRFANALYEPLWNANYIDHVQITVAEAVGL
FT                   EGRAGYYDTAGALRDMVQNHILQLLCLTAMEVPSSMDSEAVRDEKLKVLRALKPLNASN
FT                   VEQATVRGQYRAGASGSGPVKGYLEELEGGVSNTETFVAIKAEINNWRWAGVPFYIRTG
FT                   KRLTGRMSEIVITFKPIPHAIFDQAAGRIVANQLIIRLQPDEGVKQSLMIKDPGPGGMR
FT                   LRNVSLDMSFAQAFNVRNPDAYERLLMDVIRSNQTLFMRRDEVEAAWKWVDPILKGWET
FT                   TGQQVQGYTAGTWGPSQAIALIERDGRTWHDDI"
FT   gene            complement(369537..370832)
FT                   /locus_tag="Rleg2_0364"
FT   CDS_pept        complement(369537..370832)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0364"
FT                   /product="FAD dependent oxidoreductase"
FT                   /note="PFAM: FAD dependent oxidoreductase; KEGG:
FT                   rec:RHECIAT_CH0000786 oxidoreductase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53663"
FT                   /db_xref="GOA:B5ZQI2"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZQI2"
FT                   /protein_id="ACI53663.1"
FT                   /translation="MASQETWQSPISPGLSWYQATAGERPSYAALDGSRTCDVAIIGGG
FT                   YTGLQAAYNLAKSGVSVVLIEACRFGDGASGRNGGQLGTGQRWWPEELEEKIGYQRSKA
FT                   LFDLAEAAKHHLLDFAREHQIEIDYVPGQLNVAHKASYERDYRQTAEIAAQRYGYPHIS
FT                   FMDERETQERLGSKRFYCGVRDVGTGHIHPLKLLIGLARVAANAGAAIFEMTKAKTIHQ
FT                   GGGKVTIETDRGTITASRALIACNGHIGNLEPVTASHVMPIRSFIGATAPLDRHPDVLP
FT                   GGEAVADSRFVVRYFRRFEGRLLFGGREAYTADNPRDISEHIRRQIVEIYPDLKDIEIT
FT                   HAWGGTVGITMPRQLFVREVMPGVTSIGGYSGHGVMLSNYCGKLYAETVLGKSGDLDLF
FT                   ASLDIPAFPGGARMRAPLLFLALSWFALRDKF"
FT   gene            complement(370842..372278)
FT                   /locus_tag="Rleg2_0365"
FT   CDS_pept        complement(370842..372278)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0365"
FT                   /product="Glutamate--putrescine ligase"
FT                   /EC_number="6.3.1.11"
FT                   /note="PFAM: glutamine synthetase catalytic region; KEGG:
FT                   ret:RHE_CH00706 glutamine synthetase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53664"
FT                   /db_xref="GOA:B5ZQI3"
FT                   /db_xref="InterPro:IPR008146"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR027303"
FT                   /db_xref="InterPro:IPR036651"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZQI3"
FT                   /protein_id="ACI53664.1"
FT                   /translation="MSPKKTTLKPARNVPASKKTPPDPGSLRGVANWKEAARWLRDRGI
FT                   EDIECITPDLAGVPRGKMMPSSKFTSNTSLALPSAIYRHTISGEYPEETESFRYEPRDS
FT                   DLKLMPDLSTLSVVPWETDPTAQVICDIVDSDGGEVPYTPRNVLKRIMSLYHDRGWKPI
FT                   VAPEIEFYLVAKNDDPDYPLHPPKGRSGRSILGGQGYSIAGINEFDELIDDIYHFSEKQ
FT                   GLEIDTLIHEEGPAQLEINLRHGNPIELADQVFLFKRTIREAALKHDIYATFMAKPMQA
FT                   QPGSAMHIHQSVVNIETGKNVFSNPDGSASKEFFHFIGGMQKFVPSAMAMLAPYVNSYR
FT                   RLQPDMSCPVNNAWGYDNRTTAFRVPVSDPQARRVENRLPSSDANPYLALAASLAAGLL
FT                   GIMKQIEPTAPTEDSANEGSIDLPRGLLEAVALLEDEPAFEEIFGKQFIGLYAGVKRGE
FT                   FETFMQVISPWEREFLLLNV"
FT   gene            372366..373586
FT                   /locus_tag="Rleg2_0366"
FT   CDS_pept        372366..373586
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0366"
FT                   /product="HI0933 family protein"
FT                   /note="PFAM: fumarate reductase/succinate dehydrogenase
FT                   flavoprotein domain protein; HI0933 family protein; FAD
FT                   dependent oxidoreductase; FAD-dependent pyridine
FT                   nucleotide-disulphide oxidoreductase; KEGG:
FT                   rec:RHECIAT_CH0000788 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53665"
FT                   /db_xref="InterPro:IPR004792"
FT                   /db_xref="InterPro:IPR023166"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZQI4"
FT                   /protein_id="ACI53665.1"
FT                   /translation="MEKEGAVLIGETSLQRKSDVIVIGAGAAGMMAAIRAGKRGRSIVV
FT                   LDHARAPGEKIRISGGGRCNFTNIHAGSKNFLSANPHFCKSALARFTPADFIAMVDRHG
FT                   IAWHEKTLGQLFCDDSAKDVIRMLLTEMRAAGAQLHLGTEITAVEKVEAGFRVSTGEDA
FT                   FEASSLIVATGGKSIPKMGATGFAYRLAEQFGLAVLETRPGLVPLTLDPGLLEAIAPLA
FT                   GISAPAEIRHGRTAFREALLFTHRGLSGPAILQISSYWREGDEIVVSIEPDIDIGVHLK
FT                   TVKQLNGRQSPQTALSDILPKRLAQFLVEREKIAGNMADLPDKVLLRLAAAAQNFAVKP
FT                   SGSEGYRTAEVTLGGIDTAALDSRSMEAKAVPGLYFIGECVDVTGWLGGYNFQWAWASG
FT                   FAAGEYA"
FT   gene            373835..373978
FT                   /locus_tag="Rleg2_0367"
FT   CDS_pept        373835..373978
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0367"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53666"
FT                   /db_xref="GOA:B5ZQI5"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZQI5"
FT                   /protein_id="ACI53666.1"
FT                   /translation="MTRNTRRARAIAIAEAKPNARMVALRYLMLAAGATAASLALLLSH
FT                   VL"
FT   sig_peptide     373835..373945
FT                   /locus_tag="Rleg2_0367"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.856) with cleavage site probability 0.662 at
FT                   residue 37"
FT   gene            374292..376823
FT                   /locus_tag="Rleg2_0368"
FT   CDS_pept        374292..376823
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0368"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="PFAM: histidine kinase HAMP region domain protein;
FT                   chemotaxis sensory transducer; KEGG: rec:RHECIAT_CH0000790
FT                   methyl-accepting chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53667"
FT                   /db_xref="GOA:B5ZQI6"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZQI6"
FT                   /protein_id="ACI53667.1"
FT                   /translation="MLIDKILSRFRIKTKVLIFVLPFVVTISAVGLTGLYASGLLQGRM
FT                   EISNSVLQSLSGFKDLYGSMDDFLRITSQQARDKLLADLKTQQGVLDATLNQVGEEAAG
FT                   RDSLAEASRRTKDISGVVDKLWGLHEQEQALHEQIDAAQKSLISTRFTVSYQAEELQTA
FT                   LQQDEGAATITLRTADRLLKGGDFLGTVASGYSKPQTPQEKIAYINEQMPAIIKSQRLI
FT                   AISVPTNQKNVIDALAATIDSIKAIAAMPAPTDENIAELGRLVSRFRQTSTYTQLTATQ
FT                   KMREATQRFADLEGRIGQTNSVLQDTRRLENSVYALQIVLSDFLANSSKDNLVRLQQQA
FT                   GTLGKDMQVLITSAKGMGFAEGISGAIQPALDAISGGGSKIVDTIAERVTAYAAARQEL
FT                   DQIWTKLTDFAELQKQTAGTERTQANSISVMTTGLGILLSILGGIALVLTLQRPISQIT
FT                   AAMRRIAEGALETNISGEQRHDEIGDMARALGIFKENAISKIRIEEQSDEERAAAEHER
FT                   QRNDADKREMDRQIEFAVNALAAGLERMSQGDISTTIETPFIGRLEQLRQDFNGSMMRL
FT                   QATMSQIRDNVELIQGNGNQMAQSAEDLSKRTEQQAASLEETAAAVDEITVTVRSSAER
FT                   AKDADQIVRQAKRSADDSAVVVNNAIDAMGRIEDASRQIEQIIGVIDEIAFQTNLLALN
FT                   AGIEAARAGEAGKGFAVVAMEVRELAQRSAAAAQEIKGLINKSTNEVSSGSQFVQETGT
FT                   VLAKISAQIVTISQHVEMIARASHDQSNALQSVNATVNQMDQMTQQNAAMVEETTAASR
FT                   ELADEADSLRRLIQQFKIDGEAAASPVYRAA"
FT   sig_peptide     374292..374405
FT                   /locus_tag="Rleg2_0368"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.945) with cleavage site probability 0.614 at
FT                   residue 38"
FT   gene            376979..378826
FT                   /locus_tag="Rleg2_0369"
FT   CDS_pept        376979..378826
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0369"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="PFAM: histidine kinase HAMP region domain protein;
FT                   chemotaxis sensory transducer; KEGG: ret:RHE_CH00709
FT                   methyl-accepting chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53668"
FT                   /db_xref="GOA:B5ZQI7"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR033462"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZQI7"
FT                   /protein_id="ACI53668.1"
FT                   /translation="MLRLFSTSIVRQIVAITLCLLAVSTAAIVGATYYNLSRYVMDGAV
FT                   SDARDATRAMAVLYGAADQAAKIELKDDGLSTVTEDAIPALADHSLVDRTAQSIAGVAT
FT                   IFQKQGGDYVRISTNVKKENGDRAVGTKLVAEHPAQPVLARGDAYYGQAELFGRKFMTG
FT                   YFPVKNASNANVGILFIGIPMEVYYQRMYKLQMLVLGVGAIVMLIVGVLAFYAIRLSVK
FT                   PLQALTASVHAISSGDLDGAIPCVEKKNEFGDIGRALALFRDSARARRDLETQAAEQRA
FT                   LSDAERARNDADKRSLDSQIDFAVNELAAGLGRLSQGDVSETIGTPFVGRLEQLRVDFN
FT                   ASLLRLQDTLSGIRDSASTIQRNSGAVSVSASELSKRTEAQAASLEETAAAVEEITVTV
FT                   RSSAERAREANSVVAATKKTADNSGAVVGDAVAAMERIEEASQRIEQIIEVIDDIAFQT
FT                   NLLALNAGIEAARAGEAGKGFAVVAQEVRELAQRSADAAREIKSLIETSSREVTVGSEL
FT                   VQKTGSVLAAISHEIIAISGHVETIATASRDQSAALQEVNGSVNAMDQMTQKNASMVAE
FT                   TTQASRLLAGEADTLMALIERFRIIAEPAAAHLGTRKVA"
FT   sig_peptide     376979..377068
FT                   /locus_tag="Rleg2_0369"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.995) with cleavage site probability 0.374 at
FT                   residue 30"
FT   gene            complement(378799..379032)
FT                   /locus_tag="Rleg2_0370"
FT   CDS_pept        complement(378799..379032)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0370"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rec:RHECIAT_CH0000792 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53669"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZQI8"
FT                   /protein_id="ACI53669.1"
FT                   /translation="MIDLITIAATQGYRHVCRPGRGKTDEDRFYAEFGDSGLVNFAAWL
FT                   TSLDLSLRRRRKAAVRSGSCGCAPQATFLVPR"
FT   gene            379122..379991
FT                   /locus_tag="Rleg2_0371"
FT   CDS_pept        379122..379991
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0371"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; KEGG:
FT                   rec:RHECIAT_CH0000793 probable transcriptional regulator
FT                   protein, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53670"
FT                   /db_xref="GOA:B5ZQI9"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZQI9"
FT                   /protein_id="ACI53670.1"
FT                   /translation="MKNANWDSYQLFLQVARLGGLTGASTASGLSPATVGRRMLDLEQE
FT                   VGRALFSRSQTGYRLTQDGQALLDHLQEMEAAARKVEAWRQSGEGGTTVRIAAGTWVAW
FT                   LLTENFAAVRMPGDGFAISLTIGEARASLAYRESDIGIRAFEPEEANLAARRLGEVAYA
FT                   LYIRRNAAETDERWIAVAEEEAISAYLRWPHANAAAGIVATVNRPRSLPDLVRAGAGKA
FT                   VLPCFVGDLHPDLQRLGGELPELRHAQWIVMNAEDRHRPEIRTVADRMTKLIRSYADLF
FT                   AGKRPSRG"
FT   gene            complement(380041..380277)
FT                   /locus_tag="Rleg2_0372"
FT   CDS_pept        complement(380041..380277)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0372"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rec:RHECIAT_CH0000794 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53671"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZQJ0"
FT                   /protein_id="ACI53671.1"
FT                   /translation="MASISRVRERAEEQATSMSEDQQTTIRMLANDLHRLNQSVMKAVE
FT                   AGVSVELVRSARHHGGDGNWGDLLIPVVVTNRH"
FT   gene            complement(380300..381589)
FT                   /locus_tag="Rleg2_0373"
FT   CDS_pept        complement(380300..381589)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0373"
FT                   /product="isocitrate lyase"
FT                   /note="TIGRFAM: isocitrate lyase; PFAM: isocitrate lyase
FT                   and phosphorylmutase; KEGG: ret:RHE_CH00712 isocitrate
FT                   lyase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53672"
FT                   /db_xref="GOA:B5ZQJ1"
FT                   /db_xref="InterPro:IPR006254"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018523"
FT                   /db_xref="InterPro:IPR039556"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZQJ1"
FT                   /protein_id="ACI53672.1"
FT                   /translation="MTDFYKLVPNAPTGRFDGIDRPYSADDVRRLRGSVALTHTLAEMG
FT                   ADRLWRLLRQEDFVNALGALSGNQAMQMVRAGLKAIYLSGWQVAADANTASAMYPDQSL
FT                   YPANAGPELAKRINRTLQRADQIETSEGQGLSVDSWFAPIVADAEAGFGGPLNAFEIMK
FT                   AYIEAGAAGVHFEDQLASEKKCGHLGGKVLIPTAAHIRNLNAARLAADVMGVATLVIAR
FT                   TDAEAAKLLTSDIDERDQPFVDYDAGRTVEGFYQVRNGIEPCIARAVAYAPYCDLIWCE
FT                   TSKPDLDQARRFAEGVHRVHPGKLLAYNCSPSFNWKKNLDEATIAKFQRELGAMGYKFQ
FT                   FITLAGFHQLNYGMYELARGYRQRQMSAYSELQQAEFDAEVNGYTATKHQREVGTGYFD
FT                   AVSLAITGGRSSTTAMHDSTEHAQFKPAAE"
FT   gene            381782..383191
FT                   /locus_tag="Rleg2_0374"
FT   CDS_pept        381782..383191
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0374"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="PFAM: helix-turn-helix domain protein; protein of
FT                   unknown function DUF955; KEGG: rec:RHECIAT_CH0000796
FT                   probable transcriptional regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53673"
FT                   /db_xref="GOA:B5ZQJ2"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010359"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR018653"
FT                   /db_xref="InterPro:IPR026281"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZQJ2"
FT                   /protein_id="ACI53673.1"
FT                   /translation="MAERKIFAGPKLRRIRNALALTQTAMAEALEISPSYLNLIERNQR
FT                   PLTVQLLLKLATVYRVDLEELRGQTGGSLGQLKEVFADPLLLGELPGDQELVEVAEAAP
FT                   NAASGMIKLYRAYREQAARLSDLTALMAAEGHAPVAAGRLPLDEVRETLERRSAYFGRI
FT                   ETAAEALAATLPGGLDLAAGLKDWLRAERGIAVRVLPVHVMPDLRRRFDRHSMRLFISE
FT                   RLSQADRAHEIAVEAATLALLPAIDAELDDLQLSSAEARRIARFELARIAALALAMPYE
FT                   AFLSAAKTTRYDIDILRARFGVSFGHAAARLTMLQRLGAAAIPFFLIEIDAAGHRLRRA
FT                   GAQGFPQARFGGGCPKLNLHAAFLQPGQILAETVVMPDGASFLTVARTLEGPSVEFGER
FT                   LRRTAILIGCDAALGEALIYGQATALEPVAIGPACRLCERRGCLSRAEPPVTRPLGLDE
FT                   MVAGLSAFDFQ"
FT   gene            383318..384415
FT                   /locus_tag="Rleg2_0375"
FT   CDS_pept        383318..384415
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0375"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   KEGG: rec:RHECIAT_CH0000797 spermidine/putrescine ABC
FT                   transporter, substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53674"
FT                   /db_xref="GOA:B5ZQJ3"
FT                   /db_xref="InterPro:IPR001188"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZQJ3"
FT                   /protein_id="ACI53674.1"
FT                   /translation="MRSIIASVTAAAVAALLTAAPAFAQERVVNVYNWSDYIDDSILAD
FT                   FTKETGIKVVYDTFDSNETVETKLLAGGTGYDVVVPTADFLQRQIQAGVFQKLDKSKLP
FT                   NLSNMWDVIQQRTAEYDPGNEHAVDYMWGTDGIGYNVKKVAEILGPDAKPGLEVIFDPK
FT                   VAAKFKDCGIYILDTPKDVITTAFRYLGLDPNSTKAEDFKKAEELLTAARPYVRKFHSS
FT                   EYINALANGDICIAFGYSGDMLQARDRAAEAKNGVEVNYSVPPQGAQMWFDMMAIPADA
FT                   PHVAEAHEFLNYMMKPEVIAKASDHTFYANGNKASQQFVSKDILEDPAVYPTEAVMKNL
FT                   FTVKPWDPKTQRLGTRLWTKVVTGQ"
FT   sig_peptide     383318..383392
FT                   /locus_tag="Rleg2_0375"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 25"
FT   gene            384505..385647
FT                   /locus_tag="Rleg2_0376"
FT   CDS_pept        384505..385647
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0376"
FT                   /product="spermidine/putrescine ABC transporter ATPase
FT                   subunit"
FT                   /note="KEGG: rec:RHECIAT_CH0000798 spermidine/putrescine
FT                   ABC transporter, ATP-binding protein; TIGRFAM:
FT                   spermidine/putrescine ABC transporter ATPase subunit; PFAM:
FT                   ABC transporter related; Transport-associated OB domain
FT                   protein; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53675"
FT                   /db_xref="GOA:B5ZQJ4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005893"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZQJ4"
FT                   /protein_id="ACI53675.1"
FT                   /translation="MKSLGNIRRAFAPWTDPSAKPFIAFKNVTKRFGDFTAVDDLSLNI
FT                   YHREFFALLGASGCGKSTLLRMLAGFEQPTSGEIVLDGTDMAGTPPYKRPVNMMFQSYA
FT                   LFPHMTVEKNIAFGLKQDGMGKDEMTDRVAQMLKLVKLEQFASRKPNQLSGGQRQRVAL
FT                   ARSLAKRPKVLLLDEPLGALDKKLREETQFELMDLQQSLGLTFVVVTHDQEEAMTMADR
FT                   IAVMSHGKVVQVATPAEIYEAPNSRFVADFIGDVNIFDGKVASSGNGTVEISVDSGFSV
FT                   RVAASETPPAGSAVGFAIRPEKMRVLRQAPANASVNAARGELWDIAYLGDMTVFHVKLQ
FT                   SGKIVKASSLNAQRSVDDPFTYDQEVWISFDENAGVLLKD"
FT   gene            385652..386563
FT                   /locus_tag="Rleg2_0377"
FT   CDS_pept        385652..386563
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0377"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: rec:RHECIAT_CH0000799
FT                   spermidine/putrescine ABC transporter, permease component I
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53676"
FT                   /db_xref="GOA:B5ZR44"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZR44"
FT                   /protein_id="ACI53676.1"
FT                   /translation="MGKLTSGLYNRLVITIPYAWLLLFFLAPFFIVFRISLSTTAIAMP
FT                   PYEPVFSLADGWAGLWSKIGELSFDNYAYLTDDALYFNAYISSVVIAGISTFLTLLIAY
FT                   PIAYGMAQAPRTIRPTLVMLVILPFWTSFLIRVYSWIAILKPEGLLNQLLQSLHIIDSP
FT                   LIILNTTTAVYIGIVYSYLPFMVLPLYSALEKMDGTLIEAAQDLGCTPIRAFWRVTFPL
FT                   SIPGVVAGCMLVFIPAVGEFVIPDLLGGSQTLMIGKTLWNEFNANRDWPVSSAVATILL
FT                   MILVIPIVFFQNAQAKAEERGK"
FT   gene            386567..387385
FT                   /locus_tag="Rleg2_0378"
FT   CDS_pept        386567..387385
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0378"
FT                   /product="Ornithine carbamoyltransferase"
FT                   /EC_number="2.1.3.3"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: rec:RHECIAT_CH0000800
FT                   spermidine/putrescine ABC transporter, permease component
FT                   II protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53677"
FT                   /db_xref="GOA:B5ZR45"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZR45"
FT                   /protein_id="ACI53677.1"
FT                   /translation="MLKWTRFNIVSVTLGFAFLYLPIVLLVIFSFNESKLVTVWGGFST
FT                   KWYVSLLSNQGLLDAAWVTIRVGLLSATLATILGTMAALTLVRYTRFRGRMLFSGMIYA
FT                   PLVMPDVITGLSLLLLFVAIGFDRGFWTITLAHTTLTMCFVAVVVQSRLLSFDRSIEEA
FT                   AQDLGAPPVRTFFEITLPIIAPAVVSGWILAFTLSLDDLVIASFTSGPGATTLPMRIYS
FT                   QVRLGVTPEINAVCTILIGIVAVGVICASIVTKRREIQRQRDERAAAAGA"
FT   gene            complement(387388..389280)
FT                   /locus_tag="Rleg2_0379"
FT   CDS_pept        complement(387388..389280)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0379"
FT                   /product="AsmA family protein"
FT                   /note="PFAM: AsmA family protein; KEGG: ret:RHE_CH00718
FT                   hypothetical conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53678"
FT                   /db_xref="InterPro:IPR007844"
FT                   /db_xref="InterPro:IPR032712"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZR46"
FT                   /protein_id="ACI53678.1"
FT                   /translation="MSTSRHRRWRRKIGPVSRWLPAFARLSTVFLLIALALFVALRVAA
FT                   PYLITTGFVRSGIEDALSKWTGYHAEIKGSPVLEFWPTPRITLNQITIRQPRESGDKLL
FT                   GSIDSLSADFSLIDALRGRTSFHEFHLVRPNLALTRDENGLIDWSYAGLLARAISGVRT
FT                   ENGAEVLDPDLDAEIGAVTVEDGALAVTDIKTAKTYRFDSVTADIAWPRLSGAISAVVI
FT                   ARINGEDLKVDFASRQPLLVFAGRNAETRTSLTSNLLTAHFQGIANIASLLALSGNITA
FT                   SIPDMPALLTWSGKSIPGIATLKSASLESDIMSSGNGLRFNNLSLSLNEASATGVMDLL
FT                   TQPGKRPKIGGTLAFDQMNLKPFLDAFALRLAAGEAEEISAGINGPLRLLDVDVRLSAR
FT                   RAQMGLFELSDVGASMIVAGGEAKFDIGDSRFEGGEMTAHLEATQRDFDGGGKLQLSIR
FT                   DADFAALAERLQLKGPLPLATGSLDLDLQSPKAIWTTGLADVTGKLHFWTREGIIPGID
FT                   AAALRTEAAEKPFFPLSAAAGGAFAFNQLNVLADFANGSAEMHDAQIAGAAETLTLSGV
FT                   ITYQSNGLALSGSLEATDPAKAADLPLLPFFIGGSWPNPVISPVPLFGTTPHAQ"
FT   sig_peptide     complement(389146..389280)
FT                   /locus_tag="Rleg2_0379"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.988 at
FT                   residue 45"
FT   gene            389521..391473
FT                   /locus_tag="Rleg2_0380"
FT   CDS_pept        389521..391473
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0380"
FT                   /product="acetoacetyl-CoA synthase"
FT                   /note="TIGRFAM: acetoacetyl-CoA synthase; PFAM:
FT                   AMP-dependent synthetase and ligase; KEGG:
FT                   rec:RHECIAT_CH0000803 acetyl-CoA synthetase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53679"
FT                   /db_xref="GOA:B5ZR47"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR005914"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZR47"
FT                   /protein_id="ACI53679.1"
FT                   /translation="MQDNRPLWVPSAEAVARSPIHAFMARCNADFGLSLSGFEDLHAWS
FT                   VAERENFWSAVWDFCGVKGERGAEVLINGDRMLEARFFPNATLNFAENLLAGRGDGDAI
FT                   VFRGEDKAEDRWSWDRLRALVSKLQQAFKAQGIGEGDRIAAMMPNMPETVAAMLAAASI
FT                   GAIWSSCSPDFGEQGVLDRFGQIGPKLFIACDAYWYSGKLQDVGPKVAAVAKSLGVPTI
FT                   VVHYAGDAEAVARATPGASTLETFVAPYQAREVEFTPLAFAHPLYILFSSGTTGVPKCI
FT                   VHSAGGTLLQHLKEQRLHCGLKAGEKLFYFTTCGWMMWNWLVSGLASGATLCLFDGSPF
FT                   APDGNVLFDYAAAENFAIFGTSAKYIDAVRKSGLTPRTSHDLSSLRLMTSTGSPLSPEG
FT                   FTFVYEGIKADVQLASISGGTDIVSCFVLGNPLQPVWRGEIQGAGLGLAVDVWNDDGKP
FT                   VRGEKGELVCTKAFPSMPVMFWNDPDGAKYRAAYFDRFDNVWCHGDFAEWTEHGGLVIH
FT                   GRSDATLNPGGVRIGTAEIYNQVEQMEEVAEALCIGQEWDDDVRVILFVRLAPGVTLTE
FT                   DLIKAIKTRIRTGASPRHVPAKIIAVADIPRTKSGKIVELAVREVVHNRPVKNQEALAN
FT                   PEALRLFAGLEELKD"
FT   gene            complement(391728..395618)
FT                   /locus_tag="Rleg2_0381"
FT   CDS_pept        complement(391728..395618)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0381"
FT                   /product="PAS/PAC sensor signal transduction histidine
FT                   kinase"
FT                   /note="KEGG: rec:RHECIAT_CH0000804 probable two-component
FT                   sensor histidine kinase protein; TIGRFAM: PAS sensor
FT                   protein; PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase A domain protein; PAS fold domain protein;
FT                   SMART: PAS domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53680"
FT                   /db_xref="GOA:B5ZR48"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZR48"
FT                   /protein_id="ACI53680.1"
FT                   /translation="MPAVQYPFIDIAVHARVRERFSRGEAMVLFSADLARLLWANGAGA
FT                   ELFGHAAVYDLLDQGVDRTDITFRQLETAARQLADIGDHRSLMIRVAKGFQRVQVQAAA
FT                   ELIRLSTGEKAMLFSVPVSAKPLTSGASAAQMLQGLDDPDTHMAVIGADGDVIAASPGF
FT                   ASLGISAQTAKTLINLAGAHPDRLVKRPVATGRGNLPAAVGKLSDEPALNLLFAVETAI
FT                   GHLDPIDAAASDPIDTPALDLIDTPVQEESVPPAEDFRDESVDAAGFTEIIEAVSGIEE
FT                   VEETLEDITGENDQPAESTAATADEMADEAGLPEDAEPESDAGVIDSSADEAHEPAAII
FT                   EDDLASVTQTVETATTAEPPVETGETPVDAAPEAVHEEPVVAPPMVADASPAPELVAAP
FT                   GFIFRPNSRATRFVWKIDAEGRFNEVSHEFAEAVGPHASEIIGSAFGDVAALFNLDSDG
FT                   KLAEALARRDTWSGKTILWPVEGTSLVVPVDLAALPTYTRNRDFDGFRGFGVVRLSDAQ
FT                   EDPLALGLTLGPDGVGHDAASLGPVTETVAEAALEVPAAQEEAPSEPALTDEVEDKALA
FT                   ASEPQPETEPEEITAEQASGERAADEPPFQQSASETADDSAESGDISAVDPAAEMSNEP
FT                   PALRISETPNRRFSDKIVQLHNSGAALTAAEQANFREIAKRLEAFGASKDEPAGPGRSD
FT                   PAATETASFEEASGAEDLKAETPIADKAEAPSLEEIAPQEAIFENAADAQRDDDAREDD
FT                   ASVEATDDIDEDEATEGLEETVSQIEVLTSFIPPRVKMTDGLSLGTVDQLPVAVLIHVG
FT                   DALLHANPEFMRLTGYTSLDALREVGGIEALLQRRELEEKAAGSGTMMLVKADDSLVPV
FT                   TARLQSVRWEDANALMLALMPVEGKEEGRSDAGRSEGRTEARPERMVEKVAKLQVEVEE
FT                   LRSILETATDGVVVIGTEGDIRSMNRSASALFNYDEQETRGKPFVMLFAHESQKAVLDY
FT                   LHGLSGHGVASVLNDGREVIGREAAGGFVPLFMTMGQLTSSNGYCAVIRDITQWKRTED
FT                   ELRNAKGAAETANAHKTDFLARVSHEIRTPLNAIIGFSDMMAGERFGPIGHPRYIEYAN
FT                   DIGRSGRHVLDIVNDLLDISKIEAGEMDLDFAAVGLNEAVSEAVALVQPQANGQRVIIR
FT                   TALSHAVPEVVADLRSIKQIALNILSNAIRFTPSGGQIVVSTSYEANGSVVLRVRDTGI
FT                   GMTRSELDQAMKPFRQVSSTQSRHRGDGTGLGLPLTKAMVDANRAVFSINSAPNEGTLV
FT                   EITFPSQRVLAG"
FT   gene            395833..396282
FT                   /locus_tag="Rleg2_0382"
FT   CDS_pept        395833..396282
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0382"
FT                   /product="phasin"
FT                   /note="TIGRFAM: phasin; PFAM: Phasin 2 family protein;
FT                   KEGG: ret:RHE_CH00721 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53681"
FT                   /db_xref="InterPro:IPR010234"
FT                   /db_xref="InterPro:IPR018968"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZR49"
FT                   /protein_id="ACI53681.1"
FT                   /translation="MATIKTDDVFSIASFDPSKFAESFRDFAEKGAQQSKDAYAKLKTA
FT                   GEEAGKTLEATVQTAQAGSVELGLKAIDILRVNSENSLSHFEALLGVKSPAEFFELQTS
FT                   FIRKQAELTVEQAKSIQETTKQVAEKLAKPSKDAAEKAMASFKVA"
FT   gene            396413..396489
FT                   /locus_tag="Rleg2_R0006"
FT                   /note="tRNA-His1"
FT   tRNA            396413..396489
FT                   /locus_tag="Rleg2_R0006"
FT                   /product="tRNA-His"
FT   gene            396585..397022
FT                   /locus_tag="Rleg2_0383"
FT   CDS_pept        396585..397022
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0383"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ret:RHE_CH00727 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53682"
FT                   /db_xref="InterPro:IPR025232"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZR50"
FT                   /protein_id="ACI53682.1"
FT                   /translation="MSKTLLYGATKIDETNSAYAPVESLAASQWKNRVFVVFADKDNAR
FT                   AARQENQLLADRSALDQRDLVVLKISGAAVRPLFGAADGLDGEAIRRDLEAAEIGEFAA
FT                   FLVGKDGTVKLKVSEPITDGELFAIIDSMPMRAAEVLKPDK"
FT   gene            complement(397229..398110)
FT                   /locus_tag="Rleg2_0384"
FT   CDS_pept        complement(397229..398110)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0384"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: ret:RHE_CH00729 probable
FT                   transcriptional regulator protein, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53683"
FT                   /db_xref="GOA:B5ZR51"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZR51"
FT                   /protein_id="ACI53683.1"
FT                   /translation="MNWDDVRIFLAVARTGQILAASKRLGLNHATLSRRLTSLEEALKT
FT                   RLFIRRTNGCELTAEGEVFLASAERMETEMLAAQASLGHTDTAIAGTVRVGAPDGFGVS
FT                   FLAPRMGRLIERHPALKIQLVPVPRSFSLSQREADIAITLERPEQGRLVSSKLTDYTLG
FT                   LYASRDYLASRGTPSDIEALKAHPRIGYVEDLIFTASLNFSGEVMRSWDASFEISTAIG
FT                   QTEAVRSGAGICILHDYIARQYPELQRILPDISIRRAYWTTYHETARDLVRVRSVVDFL
FT                   QELIGAERQIFL"
FT   gene            complement(398107..398421)
FT                   /locus_tag="Rleg2_0385"
FT   CDS_pept        complement(398107..398421)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0385"
FT                   /product="Antibiotic biosynthesis monooxygenase"
FT                   /note="PFAM: Antibiotic biosynthesis monooxygenase; KEGG:
FT                   rec:RHECIAT_CH0000812 putative antibiotic biosynthesis
FT                   monooxygenase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53684"
FT                   /db_xref="GOA:B5ZR52"
FT                   /db_xref="InterPro:IPR007138"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZR52"
FT                   /protein_id="ACI53684.1"
FT                   /translation="MSRKPVVRMAELEIDPDMLDAYRALLTEEIEASVRLEAGVLSLSA
FT                   VSIRDDPNRIRILEVYADQDAYEAHLRTPHFLKYKVETAGMVTSLTLLDVDPIAMRAKP
FT                   "
FT   gene            398602..400098
FT                   /locus_tag="Rleg2_0386"
FT   CDS_pept        398602..400098
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0386"
FT                   /product="methylmalonate-semialdehyde dehydrogenase"
FT                   /note="TIGRFAM: methylmalonate-semialdehyde dehydrogenase;
FT                   PFAM: Aldehyde Dehydrogenase; KEGG: rec:RHECIAT_CH0000813
FT                   methylmalonate-semialdehyde dehydrogenase (acylating)
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53685"
FT                   /db_xref="GOA:B5ZR53"
FT                   /db_xref="InterPro:IPR010061"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZR53"
FT                   /protein_id="ACI53685.1"
FT                   /translation="MREIGHFIGGKQVAGTSGRVSNVYNPATGEVQATVALASVEELRA
FT                   AVENAKAAQPKWAATNPQRRARVFFKFVELLNKHMDELAEMLSKEHGKTIEDAKGDVIR
FT                   GLEVCEFVCGIPHLAKGEFTEGAGPAIDMYSIRQPVGIGAGITPFNFPGMIPMWMFAPA
FT                   IACGNAFILKPSERDPSLPIRLAELMIEAGLPAGILNVVNGDKGAVDAILTDPDIGAVS
FT                   FVGSTPIARYVYGTAAMNGKRAQCFGGAKNHMIIMPDADMDQAVNALMGAGYGSAGERC
FT                   MAISVAVPVGEDTANRLVEKLIPKIESLRIGPYTDDQADMGPLVTKDAYTRVRGLIDRG
FT                   VEEGAKLLVDGRDFKLQGYEDGYFVGGCLFDHVTPEMDIYKTEIFGPVLSVVRAQNYEE
FT                   ALSLPMKHEYGNGVAIYTRDGDAARDFASRINIGMIGINVPIPVPLAYHSFGGWKASSF
FT                   GDLNQHGTDSIKFWTKTKTVTARWPSGIKSGAEFVMPTMK"
FT   gene            400252..401334
FT                   /locus_tag="Rleg2_0387"
FT   CDS_pept        400252..401334
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0387"
FT                   /product="protein of unknown function DUF898 transmembrane"
FT                   /note="PFAM: protein of unknown function DUF898
FT                   transmembrane; KEGG: sme:SMc00782 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53686"
FT                   /db_xref="GOA:B5ZR54"
FT                   /db_xref="InterPro:IPR010295"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZR54"
FT                   /protein_id="ACI53686.1"
FT                   /translation="MDNRVSAGSAANAFERARFTGTASEYFGIWIVNVLLTIVTLGIYS
FT                   AWAKVRRNRYFYGNTVLLGRAFEYHATGKQILIGRLIVFAFVVVANILAAIHPLFSLVT
FT                   TILVLIALPWLIVRGIRFNARVTSYRNVRFDFTGTAGGAFVSVMLGGLVAFLSLGLLAP
FT                   LASRWLNRYVFNNLRYGNRPFDTDPKIGTLYRALLIPALMVVLGLVVLAGLVAIAVVGM
FT                   QANDPGAFEHDAAVLIIVSGMYLVVFGLIIVYGLAGLIYRAAVHNIVWSSTRIDGQHLL
FT                   RSDLSRARYAWIAISNVVVTMLTLGLMRPWAAVRLARYVAEHTAIRIEGEIGEVFTQFQ
FT                   TTGAAVGAEYMSMEGIDFGF"
FT   gene            401324..402373
FT                   /locus_tag="Rleg2_0388"
FT   CDS_pept        401324..402373
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0388"
FT                   /product="peptidase M48 Ste24p"
FT                   /note="PFAM: peptidase M48 Ste24p; KEGG: sme:SMc00783
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53687"
FT                   /db_xref="GOA:B5ZR55"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZR55"
FT                   /protein_id="ACI53687.1"
FT                   /translation="MVSDAETVAKGEWYPPHSSGSVPARLLSRGGRLLAVTDEDVALSD
FT                   SAAGELSFTPRVGSIPRRAVFADGSVFESSDNDAIDAFLRGGGRSGWVHRLEEFHPRIF
FT                   VFAVAVVLLAVGIYRYALPVLVEVAVLVTPPVVSEAMSYSALNTLDRTALSASQLDEAR
FT                   QAEIAARFRQVAANAEGGAGRYVLNFRDGGLIGPNAFALPDGNIVITDQLVELAGGDDE
FT                   MITGVLAHEIGHVEYKHSLRQLYRAAGVAGLVMLIAGDVGSGVEDILTQGGGLLALSYS
FT                   RGAEAEADRRSVELMRKAGMDPVAIARFFDVLEAKLGDHASTSMLSTHPGTPERKQAIL
FT                   EYDRILQQD"
FT   gene            402484..402966
FT                   /locus_tag="Rleg2_0389"
FT   CDS_pept        402484..402966
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0389"
FT                   /product="transcriptional regulator, BadM/Rrf2 family"
FT                   /note="TIGRFAM: transcriptional regulator, Rrf2 family;
FT                   PFAM: protein of unknown function UPF0074; KEGG:
FT                   rec:RHECIAT_CH0000814 rhizobial iron transcriptional
FT                   regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53688"
FT                   /db_xref="GOA:B5ZR56"
FT                   /db_xref="InterPro:IPR000944"
FT                   /db_xref="InterPro:IPR030489"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZR56"
FT                   /protein_id="ACI53688.1"
FT                   /translation="MRLTKQTNYAVRMLMYCAANDGHLSRIPEIARAYGVSELFLFKIL
FT                   QPLNKAGLVETVRGRNGGVRLGKPAADITLFDVVRVTEDSFAMAECFEDDGVVECPLVD
FT                   SCGLNSALRKALNAFFAVLSEYSIDDLVKARPQINFLLGITGEQPYRKPAIVAPAA"
FT   gene            403328..404923
FT                   /locus_tag="Rleg2_0390"
FT   CDS_pept        403328..404923
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0390"
FT                   /product="extracellular solute-binding protein family 5"
FT                   /note="PFAM: extracellular solute-binding protein family 5;
FT                   KEGG: rec:RHECIAT_CH0000815 dipeptide ABC transporter,
FT                   substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53689"
FT                   /db_xref="GOA:B5ZR57"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZR57"
FT                   /protein_id="ACI53689.1"
FT                   /translation="MKKISVMLAATALISVMATSAWSKTLVYCSEGSPEGFDPSLYTAG
FT                   TTFDASSRTVYSRLVEFKHGGTEIEPGLADSWSVSADGTEYTFKLHPGVKYQTTDFFTP
FT                   TRDFNADDVVFSFERQLKADNPWNKYVEGGSYEYAAGMGFPDLIKSIEKVDDLTVKFTL
FT                   NHPEAPFLADLAMDFASIVSKEYADKLAADGKMAQLNQQPLGTGPFTFVAYQPDAVIRY
FT                   KANETYFKGKEKIDDLVFAITSDAAVRAQKLKAGECHLIPYPNAADVPELKKDGNLTVM
FT                   EQAGLNVGFLAYNTQMAPFDKPEVRRALNMAINKQAIIDAVFQGAAAVAKNPIPPTMWS
FT                   YNDAVQDDKYDPDAAKKALADAGVKDLSMKVWAMPVSRPYMLNARRAAELIQADFAKAG
FT                   VKVEIVTHEWAEYLKLSSDVKRDGAVILGWTGDNGDPDNFMDTLLGCDAVGGNNRAQWC
FT                   NKEYDDLMTKAKLTADVGERTKAYEQAQLIFKKEAPWATLDHSLVFVPMSKKVSGFFMD
FT                   PLGIHRFDGVDVSE"
FT   sig_peptide     403328..403399
FT                   /locus_tag="Rleg2_0390"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.957 at
FT                   residue 24"
FT   gene            405011..406015
FT                   /locus_tag="Rleg2_0391"
FT   CDS_pept        405011..406015
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0391"
FT                   /product="Nickel-transporting ATPase"
FT                   /EC_number="7.2.2.11"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: rec:RHECIAT_CH0000816
FT                   dipeptide ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53690"
FT                   /db_xref="GOA:B5ZR58"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZR58"
FT                   /protein_id="ACI53690.1"
FT                   /translation="MLRFFIGRLAVLIPTFLGVSLIAFSFIRMLPGDPVMLLSGERVMA
FT                   PERHAQIMHDLGFDRPMYVQYFDYLGKVLHGDLGTSIVTKRPVLGEFLTLFPATLELSF
FT                   CAIILAVCIGVPAGIFAAVKRGTWFDQSVMGVALIGYSMPIFWWGLLLIIFFSGYLGWT
FT                   PVSGRISLMYFFKPVTGFMLIDSLLSGQKGAFASAVSYLILPTIVLATIPLAVIARQTR
FT                   SAMLEVLGEDYVRTARSKGLKPLRVVGVHALRNAMIPVITTIGLQIGVLLAGAILTETI
FT                   FSWPGIGKWMVDSVFKRDYAVVQGGLLLIAGVIMLVNLIVDVLYGFINPRIRH"
FT   sig_peptide     405011..405088
FT                   /locus_tag="Rleg2_0391"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.757) with cleavage site probability 0.482 at
FT                   residue 26"
FT   gene            406025..406915
FT                   /locus_tag="Rleg2_0392"
FT   CDS_pept        406025..406915
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0392"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: rec:RHECIAT_CH0000817
FT                   dipeptide ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53691"
FT                   /db_xref="GOA:B5ZR59"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR025966"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZR59"
FT                   /protein_id="ACI53691.1"
FT                   /translation="MSTVTVKTGQPSALAEFWHYFSRNKGAVIGLVVFVIILVVAVFAP
FT                   VFAPHTPNEQNRQVLLAVPAWMEGGSISFPLGTDAVGRDILSRLIYGARFSLFIGVVVV
FT                   TLSVVCGVLIGLVAGYFRGKVDTAIMRLMDIILAFPSLLLALVLVAVLGPGLTNAMIAI
FT                   SLVNQPHFVRLTRASVITEREKEYVIASRVAGAGTFRLMFKTILPNCLGPLIVQATLAF
FT                   SAAILDAAALGFLGMGAQPPTPEWGTMLAESREFISRAWWVVTFPGLAILITVLAINLM
FT                   GDGLRDALDPKLKRS"
FT   gene            406915..407931
FT                   /locus_tag="Rleg2_0393"
FT   CDS_pept        406915..407931
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0393"
FT                   /product="oligopeptide/dipeptide ABC transporter, ATPase
FT                   subunit"
FT                   /note="KEGG: ret:RHE_CH00739 dipeptide ABC transporter,
FT                   ATP-binding protein; TIGRFAM: oligopeptide/dipeptide ABC
FT                   transporter, ATPase subunit; PFAM: ABC transporter related;
FT                   Oligopeptide/dipeptide ABC transporter domain protein;
FT                   SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53692"
FT                   /db_xref="GOA:B5ZR60"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZR60"
FT                   /protein_id="ACI53692.1"
FT                   /translation="MPLLEIENLTVEFQTSSGLFRAVDRVSLACDKGEILSVVGESGSG
FT                   KSVAMLALMGLLPWTAKITADRMQFDGQDLRGISGRQRRRIVGKDMAMIFQEPMSSLNP
FT                   CFTVGFQLGETLRVHMGLNRKERRERSIELLNLVGIPAPEDRLSNFPHQMSGGMSQRVM
FT                   IAMALACNPKLLIADEPTTALDVTIQAQILDLLVRLQKEQGMALVLITHDMGVVAETAE
FT                   RVQVQYAGQKVEEQPVKALFRDPHHPYTAALLAALPERAQIGQRLPSIAGVVPGQHGRP
FT                   TGCLFAPRCGYATVECDRGVVRQGPELGLALCNYPLKDGKPLGHPGVMATETAGDLV"
FT   gene            407928..408881
FT                   /locus_tag="Rleg2_0394"
FT   CDS_pept        407928..408881
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0394"
FT                   /product="oligopeptide/dipeptide ABC transporter, ATPase
FT                   subunit"
FT                   /note="KEGG: ret:RHE_CH00740 dipeptide transporter
FT                   ATP-binding subunit; TIGRFAM: oligopeptide/dipeptide ABC
FT                   transporter, ATPase subunit; PFAM: ABC transporter related;
FT                   Oligopeptide/dipeptide ABC transporter domain protein;
FT                   SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53693"
FT                   /db_xref="GOA:B5ZR61"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZR61"
FT                   /protein_id="ACI53693.1"
FT                   /translation="MTGAVLEGRDLARFYTVNRGLFKADATVKALNGVSFSLHSGKTLA
FT                   VVGESGCGKSTLARLVTMIENPTAGELLIDGKPARVGDRSLRSQVQIVFQNPYGSLNPR
FT                   QKVGSILEEPLKINTDLNAAARRRKVEEMMARVGLRPEHHGRYPHMFSGGQRQRIAIAR
FT                   ALMLRPKVLVLDEPVSALDLSIQAQVLNLLMDLQKEMGLAYLFISHGLSVVHHIADEVM
FT                   VMYLGRPVETGPAAEVFARPRHPYTAALLSATPIADPEREKNRIRLQGELPSPLKPPSG
FT                   CHFNPRCWKAQDYCRQVSPELRGEGAQQYACHFPLD"
FT   gene            408965..409504
FT                   /locus_tag="Rleg2_0395"
FT   CDS_pept        408965..409504
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0395"
FT                   /product="carbohydrate kinase, thermoresistant glucokinase
FT                   family"
FT                   /EC_number="2.7.1.12"
FT                   /note="KEGG: rec:RHECIAT_CH0000820 gluconokinase protein;
FT                   TIGRFAM: carbohydrate kinase, thermoresistant glucokinase
FT                   family; PFAM: shikimate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53694"
FT                   /db_xref="GOA:B5ZR62"
FT                   /db_xref="InterPro:IPR006001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031322"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZR62"
FT                   /protein_id="ACI53694.1"
FT                   /translation="MPDLRTNKPHAIIVMGVSGCGKSSVGEKLAEALHLAFVEGDALHP
FT                   AANVEKMSKGIALTDEDRMPWLDRIGDDIKASLEKGEGIIVSCSALKRIYRDRLRAAAG
FT                   GNLFFVYLEGSKALLTQRMGERKGHFMPVSLLESQLATLEVPTGEQGVVTVDIDDTVQG
FT                   IAATALDGLATLGVTG"
FT   gene            complement(409494..410741)
FT                   /locus_tag="Rleg2_0396"
FT   CDS_pept        complement(409494..410741)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0396"
FT                   /product="FAD dependent oxidoreductase"
FT                   /note="PFAM: FAD dependent oxidoreductase; KEGG:
FT                   rec:RHECIAT_CH0000821 putative D-amino acid dehydrogenase
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53695"
FT                   /db_xref="GOA:B5ZR63"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZR63"
FT                   /protein_id="ACI53695.1"
FT                   /translation="MTKNAIVLGAGIVGVSTAIHLQRRGRQVTLIDRKDPGNETSFGNA
FT                   GLIQREGVAPYGFPQQLGLLLRYALNNRIDAHYHLRTLPSQLAFLARYWWNSNARRHAI
FT                   ITRAYAPLIENSITEHKDLIEASEAQALIRRDGWIKIFRTPARRDEALGEAALWRNEFG
FT                   VAYDSLTSADIARMEPDMTGDFAGGIRWRDPWSVLDPHALTSAYRGYFESLGGRFVTGD
FT                   AASLGQFGSGWKIMTGEGPLEADDAVIALGPWAALATRRLGYSLSLGVKRGYHMHYAAK
FT                   GNAVLNNWMLDAERGYLLAPMRRGIRLTTGAEFATVDAPKTPVQLDRAEAVARTIFPLG
FT                   DRLDPEPWMGARPCTPDMMPIIGKAPRHQGLWFAFGHAHHGLTLGPVTGRVLAELITGE
FT                   TPFIDIAAYAPQRFNP"
FT   gene            complement(410814..411317)
FT                   /locus_tag="Rleg2_0397"
FT   CDS_pept        complement(410814..411317)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0397"
FT                   /product="Isoprenylcysteine carboxyl methyltransferase"
FT                   /note="PFAM: Isoprenylcysteine carboxyl methyltransferase;
FT                   KEGG: rec:RHECIAT_CH0000822 putative isoprenylcysteine
FT                   carboxyl methyltransferase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53696"
FT                   /db_xref="GOA:B5ZR64"
FT                   /db_xref="InterPro:IPR007269"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZR64"
FT                   /protein_id="ACI53696.1"
FT                   /translation="MIWPSIALLAFVTLQRLGELVLARRNTAALLARGARELAPEHYPA
FT                   MVALHAGWIIGLWLLAPGRPVELFWFAVFIGLQVLRLWVLATLKDRWTTRIIILPGAPL
FT                   VTSGPYRFLRHPNYAIVVGEIAALPLAFGLPFFAIGFSLLNACVLYVRMKAENAALKSA
FT                   MILK"
FT   gene            complement(411314..412366)
FT                   /locus_tag="Rleg2_0398"
FT   CDS_pept        complement(411314..412366)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0398"
FT                   /product="3-Oxoacyl-(acyl-carrier-protein (ACP)) synthase
FT                   III domain protein"
FT                   /note="PFAM: chalcone and stilbene synthase domain protein;
FT                   FAE1/Type III polyketide synthase-like protein;
FT                   3-Oxoacyl-[acyl-carrier-protein (ACP)] synthase III domain
FT                   protein; KEGG: rec:RHECIAT_CH0000823 probable chalcone
FT                   synthase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53697"
FT                   /db_xref="GOA:B5ZR65"
FT                   /db_xref="InterPro:IPR001099"
FT                   /db_xref="InterPro:IPR011141"
FT                   /db_xref="InterPro:IPR012328"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZR65"
FT                   /protein_id="ACI53697.1"
FT                   /translation="MSDTVKLVSLAVAAPEHVIFQKEAVEASGRLFADRFEDFRHLARV
FT                   FDSAGIQKRHAARPLAWFDEPHGWQDRMQAYAEVAAELFVEAASSALSRAGLEAGDVDC
FT                   VVTVSSTGFTTPSLDAQMARRMGFRADIERVPVFGLGCAAGVSGFAIASRLARSRPGAV
FT                   VLFVSIELCTLAFRLDELTRPNIIATALFGDGAAACVLRSGEGGLAEVESTGDHLFPDT
FT                   LDIMGWKIDDGGFGIVLAQSLPPFAEKELGPAVTAILARNGLTPADIDRFICHPGGTKV
FT                   LAAMESALSLTPGTLDHERGVLADYGNMSSPTILFVLERAIRAGLPERSAMIAMGPGFS
FT                   ASCVTLRRVA"
FT   gene            412536..413072
FT                   /locus_tag="Rleg2_0399"
FT   CDS_pept        412536..413072
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0399"
FT                   /product="TPR repeat-containing protein"
FT                   /note="PFAM: TPR repeat-containing protein;
FT                   Tetratricopeptide TPR_2 repeat protein; SMART:
FT                   Tetratricopeptide domain protein; KEGG: ret:RHE_CH00745
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53698"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZR66"
FT                   /protein_id="ACI53698.1"
FT                   /translation="MTIMTVRIASLILGGCLAASVFSGPVYAAGNDSSTMPTCKKGEIY
FT                   DQKTKKCVKQQSANVSDENRTDYAYSLAKTGRYEEALAMLDTVKDQNTAEVLNYRGYAT
FT                   RKLGRTDEGISYYLKSVKMDPQYAKVREYLGEAYVIKGQLDLAKDQLSTIKAICGTSCE
FT                   EYQDLSAAIIDPSKI"
FT   sig_peptide     412536..412622
FT                   /locus_tag="Rleg2_0399"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 29"
FT   gene            413118..413723
FT                   /locus_tag="Rleg2_0400"
FT   CDS_pept        413118..413723
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0400"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /note="TIGRFAM: RNA polymerase sigma factor, sigma-70
FT                   family; PFAM: sigma-70 region 2 domain protein; sigma-70
FT                   region 4 domain protein; Sigma-70 region 4 type 2; KEGG:
FT                   ret:RHE_CH00746 RNA polymerase sigma factor protein
FT                   (sigma-24)"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53699"
FT                   /db_xref="GOA:B5ZR67"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZR67"
FT                   /protein_id="ACI53699.1"
FT                   /translation="MSVAPTSFPAYSRARMESPVRPAVSKNAGSAEAAIASEADIRSGL
FT                   TENLARLWRYGLVLSHQRDVADDLVQATCVRALERADQFIPGTRLDRWLFSILHSIWLN
FT                   EIRSRRVRQGQGFVDARETLTFDGAHATETQVMAGQVLKRVNALPEAQRTVVFLAYVEG
FT                   LSYREVASILDIPIGTVMSRLAAARARLSGDGLEGGRQ"
FT   gene            413720..414523
FT                   /locus_tag="Rleg2_0401"
FT   CDS_pept        413720..414523
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0401"
FT                   /product="putative transmembrane anti-sigma factor"
FT                   /note="KEGG: ret:RHE_CH00747 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53700"
FT                   /db_xref="GOA:B5ZR68"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZR68"
FT                   /protein_id="ACI53700.1"
FT                   /translation="MNTKQIIPSDEDLTAFIDGELTAEEAARIESLVNEDESVAERLEF
FT                   LARASLPFEPAFAPLLSQAPREKLQTMLAAIPVPESAKPGATPVFASRRRFLGALAASL
FT                   VAGVAIDRAVLSIGRGFSAKDENSEWRAVVADYISLYTPETLAGPVPERDVQAAQLAGL
FT                   DEKLGLSLSPESVSLPGIDFKRALLLQYDGKPLAQIAYLDPESGPMALCIVRSDAGRKA
FT                   PDLESRKGMNVVYWSNGTHAFMLIGHAEADRMTAIADEVWGRVAA"
FT   gene            complement(414564..415352)
FT                   /locus_tag="Rleg2_0402"
FT   CDS_pept        complement(414564..415352)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0402"
FT                   /product="glycosyl transferase family 2"
FT                   /note="PFAM: glycosyl transferase family 2; KEGG:
FT                   rec:RHECIAT_CH0000827 putative beta-glycosyltransferase
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53701"
FT                   /db_xref="GOA:B5ZR69"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZR69"
FT                   /protein_id="ACI53701.1"
FT                   /translation="MAANTADPRPPRISLITVCWNAERTIADTLRSIDTQTYRDFEHII
FT                   IDGGSSDSTLAIIASAPAENRRVVSGRDGGIYEAMNKGIGLASGDIIGFLNADDTFESS
FT                   GSLETVAAALDDEAYDGCYGDLIYVSNQHPDRTVRYWKSCAFEPGFFRRGWCPPHPTFY
FT                   VRRRIYDRFGTFDLRYRLAADVELMMRFLEVARIRTVYIPRVLVRMRLGGATNKNVQNI
FT                   SRQNKEVLRALADHGLRVSILMFWASKLVNRLGQFVKRNR"
FT   gene            415604..416515
FT                   /locus_tag="Rleg2_0403"
FT   CDS_pept        415604..416515
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0403"
FT                   /product="glucose-1-phosphate thymidylyltransferase"
FT                   /note="TIGRFAM: glucose-1-phosphate thymidylyltransferase;
FT                   PFAM: Nucleotidyl transferase; KEGG: rec:RHECIAT_CH0000828
FT                   putative glucose-1-phosphate thymidylyltransferase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53702"
FT                   /db_xref="GOA:B5ZR70"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR005907"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZR70"
FT                   /protein_id="ACI53702.1"
FT                   /translation="MSSKKKLRKGILLAGGSGTRLHPATLAISKQLLPVFDKPMIYYPL
FT                   STLMLAGIRDILIISTPQDTPRFEQLLGDGAQWGLNLQYAVQAAPDGIPQAFSIGREFI
FT                   GQEATALVLGDNIFYGNLLTHDLSAASARSDEATIFAYKVHDPERYGVVEFDGQGKVLT
FT                   LEEKPSRPRSSYAVTGLYFYDNEVIDIAAGLKPSPRGETEITDINRHYLSAGRLNVAVL
FT                   GRGHAWLDTGTHDSLLEASQFIATIERRQGLKIACPEEIAFHLEYIDAEQLLRLAAPLE
FT                   KSSYGRYLISLVREPAPHFPTG"
FT   sig_peptide     415604..415687
FT                   /locus_tag="Rleg2_0403"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.899) with cleavage site probability 0.598 at
FT                   residue 28"
FT   gene            416540..416914
FT                   /locus_tag="Rleg2_0404"
FT   CDS_pept        416540..416914
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0404"
FT                   /product="WxcM domain protein"
FT                   /note="PFAM: WxcM domain protein domain protein; KEGG:
FT                   rec:RHECIAT_CH0000829 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53703"
FT                   /db_xref="InterPro:IPR008894"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZR71"
FT                   /protein_id="ACI53703.1"
FT                   /translation="MSAFTLLTLKTMSDGRGALTVMDGILPFPVVRSFWIYGADGYTRG
FT                   GHRHHQTRQALVALSGSVMILMDDGKAREEITLSSPDQCLLVEPRDWHEMTFGPGSILL
FT                   VFASRGYDKDDYIDTPYERL"
FT   gene            416916..418022
FT                   /locus_tag="Rleg2_0405"
FT   CDS_pept        416916..418022
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0405"
FT                   /product="DegT/DnrJ/EryC1/StrS aminotransferase"
FT                   /note="PFAM: DegT/DnrJ/EryC1/StrS aminotransferase; KEGG:
FT                   rec:RHECIAT_CH0000830 putative aminotransferase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53704"
FT                   /db_xref="GOA:B5ZR72"
FT                   /db_xref="InterPro:IPR000653"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZR72"
FT                   /protein_id="ACI53704.1"
FT                   /translation="MIEYESLAQANRALMEELEAVASRVIRSGWYILGNEVSSFEAEFA
FT                   AFAESKHCISVANGLDALILSIEALDLPKGSEIMVASNTYIATILAILRAGHKPVLVEP
FT                   ERETFNIDPERLAAAVTRHTQAICVTHLFGKSCRMTEIAAFASEHGLKVIEDCAQSHGA
FT                   RYDGKLTGTFGIAGCFSFYPTKNLGALGDAGAIVTDDDEFADRLRHMRNYGSKKKYENV
FT                   YIGVNSRLDEMQAAFLRVKLRYLDQVTEHKRALADIYFANLPKWLAQPLRRPAEYDVFH
FT                   IFGIRHPARDELRQWLLDNGVKTEIHYPIAPHRQKAMQGILSGDYPIADELHATELSLP
FT                   ISAGHRKDEIERVCSLLAALPEKLKLAA"
FT   gene            418019..418897
FT                   /locus_tag="Rleg2_0406"
FT   CDS_pept        418019..418897
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0406"
FT                   /product="ABC-2 type transporter"
FT                   /note="PFAM: ABC-2 type transporter; KEGG:
FT                   rec:RHECIAT_CH0000831 putative polysaccharide ABC
FT                   transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53705"
FT                   /db_xref="GOA:B5ZR73"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZR73"
FT                   /protein_id="ACI53705.1"
FT                   /translation="MTEHLKGPASARADDDWDIVIKPSKGNTPDLGLVWQYRDLVWMFF
FT                   KRDFTTFYKQTILGPVWYIIQPSLTAMTYYVVFGKIANLSTDGLPPFLFYMSGTIIWSY
FT                   FAACLTNNSEVFSKNANLFGKVYFPRLVVPLSVAMSGLVAFAIQFLLLLTVSIGLKIAN
FT                   PDLALNYWFLLLTPLVLLYIAVLGIGAGLVVSALTVRFRDLVYAVGFMTQLWMYGTPIV
FT                   YPFSQIPERYHWFYYLNPMTTPVQTFRWALFDAPALPIGLCLANFAVTIAITLFGLALF
FT                   SRAEANAMDTV"
FT   gene            418897..420216
FT                   /locus_tag="Rleg2_0407"
FT   CDS_pept        418897..420216
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0407"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: rec:RHECIAT_CH0000832 putative polysaccharide ABC
FT                   transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53706"
FT                   /db_xref="GOA:B5ZR74"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029439"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZR74"
FT                   /protein_id="ACI53706.1"
FT                   /translation="MNDIVIRAEHVSKLYRLGVINHGTLYRDLQSWWAKWRNLPDPNVS
FT                   VSDHTSDRGAQSRLKGDIFHALDDVSFEVGQGEIVGIIGRNGAGKSTLLKVMSRITMPN
FT                   SGFIGIRGRIASLLEVGTGFHPELTGRENVYLNGAILGMSRAEVRSKFDEIVEFAEIGE
FT                   FIDTPVKRYSSGMYVRLAFAVAAHLEPEILLVDEVLAVGDVNFQNKCMGRMQEVTKAGR
FT                   TIIFVSHNMTAISSICPKSILMADGKVAAMGDTADVIKAYLDRPEFGGTASYSVNPEDV
FT                   EGKAVICRVAVLNEKDEASGTLELSKGFSVEVEYELREPLSGLSVGMQIMMEDGYTTLV
FT                   SLSDPELDVGRLDTRPAGYYRARVKFPGYLLNTGTFYLRLGISSRFSIYSVAEGIRFDV
FT                   EDNVGIIQMLGQQRKPSISAIQLPWEVEKLFLRDSEGVLK"
FT   gene            420213..421193
FT                   /locus_tag="Rleg2_0408"
FT   CDS_pept        420213..421193
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0408"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase;
FT                   short-chain dehydrogenase/reductase SDR; 3-beta
FT                   hydroxysteroid dehydrogenase/isomerase; polysaccharide
FT                   biosynthesis protein CapD; dTDP-4-dehydrorhamnose
FT                   reductase; Male sterility domain; KEGG:
FT                   rec:RHECIAT_CH0000833 putative nucleoside-diphosphate-sugar
FT                   epimerase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53707"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR026390"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZR75"
FT                   /protein_id="ACI53707.1"
FT                   /translation="MKKALVTGADGFIGSHLVETLVRSGVEVRALCQYNSFSSWGWLDQ
FT                   SEYRGKFEVILGDVRDPAQMRSVARDVDTIFHLAALIAIPYSYQAPSSYIDTNVHGTLN
FT                   VLQGALDAGVGRVIQTSTSEVYGTARFVPISESHPLQAQSPYSASKIGADAIAYSYHSS
FT                   FDLPVTIARPFNTYGPRQSARAVIPTVISQLLSGRRTLKLGALSPTRDFNFVQDTCDGF
FT                   LALAACDKAIGQTVNIGSGGEISIGDTVRLIADIIGVNIEIECDEQRLRPANSEVERLC
FT                   CDNSLIKSLTGFSPRYSLKDGLQATIEWLRQPENLARYKADIFNV"
FT   gene            421186..421899
FT                   /locus_tag="Rleg2_0409"
FT   CDS_pept        421186..421899
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0409"
FT                   /product="Nucleotidyl transferase"
FT                   /note="PFAM: Nucleotidyl transferase; KEGG:
FT                   rec:RHECIAT_CH0000834 putative nucleoside-diphosphate-sugar
FT                   pyrophosphorylase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53708"
FT                   /db_xref="GOA:B5ZR76"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZR76"
FT                   /protein_id="ACI53708.1"
FT                   /translation="MSRRAVILAGGMGTRLRPYTVVLPKPLMPIGDYPILEVIIRQLIS
FT                   GGFQHITLAVNHQAELIKAFFQDGDKWGVRIDYSLEDQPLGTMGPLRLIKDLPENFLVM
FT                   NGDILTDLNYADFHDTHVREGNIFTISSKTREHRIDYGVLDTNEAGLLTGFREKPTAEY
FT                   KVSMGVYMVSSGAVEHIPQRGAYGFDQLMLDLLAAGKPATVRDFPGYWLDIGRPDDYAL
FT                   AIEQFETMQSRFLNG"
FT   gene            421892..422737
FT                   /locus_tag="Rleg2_0410"
FT   CDS_pept        421892..422737
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0410"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase; 3-beta
FT                   hydroxysteroid dehydrogenase/isomerase;
FT                   dTDP-4-dehydrorhamnose reductase; Male sterility domain;
FT                   KEGG: rec:RHECIAT_CH0000835 putative epimerase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53709"
FT                   /db_xref="GOA:B5ZR77"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZR77"
FT                   /protein_id="ACI53709.1"
FT                   /translation="MVDAIVTGAGGFLGKRLIERLKQAGVDVLAVDRTHGDISEEAIWQ
FT                   ALPAAGTLFHLAGRTFVPDSWSQGPSFMAANVLGTQHALNWCKRHKARLVFASAYVYGV
FT                   PERLPIHESDPVRPNNPYALSKHLAEQLCEFAATHEQIPVVVLRLFNIYGAGQRPEFLI
FT                   PTLLNRIRAKQDIEVMDLSPRRDYVFVDDVLSAFAKAMDVSEGYHCINIGSGMSYSVQE
FT                   IIDILQQAAGTDLPVVSSCAVRRNEIPDVRADITRARAVLGWRPEWDLPAGIRVMMKES
FT                   "
FT   gene            422739..423809
FT                   /locus_tag="Rleg2_0411"
FT   CDS_pept        422739..423809
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0411"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: Radical SAM domain protein; KEGG:
FT                   rec:RHECIAT_CH0000836 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53710"
FT                   /db_xref="GOA:B5ZR78"
FT                   /db_xref="InterPro:IPR000385"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR023885"
FT                   /db_xref="InterPro:IPR034391"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZR78"
FT                   /protein_id="ACI53710.1"
FT                   /translation="MNERYVPINKGNYSMDTDEREAAFDKFRGEGWEAEYADYRRKWSE
FT                   YALNQQVSDYPLLVDLELASICNLRCPMCYTISDEFKKSVNTTRMDWDLYCRIIDEIGG
FT                   KVPAIRLSLRGEATLHKRFADCVRYAKDHGIKEVSTLTHGFKLNRDYFAELVDAGIDWI
FT                   TVSIDGTGETYEKIRKPIKFQALLDKIKDIKKYKDERGLHRPVIKVQGIWPAIRENPDL
FT                   YYDTFAPHVDLVAFNPLIDYLGNDSDIAYLDNFTCPQQYQRLVIGADGLVMKCSNDEEN
FT                   REVIGNANTETVHQIWHGEKMNAVRALHKEPQGFLKSEVCRRCYLPRETNDETAQICGR
FT                   QVTVRNYVDRNQEIGR"
FT   gene            423902..424918
FT                   /locus_tag="Rleg2_0412"
FT   CDS_pept        423902..424918
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0412"
FT                   /product="N-acylneuraminate-9-phosphate synthase"
FT                   /EC_number="2.5.1.57"
FT                   /note="PFAM: N-acetylneuraminic acid synthase domain; SAF
FT                   domain protein; KEGG: rec:RHECIAT_CH0000837 putative
FT                   N-acylneuraminate-9-phosphate synthase (sialic acid
FT                   synthase) protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53711"
FT                   /db_xref="GOA:B5ZR79"
FT                   /db_xref="InterPro:IPR006190"
FT                   /db_xref="InterPro:IPR013132"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR013974"
FT                   /db_xref="InterPro:IPR036732"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZR79"
FT                   /protein_id="ACI53711.1"
FT                   /translation="MFRNYRPDRCYIIAEIGGNFTTFDQAKRLIDEAKASGVDAVKLQT
FT                   YRAETLSSRNAMFDMENTGVTSQFELFRKYEIGHELHEAVFRYAEEQALDWFSSPSHET
FT                   DVDLLERCGVGAHKVGSDDAVNIPFLRYLARTGKPIILSTGMSTLEEVRESVAAIKDAG
FT                   NDKLILLHAITSYPTHPENVNLGAMQTMMEVFPDLDVGYSDHTLNPVASLCAVAMGARV
FT                   IERHFTYDKAADGPDHMLSADPAEMKWLVDAIRAFEIMKGSGRKEPAASEATTRLNNRK
FT                   SVVLNRPLKAGDVISAGDISVKRPGTGIEPKHLETLAGRRLLRDLEGDAVLQWSDLA"
FT   gene            424915..425592
FT                   /locus_tag="Rleg2_0413"
FT   CDS_pept        424915..425592
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0413"
FT                   /product="acylneuraminate cytidylyltransferase"
FT                   /note="PFAM: acylneuraminate cytidylyltransferase; KEGG:
FT                   rec:RHECIAT_CH0000838 putative acylneuraminate
FT                   cytidylyltransferase (spore coat polysaccharide
FT                   biosynthesis) protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53712"
FT                   /db_xref="GOA:B5ZR80"
FT                   /db_xref="InterPro:IPR003329"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZR80"
FT                   /protein_id="ACI53712.1"
FT                   /translation="MTLGIIIQARMGSTRLPGKVLRDISGKPLLAHVLGRLQMLKRPAK
FT                   IVVATSSAVENDIIETWCLEHGVSCFRGDEADVLDRYFECARSLGMSDIVRLTADNPFT
FT                   DIEELERLIDLHQEQGFDYTHAFGQLPIGVGAEIFTFEALSRSHREGKLPHHREHVNEY
FT                   FTDRPELFKIGQLDIPPTKISPNLRLTVDTEEDWKRACALAAQAGGNWLGTEEAISLCS
FT                   SSA"
FT   gene            425574..426542
FT                   /locus_tag="Rleg2_0414"
FT   CDS_pept        425574..426542
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0414"
FT                   /product="putative glycosyltransferase spore coat
FT                   polysaccharide biosynthesis protein"
FT                   /note="KEGG: rec:RHECIAT_CH0000839 putative
FT                   glycosyltransferase spore coat polysaccharide biosynthesis
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53713"
FT                   /db_xref="GOA:B5ZR81"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZR81"
FT                   /protein_id="ACI53713.1"
FT                   /translation="MFVFCIESSHARGMGHLFRSLTLATELRSRGHSVRFAANDHPNSL
FT                   RIIRERGFDVALYDLAAVTGWEEGLVDPTTVPSPIWINDRLDTRRPHSETIKRLGAKLV
FT                   TFDDRGDGAELADMNICALLFEKTEDLKGEDIRLGVEYMILNPEIERYRRVRQSLASIL
FT                   VTLGGADTYGVTVRVAKWLSSKPFPVTIVTGPSFQHMAELEEVVSTAEPDRFKLLNQVP
FT                   SLAAEMYGHDLAITGGGVTPFEACAAGLPCVVIANEPFEIPVGRALEGLGAAFFAGHHS
FT                   EFDLGILEKAIPIRSMSETAMTKVDLGGVGRIAALLERLAA"
FT   gene            426539..427240
FT                   /locus_tag="Rleg2_0415"
FT   CDS_pept        426539..427240
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0415"
FT                   /product="WbqC-like family protein"
FT                   /note="PFAM: WbqC-like family protein; KEGG:
FT                   rec:RHECIAT_CH0000840 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53714"
FT                   /db_xref="InterPro:IPR014985"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZR82"
FT                   /protein_id="ACI53714.1"
FT                   /translation="MTITAVIHQPDFASYLGFFQRFLNADLYIVLDHVQFVHGTSKSWT
FT                   HRDKIKTAQGDRWLTVGIKKPSLGTPINEVELAPGNGWIDQNLSLLRENYRKSGGWSEV
FT                   FPRIEALYGQRFELLADFNMHFLEGILEMLEITMPTVRSSTLSPKGHKNELLVELLRKV
FT                   GATRYLSGLGARDYMRPEVFEAAGIEIEWQHFVHPVYPQPFGEFMPYLSILDTLLNCGI
FT                   AGTRDLLWSCK"
FT   gene            427237..427869
FT                   /locus_tag="Rleg2_0416"
FT   CDS_pept        427237..427869
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0416"
FT                   /product="LmbE family protein"
FT                   /note="PFAM: LmbE family protein; KEGG:
FT                   rec:RHECIAT_CH0000841 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53715"
FT                   /db_xref="InterPro:IPR003737"
FT                   /db_xref="InterPro:IPR024078"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZR83"
FT                   /protein_id="ACI53715.1"
FT                   /translation="MNILAIGAHFDDVELGCGGALARHAANGDTVYVYVATVSGFSNQY
FT                   DQSVRSSQVARAEADAAMEILGVHKMFCGEFKTLQIEFVDPLNIEILKLVQDLKIDMVY
FT                   THWVGDIHHDHLALSRASLHSCRHVPRLLMYRSNWYHSTVDFRGNFYVDITSHWDQKEK
FT                   AILAHESEMERTGRKWVSFFRNEAENAGQRIGVKYAEVFEVVKWLQP"
FT   gene            427854..428720
FT                   /locus_tag="Rleg2_0417"
FT   CDS_pept        427854..428720
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0417"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rec:RHECIAT_CH0000842 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53716"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZR84"
FT                   /protein_id="ACI53716.1"
FT                   /translation="MAAALRKILTFGSMLLPYGVHELRRRLSSRHKISADVARSLAGNR
FT                   QLAGLHAGQRCFILGNGPSVKGLDLSRLQGQNVITVSNGYLHSDFDKFQSRYHCVPQIT
FT                   YGLMTSEDVIRWFEEMHSHLGAAELFLSSTEAELVRKHNLFAGRTVRYLVLGESFDDKR
FT                   SDEIVDISRPVPRVESVPVMALMISMHLGFKEIILLGVDHDHFLSSSYQYAFDLKVQKG
FT                   MDSTANADGTLRTNRHDDFQTLARLWRQYRAIANIAKANGIRIVNSTPGGALDEFDRRP
FT                   FEAWFEE"
FT   gene            428717..429631
FT                   /locus_tag="Rleg2_0418"
FT   CDS_pept        428717..429631
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0418"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rec:RHECIAT_CH0000843 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53717"
FT                   /db_xref="InterPro:IPR027612"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZR85"
FT                   /protein_id="ACI53717.1"
FT                   /translation="MRQINFSLPGIHCLLEVTRESPQAREQDILSEFRRHNVVFDGPHN
FT                   DWRSAMAAADGYDAPAILAKVVEATRAVVQGRAEYERDTVVFTEKSYSHPLLAWLLYVA
FT                   SRSDLHLRVVDFGGALGSSYFQHRSALAHLAELKWCVVEQPHFVSAGRTEFEDARLSFS
FT                   DSLDEAIERVKPNVVLLSGVLQYLEYPLEYLDNLLSKGVKFILIDRTAAQFDIAATPFV
FT                   QHVPAWIYSASYPVWFLNADEMQDGFARHGYEVLDRFQPAGTFGSVTPPPLQELKRWGI
FT                   GVTPAPQQHEWPYVGWFLEKLES"
FT   gene            429635..430513
FT                   /locus_tag="Rleg2_0419"
FT   CDS_pept        429635..430513
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0419"
FT                   /product="glycosyl transferase family 2"
FT                   /note="PFAM: glycosyl transferase family 2; KEGG:
FT                   rec:RHECIAT_CH0000844 putative fusion protein:
FT                   glycosyltransferase and acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53718"
FT                   /db_xref="GOA:B5ZR86"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZR86"
FT                   /protein_id="ACI53718.1"
FT                   /translation="MRVNVIIPVFNRLEHTRKVLEALRQQTVFDAMTIVIVNDGSTDGT
FT                   AKYLQSQSDVTEIQGDGNLWWGGAIEEGLKHVLPGCRPDDYVLFLNNDTWFDDNFVEAL
FT                   VQASKENGGAAVGSVIHEEGRDPPLVSIGARVNINRLAVWDLLSELSETEKQSPARQYR
FT                   VDALSGRGTLYPAILFRRHGGMRPNLLPHYMADYEIAMRFARAGVPLVVSSKAIVYSPP
FT                   VYGNDGSSLSWRKRLFGRRSAHNVFQRLIFYSLVGSPVQRMTAPIRMAYFSCSRAFSTW
FT                   RSLAKRKEGTI"
FT   gene            430510..431517
FT                   /locus_tag="Rleg2_0420"
FT   CDS_pept        430510..431517
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0420"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: Methionine biosynthesis MetW protein;
FT                   Methyltransferase type 11; Methyltransferase type 12; KEGG:
FT                   gme:Gmet_2177 methylase involved in ubiquinone/menaquinone
FT                   biosynthesis-like"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53719"
FT                   /db_xref="GOA:B5ZR87"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZR87"
FT                   /protein_id="ACI53719.1"
FT                   /translation="MSGGQHQQCIACGSKMRTFIERISDDRYGCPGVYSIDRCVSCGHM
FT                   STAPRLTEEDLPALYSNYYPRREIDFHALEKEAALVEKPLAGFRRWAAGTDNQGHYLAK
FT                   PGQKVLDIGCGSCLSLLEMQKLGVECWGVEADPNVRTIAEKYGLRVHIGNIYDVPFADQ
FT                   KFDLIVLNQVIEHVPDPLAMLAALKGRLNEDGRVILAFPNTGSFHRKLWKLRWINWHIP
FT                   YHQNHFNRTSFTLLARKSGYDVKRIRTITPNLWSVLQLRTSQEQRQEGRASNTWSESGS
FT                   SQKPPSFVRKLRNVTVTRGARLAGAMMGFVNRALDATGQGDSLLVELRLSATKN"
FT   gene            431528..432661
FT                   /locus_tag="Rleg2_0421"
FT   CDS_pept        431528..432661
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0421"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rec:RHECIAT_CH0000845 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53720"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZR88"
FT                   /protein_id="ACI53720.1"
FT                   /translation="MRIAVFDTYYSRFMTMHYRRNRDLRSASSQKQTDALLEAAFGTSD
FT                   FYSRHLKELGCDVIDIVGNCVPLQSAWARENNEPFSPWAMKLPHRFFRLPYIGARLAAL
FT                   PGLLEVAMARVRAFKPDVLYCQDLSFFPPHALMELKKTVPLIVGQIACPLPPDGFLRPY
FT                   NLILTSFPHFVPRFHEMGIKSEYFRIGFDTRVLDILGDVPRDVPVSFVGGISRHHGKAI
FT                   PLLEHLAETTPIQFFGYGAATLSRSSPIRQRHNGEVWGPDMYRALARSRITVNRHINVA
FT                   ESNANNMRLYEATGVGSLLITDRKDNLGEIFDVGKEVVAYSSPEEAAELIRYYIDHPDE
FT                   ADAIAKAGQARTLKDHTYKSRMKELMPILERHLEKQG"
FT   gene            432661..433473
FT                   /locus_tag="Rleg2_0422"
FT   CDS_pept        432661..433473
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0422"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: Methyltransferase type 11; Methyltransferase
FT                   type 12; KEGG: rec:RHECIAT_CH0000846 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53721"
FT                   /db_xref="GOA:B5ZR89"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZR89"
FT                   /protein_id="ACI53721.1"
FT                   /translation="MSFVRTTLNRFPVLKSQLKRLRERLQPAASVSSHYVEIDSARRDS
FT                   ESSRLAASWKANDLPARQRALVERQLKEYRGGASIDVFDVFTAALRKIDNLPAAGSLLE
FT                   IGCSSGYYSEVLEVNGLPLRYHGCDYSDAFIDMARRIYPALSFDVEDATRLSYQDNAFD
FT                   IVISGCCLLHIADYEAAIAESARVAKDYVIFHRTPIVYGEPTKYFRKQAYGVETMEIHF
FT                   SEPQLLDSFRVHGLEVLSTFTLNENADPRDSSKGNANRTYLCRKQSQS"
FT   gene            433470..434441
FT                   /locus_tag="Rleg2_0423"
FT   CDS_pept        433470..434441
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0423"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rec:RHECIAT_CH0000847 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53722"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZR90"
FT                   /protein_id="ACI53722.1"
FT                   /translation="MTTYFCTLFDSGYLIKGMAMMESLVRWCPDAHIFVLCMDQQAQEI
FT                   LTASNRSYISCIPLTDLETPELLEAKKSRGVAEYCWTLSPCLPTFVLRHHPEIDFITYL
FT                   DSDLLFYSPIQPILDEIGDNSIAIIEHRFAPRLQDREVNGRFCVEWVSFRRDEEGMRCL
FT                   DRWREQCIEWCYYRLEDGKMGDQKYLDEWPDLYPHCHIIEHPGAGVAPWNYEKLHFTQN
FT                   ASGQIEVDGSPLIFYHFHQFQLLANGDFNRLSTFYTSVCEEPVVAYEAYERALMRALDA
FT                   IRTISPGFSGGLRPVRAVALRRWVQRYVPLPIKRFLHRFIRY"
FT   gene            complement(434482..434853)
FT                   /pseudo
FT                   /locus_tag="Rleg2_0424"
FT   gene            435027..436088
FT                   /locus_tag="Rleg2_0425"
FT   CDS_pept        435027..436088
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0425"
FT                   /product="GDP-mannose 4,6-dehydratase"
FT                   /note="TIGRFAM: GDP-mannose 4,6-dehydratase; PFAM:
FT                   NAD-dependent epimerase/dehydratase; KEGG:
FT                   rec:RHECIAT_CH0000849 GDP-mannose 4,6-dehydratase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53723"
FT                   /db_xref="GOA:B5ZR91"
FT                   /db_xref="InterPro:IPR006368"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZR91"
FT                   /protein_id="ACI53723.1"
FT                   /translation="MTKTALITGVTGQDGAYLAELLLSKGYTVHGIKRRSSSFNTGRIE
FT                   HIYQDPHEAHPRFILHYGDMIDSTNLLRIVQQTQPDEIYNLAAQSHVGVSFETPEYTAD
FT                   ADGIGTLRLLEAIRILRLEEKTRFYQASTSELYGLVQEVPQSEKTPFYPRSPYAAAKLY
FT                   AYWIVVNYREAYGMHASNGILFNHESPLRGETFVTRKITMAVAAIHLGLQDKLFLGNLD
FT                   AKRDWGHAREYVEGMWRMLQQDKPDDYVLATGETTSVRQFVEWAFADVGIALEWKGSGV
FT                   DEKGYDSASGACLVEVDPRYFRPTEVDLLLGDPTKARQKLGWQHKTPVRELAAEMVRED
FT                   VKHWKAQNSRKEI"
FT   gene            436089..437039
FT                   /locus_tag="Rleg2_0426"
FT   CDS_pept        436089..437039
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0426"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase;
FT                   dTDP-4-dehydrorhamnose reductase; KEGG:
FT                   rec:RHECIAT_CH0000850 probable GDP-L-fucose synthase
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53724"
FT                   /db_xref="GOA:B5ZR92"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR028614"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZR92"
FT                   /protein_id="ACI53724.1"
FT                   /translation="MYDLSNKKIWVAGHRGMVGSALVRRLQSEDCSVITATRREVDLKR
FT                   QEEVEKFVEANRPDAIILAAAKVGGILANDSYPAEFIYDNLIIEANIFEAAHQGGVDRL
FT                   LFLGSSCIYPKLAPQPIPEEALLTGALEPTNEWYAIAKIAGIKLAEAYRKQYGRDYISA
FT                   MPTNLYGPGDNFDLNSSHVLPALIRKAHAAKLRKDPHMVVWGTGTPRREFLHVDDCADA
FT                   LVFLLKTYSGSQHVNVGSGTDLEIIELTRLVCRVVGYEGEIIHDLSKPDGTPRKLMSNQ
FT                   KLQDMGWKPRISLEDGIRATYAWFLEFENTSDPAV"
FT   gene            complement(437276..437349)
FT                   /locus_tag="Rleg2_R0007"
FT                   /note="tRNA-Gln3"
FT   tRNA            complement(437276..437349)
FT                   /locus_tag="Rleg2_R0007"
FT                   /product="tRNA-Gln"
FT   gene            437594..439156
FT                   /locus_tag="Rleg2_0427"
FT   CDS_pept        437594..439156
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0427"
FT                   /product="Ppx/GppA phosphatase"
FT                   /note="PFAM: Ppx/GppA phosphatase; KEGG: ret:RHE_CH00788
FT                   exopolyphosphatase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53725"
FT                   /db_xref="InterPro:IPR003695"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZR93"
FT                   /protein_id="ACI53725.1"
FT                   /translation="MEDPEGGAKPQFDGASAAGRKDGKKSRRRKGKRGGQSRNAAHPAS
FT                   HELSGNAGQSARPMEDAAGNPARKRKRRRRGGQGVAQDGSSHPQAMEQARAAGNAARAE
FT                   GEQTPGRRNRRKHRGKRGLQGRPLTAAKPSPPQQESRAEETVQRAEPREAQNGANAGRR
FT                   GRQDGHINSGYPGDRQAGEHAWPDELYAALDLGTNNCRLLIAQPTRPGQFRVVDAFSRI
FT                   VRLGEGLAASGRLSDEAMERAIEALRICASKLRNREIRRMRLIATEACRQAVNGEEFLA
FT                   RVVAETGLALEIIDRETEARLAVSGCSSLVGRETRSVVLFDIGGGSSEIAVIRIGDNRF
FT                   SRLANHITHWTSLPVGVVTLSERHGGRDVTPEAFEGMVREVGGMLEGFDCPEIEVAQTG
FT                   DFHLIGTSGTVTTLAGVHLDLPRYDRRKVDGIWLSDDEVSAMQAKLLSWNFESRAANPC
FT                   IGPDRADLVLAGCAILEAIRRRWPSPRMRVADRGLREGLLTDMMADDGVWRRNRNRRGQ
FT                   RAR"
FT   gene            439166..439885
FT                   /locus_tag="Rleg2_0428"
FT   CDS_pept        439166..439885
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0428"
FT                   /product="ribosomal RNA methyltransferase RrmJ/FtsJ"
FT                   /note="PFAM: ribosomal RNA methyltransferase RrmJ/FtsJ;
FT                   KEGG: rec:RHECIAT_CH0000875 ribosomal RNA
FT                   methyltransferase/cell division protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53726"
FT                   /db_xref="GOA:B5ZR94"
FT                   /db_xref="InterPro:IPR002877"
FT                   /db_xref="InterPro:IPR015507"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5ZR94"
FT                   /protein_id="ACI53726.1"
FT                   /translation="MTKAPIAGNRTGRKLGQRVKNKKMKASSRQWLQRHINDPYVQRAQ
FT                   LEGYRARAAFKLLEIDEKHHILRGAKRIIDLGAAPGSWSQIAAKVTGSTDEDIRVAAID
FT                   FLEMAQLPGVKILQLDFLDPTAPEKLLEAVGGTPDLVISDMAAPTTGHHRTDHLRTMHL
FT                   CEVAAQFAVEVLGEGGHFLTKTFQGGTERELLAMLKQNFRQVVHVKPNASRAESVEMFL
FT                   LAKGFKGRKVEGDAEKA"
FT   gene            439941..440324
FT                   /locus_tag="Rleg2_0429"
FT   CDS_pept        439941..440324
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0429"
FT                   /product="putative lactoylglutathione lyase protein"
FT                   /note="KEGG: rec:RHECIAT_CH0000876 putative
FT                   lactoylglutathione lyase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53727"
FT                   /db_xref="GOA:B5ZR95"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZR95"
FT                   /protein_id="ACI53727.1"
FT                   /translation="MLLYITLGTNDLYRAGQFYDAVLPLLGYRRQHYSEEEIGYSADSD
FT                   TRCRFWVVTPFNRRRATAGNGAMVALAAETRTSVDAFHAAAIAAGGVDEGGPGLRPYHA
FT                   HFYAAYVRDLDGNKLSAVCENPE"
FT   gene            complement(440375..441799)
FT                   /locus_tag="Rleg2_0430"
FT   CDS_pept        complement(440375..441799)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0430"
FT                   /product="drug resistance transporter, EmrB/QacA subfamily"
FT                   /note="TIGRFAM: drug resistance transporter, EmrB/QacA
FT                   subfamily; PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   ret:RHE_CH00792 probable efflux transporter, permease
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53728"
FT                   /db_xref="GOA:B5ZR96"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR004638"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZR96"
FT                   /protein_id="ACI53728.1"
FT                   /translation="MNRIVPLILAVALFMEQMDSTVIATALPAIAADLNVGPITLKLAL
FT                   TSYMVALAVFIPVSGWMADRFGAKKIFRLAISVFVIGSIFCAVSSNLVEFVFARFLQGM
FT                   GGAMMTPVGRLVLVRTTKRSDLVSAMALLTIPALVGPLTGPPLGGFITTYFSWHWIFLI
FT                   NVPVGIIGIWLATIFLPEVEATAPPKLDFTGFVLTSLSAAGVVFGLSVVSLPALPPIIG
FT                   VTATAIGLICGFLYIRHARRHPTPILNLDLFKNPTFRASTLGGTLFRICVGAMPFLTPL
FT                   MLQLGFGLTPFQSGLITFAGAIGAITTKFMAKRVFAAAGFRTTLLCAAMVTTLVTIVTG
FT                   LFTPATPHLVIIGVLLIGGFSRSFMFTGVNALAFADIDDAEASQATSMSSVMQQVSLAL
FT                   GVAVAAAILESSIYIRGEALQVADFHLAFYIIAGLTVIATIPFVRMDRNAGALVSGHRA
FT                   KVVTVSTVEAEQPVVK"
FT   sig_peptide     complement(441704..441799)
FT                   /locus_tag="Rleg2_0430"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.616) with cleavage site probability 0.588 at
FT                   residue 32"
FT   gene            442063..443055
FT                   /locus_tag="Rleg2_0431"
FT   CDS_pept        442063..443055
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0431"
FT                   /product="beta-lactamase domain protein"
FT                   /note="PFAM: beta-lactamase domain protein; KEGG:
FT                   rec:RHECIAT_CH0000878 putative beta-lactamase family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53729"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZR97"
FT                   /protein_id="ACI53729.1"
FT                   /translation="MAISTQLKRRTFFAAGLGLLAAPAILREKAEAAAIGESRNMDVTP
FT                   LPEINQFKLGSYKFTAVRDGINISEKPYETYGTNQDPETVKALLTANFLPADKLLNGYT
FT                   PALVDTGSDVILVDTGFGESGRARGSGKLVQGLKAAGYSADDVTIVALTHLHGDHIGGL
FT                   MENGAPAFRNARYVIGQAEYDFWSNKSREGTPAEASHKAVLANVAPLAEKTTFIKDGDS
FT                   VAPGITAMLAAGHSPGHMVFHVESEGKRLVLTGDTANHYILSLLRPDWEVRFDMDKAQA
FT                   AATRRKVFDMIATEKIAFLGYHMPFPAVGFVEKQDGGYRFVPKTYQFDI"
FT   sig_peptide     442063..442161
FT                   /locus_tag="Rleg2_0431"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.985) with cleavage site probability 0.489 at
FT                   residue 33"
FT   gene            443359..444843
FT                   /locus_tag="Rleg2_0432"
FT   CDS_pept        443359..444843
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0432"
FT                   /product="inosine-5'-monophosphate dehydrogenase"
FT                   /EC_number="1.1.1.37"
FT                   /note="KEGG: ret:RHE_CH00794 inositol-5-monophosphate
FT                   dehydrogenase; TIGRFAM: inosine-5'-monophosphate
FT                   dehydrogenase; PFAM: CBS domain containing protein; IMP
FT                   dehydrogenase/GMP reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53730"
FT                   /db_xref="GOA:B5ZR98"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR001093"
FT                   /db_xref="InterPro:IPR005990"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR015875"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZR98"
FT                   /protein_id="ACI53730.1"
FT                   /translation="MARIIETATGADALTFDDVLLQPGHSEVMPGQTNIATRIARDFEL
FT                   NIPILSSAMDTVTESRLAIAMAQAGGLGVIHRNLTPVEQAEEVRQVKKFESGMVVNPVT
FT                   IGPEAKLAEALGLMKSHGISGIPVVEKSGRLVGILTNRDVRFASDPEQKIHELMTKDNL
FT                   VTVKESVDQQEAKRLLHSHRIEKLLVVDTEGRCVGLITVKDIEKSQLNPNASKDAQGRL
FT                   RAAAAISVGDDGFERAERLIEAGVDLLVVDTAHGHSQRVLDAVTRVKKLSNSVRIMAGN
FT                   VATYDGTRALIDAGADAVKVGIGPGSICTTRIVAGVGVPQLAAIMSAVQAAQAQDVPVI
FT                   ADGGIKFSGDLAKAIAAGASAVMIGSLLAGTDESPGEVYLYQGRSFKAYRGMGSVGAMA
FT                   RGSADRYFQAEVRDTLKLVPEGIEGQVPYKGPVSAVVHQLAGGLKAAMGYVGGKDLKDF
FT                   QERATFVRISGAGLRESHAHDVTITRESPNYPGAGL"
FT   gene            444846..445397
FT                   /locus_tag="Rleg2_0433"
FT   CDS_pept        444846..445397
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0433"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ret:RHE_CH00795 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53731"
FT                   /db_xref="GOA:B5ZR99"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZR99"
FT                   /protein_id="ACI53731.1"
FT                   /translation="MKAGSGIPLWTVALLAALCLAVLAWTTFGFVVPFKHETGQAVLDT
FT                   YFAGYDESAVFHMQTLLDQNETAAKLLSAMYFGPELIFPALLTALLFLALLKLGPVGAW
FT                   FGRSHPLVGQAIYLLPFVYGIADYGENIASLIAFGDSPSASLAAQLLPWMTRLKFASLA
FT                   ISCIVLVRLAIARWLSPGRD"
FT   sig_peptide     444846..444920
FT                   /locus_tag="Rleg2_0433"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.877 at
FT                   residue 25"
FT   gene            complement(445405..446322)
FT                   /locus_tag="Rleg2_0434"
FT   CDS_pept        complement(445405..446322)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0434"
FT                   /product="transcriptional regulator, LysR family"
FT                   /EC_number="4.2.1.1"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: ret:RHE_CH00796 probable
FT                   transcriptional regulator protein, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53732"
FT                   /db_xref="GOA:B5ZRA0"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZRA0"
FT                   /protein_id="ACI53732.1"
FT                   /translation="MNKFPDFEGLAMFAKVAEERSFARAAQTLGVSVPTVSRAVSRLEQ
FT                   RLGARLFNRTSRQLALTDFGLRLVDSAARIYAEAEMAEDAARELATRPKGLIRLAAPMD
FT                   FGTRWLPPILPDFFELFPEISIDLHMSDAVVDIVGDGFDAALRIAVLPDSSLVARRLAP
FT                   VDRFILAAPAYLKQYGLPEHPRELTAHHCLGYAYRARQDVWRLRNSEGKEEVISPSGSL
FT                   RATNSQALVPMALRGLGIIELPEFLAHDYLVDGQLTPILPDWTLPTGALYFVTPSARSR
FT                   PAKVEVLADFMMARLSNPVWRRRS"
FT   gene            446415..447170
FT                   /locus_tag="Rleg2_0435"
FT   CDS_pept        446415..447170
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0435"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR
FT                   domain protein; KEGG: rec:RHECIAT_CH0000882 probable
FT                   dehydrogenase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53733"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZRA1"
FT                   /protein_id="ACI53733.1"
FT                   /translation="MTQRLNAKIAVITGATSGIGLAAAKRFVAEGARVFITGRRKDVLA
FT                   AAIAEIGGGVVGIQADSANLADLDRLYEEVKAEAGRVDVLFVNAGGGSMLPLGEITEEQ
FT                   YDDTFDRNVKGVLFTVQKALPLLSPGASVILTGSTAGSGGTPAFSVYAASKAALRSFAR
FT                   NWILDLKDRGIRINTLSPGPTETTGLVELAGKDPAHQQGLLDALAAQVPMGRVGRAEEV
FT                   AAAALFLASDDSSFVTGAELFVDGGSAQV"
FT   sig_peptide     446415..446489
FT                   /locus_tag="Rleg2_0435"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.913) with cleavage site probability 0.478 at
FT                   residue 25"
FT   gene            447280..447696
FT                   /locus_tag="Rleg2_0436"
FT   CDS_pept        447280..447696
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0436"
FT                   /product="protein of unknown function DUF1123"
FT                   /note="PFAM: protein of unknown function DUF1123; KEGG:
FT                   rec:RHECIAT_CH0000883 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53734"
FT                   /db_xref="GOA:B5ZRA2"
FT                   /db_xref="InterPro:IPR001129"
FT                   /db_xref="InterPro:IPR023352"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZRA2"
FT                   /protein_id="ACI53734.1"
FT                   /translation="MTGYQIFWPLLAHVALVYGLYALLGQRRAKMVRAGSVAKSDYREN
FT                   RGEPAESLVVKNCLANQFELPVLFHACCTLLYVTEADNIVAVGLAWLFVALRYAHAAVH
FT                   VTSNDLRYRSPLFAAGYLVLGAMWVWLAAWMAMG"
FT   gene            447985..448626
FT                   /locus_tag="Rleg2_0437"
FT   CDS_pept        447985..448626
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0437"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG:
FT                   rec:RHECIAT_CH0000884 probable transcriptional regulator
FT                   protein, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53735"
FT                   /db_xref="GOA:B5ZRA3"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR041674"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZRA3"
FT                   /protein_id="ACI53735.1"
FT                   /translation="MGVESMDRIGLRRKPKQERSIQRLDVILAAAAKIIAEKGVSAMRM
FT                   TELAVAAKVPIGSVYQYFPEKAAIVKALFDQHASAIQAKTAAMFADVETLDQALDLVCD
FT                   IIDWYYESYHDDPVYLGVWMGTETDQDLLQLNIEHSGRVAGIFHDAVRRLAPELCDEEM
FT                   YARTYLFSHLIGAVIRLAAVSDKALARRMLDEWKRVIRASLFAATTKRAA"
FT   gene            complement(448647..449615)
FT                   /locus_tag="Rleg2_0438"
FT   CDS_pept        complement(448647..449615)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0438"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: ret:RHE_CH00800 probable
FT                   transcriptional regulator protein, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53736"
FT                   /db_xref="GOA:B5ZRA4"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZRA4"
FT                   /protein_id="ACI53736.1"
FT                   /translation="MGDTMSAPLDLDQLQTFIAIVDSGSFTKAADRVYKTQSAVSMQMR
FT                   RLEERIGKQLFIKDGRGNRLTVEGEKLLNYARRIIRLNNEAIAAFDDNRLEGTLRIGTP
FT                   DDYADRYMPEIIGRFAKTHPNVELYIVCEPSVDLAERMHKGELDIALVTHNPRERMSDV
FT                   VRTEPLCWVGSANHPIRDDAPVPLAVGRRDCQWRQLACSALDAVGREHQILFTSWSCTV
FT                   VAAAVLAGMAVSVMPESALRTGMKVLSQADGFPALPPVQIGIMKRPGVSLSLMNAITAH
FT                   ITACLDNITPAVVDDTLEADVKSAQARLYPRLKAANMVPSW"
FT   gene            449909..450208
FT                   /locus_tag="Rleg2_0439"
FT   CDS_pept        449909..450208
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0439"
FT                   /product="protein of unknown function DUF1127"
FT                   /note="PFAM: protein of unknown function DUF1127; KEGG:
FT                   rec:RHECIAT_CH0000886 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53737"
FT                   /db_xref="InterPro:IPR009506"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZRA5"
FT                   /protein_id="ACI53737.1"
FT                   /translation="MLMTNRTTELDCGKLAPTLFQRLVAGLAPLVSLFRGFRNRMEINT
FT                   LHDLNDSQLRDIGLSRADLTSAFLASTFFEDPSEHLTRSARNRWRLQLFRSYNE"
FT   gene            complement(450297..451175)
FT                   /locus_tag="Rleg2_0440"
FT   CDS_pept        complement(450297..451175)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0440"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rec:RHECIAT_CH0000887 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53738"
FT                   /db_xref="InterPro:IPR009282"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZRA6"
FT                   /protein_id="ACI53738.1"
FT                   /translation="MLPLFDMMMQAQNGAAMEAIARQFNLAQEQATKAMAALMPAFSAG
FT                   LKRSTSNPYDFVGLMQAVSSGNYARYFEDMNRAFTPEGISDGNNILAQLFGSKEVSRAV
FT                   AAQAAQMTGIGQDIYKRMLPVLADTLMGGLFKQTTGQMASPINPFVNTAMGETIQQWLE
FT                   STGFAPKPKAAQPSIFDNPFTQAMQQMFSVPKAEPAPQPNPFLDNPFAKAFQEMMAGLG
FT                   QPAAAKQPAAKTQEAPKEEAPKEEAKATADSYTEILNAMFDSGLEVQKTYQRNLEAIFE
FT                   TYRPKPPETKA"
FT   gene            complement(451322..452695)
FT                   /locus_tag="Rleg2_0441"
FT   CDS_pept        complement(451322..452695)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0441"
FT                   /product="glutamate/cysteine ligase"
FT                   /EC_number="6.3.2.2"
FT                   /note="KEGG: rec:RHECIAT_CH0000888 gamma-glutamylcysteine
FT                   synthetase protein; TIGRFAM: glutamate/cysteine ligase;
FT                   PFAM: glutamate--cysteine ligase GCS2"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53739"
FT                   /db_xref="GOA:B5ZRA7"
FT                   /db_xref="InterPro:IPR006336"
FT                   /db_xref="InterPro:IPR011556"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR035434"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZRA7"
FT                   /protein_id="ACI53739.1"
FT                   /translation="MARDTTDQTPLSSVQDLTDYIAAGNKPRERFRIGTEHEKFAFFRA
FT                   DNSPVPYFGDASISALLTGLQAKSGWEPIMDGGNIIGLAEQSGMGAISIEPGGQFELSG
FT                   APLETIHETCRESNQHLATLREIAEPMGIRFLGIGGSPKWTYAETPQMPKSRYEIMTRY
FT                   MPKVGSQGLDMMYRTCTIQVNLDFSSEDDMRKKMRVSMKLQSLATALFASSPFTEGKPN
FT                   GLLSWRGDIWRDTDNRRSGLLDFTFRDDFGFRDYAEWALDVPMYFIVRDGRYHDCTHVT
FT                   FRQFMNGALKGEIADPAPTMGDWTNHLSTLFPDVRLKRFLEMRGADGGPWRRICALPAF
FT                   WVGLLYDDAALDAADQLTKDWSFAEIGALRDAVPAQGLKADFRGHPLFDMAREVVGISR
FT                   AGLKARGKLNREGQDETIFLAPLDEVLAKKATLAEDLLSLYHGRWNGSVEPVFEDYQY"
FT   gene            complement(452844..453581)
FT                   /locus_tag="Rleg2_0442"
FT   CDS_pept        complement(452844..453581)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0442"
FT                   /product="protein of unknown function DUF558"
FT                   /note="PFAM: protein of unknown function DUF558; KEGG:
FT                   rec:RHECIAT_CH0000889 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53740"
FT                   /db_xref="GOA:B5ZRA8"
FT                   /db_xref="InterPro:IPR006700"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZRA8"
FT                   /protein_id="ACI53740.1"
FT                   /translation="MRANFRMQRLFVDAPLSSGAALEANADQFNYLANVLRMEEGGEVL
FT                   LFNGRDGEWKATLTFPTRKRIQLTAIEETRPQPAPCDLHYLFAPLKVGRMDYLVQKAVE
FT                   MGAGLLQPVMTQHVQGKITNLDKLRANVVEAAEQCGVLGIPDVAEPVRLLDLLDRWPKE
FT                   RRIIYCDEGDAGQNPLPVLSAIRERHLALLVGPEGGFSEEERARLRSLDFVTAIPLGPR
FT                   ILRADTAAVAALAVVQAAIGDWS"
FT   gene            complement(453598..455097)
FT                   /locus_tag="Rleg2_0443"
FT   CDS_pept        complement(453598..455097)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0443"
FT                   /product="phosphate transporter"
FT                   /note="PFAM: phosphate transporter; KEGG: ret:RHE_CH00805
FT                   probable phosphate transport permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53741"
FT                   /db_xref="GOA:B5ZRA9"
FT                   /db_xref="InterPro:IPR001204"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZRA9"
FT                   /protein_id="ACI53741.1"
FT                   /translation="MPPRPTVLTKRTLDKDLDKITHAEEAAKHVLRRLVAPGLGLIFVG
FT                   LVMLFAGVYVLDQPGAVLVVAAAALAGYMAMNIGANDVTNNVGAAVGARAMTMGQALII
FT                   AAIFEVLGATVAGGEVVKTISSNIVDTVQVPQALLGWIMMAALMAAALWINLATWMNAP
FT                   VSTTHAIVGAVIGAGIAAVGTEPVNWRVMLEITSSWITSPLIGGLIAAGLLYLVKTLII
FT                   YRDDKIAAARRWVPVLVAVMAGGFMAYMVLQLSPIGKFPPFTVILIGIGIGLVSWLAAR
FT                   PLVLAQAHNLENRNSSLRVLFRLPLIGSAALLSFAHGANDVSNAVGPLSAIVHSVGIGG
FT                   DGGVGHPPLWVMLIGAFGISVGLLLFGPRLIRLVGEEITKLNPMRAYCVALSTAFTVIA
FT                   ASWLGLPVSTTHIAIGAVFGVGFFREWYTRHSKRRIAYIRRRAENFDIDEPEDPNIHET
FT                   RRRYLVRRSHFMTIIAAWIVTVPVSAALAAVIYWVMFALFV"
FT   gene            complement(455161..455691)
FT                   /locus_tag="Rleg2_0444"
FT   CDS_pept        complement(455161..455691)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0444"
FT                   /product="NUDIX hydrolase"
FT                   /note="PFAM: NUDIX hydrolase; KEGG: rec:RHECIAT_CH0000891
FT                   putative NTP pyrophosphohydrolase protein, MuT/NUDIX
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53742"
FT                   /db_xref="GOA:B5ZRB0"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZRB0"
FT                   /protein_id="ACI53742.1"
FT                   /translation="MTLLARLASDVQLMFRRPPRQQYGAICYRVKKKSGDVEVLLMTSR
FT                   DTGRWVIPKGWPMTGKCAHEVAAQEAFEEAGVRGAVETETLGAYSYSKVLRDGVQVACK
FT                   VQVYALEVTDMAKNFKEKGERRIEWVSFDEAAGRVREPELRGLLLAFKRKVTERLSAKA
FT                   AKQGSAAKQIPAE"
FT   gene            455955..456833
FT                   /locus_tag="Rleg2_0445"
FT   CDS_pept        455955..456833
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0445"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: psb:Psyr_0035 regulatory protein,
FT                   LysR:LysR, substrate-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53743"
FT                   /db_xref="GOA:B5ZRB1"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZRB1"
FT                   /protein_id="ACI53743.1"
FT                   /translation="MRLPPLNAVRAFEAVCRHGSILKAAEELKVVRGAVRQQIATLESH
FT                   FGRKLFVRDGRRLIPTAEATAFAEASGAAFDILQRAACELSGTGPGRIRLGVPSAFAVW
FT                   WLMPRVADMQASLGDMAVDIVPMSVVEPLLMHPELDAVIMGGEYRPAAGVTAVRFMEDE
FT                   FGPVATPALAATLSESPAAMGRLTMLASRSVPKLWDEWFAESGTPPVAFSRVQEFEDLL
FT                   LALGAARSGLGIALAPRASIEDDLQRGQLVAPYGFIARPSGYSLCCRTSDAKRPDFSAL
FT                   SGWLRRCGRPS"
FT   gene            456933..458090
FT                   /locus_tag="Rleg2_0446"
FT   CDS_pept        456933..458090
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0446"
FT                   /product="Adenosylhomocysteinase"
FT                   /EC_number="3.3.1.1"
FT                   /note="PFAM: S-adenosyl-L-homocysteine hydrolase, NAD
FT                   binding; KEGG: tma:TM0172 S-adenosyl-L-homocysteine
FT                   hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53744"
FT                   /db_xref="GOA:B5ZRB2"
FT                   /db_xref="InterPro:IPR000043"
FT                   /db_xref="InterPro:IPR015878"
FT                   /db_xref="InterPro:IPR020082"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR042172"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZRB2"
FT                   /protein_id="ACI53744.1"
FT                   /translation="MDKTATRIDWIGSSCRLLKATAAEFERTRPFEGLSIGTSIHLEPK
FT                   TVALLMTLRAGGARLVCTGNLNSTQPLTVEFLRSQGFTVFATQTTDPAAHHQSLEAVIA
FT                   ERPDLLLDNGGDLFAIAAEKPYANLRGGTEETTSGRTRLLPLRERLAMPILVINDSPIK
FT                   QFAENRHAVGQSLFESYLRFTNRSTNGKRVTVFGYGACGKGTAACFRNAFSTVSVVDID
FT                   AVTTLEAHLDGFATPPREAAIRSADIIVTVTGFAGIVTAADLPLVKDGAILMNGGHFPH
FT                   EIDVEAFRRHPDVIGIDRYEADQIETFHLRDGRSFHVLGGGHMANLAGPRPLGNTVESM
FT                   DLGFTLQARCLERIARGEAGPEACVVPVPGDIDAMVANAYLDLAR"
FT   gene            complement(458201..459214)
FT                   /locus_tag="Rleg2_0447"
FT   CDS_pept        complement(458201..459214)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0447"
FT                   /product="Alcohol dehydrogenase zinc-binding domain
FT                   protein"
FT                   /note="PFAM: Alcohol dehydrogenase zinc-binding domain
FT                   protein; Alcohol dehydrogenase GroES domain protein; KEGG:
FT                   met:M446_1258 alcohol dehydrogenase GroES domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53745"
FT                   /db_xref="GOA:B5ZRB3"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZRB3"
FT                   /protein_id="ACI53745.1"
FT                   /translation="MSRQSTMKVMLAESPNSPLRIADVSKPVPGEGQVLVRILASGVNP
FT                   LDLKIRAGNAAHARHPLPAVLGIDMAGIVEEIGPGVGGFRRGDAVYGMTGGVGGVQGSL
FT                   AEFAAVDAALLAPKPQNLSMREAAALPLIAITAWEGLVDRAGVRADHKVLVLGGGGVGH
FT                   IVAQIAKAVGAEVYVVDGASKVDYLAGLGATPIDRAAETVETYVARYTGGKGFDLIYDT
FT                   VGGQGLDTAFRAVSRFGHVVSCLGWGNHALAPLSFKAATYSGVFTLLPLLSGEGRPHHG
FT                   EIMREMTKLVEAGEVMPRLDPHRFTFDDTDEAYLLIENRQADGKVVVEIDRSHLAE"
FT   gene            459352..460203
FT                   /locus_tag="Rleg2_0448"
FT   CDS_pept        459352..460203
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0448"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: bja:bll5543 transcriptional
FT                   regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53746"
FT                   /db_xref="GOA:B5ZRB4"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZRB4"
FT                   /protein_id="ACI53746.1"
FT                   /translation="MEWSDLKIFLAIARFGTLGAAARSLRLTQPTMGRRLRSLEASVGQ
FT                   TLFQRTTEGFVLTEEGAAVLAGAERIEEETLAMERILAGGSRQLGGFLRLSSSDWFGAH
FT                   VLSPVLAEFSQLHPKVVVELLTDSRLLSLPRREADLVFRIQPFTEAEIISRKLIHIKYG
FT                   LYIRRGAPHPRAFDGVGARLVTMDQAFGDMPDAGWLQRLLPRAEIAMRSNSRDVQATLC
FT                   ANGAGLAVLPRPLGDSLAAIELVDLGEAPPGRDTWVGYHRDMKRLARLRALLDLVIERL
FT                   TH"
FT   gene            complement(460279..461175)
FT                   /locus_tag="Rleg2_0449"
FT   CDS_pept        complement(460279..461175)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0449"
FT                   /product="transcriptional regulator, LysR family"
FT                   /EC_number="4.2.1.1"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: rec:RHECIAT_CH0000892 probable
FT                   transcriptional regulator protein, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53747"
FT                   /db_xref="GOA:B5ZRB5"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZRB5"
FT                   /protein_id="ACI53747.1"
FT                   /translation="MTNLGDLEIFAKVVSTGSMSLAGRALGFSPAVVSKRIKRLEDRLG
FT                   TRLLQRTTRQISLTEAGQGFYDRVLGILAGLEEAEFYISGRSTQMHGTLKISAPTSFGR
FT                   MHIAPHLKAFMEAHPELAINLVLTDEFSDIVGGGFDLAIRIAELTDSSLVARRLAPVRR
FT                   LLCASPDYLAEHGEPGDIDDLKHHRCLPAHNGDTWRLNGPDGMISLRPEGMLVTNSSEV
FT                   IREAVISGLGIALRSTWDIGEELKAGKLVQVLPAYEGSHNVALSAVYPSRQFLPAKVRL
FT                   FIDYLAELYGPVPYWER"
FT   gene            461317..462756
FT                   /locus_tag="Rleg2_0450"
FT   CDS_pept        461317..462756
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0450"
FT                   /product="D-lactate dehydrogenase (cytochrome)"
FT                   /EC_number="1.1.2.4"
FT                   /note="PFAM: FAD linked oxidase domain protein; KEGG:
FT                   ret:RHE_CH00808 glycolate oxidase subunit D protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53748"
FT                   /db_xref="GOA:B5ZRB6"
FT                   /db_xref="InterPro:IPR004113"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016171"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZRB6"
FT                   /protein_id="ACI53748.1"
FT                   /translation="MSDAIPFLKPRADVLARRAQIVADLTDLLPPESLVHEARELVPFE
FT                   TDAFVSYRRLPLAVALPRSTAEVSAVMRYCHRYGIPVVPRGAGTSLSGGAIPQEDAVVL
FT                   GLSKMNHILEIDLPNRVAVVQAGVTNLNISESVSADGFFYAPDPSSQLACTIGGNIGMN
FT                   SGGAHCLKYGVTTNNLLGVRMVLVDGTVIELGGKALDAAGYDLLGLVCGHEGQLGIVTE
FT                   ATVRLIAKPEGARPVLFGFEASEEAGACVADVIAAGIIPVAIEFMDKPAIEICEAFAHA
FT                   GYPLDVGALLIVEVEGSEAEMDASLKDIVEIARRHGVKTVRECQSATEAALIWKGRKSA
FT                   FGATGRIADYICMDGTVPLSQLSHVLKRTAEIIDHYGLRVANVFHAGDGNMHPLILFNA
FT                   NDPEDAARAEAAGNDILKLCVDAGGCLTGEHGVGIEKRDLMRHQYSETDLAQQMAARAA
FT                   FDPGWLLNPSKVFPLEGRPAA"
FT   gene            462753..463952
FT                   /locus_tag="Rleg2_0451"
FT   CDS_pept        462753..463952
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0451"
FT                   /product="FAD linked oxidase domain protein"
FT                   /note="PFAM: FAD linked oxidase domain protein; KEGG:
FT                   rec:RHECIAT_CH0000894 glycolate oxidase protein, subunit E"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53749"
FT                   /db_xref="GOA:B5ZRB7"
FT                   /db_xref="InterPro:IPR004113"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016171"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZRB7"
FT                   /protein_id="ACI53749.1"
FT                   /translation="MIDLTPTSEEEAAAIVRHHAESGRPLAICGGDSRAGFGNAVASED
FT                   RLRSTGLAGIVAYNPGEMVMTVRSGTPLAEVEAALSDSGQMLAFEPMDHRPVMGTSGEP
FT                   TIGGVFAANVSGPRRLIAGAARDSLLGVRFVNGKGEIIKAGGRVMKNVTGLDLVKLIAG
FT                   SHGTLGFLTEVTFRVPPRPKTERTVVLSGLNDAEAANAMAAAMALPVEVSGAAHLPLTV
FT                   TWKFLAGKLPEGEATVLRIEGLAGSVDVRLEKLAAAMSAFAAVTRLDEPESRRLWQEIR
FT                   DVLPYADGTARPVWRVSVAPGTGHQLVAALRLEAGVDAFYDWQGGLVWLRMEAGPEGEL
FT                   VRRYIKALGGGHATLIRAPEQARAATAAFHPEPEAVAMLSRRVKEKFDPAGIFNPGKMG
FT                   "
FT   gene            464191..465501
FT                   /locus_tag="Rleg2_0452"
FT   CDS_pept        464191..465501
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0452"
FT                   /product="protein of unknown function DUF224 cysteine-rich
FT                   region domain protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein; protein of unknown function DUF224 cysteine-rich
FT                   region domain protein; KEGG: ret:RHE_CH00810 glycolate
FT                   oxidase subunit F protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53750"
FT                   /db_xref="GOA:B5ZRB8"
FT                   /db_xref="InterPro:IPR004017"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR012257"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZRB8"
FT                   /protein_id="ACI53750.1"
FT                   /translation="MQTNFTPAQLADPDVAESEQILRKCVHCGFCTATCPTYVTLGNEL
FT                   DSPRGRIYLIKDMLENGRPADAEVVTHIDRCLSCLACVTTCPSGVDYMHLVDHARAHIE
FT                   KTYRRPLMNRLTRAILAAVLPYPGRFRLALNLARLGRPFAGLMRGAALKPFAAMLALAP
FT                   RRIPAASDFAKPGSYLPETERRGRVAMLSGCAQPVLDPGINAAAIRLLTRLDVEVVLPE
FT                   GEVCCGSLVHHMGRAEQALASARTNVDLWTREIDGQGLDAIIITASGCGTTIKDYGHML
FT                   RLDPAYAAKAARVSGLAKDITEYLATLELPVHTPKGITVAYHSACSMQHGQRITLAPKQ
FT                   LLKAAGFTVRDPAEGHLCCGSAGTYNIMQPEISAALKARKVKNIEATKAEIIATGNIGC
FT                   ITQIATGTGMPILHTVELLDWAYGGAVPEKLTGLSLG"
FT   gene            465541..465981
FT                   /locus_tag="Rleg2_0453"
FT   CDS_pept        465541..465981
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0453"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ret:RHE_CH00811 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53751"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZRB9"
FT                   /protein_id="ACI53751.1"
FT                   /translation="MWRGMIVFAGLLGAAGAAHADSRFFCSADDKEARFTLESGFESGA
FT                   GHKLNHFRGALVVKDPAQSTVFGKRVFESQHLTNHWSRDGDLLMEVFDGGEDDTGGATL
FT                   DLVVVAGERGKPAANFSGTYSLTIEGGEKPYAVEGKVSCGTK"
FT   sig_peptide     465541..465603
FT                   /locus_tag="Rleg2_0453"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 21"
FT   gene            complement(466058..466732)
FT                   /locus_tag="Rleg2_0454"
FT   CDS_pept        complement(466058..466732)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0454"
FT                   /product="lipid A oxidase (involved in formation of
FT                   2-aminogluconate) protein"
FT                   /note="KEGG: rec:RHECIAT_CH0000897 lipid A oxidase
FT                   (involved in formation of 2-aminogluconate) protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53752"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="InterPro:IPR027385"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZRC0"
FT                   /protein_id="ACI53752.1"
FT                   /translation="MTSALRSSASLLAGIAFFTICSAASVSAEDLQFSIYGGYQTAPHS
FT                   GVDLSDGTHFTAGWEGKSFGSPPYYGGRVTWWLENFNKPNWGISLDYTHDKVYADDDTL
FT                   AKTGWSHFEFTDGLNLLTVNGLYRFQDPSRRWTPYLGAGVGVNIPHVEVIRPEGKTWAY
FT                   EFGGVTLQAQAGVDFKVTDRWSTFVEYKGTYSRVDVPIDSGVDLKTNIFTNAVNVGVSF
FT                   HW"
FT   sig_peptide     complement(466646..466732)
FT                   /locus_tag="Rleg2_0454"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.930 at
FT                   residue 29"
FT   gene            complement(466857..467543)
FT                   /locus_tag="Rleg2_0455"
FT   CDS_pept        complement(466857..467543)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0455"
FT                   /product="ErfK/YbiS/YcfS/YnhG family protein"
FT                   /note="PFAM: ErfK/YbiS/YcfS/YnhG family protein; KEGG:
FT                   rec:RHECIAT_CH0000898 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53753"
FT                   /db_xref="GOA:B5ZRC1"
FT                   /db_xref="InterPro:IPR005490"
FT                   /db_xref="InterPro:IPR038063"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZRC1"
FT                   /protein_id="ACI53753.1"
FT                   /translation="MIKLMPGLAAAGLVLSLMSASAFAAPAGSDNTQRPAQVVRVAQMP
FT                   KYVKPEFKRKKVRLVTTEAAGTVIIDTNNKYLYLIEGNNRATRYGIGVGRDGFGWSGVV
FT                   KIGRKAEWPAWTPPAEMRRREAAKGHIIPAFQEGGEDNPLGARAMYLYQGGRDTIFRIH
FT                   GTNQPWTIGLNMSSGCIRMMNEDVTHLYDRAPVGTKVIVIGPGNKQGKVAFEDRGIDVL
FT                   RTLFGG"
FT   sig_peptide     complement(467469..467543)
FT                   /locus_tag="Rleg2_0455"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 25"
FT   gene            complement(467679..468428)
FT                   /locus_tag="Rleg2_0456"
FT   CDS_pept        complement(467679..468428)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0456"
FT                   /product="ErfK/YbiS/YcfS/YnhG family protein"
FT                   /note="PFAM: ErfK/YbiS/YcfS/YnhG family protein; KEGG:
FT                   ret:RHE_CH00814 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53754"
FT                   /db_xref="GOA:B5ZRC2"
FT                   /db_xref="InterPro:IPR005490"
FT                   /db_xref="InterPro:IPR038063"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZRC2"
FT                   /protein_id="ACI53754.1"
FT                   /translation="MMKQLVLAAALFGICSTAALADDRYATRPPVVLSPDLTAPWINQL
FT                   GGGTVRPVVYQRPVVQLQQRGLFQRRVIRQAPQVAPQTVSAINPGIPAIRHPIEPQFLP
FT                   QMVDYDTEEKPGTIVIDTNNRFLYLVMDGGKARRYGVGVGKPGFEWAGAHKITRKQEWP
FT                   DWTPPSEMISREAAKGHYLPARMDGGAENPLGARAMYLGSTLYRIHGTNAPWSIGSAVS
FT                   SGCIRLRNEDVVDLYDRVRVGTRVVVM"
FT   sig_peptide     complement(468363..468428)
FT                   /locus_tag="Rleg2_0456"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.996 at
FT                   residue 22"
FT   gene            468692..469321
FT                   /locus_tag="Rleg2_0457"
FT   CDS_pept        468692..469321
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0457"
FT                   /product="DNA-3-methyladenine glycosylase I"
FT                   /EC_number="3.2.2.20"
FT                   /note="PFAM: methyladenine glycosylase; KEGG:
FT                   ret:RHE_CH00815 DNA-3-methyladenine glycosylase I protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53755"
FT                   /db_xref="GOA:B5ZRC3"
FT                   /db_xref="InterPro:IPR005019"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZRC3"
FT                   /protein_id="ACI53755.1"
FT                   /translation="MSETGIIIGEDGRSRCHWHANLPDYLRYHDEEWGRPVTNDIRLFE
FT                   KICLEGFQSGLSWLTILRKRENFRAAFSGFDFEKVALFGDQDVTRCLADAGIIRHRGKI
FT                   VSTINNARRAIALRDEFGSLAHYFWRYEPGHNERPGVVDREHIVANPTTPTSTIISKDL
FT                   KKRGWTFVGPTTVYAFMQAMGLVNDHLEGCFCRPEVEAMRAVLVRP"
FT   gene            469318..469827
FT                   /locus_tag="Rleg2_0458"
FT   CDS_pept        469318..469827
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0458"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rec:RHECIAT_CH0000901 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53756"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZRC4"
FT                   /protein_id="ACI53756.1"
FT                   /translation="MKEDASVRTLIAAAALLLLTVPALAQTPQLDPGEKLEKLQFPAVT
FT                   MQLKGWTKFGNGHVYTLPVRAGQHMKIDFATKSKFAFLAIFDLSKPDDEAFFGTDEDGM
FT                   SFETTVKENTTWLLRPYYSKVSPRRGLGAPFSILIEPLAAAPKQPQPPAEPERPSLFPK
FT                   APAKQQ"
FT   sig_peptide     469318..469395
FT                   /locus_tag="Rleg2_0458"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 26"
FT   gene            complement(469843..470547)
FT                   /locus_tag="Rleg2_0459"
FT   CDS_pept        complement(469843..470547)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0459"
FT                   /product="Haloacid dehalogenase domain protein hydrolase"
FT                   /note="PFAM: Haloacid dehalogenase domain protein
FT                   hydrolase; KEGG: rec:RHECIAT_CH0000902 putative hydrolase
FT                   protein, HAD superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53757"
FT                   /db_xref="GOA:B5ZRC5"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZRC5"
FT                   /protein_id="ACI53757.1"
FT                   /translation="MTTRPLTTIGFDADDTLWQNEQYYRLTEAHFTGLLADFAEGPKIS
FT                   ERLLEAEKRNLRHYGFGIKGFTLSMIETAIEITEGKVPAGVIAKILDTGRDLLSHPVET
FT                   MPHVRDTLEALSGKYLLVMITKGDLFDQERKLAQSGLGDFFDAVEIVSDKTAVTYRRIF
FT                   AKVGDGPERAMMVGNSLKSDIVPAIAAGSYGVFVPHELTWVLEHVDEPTEAPRFRKIGH
FT                   LGELRDLIDRLA"
FT   gene            470909..471958
FT                   /locus_tag="Rleg2_0460"
FT   CDS_pept        470909..471958
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0460"
FT                   /product="aldo/keto reductase"
FT                   /note="PFAM: aldo/keto reductase; KEGG:
FT                   rec:RHECIAT_CH0000903 putative aldo/keto reductase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53758"
FT                   /db_xref="GOA:B5ZRC6"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZRC6"
FT                   /protein_id="ACI53758.1"
FT                   /translation="MRYNQLGNTGLFVSEICLGTMTFGEAKQGTMWGAIADVDQNAADR
FT                   IVERSLASGVNFIDTADVYSAGESERLLGQALKNLDVPRKDVVIATKVYGVMGDKPNDR
FT                   GASRGHIMDSVEASLKRLQTDHIDLYQIHATDTVTPIEETLRAFDDLVSRGLVRYIGVS
FT                   NWQAWRISKALGLSERRGFARFETVQAYYSIAGRDLERDIVPMMQEEKLGLMVWSPLAG
FT                   GLLSGKYGPGAPGNGEGRRASFDFPPVDKDKAWACVAVMREVAEKHGVSVATVALAYIL
FT                   AKPFVTTVIIGAKHVDQLDQNLAAVKLKLDGDDMTKLDEVSALAPEYPGWMLSRQGAGR
FT                   RPVDFEPKG"
FT   gene            complement(472178..472537)
FT                   /locus_tag="Rleg2_0461"
FT   CDS_pept        complement(472178..472537)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0461"
FT                   /product="protein of unknown function DUF305"
FT                   /note="PFAM: protein of unknown function DUF305; KEGG:
FT                   rec:RHECIAT_CH0000904 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53759"
FT                   /db_xref="InterPro:IPR005183"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZRC7"
FT                   /protein_id="ACI53759.1"
FT                   /translation="MSLKIITLTAMLAIIAAPTLAEDMSMDMSKPMGSHDAASHAFSEA
FT                   NTKMHKDMMIKYSGDADVDFVRGMIPHHQGAIDMAKIELQYGKDAEIRKLAEGVIKAQE
FT                   AEIAEMNAWLKAHGK"
FT   sig_peptide     complement(472472..472537)
FT                   /locus_tag="Rleg2_0461"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 22"
FT   gene            complement(472608..472976)
FT                   /locus_tag="Rleg2_0462"
FT   CDS_pept        complement(472608..472976)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0462"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rec:RHECIAT_CH0000905 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53760"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZRC8"
FT                   /protein_id="ACI53760.1"
FT                   /translation="MRTLALITMVLGWLVYSAMSAWAACPACASMNAPVAVENGSVHHE
FT                   MAGMKMPEGTSHAAPLKEPCTGGDAAHMPLCAACLLLPPTVTVMDGGKSVFGYPAPALA
FT                   RALNDNRPAPQAPPPRLS"
FT   sig_peptide     complement(472905..472976)
FT                   /locus_tag="Rleg2_0462"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.856 at
FT                   residue 24"
FT   gene            complement(473036..473791)
FT                   /locus_tag="Rleg2_0463"
FT   CDS_pept        complement(473036..473791)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0463"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rec:RHECIAT_CH0000906 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53761"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZRC9"
FT                   /protein_id="ACI53761.1"
FT                   /translation="MITEALLYAATWPLTGKPHRKFIRYSVNLWSRAGRCAPDWAEHET
FT                   MSRNAIRAATADLRQKRTAVVLGSGLLRDVPIDELAGAFDTVVLVDLVHLASVRLWLGA
FT                   KGYRNVRLIERDLSGYDDLAAGKEPEPLGFLRSVPYLDFVVSANLLSQIGRGVKRRCEA
FT                   EAGRMPDDTVERLIAAHLAGLSGFSCRNCLVSDIAYAVIDRNGKTHEEADLLHGVPAPP
FT                   SKAAWIWPVAPLGEESRDYRIEHKMIAAW"
FT   gene            473927..475450
FT                   /locus_tag="Rleg2_0464"
FT   CDS_pept        473927..475450
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0464"
FT                   /product="histidyl-tRNA synthetase"
FT                   /EC_number="6.1.1.21"
FT                   /note="KEGG: ret:RHE_CH00821 histidyl-tRNA synthetase;
FT                   TIGRFAM: histidyl-tRNA synthetase; PFAM: tRNA synthetase
FT                   class II (G H P and S); Anticodon-binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53762"
FT                   /db_xref="GOA:B5ZRD0"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR004516"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR015807"
FT                   /db_xref="InterPro:IPR033656"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="InterPro:IPR041715"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5ZRD0"
FT                   /protein_id="ACI53762.1"
FT                   /translation="MNDKQKKPQKLKARLPRGFVDRTAGDIRAVNEMTAKIREVYEHYG
FT                   FDPLETPQFEYTDALGKFLPDSDRPNEGVFSLQDDDEQWMSLRYDLTAPLARHVAENFN
FT                   EIQLPYRTYRAGYVFRNEKPGPGRFRQFMQFDADTVGAPGVQADAEMCMMMADTLEALG
FT                   IKRGDYVVRVNNRKVLDGVLEAIGLGGDDKAGQRLNVLRAIDKLDKFGPEGVALLLGPG
FT                   RKDESGDFTKGAGLDQAQIDKVLFFVGIKDYAESASRLAELVAGTSKGAEGVEELNFIG
FT                   TLVASAGYGADRIKIDPSIVRGLEYYTGPVYEAELSFDVTNEKGEKVVFGSVGGGGRYD
FT                   GLVSRFMGQPVPATGFSIGVSRLMTALKNLGKLGASEVIEPVLVTVMDGDVEAMGRYQK
FT                   MTQDLRAAGIRAEMFQGNWKKFGNQLKYADRRGCPVAIIQGGDERATGVVQIKDLIEGK
FT                   RLSGEIEDNASWREARVAQETVPEADLVAKVREILAAQAEDRKRAGGDV"
FT   gene            475682..476803
FT                   /locus_tag="Rleg2_0465"
FT   CDS_pept        475682..476803
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0465"
FT                   /product="tRNA synthetase class II (G H P and S)"
FT                   /note="PFAM: tRNA synthetase class II (G H P and S); KEGG:
FT                   ret:RHE_CH00822 ATP phosphoribosyltransferase regulatory
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53763"
FT                   /db_xref="GOA:B5ZRD1"
FT                   /db_xref="InterPro:IPR004516"
FT                   /db_xref="InterPro:IPR004517"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR041715"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5ZRD1"
FT                   /protein_id="ACI53763.1"
FT                   /translation="MPLINLPEFASDLLAEFDARKVERIDTPVIQPAEPFLDIAGEDLR
FT                   RRIFMTESETGASLCLRPEFTIPVCLRHIETATGTPKRYAYLGEVFRQRRDGANEFYQA
FT                   GIEDLGDINIPSADARAIGDATGILARLLPGRRLSVTLGDQAVFEAVVQALGLPLGWQK
FT                   RLIHAFGNMTQLEALLAGLVSPQFVTGLDDDVAKLVASGDEQALVSHLEQEMQATGYSA
FT                   NAGRSPLEIARRLKEKLILSETRLDDAAFHVLEEFLSLDVPLVNASAALAGFADAAGLK
FT                   LGNALSRFNGRVAALADAGVDLSCLDYRAAFGRPLDYYTGLVFEVTVEGSAAVLAGGGR
FT                   FDKLLTFLGATDRIPAVGFSFWLDRIETERAAV"
FT   gene            476800..477495
FT                   /locus_tag="Rleg2_0466"
FT   CDS_pept        476800..477495
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0466"
FT                   /product="ATP phosphoribosyltransferase"
FT                   /EC_number="2.4.2.17"
FT                   /note="KEGG: rec:RHECIAT_CH0000909 ATP
FT                   phosphoribosyltransferase protein; TIGRFAM: ATP
FT                   phosphoribosyltransferase; PFAM: ATP
FT                   phosphoribosyltransferase catalytic region"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53764"
FT                   /db_xref="GOA:B5ZRD2"
FT                   /db_xref="InterPro:IPR001348"
FT                   /db_xref="InterPro:IPR013820"
FT                   /db_xref="InterPro:IPR018198"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZRD2"
FT                   /protein_id="ACI53764.1"
FT                   /translation="MTITIALPSKGRMKDEASAIFERAGMPITAVGNDRSYRGRVEGWG
FT                   DVEVAFLSASEISRELGNGTVDFGVTGEDLMREGFSEVDKRVEFCARLGFGHADVVVAV
FT                   PEIWLDVETMADLGDVAADFRARHSRRLAIATKYWRLTQQFFSSQHGIQLYRIVESLGA
FT                   TEGAPASGSADIIVDITSTGSTLRANHLKVLQDGVILHSQACLVRARKESHVDAPVVQA
FT                   IIDAVRAAL"
FT   gene            complement(477580..477993)
FT                   /locus_tag="Rleg2_0467"
FT   CDS_pept        complement(477580..477993)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0467"
FT                   /product="DoxX family protein"
FT                   /note="PFAM: DoxX family protein; KEGG: ret:RHE_CH00824
FT                   hypothetical conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53765"
FT                   /db_xref="GOA:B5ZRD3"
FT                   /db_xref="InterPro:IPR032808"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZRD3"
FT                   /protein_id="ACI53765.1"
FT                   /translation="MSNAIILIARILLSFMFVLSGFMKLTDPAGTAGMIAGAGLPAATL
FT                   LAYVAGLFELLAGLAVLTGFQVRIAGWLLAGFCVFTAVAFHLPYASGAELVNILNQIMV
FT                   MKNITLAGAYILLATVGAGAYSIDARRGAYAAA"
FT   gene            478206..478916
FT                   /locus_tag="Rleg2_0468"
FT   CDS_pept        478206..478916
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0468"
FT                   /product="Glutathione S-transferase domain"
FT                   /note="PFAM: Glutathione S-transferase domain; KEGG:
FT                   ret:RHE_CH00825 glutathione S-transferase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53766"
FT                   /db_xref="GOA:B5ZRD4"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZRD4"
FT                   /protein_id="ACI53766.1"
FT                   /translation="MADLSAFPITKRWPAKNSDIIQLYSLQTPNGVKVSVALEELGLAY
FT                   EPHYVSFAANEQKSPEFESLNPNGRIPAIIDPNGPDGKPIGLFESGAILLYLAEKTGKL
FT                   IPADAAGRYECIQWVFFQMAGIGPMFGQFGHFHKFAADKVANNSYPVERYRDESKRLLG
FT                   VLEGRLKGRQWIMDDQYTIADITTFTWVRGADIFYGGREILDYAKFPAVMDWLQRCIAR
FT                   PASEKGLNIPVKPE"
FT   gene            complement(478979..479425)
FT                   /locus_tag="Rleg2_0469"
FT   CDS_pept        complement(478979..479425)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0469"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rec:RHECIAT_CH0000912 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53767"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZRD5"
FT                   /protein_id="ACI53767.1"
FT                   /translation="MFKIAKANAAVPLTPGSLEHHNQNDEMVAQFSISEAWTGDLSSGM
FT                   LRLGEWSAMLHGLSARDCGLLSLIRCYDSKDRGHILELFEQAATLCSSFCFSTTIVMPN
FT                   GLRQPLFCMGESNGLEEKYSGSMVGVFIFPRFKLEGARQITSPR"
FT   gene            complement(479990..481633)
FT                   /locus_tag="Rleg2_0470"
FT   CDS_pept        complement(479990..481633)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0470"
FT                   /product="chaperonin GroEL"
FT                   /note="TIGRFAM: chaperonin GroEL; PFAM: chaperonin
FT                   Cpn60/TCP-1; KEGG: ret:RHE_CH00828 chaperonin GroEL"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53768"
FT                   /db_xref="GOA:B5ZRD6"
FT                   /db_xref="InterPro:IPR001844"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR018370"
FT                   /db_xref="InterPro:IPR027409"
FT                   /db_xref="InterPro:IPR027410"
FT                   /db_xref="InterPro:IPR027413"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5ZRD6"
FT                   /protein_id="ACI53768.1"
FT                   /translation="MASKEIKFGRTAREKMLRGVDILADAVKVTLGPKGRNVIIDKSFG
FT                   APRITKDGVSVAKEIELEDKFENMGAQMVREVASKTNDIAGDGTTTATVLAQAIVREGN
FT                   KAVAAGMNPMDLKRGIDLAVADVVKDLQAKAKKISTSEEVAQVGTISANGDKQVGLDIA
FT                   EAMQKVGNEGVITVEEAKTAETELEVVEGMQFDRGYLSPYFVTNPEKMIADLEDVFILL
FT                   HEKKLSNLQSMLPVLEAVVQTGKPLLIIAEDVEGEALATLVVNKLRGGLKIAAVKAPGF
FT                   GDRRKAMLEDIAILTGGTVISEDLGIKLESVTLDMLGRAKKVSISKENTTIVDGSGAKS
FT                   DIEGRVAQIKAQIEETTSDYDREKLQERLAKLAGGVAVIRVGGSTEVEVKEKKDRIDDA
FT                   LNATRAAVQEGIVPGGGIALLRSSTKITVKGANDDQEAGINIVRRALQSLVRQIAENAG
FT                   DEASIVVGKVLDKNEDNYGYNAQTSEFGDMIAMGIVDPLKVVRTALQNAASVASLLITT
FT                   EAMIAELPKKESAGGGMPGGMGGMGGMDMM"
FT   gene            complement(481704..482000)
FT                   /locus_tag="Rleg2_0471"
FT   CDS_pept        complement(481704..482000)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0471"
FT                   /product="chaperonin Cpn10"
FT                   /note="PFAM: chaperonin Cpn10; KEGG: rec:RHECIAT_CH0000915
FT                   10 kDa chaperonin, heat shock protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53769"
FT                   /db_xref="GOA:B5ZRD7"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR018369"
FT                   /db_xref="InterPro:IPR020818"
FT                   /db_xref="InterPro:IPR037124"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5ZRD7"
FT                   /protein_id="ACI53769.1"
FT                   /translation="MASTNFRPLHDRVVVRRVESEAKTKGGIIIPDTAKEKPQEGEIVA
FT                   VGSGARDESGKVVALDVKAGDRILFGKWSGTEVKIDGEDLLIMKEADIMGIIG"
FT   gene            482285..483133
FT                   /locus_tag="Rleg2_0472"
FT   CDS_pept        482285..483133
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0472"
FT                   /product="HAD-superfamily hydrolase, subfamily IIA"
FT                   /note="TIGRFAM: HAD-superfamily subfamily IIA hydrolase
FT                   like protein; HAD-superfamily hydrolase, subfamily IIA;
FT                   PFAM: Haloacid dehalogenase domain protein hydrolase; KEGG:
FT                   rec:RHECIAT_CH0000916 putative hydrolase protein, HAD
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53770"
FT                   /db_xref="GOA:B5ZRD8"
FT                   /db_xref="InterPro:IPR006356"
FT                   /db_xref="InterPro:IPR006357"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZRD8"
FT                   /protein_id="ACI53770.1"
FT                   /translation="MARRIESFSEITAHYDVVLCDVWGVVHNGVDPFPKAAAALEAARA
FT                   GGVAVVLITNSPRLSWQVVEQLRQIGVPDSAYDRIVTSGDVTRRLIAEGPKTVFLLGPE
FT                   RDSPLLDGLDVERRPAGEAQSLVCTGFFDDETQKPEDYTDMLLEFKSREVPMICANPDL
FT                   VVERGHRIIPCAGAMAAYYEQLGGSTRIAGKPHRPIYEATLAAARELRGDFPVDRVLAI
FT                   GDGMPTDVRGALNYGLDLLYISGGIHAREYTLNGETDEAILNAYLDRENAAPKWWMPRL
FT                   A"
FT   gene            483160..484143
FT                   /locus_tag="Rleg2_0473"
FT   CDS_pept        483160..484143
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0473"
FT                   /product="riboflavin biosynthesis protein RibF"
FT                   /note="TIGRFAM: riboflavin biosynthesis protein RibF; PFAM:
FT                   FAD synthetase; Riboflavin kinase; KEGG:
FT                   rec:RHECIAT_CH0000917 riboflavin kinase/FMN
FT                   adenylyltransferase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53771"
FT                   /db_xref="GOA:B5ZRD9"
FT                   /db_xref="InterPro:IPR002606"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015864"
FT                   /db_xref="InterPro:IPR015865"
FT                   /db_xref="InterPro:IPR023465"
FT                   /db_xref="InterPro:IPR023468"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZRD9"
FT                   /protein_id="ACI53771.1"
FT                   /translation="MTVFHRNETREPLPAHLKGGVIAIGNFDGVHRGHQSVLNRALEIS
FT                   KARGIPALVLTFEPHPRTVFRPETPVFRLTPAPLKARILETLGFNAVIEYPFDYEFSQR
FT                   SADDFIHSILKDWLGASEVVTGFDFHFGRGREGGPAFLMNAGQTYGFGVTLIDAFRDEN
FT                   ADVASSSHIRALLKEGSVSEVAGMLGYRYTVEAEVIDGEKLGRQLGFPTANMRLPPEVE
FT                   LAAGIYAVRFRRQDGTLHDAVASYGRRPTVTENGAPLLETYLFDFSGDLYGQRCAVSFF
FT                   GYLRPELKFDGLDPLVAQIKRDEEEARALLSGVQPLGELDRKLCFS"
FT   gene            484431..487322
FT                   /locus_tag="Rleg2_0474"
FT   CDS_pept        484431..487322
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0474"
FT                   /product="isoleucyl-tRNA synthetase"
FT                   /note="TIGRFAM: isoleucyl-tRNA synthetase; KEGG:
FT                   rec:RHECIAT_CH0000920 isoleucyl-tRNA synthetase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53772"
FT                   /db_xref="GOA:B5ZRE0"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002301"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR023585"
FT                   /db_xref="InterPro:IPR033708"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZRE0"
FT                   /protein_id="ACI53772.1"
FT                   /translation="MTDTAEKIDYSKTLYLPETDFPMRAGLPQKEPELVKRWQEMGLYK
FT                   KLRASAAGREKFVLHDGPPYANGNIHIGHALNKILKDVINRSFQMRGYDANYVPGWDCH
FT                   GLPIEWKIEEKYREKGRNKDEVPVNEFRRECREFATGWIKTQAEEFKRLGIEGDFDNPY
FT                   TTMNFHAESRIAGELLKIAASGQLYRGSKPIMWSVVERTALAEAEVEYQDYESDTIWVK
FT                   FPVVEGPAALKDAFVVIWTTTPWTIPGNRAVSFSARVSYGLYEVTAAENDFGPRPGEKL
FT                   IFADKLAEESFAKSKLQYKRLSDVSAADFAAMACAHPFKGLDGGYEFAVPLLDGDHVTD
FT                   DAGTGFVHTAPSHGREDFDAWMSAVRTLEARGIDSKIPFPVDDGGFYTSDAPGFEGARV
FT                   IDDNGKKGDANDRVIKALIERNALFARGRLKHQYPHSWRSKKPVIFRNTPQWFVYMDKT
FT                   LADGTTLRSRALGAIDDTRFVPAAGQNRLRAMIEGRPDWVLSRQRAWGVPIAVFADDEG
FT                   EVLVDEAVNARILEAFEQEGADAWFADGAKERFLGNDHDHSRWKQVMDILDVWFDSGST
FT                   HTFTLEDRPDLKWPADLYLEGSDQHRGWFHSSLLESAATRGRAPYNAVLTHGFTMDEKG
FT                   EKMSKSKGNVTAPQEVMKDAGADILRLWVMTSDYADDLRVGKTIIQTNVDAYRKLRNTI
FT                   RWMLGTLAHDKGEEILLADLPELEQLMLHRLAELDELVRENYDAFDFKKIARALIDFAN
FT                   VELSAFYFDVRKDALYCDAPSSLRRRASLHVIRQIFDCMVTWLAPMLPFTTEEAWLSRN
FT                   PSAVSVHLEQFAPVAKEWRNDALAEKWKKIRAVRSVVTGALEIERKDKRIGSSLEAAPV
FT                   VHIADPELMKALEGQDFTEVCITSAIEIAAGEGPAEAFRLAEVPLVSVVPKLAEGEKCA
FT                   RSWRITRDVGSDPEYPDVSARDAAALRELARLA"
FT   gene            487454..488083
FT                   /locus_tag="Rleg2_0475"
FT   CDS_pept        487454..488083
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0475"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rec:RHECIAT_CH0000921 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53773"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZRY0"
FT                   /protein_id="ACI53773.1"
FT                   /translation="MFATHWFRMGACLSVVMAGCSLVSSCASSPTYGTDKTAMEQLTDD
FT                   LGQSVSLTGPDPKNKGVKYTPRPTLVLPAQAQRETLVAPQATVANKDNPQWIESPEETR
FT                   ARLVGEADANSDNPNYRSPLASSAIEGGRRTTEAQTKAYREARALQKGSYVDQRRYISD
FT                   PPPGYRTVDDPAKLDDVGEPELKKQKKRKKDAAVANSGKQWWNFLQ"
FT   sig_peptide     487454..487537
FT                   /locus_tag="Rleg2_0475"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.504 at
FT                   residue 28"
FT   gene            complement(488288..488725)
FT                   /locus_tag="Rleg2_0476"
FT   CDS_pept        complement(488288..488725)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0476"
FT                   /product="CMP/dCMP deaminase zinc-binding"
FT                   /note="PFAM: CMP/dCMP deaminase zinc-binding; KEGG:
FT                   rec:RHECIAT_CH0000922 cytosine deaminase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53774"
FT                   /db_xref="GOA:B5ZRY1"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR028883"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZRY1"
FT                   /protein_id="ACI53774.1"
FT                   /translation="MEMALEEARAAGERGEVPIGAVVVIDDIAVSRSGNRTRELNDVTA
FT                   HAEIAAIRLACEGLGQERLVGADLYVTLEPCTMCAAAISFARIRRLYYGAEDPKGGGVD
FT                   NGVRFYAQPTCHHAPEVYSGFNEVQSAEILRTFFSQKREAP"
FT   gene            488816..490885
FT                   /locus_tag="Rleg2_0477"
FT   CDS_pept        488816..490885
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0477"
FT                   /product="RNA-binding S4 domain protein"
FT                   /note="PFAM: RNA-binding S4 domain protein; pseudouridine
FT                   synthase; KEGG: rec:RHECIAT_CH0000923 probable
FT                   RNA-pseudouridine synthase protein, ribosomal large subunit
FT                   B"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53775"
FT                   /db_xref="GOA:B5ZRY2"
FT                   /db_xref="InterPro:IPR000748"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR018496"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="InterPro:IPR042092"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZRY2"
FT                   /protein_id="ACI53775.1"
FT                   /translation="MTPKDKPKRPGAKPFSRDSGPKAGAKSGGTKPAKAAIAAETEGEA
FT                   KAERISKVMARAGVASRRDIERMIMEGRVTLNGAVLDTPVVNVTLADRIEVDGVPIRGI
FT                   ERTRLWLYHKPAGLVTTNADPEGRATVFDNLPEELPRVMSIGRLDINTEGLLLLTNDGG
FT                   LARALELPATGWLRRYRVRAHGDIDQDALDKLKDGIAVDGVLYGSIEATLDRTQGSNVW
FT                   ITMGLREGKNREIKNVMGALGLDVNRLIRISYGPFQLGDLPEGHVIEVRGRTLRDQLGP
FT                   RLIEEAKANFDAPIYNAPAVAAEEEAEAPVPERREQRPRRDEDKRERALSRLDTKRDDR
FT                   RGGGRRDDDRRDGGRFDDDKPKRPQPLGQRRSANVWMAPGARPLGEKAAAKAAKNEQTA
FT                   RRGEHAPAKGTGSHHIEDRPRTQINRVREEDGEWIRSSEQPNRKDEGEGRKRSFGDRPA
FT                   REDRGFGDRPARGDRRPREGGDERPRSRSSAGEGRPERPRGDRPFGDRPSRGDRPSRGD
FT                   RPFGDKPRGDRKPRGDGDERPRAARASTGEARSERPRGDRPFGDRPSRGDRPFGDKPRG
FT                   ERRPREEGDERPRAARSFAGEGRSERPRGEKSFGDKSPGGRPSSGKPSGDKPRGKGFGA
FT                   KPGGAKSFSGKPKGAKPGGERAGGDRPGGDRPAGGPSRSGGKGKGMTRGADRRR"
FT   gene            490866..491426
FT                   /locus_tag="Rleg2_0478"
FT   CDS_pept        490866..491426
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0478"
FT                   /product="methyltransferase"
FT                   /note="TIGRFAM: methyltransferase; PFAM: Protein of unknown
FT                   function methylase putative; KEGG: rec:RHECIAT_CH0000924
FT                   putative methylase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53776"
FT                   /db_xref="GOA:B5ZRY3"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR004398"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZRY3"
FT                   /protein_id="ACI53776.1"
FT                   /translation="MRIVGGEFRGRPLAVPKSNEIRPTADRTRESLFNILSHAYPECVD
FT                   GTRILDLFAGTGAVGLEAVSRGCRHALFVENSVEGRALLWENIDALGLHGRTRILRRDA
FT                   TDLGSVGNLEAFDVLFADPPYGKGLGEKAMAAAAGGGWLRPGAIAVLEERADIVVSVHP
FT                   SYVFLENRIFGDTRVHFFRYQPQ"
FT   gene            491440..492321
FT                   /locus_tag="Rleg2_0479"
FT   CDS_pept        491440..492321
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0479"
FT                   /product="Patatin"
FT                   /note="PFAM: Patatin; KEGG: rec:RHECIAT_CH0000925 putative
FT                   hydrolase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53777"
FT                   /db_xref="GOA:B5ZRY4"
FT                   /db_xref="InterPro:IPR002641"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZRY4"
FT                   /protein_id="ACI53777.1"
FT                   /translation="MQQAEIISPKLPAISDLPTVAVAFGGGGARGLAHIHIIETLDELG
FT                   IRPVAISGSSMGAIMGAGMAAGMSGAEIREHALTTVGNKTAVVARIWGLRPATVRDAVA
FT                   KGIRIGQFNLERILKAFLPAELPARFEDLLVPMKVITTDYYGQNEVIIEDGELFPALAA
FT                   SSAIPAVFMPVRLRGRVMIDGGISNPVPYEPLMDLADIVIGIDVVGAPEGDGTHIPNRM
FT                   ESIFGSGQLMMQTAITLKLKLCQPHIFLRPAVGRTGVMDFLKAREVLAMSIGVKDELKF
FT                   ALDREIEARLKR"
FT   gene            complement(492334..492951)
FT                   /locus_tag="Rleg2_0480"
FT   CDS_pept        complement(492334..492951)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0480"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: mlo:mlr5353
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53778"
FT                   /db_xref="GOA:B5ZRY5"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011075"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZRY5"
FT                   /protein_id="ACI53778.1"
FT                   /translation="METQTKAARRGPKPNPNTRDNLMRVGVQMLHEAGYTATGIKDIVD
FT                   AAHVPKGSFYNHFESKEAFGKEVVDFYFDGGLVELRARLCDDSIPPIDRLRGYFDERIR
FT                   GFQATDYVRGCMLGNLSLEVADHSVPIRDRLAAHFGTWSGLFEACIAEAQSAGAISNRL
FT                   PAPLLAEFLLNSWEGALLRMRVEKSDEPLRAFVEVAFGSLLI"
FT   gene            493242..494351
FT                   /locus_tag="Rleg2_0481"
FT   CDS_pept        493242..494351
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0481"
FT                   /product="NADH:flavin oxidoreductase/NADH oxidase"
FT                   /note="PFAM: NADH:flavin oxidoreductase/NADH oxidase; KEGG:
FT                   bur:Bcep18194_B1242 NADH-flavin oxidoreductase/NADH
FT                   oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53779"
FT                   /db_xref="GOA:B5ZRY6"
FT                   /db_xref="InterPro:IPR001155"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZRY6"
FT                   /protein_id="ACI53779.1"
FT                   /translation="MHRPSLFSSLHLGRYQLAHRVVMAPLTRMRADAGNVPNALAPEYY
FT                   GQRASSGGLIIAEATQVTPYGQGYPSTPGIHSDEQVRGWRKVTDAVHAKGGLIFLQLWH
FT                   VGRASHASFQPNGVLPVAPSAIAITDQMSLTPEWKQVPYETPRALELDEIPEIVENYLQ
FT                   AARNAMAAGFDGVELHGANGYLLEQFLHDRSNKRTDIYGGSIENRARLLLDVTKAVVEI
FT                   WGSDRVGVRLSPFGTYNDVGDSDPIGLYSHVLSRLMELDIAYVSLIEARPGAGMEIDAP
FT                   QAVDQLRPFWPKALILAGGFTRQSAEETIRSGRADAVAFGRQFIANPDLPLRLKLGAPL
FT                   NSHDRSTFYGGGAAGYVDYPELEAAHAAE"
FT   gene            494435..495085
FT                   /locus_tag="Rleg2_0482"
FT   CDS_pept        494435..495085
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0482"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase; KEGG:
FT                   bpt:Bpet0022 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53780"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZRY7"
FT                   /protein_id="ACI53780.1"
FT                   /translation="MKVVVLAATGQAGRTVLSELISRSHQVTAVARNPDKLPNSIDRVR
FT                   DDLSSVDRIAEIIAGADAVVSAFGPPKDNPRFFSDVTYTDQLAGVAERLIAAVRKAGVP
FT                   RLVVVGGAGSLEFAPGVTVLKSGHWPEALEPIAISHMKAFAALRASDINWTYFSPPMLI
FT                   DPGVRTGKFRLGGDSVIFDEQGRSWVSFEDYAVALVDELENPGHERARFTIGY"
FT   gene            complement(495098..496043)
FT                   /pseudo
FT                   /locus_tag="Rleg2_0483"
FT   gene            complement(496213..498027)
FT                   /locus_tag="Rleg2_0484"
FT   CDS_pept        complement(496213..498027)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0484"
FT                   /product="potassium efflux system protein"
FT                   /note="TIGRFAM: potassium efflux system protein; PFAM:
FT                   TrkA-N domain protein; sodium/hydrogen exchanger; KEGG:
FT                   rec:RHECIAT_CH0000928 glutathione-regulated
FT                   potassium-efflux transporter protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53781"
FT                   /db_xref="GOA:B5ZRY8"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR004771"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZRY8"
FT                   /protein_id="ACI53781.1"
FT                   /translation="MSASNAFFSETILLLGGAVVAAPIFKKLGLGTVLGYLAAGIVIGP
FT                   VFHGITDGEQILAVAELGVVFLLFIIGLELKPSRLWQMRRDIFGLGTAQVVVTGLALTA
FT                   LAWFSEVLDWRGSIVAGFGLALSSTAFAMQILEGDGDVNTRYGQRSFSMLLFQDLAIVP
FT                   LLALITVLDGGGKGSPAPLTDFAVAVGAVAAMVVMGRYLLTPLFQVIARTGAREAMIAA
FT                   ALFVVMGSASLMQLAGLSMAMGAFLSGVMLAESSYRHELEADIEPFRGVLLAIFFIAVG
FT                   LSLQLDVLADNVLFVIVAVPIIMAVKAIIIYGLCRISGSPHDDAIRIAFLLPQGGEFGF
FT                   VLFTAAATVGLMSASTASLLVAIVTLSMALTPIGAALSKRLLSGDEHEELDEDFEGAGA
FT                   DVLMVGFSRFGQIAAQILLAGGRSVTVIEFSADRIRQASSFGFRIYFGDGTRKDVLRSA
FT                   GIDRAKIVLVCTQKKEVTDKVVELVQADYPHTRLYVRSYDRIHSIELRNKGVDYELRET
FT                   LESGLLFGRRTLEALGVPEVDAYEIGEDIRKRDEARLVLQVSEGLQAGRDMLFSHPVRP
FT                   EPLVKPKRAADPFEDDPLAGTVDATAEA"
FT   gene            498147..499493
FT                   /locus_tag="Rleg2_0485"
FT   CDS_pept        498147..499493
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0485"
FT                   /product="peptidase U62 modulator of DNA gyrase"
FT                   /note="PFAM: peptidase U62 modulator of DNA gyrase; KEGG:
FT                   rec:RHECIAT_CH0000929 modulator of DNA gyrase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53782"
FT                   /db_xref="GOA:B5ZRY9"
FT                   /db_xref="InterPro:IPR002510"
FT                   /db_xref="InterPro:IPR035068"
FT                   /db_xref="InterPro:IPR036059"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZRY9"
FT                   /protein_id="ACI53782.1"
FT                   /translation="MSSEIDSSTLLSRASQLIDLARKAGADAADAVVVRSRSQSVSVRL
FT                   GKVEGTESSESDDFSLRVFIGKRVASVSANPGFDLQALAERAVAMAKVSPEDPFACLAD
FT                   EASLAKSYPDLQLLDTTEVSSEMLREAGLAAEAAALAVKGVTNSSGAGASAGMGGLVLA
FT                   TSHGFEGSYMASRFGHSVSVIAGEGTGMERDYDFDSRLYYAELDDPADIGRRAGERVIK
FT                   RINPRQVPTGKDVTVIFDPRVARGFVGHIAGAINGAAVARKSSFLRDRMGQQVLKSGLS
FT                   ITDDPLIVRGPSSRPFDGEGVSGERMVMIEDGVLKHWFLSTSTGRELGLQTNGRGVRGG
FT                   TAVSPSSTNLALEPGDITPEELIRSVGNGFYVTELIGHGVNMITGEYSRGATGFWIENG
FT                   ELTFPVSEVTIASNLKDMFMRLTPANDIDRKFGVAAPTFAIEGMTLAGR"
FT   gene            499567..500376
FT                   /locus_tag="Rleg2_0486"
FT   CDS_pept        499567..500376
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0486"
FT                   /product="inositol monophosphatase"
FT                   /note="PFAM: inositol monophosphatase; KEGG:
FT                   ret:RHE_CH00842 probable inositol monophosphatase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53783"
FT                   /db_xref="GOA:B5ZRZ0"
FT                   /db_xref="InterPro:IPR000760"
FT                   /db_xref="InterPro:IPR020550"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZRZ0"
FT                   /protein_id="ACI53783.1"
FT                   /translation="MSDREKARWQNDLTLIVDAAKEAGAVAFGFFNQSPEVWWKNDDRS
FT                   PVSAADFAANKTLETILRKARPDYGWLSEETDDDADRLAHETLFIIDPIDGTRAFLGGQ
FT                   KLWCVSVAVVHRGRPVAGVLYAPALEELYEAVDGGVALKNGVPFTVSAAGPQETSRLAV
FT                   GEDLLKTFPPEFRDRVSRHKHIPSLAYRIAMVADGRLEGTFVKSNSHDWDLAAADLILS
FT                   CAGGGLVDLDGRPIVYNRADVTHNVLCAAPTPRIGEFLAAFAGRRDS"
FT   gene            500438..500677
FT                   /locus_tag="Rleg2_0487"
FT   CDS_pept        500438..500677
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0487"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rec:RHECIAT_CH0000931 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53784"
FT                   /db_xref="InterPro:IPR025226"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZRZ1"
FT                   /protein_id="ACI53784.1"
FT                   /translation="MTDSGDKKQLLHLVFGGELESLDNVQFRDLKGLDIVGIFPDYATA
FT                   LTAWKSKAQQTVDNAHMRYFIVHMHRLLDPQEKA"
FT   gene            500867..502186
FT                   /locus_tag="Rleg2_0488"
FT   CDS_pept        500867..502186
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0488"
FT                   /product="Three-deoxy-D-manno-octulosonic-acid transferase
FT                   domain protein"
FT                   /note="PFAM: Three-deoxy-D-manno-octulosonic-acid
FT                   transferase domain protein; KEGG: rec:RHECIAT_CH0000932
FT                   3-deoxy-D-manno-octulosonic acid transferase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53785"
FT                   /db_xref="GOA:B5ZRZ2"
FT                   /db_xref="InterPro:IPR007507"
FT                   /db_xref="InterPro:IPR038107"
FT                   /db_xref="InterPro:IPR039901"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZRZ2"
FT                   /protein_id="ACI53785.1"
FT                   /translation="MSSRMARFGLSAYRLAGTVASPVVGLYITYRTAKGKEDRARRLER
FT                   FGYPSANRPQGPLVWFHAASVGETNAVIPLIREIRRRDIHVILTTGTITSARLAAERLG
FT                   NDAIHQYVPLDLKPSVSRFLDYWQPDCAIIAESEIWPATVLELGRRRIPQILINARMSD
FT                   RSFARWRRRPAIAEALFENLALVIAQSDIDAERFRDLGAVPVITSGNLKVDTDAPPYDS
FT                   AVLARYKKQIGDRKTWAAISTFDGEENAAAIVHRALRERDRQLTIIVPRHPDRCDEIEA
FT                   ALVKLGLKVARRTRDDVLSADVDIFLGDTIGEMGLYLRLTEIAFVGRSLFAEGGQNPLE
FT                   PAMLGCAVLSGGHVQNFRDAYQKLARSGSARMVRDTEMLAKGVHYLLTNDEARRNMIEA
FT                   GITAVHEMRGALTATVKGLEPYINPLTVKARLLPKAVAQL"
FT   gene            502196..502918
FT                   /locus_tag="Rleg2_0489"
FT   CDS_pept        502196..502918
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0489"
FT                   /product="HAD-superfamily hydrolase, subfamily IA, variant
FT                   1"
FT                   /note="TIGRFAM: HAD-superfamily hydrolase, subfamily IA,
FT                   variant 1; PFAM: Haloacid dehalogenase domain protein
FT                   hydrolase; KEGG: ret:RHE_CH00845 probable phosphoglycolate
FT                   phosphatase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53786"
FT                   /db_xref="GOA:B5ZRZ3"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZRZ3"
FT                   /protein_id="ACI53786.1"
FT                   /translation="MAAASLIKGILFDKDGTLLDYDESWLPVNRELARIAAEGDPLLAD
FT                   RLLSACGMDPVTGHIVPDSLLAAGNTRQIAEGLVAAGSMVDVVELTVRLDELFSNAAEF
FT                   SVPVTDLAGFFARLHRRGFKLGVASSDNERSIRQTAERFGFARYVDYIAGYDSGFGVKP
FT                   EPGMVLGFCAATGLSPEEVAMVGDNNHDLHMGLNAGTGLRIAVLTGTGSRDSLAAAAHH
FT                   VLDDITALETLLPDLQPA"
FT   gene            503022..504095
FT                   /locus_tag="Rleg2_0490"
FT   CDS_pept        503022..504095
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0490"
FT                   /product="tetraacyldisaccharide 4'-kinase"
FT                   /EC_number="2.7.1.130"
FT                   /note="KEGG: rec:RHECIAT_CH0000934 tetraacyldisaccharide
FT                   4'-kinase protein; TIGRFAM: tetraacyldisaccharide
FT                   4'-kinase; PFAM: Tetraacyldisaccharide-1-P 4'-kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53787"
FT                   /db_xref="GOA:B5ZRZ4"
FT                   /db_xref="InterPro:IPR003758"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5ZRZ4"
FT                   /protein_id="ACI53787.1"
FT                   /translation="MISEAPPFWWRKADWRAWLLLPVSFLYGRIAGHRMAHGRRASVAI
FT                   PVICVGNFTVGGAGKTPTALTIARAAKAKGLKPGFLSRGYGGSLDVTTVVDPDHHRAVA
FT                   VGDEPLLLAREALTVISRRRVDGAQRLVAEGADLIIMDDGFQSARLAIDYALLVIDATR
FT                   GLGNGHIVPAGPVRAPIRQQLRSATALLKVGGGNAADRIVRMAARAAKPYFTASLKVRG
FT                   DNTLAGMKVLAFAGIADPAKFFRTVESRGAEITVAKSFGDHEHLTEDEIDDILTTAERQ
FT                   DLLIVTTSKDFVRLSGHPGKAAQLAEKCRVIEVDMVFEDHLAPSLIIDRAIVACRERRL
FT                   REMKAGIKAMPGKAGPL"
FT   gene            complement(504196..505080)
FT                   /locus_tag="Rleg2_0491"
FT   CDS_pept        complement(504196..505080)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0491"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="PFAM: regulatory protein GntR HTH; GntR domain
FT                   protein; KEGG: xau:Xaut_0172 transcriptional regulator,
FT                   GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53788"
FT                   /db_xref="GOA:B5ZRZ5"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZRZ5"
FT                   /protein_id="ACI53788.1"
FT                   /translation="MRTDTTFKRAFNDMIDIIRAFDLGEELPSENALRAQLGVSRTTVR
FT                   KVLAAMSARGIIVCEAHRRIIREQPRQIERYPKEETLAISEQFETSFMEWMLRGDACPG
FT                   TEINEAELARKFGVATTIVREFLNRFQKYGLIERRQNAGWVFKGFTASFALELFEIREM
FT                   FEMRSARLFATLPDSSPIWKQVRAVRAAHLELLADIDARFQDFSELDSRFHRLIVAVAP
FT                   NRFIESFQDVIAMVFHYHYQWNKRDERARNEVAIGEHLALIDALESRNIALIDHACRSH
FT                   LTSARETLLHSIV"
FT   gene            505285..506238
FT                   /locus_tag="Rleg2_0492"
FT   CDS_pept        505285..506238
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0492"
FT                   /product="Monosaccharide-transporting ATPase"
FT                   /EC_number="3.6.3.17"
FT                   /note="PFAM: inner-membrane translocator; KEGG:
FT                   gtn:GTNG_1814 ribose ABC transporter (permease)"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53789"
FT                   /db_xref="GOA:B5ZRZ6"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZRZ6"
FT                   /protein_id="ACI53789.1"
FT                   /translation="MSLGPLLILIILIAVVSLITPAFLKPGNLGNILAQTAVIALVAMG
FT                   QQLVILTRGVDLSVGSNLALATVIGGLVYQQVDASIAVIMAMLLAGAAVGAVNGVVFVC
FT                   GRLPHPFIITLATLSICRGLALALAPGHTTMRGMPEAITAIGGGTTFGVPNSFLVVGIF
FT                   GLLFLILTKAMVCGRWIYAVGGSPNAARSMGIPVKGVLLSTYIISGFCAGAGAVLLAGR
FT                   TGAASPIYGNLLELDTIAAVIIGGASFLGGRGHLGHALIGAVLIGVIRNALNLLGVDVF
FT                   FQMIAIGLVIVIAVEADVLRNHLEARARVLQSARVQ"
FT   sig_peptide     505285..505359
FT                   /locus_tag="Rleg2_0492"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.781) with cleavage site probability 0.779 at
FT                   residue 25"
FT   gene            506235..506999
FT                   /locus_tag="Rleg2_0493"
FT   CDS_pept        506235..506999
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0493"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: acr:Acry_1972 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53790"
FT                   /db_xref="GOA:B5ZRZ7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZRZ7"
FT                   /protein_id="ACI53790.1"
FT                   /translation="MNAASTPPVLSVRNAQKRFGAIHALKNVSFDAYAGEVTALLGDNG
FT                   AGKSTLVKCISGLHSLDEGEILVDGAPVLLHSTAAARRAGIEIVYQDLALFDNLTPVQN
FT                   FYCGREISFPSWLPRPLRFLNTGVMKREAARVIDRLKVKLPRFDAPVALMSGGQRQAIA
FT                   VARAIVFARKLVILDEPTAALGVRESRQVLDLVNQLKAEGNAVIIITHNMEHVVEIADR
FT                   AVVLRQGRKVGELKPTQANKQDLVAMIVGAEA"
FT   gene            507079..507996
FT                   /locus_tag="Rleg2_0494"
FT   CDS_pept        507079..507996
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0494"
FT                   /product="periplasmic binding protein/LacI transcriptional
FT                   regulator"
FT                   /note="PFAM: periplasmic binding protein/LacI
FT                   transcriptional regulator; KEGG: sma:SAV5704 sugar ABC
FT                   transporter substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53791"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZRZ8"
FT                   /protein_id="ACI53791.1"
FT                   /translation="MKPQSLLGALALLAVAVVPSLAQEPIKLGFITKFPVPFFATMENA
FT                   AKDYAKRNPGVEIIYGQGTSATDIEGQIAQIESMVTRGVQGIALTPVDPTVSTALDKAV
FT                   ASGVKVVLMDNNIPDWKGRTALATTNNFAAGKIAGEYLKTVLKAGDTLGILEGVPGVPA
FT                   LDDRVKGMLEGLQGLDVKIVGKGATNCTEELGISVAEDLLTKNPDLKAIYAACGPPAAG
FT                   AARAIKNSGTANDKIVLVGFDFCCGEEEALKSGVEDASVAQFPTKMAELGVDALVKSIR
FT                   GEKVESLIDSGAALVTPENMAQFK"
FT   sig_peptide     507079..507147
FT                   /locus_tag="Rleg2_0494"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 23"
FT   gene            complement(508113..508343)
FT                   /locus_tag="Rleg2_0495"
FT   CDS_pept        complement(508113..508343)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0495"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rec:RHECIAT_CH0000936 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53792"
FT                   /db_xref="InterPro:IPR018661"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZRZ9"
FT                   /protein_id="ACI53792.1"
FT                   /translation="MNLFEGHGNREAKIRYLDGDFQILSPGSYVVCAMTGKQIPLDELR
FT                   YWSVARQEPYADVISAIEADKRAGVLPNQRR"
FT   gene            complement(508411..510213)
FT                   /locus_tag="Rleg2_0496"
FT   CDS_pept        complement(508411..510213)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0496"
FT                   /product="DNA mismatch repair protein MutL"
FT                   /note="TIGRFAM: DNA mismatch repair protein MutL; PFAM:
FT                   ATP-binding region ATPase domain protein; DNA mismatch
FT                   repair protein domain protein; MutL dimerisation; KEGG:
FT                   rec:RHECIAT_CH0000937 DNA mismatch repair protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53793"
FT                   /db_xref="GOA:B5ZS00"
FT                   /db_xref="InterPro:IPR002099"
FT                   /db_xref="InterPro:IPR013507"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR014762"
FT                   /db_xref="InterPro:IPR014790"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020667"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR037198"
FT                   /db_xref="InterPro:IPR038973"
FT                   /db_xref="InterPro:IPR042120"
FT                   /db_xref="InterPro:IPR042121"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5ZS00"
FT                   /protein_id="ACI53793.1"
FT                   /translation="MAIRQLSETLINQIAAGEVIERPASAAKELIENALDAGATRIEIA
FT                   TAGGGKALLRVSDNGSGMDAADLELAVRRHCTSKLSETLEDIRTLGFRGEALPSIGSVA
FT                   RLSIASRRRDSAGGHEIAVNAGKVAHLRPAAANPGTIVEVRDLFFATPARLKFLKTEKA
FT                   EAGAITEIVKRMAIAFPAVRFVLSGSDRTTLEFPATGDDHLARMAQVLGKDFRDNAIAL
FT                   DAVREEISLTGFAGVPTFNRGNSAHQYAFVNGRPVQDKLILSAIRGAYAETIPSGRHPV
FT                   AVLSITLDPALVDVNVHPAKSDVRFRDPGLVRGLIVGAIREALARDGSRAATTGASDML
FT                   RSFRPGFQPQAQRPQTAWSAETSPFRPYQPTTGFSERPQASFDGLSMPTARAEPPFSPQ
FT                   PAAADTTARYPLGAARAQIHANYIVAQTEDGLVIVDQHAAHERLVFEAMRKALHSKRLA
FT                   SQVLLIPEIVDIPEEDCDRLMQHAAELAELGLAIERFGPGAIAVRETPAMLGEVDAHGL
FT                   IRQLADEIAEWDTASGLSAKLEYVAATMACHGSVRSGRRLRPEEMNALLREMEVTPGSG
FT                   QCNHGRPTYIELKLSDIERLFGRS"
FT   gene            510505..512229
FT                   /locus_tag="Rleg2_0497"
FT   CDS_pept        510505..512229
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0497"
FT                   /product="putative PAS/PAC sensor protein"
FT                   /note="KEGG: rec:RHECIAT_CH0000938 probable two-component
FT                   sensor histidine kinase protein; TIGRFAM: PAS sensor
FT                   protein; PFAM: response regulator receiver; PAS fold-4
FT                   domain protein; PAS fold domain protein; SMART: PAS domain
FT                   containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53794"
FT                   /db_xref="GOA:B5ZS01"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZS01"
FT                   /protein_id="ACI53794.1"
FT                   /translation="MSAGFDKADTSSETDGISAGADLQTALFDVVCDSLSSAFIIYDKN
FT                   DHLIFASRQTLEFFPLPPEMLKPGTRLRDFLGAVYDTGIRQQYDVKQRGSLSREDWLSQ
FT                   KIASHWRERFDAVERHAPDSWVRFVKRRLPGGYGVTIISDISEDKKREEQWRSDLERVQ
FT                   LTEDILDNLPFPLFVKDRNLTYVAVNLAFCEKYQTTADEVLGRKSSDLFSVEIAKRFEE
FT                   SDRHVLETGEMSVSRQRQISRDGIERDIVSRKHRIGKPGRYFLVSTMQDLPRDGADLDE
FT                   FGRASAITTSSNQSYRRAYVPVPSAVERREPAAMEAIVPENFSGRKVLVVTSDLAAETA
FT                   ALRTLSKYGFESCSVRGEDEEERFLEIATSSGISLDLLIIDNQMGMRCLELSEQYGIPA
FT                   LVMDGFQIANELTFQIARHFNRNSRNGGTGADSDWEISISDDVVGLQVLVAEDNDINQI
FT                   VFSQILEGLGYRHMIAATGDEAVRLWAEHRPQIVLMDISLPGFNGFEAARLIRQMEETG
FT                   GTSHTPIIGVLTQAFERDRAECVKAGMDDVIMKPVSPDMLEAVFQRHLLDEVMRARG"
FT   gene            512411..513775
FT                   /locus_tag="Rleg2_0498"
FT   CDS_pept        512411..513775
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0498"
FT                   /product="diguanylate cyclase/phosphodiesterase"
FT                   /note="TIGRFAM: diguanylate cyclase; PFAM: GGDEF domain
FT                   containing protein; EAL domain protein; KEGG:
FT                   ret:RHE_CH00850 putative sensory box/GGDEF family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53795"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZS02"
FT                   /protein_id="ACI53795.1"
FT                   /translation="MMKSADTAFLTVGQNELQAMAYTDPLTGLGNRNRMRDKVLQISSE
FT                   RASDPAPFTIGIANLDSFKPINDLFGSAAGDEILCQVAHRLRACIPDGALVTRHDGDEF
FT                   AFVLPLIFERASAEKFGQMIREVLSAPYDLGDRNVRLSASLGFAIYPFAGEDCEELLKS
FT                   AETALYRSKRRGRGQITVYSREIAQEMKRATQLEQALRNAIISDAIDVHFQPIVSLSNN
FT                   QVVGFEALARWNDPDLGFVSPGVFVPLAEERGFIDALSEALLRKAAEAALSWPRELFLS
FT                   FNLSSAQLMDPGTSSSVLSILGRVGFDPHRLELEITETAVMSSADTAHRIIADLRAAGV
FT                   RISLDDFGTGQSSLGRLRDFIFDKIKIDRAFVSRINSDRASEHIIKAILTMCDGLELEV
FT                   VAEGIEDYAEAVKLRMLGCGMGQGYHFGRPADGIATLRFLHENYYDPTMAERVSA"
FT   gene            complement(513908..514513)
FT                   /locus_tag="Rleg2_0499"
FT   CDS_pept        complement(513908..514513)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0499"
FT                   /product="PRC-barrel domain protein"
FT                   /note="PFAM: PRC-barrel domain protein; KEGG:
FT                   rec:RHECIAT_CH0000940 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53796"
FT                   /db_xref="InterPro:IPR011033"
FT                   /db_xref="InterPro:IPR027275"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZS03"
FT                   /protein_id="ACI53796.1"
FT                   /translation="MTRKLLTTVAAGALFATAFAPAAFSQAAPKPADPAATTQAAPADP
FT                   AAPKPMTPDVTKPAGDAAQAPAAAPTADTAQAGYITEQSPDQVSANTYIGQSVYNGNNE
FT                   SIGSVNDLILKKDGGFVAAIVGVGGFLGIGEKNVAVPMEKITVAQNTQDGSVKLTTSET
FT                   AESLKAAPEFKTLAMQSAEKAPAATGTDTTATGSTTPK"
FT   sig_peptide     complement(514430..514513)
FT                   /locus_tag="Rleg2_0499"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.703 at
FT                   residue 28"
FT   gene            complement(514735..515622)
FT                   /locus_tag="Rleg2_0500"
FT   CDS_pept        complement(514735..515622)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0500"
FT                   /product="SMP-30/Gluconolaconase/LRE domain protein"
FT                   /note="PFAM: SMP-30/Gluconolaconase/LRE domain protein;
FT                   KEGG: rec:RHECIAT_CH0000941 probable gluconolactonase
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53797"
FT                   /db_xref="InterPro:IPR005511"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR013658"
FT                   /db_xref="InterPro:IPR039096"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZS04"
FT                   /protein_id="ACI53797.1"
FT                   /translation="MTDIYEFEGKTLCNTNSVLGEGPTYDPDRNTVWWFNILGKELHEL
FT                   NLSTGAKKVHPLPAMASVLARIDAGRQLIATEEGLFVRDVASGNLTFYAALENDRPENR
FT                   SNDGRTHPSGALWIGTMSKRAENQAGAIYHVAGGKVTKIFNGISIPNSICFSPDGTIGY
FT                   YTDSRLNRLMRVMVDPNTGMPSGEPIVLVDSADEPGDIDGSVVDADGYIWNSRWGAGVV
FT                   DRYSPDGLRISRYKVPAVQPSCPAFIGINADRLAVTTAWEGLDEDARSAQPSAGALLEL
FT                   GIEVKGVFDPVYVI"
FT   gene            complement(515619..516260)
FT                   /locus_tag="Rleg2_0501"
FT   CDS_pept        complement(515619..516260)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0501"
FT                   /product="KDPG and KHG aldolase"
FT                   /note="PFAM: KDPG and KHG aldolase; KEGG: ret:RHE_CH00853
FT                   2-dehydro-3-deoxy-6-phosphogalactonate aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53798"
FT                   /db_xref="GOA:B5ZS05"
FT                   /db_xref="InterPro:IPR000887"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR031338"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZS05"
FT                   /protein_id="ACI53798.1"
FT                   /translation="MNRIPFPDMKRPLIAILRGIRPDETESVVGALIDNGLTAIEIPLN
FT                   SPEPFKSIEIAAKMAPPEVLIGAGTVLTVEAVDSLNAAGGTLLVTPNVEPEVIIRARQY
FT                   GMVTMPGVFTPTEALAAARAGATGLKFFPASVLGPSGITAIRAILPPELTIAAVGGVSD
FT                   KNFGDYTKAGIFAFGLGTSLYKPGMTASEVAERAKATIYAYDAAIGSVSV"
FT   gene            complement(516274..517188)
FT                   /locus_tag="Rleg2_0502"
FT   CDS_pept        complement(516274..517188)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0502"
FT                   /product="2-dehydro-3-deoxygalactonokinase"
FT                   /EC_number="2.7.1.58"
FT                   /note="PFAM: 2-keto-3-deoxy-galactonokinase; KEGG:
FT                   rec:RHECIAT_CH0000943 2-dehydro-3-deoxygalactonokinase
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53799"
FT                   /db_xref="GOA:B5ZS06"
FT                   /db_xref="InterPro:IPR007729"
FT                   /db_xref="InterPro:IPR042257"
FT                   /db_xref="InterPro:IPR042258"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZS06"
FT                   /protein_id="ACI53799.1"
FT                   /translation="MANPAYVAVDWGTSSFRLWLIGRDGSVLAERRSGEGMTSAAKTGF
FT                   SQVLAGHLAAVEAPENLPVIICGMAGARQGWVEAGYIDVPAPLAAILTAAVSVPGESRD
FT                   IRILPGLAQRDMATPDVMRGEETQLLGALGNASAGAQAVCMPGTHSKWVHVGDGKVTGF
FT                   STFMTGELFDVISKHTILSHAVAGAQEQPADAAAFEAAVSAAFARPALASNLLFTARSG
FT                   QLLHGISAASAQARLSGTLIGLEIAGALQDAANSGITLVASGRLQALYEQAFKTLSLPF
FT                   TAIDADAAVRRGLSAAAEAIWPN"
FT   gene            complement(517188..517949)
FT                   /locus_tag="Rleg2_0503"
FT   CDS_pept        complement(517188..517949)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0503"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR
FT                   domain protein; KEGG: rec:RHECIAT_CH0000944
FT                   3-oxoacyl-[acyl-carrier-protein] reductase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53800"
FT                   /db_xref="GOA:B5ZS07"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZS07"
FT                   /protein_id="ACI53800.1"
FT                   /translation="MPAQFPEFRDRTVLVTGGGSGIGAAIVEGFARQGAKVSFIDIAEE
FT                   AGRAFAERLSQETAHPVSFHHADLRDIEAIRRTVDTVVANSGPIRVLVNNAAWDDRHDF
FT                   DAVTEAYWDNNQAVNLRHVFFTSQAAAPSMRAAGGGAIINMSSIAFKLNMGGFPAYAAA
FT                   KAAVVGLTKSMAGRLGPENIRINCILPGMVLTERQMQLWLTEESVARSVEQQCLKVALK
FT                   PDAIVGPCLFLASDCAAGMTAQSLIVDGGIL"
FT   gene            518053..518853
FT                   /locus_tag="Rleg2_0504"
FT   CDS_pept        518053..518853
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0504"
FT                   /product="transcriptional regulator, IclR family"
FT                   /note="PFAM: regulatory protein IclR; Transcriptional
FT                   regulator IclR; KEGG: rec:RHECIAT_CH0000945 putative
FT                   transcriptional regulator protein, IclR family"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53801"
FT                   /db_xref="GOA:B5ZS08"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZS08"
FT                   /protein_id="ACI53801.1"
FT                   /translation="MMNSNSQSMVQSRETGTLGKLMVLLDLVTHADAPLRFTEILALAG
FT                   QPRGTLHRQLSHLVEEGLLELDGDGRYAPGLRLLDFAARSWARNEFRLIAEPHLADLQQ
FT                   ATGETVHLGVLRGQSIIYLDKVDGRQPVRMYSQIGNASPCYCTGVGKAALSLLPADLLA
FT                   DLLAGLNFTRFTASTHLSAESLLAEIREITDQGFAFDREEHEAGIRCVAAPLWSQDRAF
FT                   IGGISITGPAYRLSMELLRQWSVPVQLAAGRIMDDMRIRLGPRR"
FT   gene            519056..519790
FT                   /locus_tag="Rleg2_0505"
FT   CDS_pept        519056..519790
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0505"
FT                   /product="transcriptional regulator, LuxR family"
FT                   /note="PFAM: regulatory protein LuxR; Autoinducer-binding
FT                   domain protein; Bacterio-opsin activator HTH domain
FT                   protein; KEGG: ret:RHE_CH00857 probable transcriptional
FT                   regulator protein, LuxR family"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53802"
FT                   /db_xref="GOA:B5ZS09"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR005143"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036693"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZS09"
FT                   /protein_id="ACI53802.1"
FT                   /translation="MAPLSQTSQEDDDYIKEIAGLKTQFDIFRFLKRVTEAYRSRAFLV
FT                   LNLPPITSLDIQGSTVITSWPAELLALYDQEGLLVNSPVLRRLRTSARPFFYDMSRENW
FT                   SRDDGKSILVASLFERFRMMRGAYFPTHEPSGVRGAISFAGDREPFSPAEMRELCYISI
FT                   HVYDRLAEIRNLDTRITDTLTDREIDCLNWTAAGKTSAEIAEILTLSEHTVNHYLNRAT
FT                   KKLDTVNRTQAVAKALRIGLIK"
FT   gene            520436..521620
FT                   /locus_tag="Rleg2_0506"
FT   CDS_pept        520436..521620
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0506"
FT                   /product="protein of unknown function DUF59"
FT                   /note="PFAM: protein of unknown function DUF59; KEGG:
FT                   rec:RHECIAT_CH0000949 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53803"
FT                   /db_xref="GOA:B5ZS10"
FT                   /db_xref="InterPro:IPR000808"
FT                   /db_xref="InterPro:IPR002744"
FT                   /db_xref="InterPro:IPR019591"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033756"
FT                   /db_xref="InterPro:IPR034904"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZS10"
FT                   /protein_id="ACI53803.1"
FT                   /translation="MTDVTKEQVLETLKTVRGPDLEHDIVELGMVSDVFISDGKVYFSI
FT                   TVPADRAKELEPMRLAAERVVKAMPGVKGALVALTADKKAAAAAPAARPAPNPPHGHAG
FT                   HDHHGHDHGSHAHAPQQQPPRAGKIGVPGIGAIIAVASGKGGVGKSTTAVNLALGLLAN
FT                   GLRVGILDADIYGPSMPRLLKISGRPTQIDGRIINPMENYGLKVMSMGFLVDEETAMIW
FT                   RGPMVQSALLQMLREVAWGELDVLVVDMPPGTGDAQLTMAQQVPLAGAVIVSTPQDLAL
FT                   IDARKGLNMFRKVEVPVLGIVENMSYFIAPDTGTRYDIFGHGGARKEAERIGVPFLGEV
FT                   PLTMNIRETSDAGTPLVASEPNGVVAGIYRGIATKVWEQLGGQTQRPAPSIVFE"
FT   gene            522017..523009
FT                   /locus_tag="Rleg2_0507"
FT   CDS_pept        522017..523009
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0507"
FT                   /product="Mg2 transporter protein CorA family protein"
FT                   /note="PFAM: Mg2 transporter protein CorA family protein;
FT                   KEGG: ret:RHE_CH00860 magnesium/cobalt transporter protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53804"
FT                   /db_xref="GOA:B5ZS11"
FT                   /db_xref="InterPro:IPR002523"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZS11"
FT                   /protein_id="ACI53804.1"
FT                   /translation="MERLPVITAYCSNCRSVEIRDLSHPASFPEDVVWIDMIEPSRDEE
FT                   LYVEKVLGIEVPTRDDLKDIEPSARLYVENDAVFMTASLLWKADTDAPTLTDVAFILAG
FT                   NRLVTIRYAHPKSFALFIAALHRLPENWRSGAALLAKLLETIVDRTAEILEISVARLDI
FT                   LSMHVFGDRAKKTRKPSNYLEEKLRDIAGYHRMISKVRDSLGSLSRLLTFFHTIPAVQQ
FT                   DRETKELCRTLSRDIQSLSEHAAFVAGNITFLLDASLGLINIEQNSIIKIFSIASVVFL
FT                   PPTLVASIYGMNFQVMPELAWAAGYPYSLALMVISAVIPFFFFRWKGWL"
FT   gene            523028..524926
FT                   /locus_tag="Rleg2_0508"
FT   CDS_pept        523028..524926
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0508"
FT                   /product="K potassium transporter"
FT                   /note="PFAM: K potassium transporter; KEGG:
FT                   rec:RHECIAT_CH0000951 potassium transporter protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53805"
FT                   /db_xref="GOA:B5ZS12"
FT                   /db_xref="InterPro:IPR003855"
FT                   /db_xref="InterPro:IPR023051"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZS12"
FT                   /protein_id="ACI53805.1"
FT                   /translation="MSAESHPNESQMTPKKLFYLALGSVGVVYGDIGTSPLYAFREALK
FT                   PVAHDGVTRFEVISLISLMIWALTIIVTIKYVLFLLRADNEGEGGTLSLLALLMKTANG
FT                   HTAILMLLGLMGAALFLGDAMITPALSVLSAVEGLKLVTPSLAEYIVPISVVILALLFV
FT                   VQSRGTGAVARFFGPITAIWFIVMAAAGISHISDDFGILAAFNPYYAVSFLLHEGFYGV
FT                   VVLGAVFLTVTGAEALYADLGHFGRRPIQWAWFALVFPALTLNYLGQGALVLGKPETMS
FT                   DPFYLMFPQWALLPVVILATAATIIASQAVITGAFSMVRQGINLGFLPRMEILFTSETN
FT                   TGQIFVPSVNAVLFIGVIFLVLSFKTSDALATAYGISVTGAMVVTSIMAFEFVRARWNW
FT                   SFPVAVIALAPLVVLELIFLGANLLKIHDGGYIPILIATAFTVIMWTWRRGTAILMEKT
FT                   RHTDIPLPSFVSSIERKSEHSPAQVPGTAIFLTSDPESAPAALLHNLKHNHVLHDRNVI
FT                   LTIRTVNKPRVPSQDRYKVEQISERFSRVELLFGFMESQNVSQALATLRKTGLKFDIMS
FT                   TSFYLGRRKLVPDAKSGMPYWQDRLYIALANAAANPSDYFRLPANRVVELGSHVII"
FT   gene            complement(525036..526181)
FT                   /locus_tag="Rleg2_0509"
FT   CDS_pept        complement(525036..526181)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0509"
FT                   /product="transposase IS4 family protein"
FT                   /note="PFAM: transposase IS4 family protein; KEGG:
FT                   ret:RHE_PA00071 probable insertion sequence transposase
FT                   protein, IS4 family"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53806"
FT                   /db_xref="GOA:B5ZS13"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025399"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZS13"
FT                   /protein_id="ACI53806.1"
FT                   /translation="MRHDNSVFHDLLKRIPWTAFERLVEEHQADKHVRRLSTKSQLIAL
FT                   LYGQLAGATSLREIVGSLQSHGTRLYHLGARPVSRSTFADANGLRPSAVFAELFAQMVA
FT                   RAGRGLKRAVGEAVYLIDGSSLSLAGAGSQWARFSDQACGAKMHVVYDANAERPIYAAV
FT                   TPANVNDITAAKEMPIEAGATYVFDLGYYDFGWWAKLNAAGCRIVTRLKSHTRLTVSAE
FT                   QAVNEDAGILFDRIGLLPQRQAKSRRNPMNRPVREIGVRIETGKVLRIFSNDLTAPAEE
FT                   IAALYKRRWAIELFFRWVKQTLKIRHFLGNNENAVRIQVAVALIAYLLLQMAKADQTSV
FT                   TSPLAFARLVRANLMHRKRIDRLLKPSHSPPISPAQMSLQW"
FT   gene            526475..527683
FT                   /locus_tag="Rleg2_0510"
FT   CDS_pept        526475..527683
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0510"
FT                   /product="cell wall hydrolase SleB"
FT                   /note="PFAM: cell wall hydrolase SleB; KEGG:
FT                   ret:RHE_CH00862 putative cell wall hydrolase protein
FT                   involved in spore germination"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53807"
FT                   /db_xref="GOA:B5ZS14"
FT                   /db_xref="InterPro:IPR011105"
FT                   /db_xref="InterPro:IPR042047"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZS14"
FT                   /protein_id="ACI53807.1"
FT                   /translation="MECSRVPCPELVLRRKSSPRSKLRLLPENWVSPAIFGLAGWLIFP
FT                   SVASHADLAAMLAGLDREGENWRMVLTNSPVGSIHQAELAFADPAVTGSIPSGAGMVLP
FT                   DGRKVAFTKEKGHEDTPDEDRVNRGTKKGRVVAVEKMQPPKDFSAGSILERTRMLFTPN
FT                   FDLKDRSAFVKPKIQGKEIEIATSFYKKQPVVTDNGVPAMLASLVTSDKADVLATAYGP
FT                   AAPDYSRQSPFDSILTEQDSGRFVPQIGPRDHAWAASILSPSVFSAREQQCLASGIYFE
FT                   ARGESVKGQAAVAQVILNRVRNPSYPKTICGVVYQNEDWRNRCQFSFACDSIKDRVNSE
FT                   YHWRMARDVAMAVTSGKIWLPQVGSATHYHAVYVRPKWAKTMEKVGRIGLHVFYRTYGG
FT                   GWS"
FT   gene            527955..528287
FT                   /locus_tag="Rleg2_0511"
FT   CDS_pept        527955..528287
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0511"
FT                   /product="ATP synthase protein, subunit I"
FT                   /note="KEGG: rec:RHECIAT_CH0000953 ATP synthase protein,
FT                   subunit I"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53808"
FT                   /db_xref="GOA:B5ZS15"
FT                   /db_xref="InterPro:IPR016989"
FT                   /db_xref="InterPro:IPR032820"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZS15"
FT                   /protein_id="ACI53808.1"
FT                   /translation="MADDREESLEKRRAQLGAELATKRAEAGVEHASEAQAEVSRKGYA
FT                   QAMKLSSEFIAAIIVGAVLGYVLDRFVGTAPWGMIVLLLLGFCAGVLNVLRSAGVVAHP
FT                   LDDDKK"
FT   gene            528350..529102
FT                   /locus_tag="Rleg2_0512"
FT   CDS_pept        528350..529102
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0512"
FT                   /product="ATP synthase F0, A subunit"
FT                   /EC_number="7.1.2.2"
FT                   /note="KEGG: rec:RHECIAT_CH0000954 ATP synthase protein,
FT                   subunit A; TIGRFAM: ATP synthase F0, A subunit; PFAM:
FT                   H+transporting two-sector ATPase A subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53809"
FT                   /db_xref="GOA:B5ZS16"
FT                   /db_xref="InterPro:IPR000568"
FT                   /db_xref="InterPro:IPR023011"
FT                   /db_xref="InterPro:IPR035908"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5ZS16"
FT                   /protein_id="ACI53809.1"
FT                   /translation="MSNDPTHQFQIFKIVPIEIGGIDFSFTNASLFMAASAAVAVGFLY
FT                   FATSNRAIVPGRSQSVAEMSYEFIANMLKEGAGKQGMKFFPLVFSLFMFVLTANLLGMF
FT                   PYFFTITSQIIVTFALAILVIGTVLVYGFYKHGFHFLNVFVPSGVPGILLPLVVSIEII
FT                   SFLSRPISLSVRLFANMLAGHITLKVFAGFVASLGALGAVGVGGAVLPLIMTVALTGLE
FT                   FLVAFLQAYVFAVLTCMYLNDAIHPGGH"
FT   gene            529171..529398
FT                   /locus_tag="Rleg2_0513"
FT   CDS_pept        529171..529398
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0513"
FT                   /product="H+transporting two-sector ATPase C subunit"
FT                   /note="PFAM: H+transporting two-sector ATPase C subunit;
FT                   KEGG: rec:RHECIAT_CH0000955 ATP synthase protein, subunit
FT                   C"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53810"
FT                   /db_xref="GOA:B5ZS17"
FT                   /db_xref="InterPro:IPR000454"
FT                   /db_xref="InterPro:IPR002379"
FT                   /db_xref="InterPro:IPR035921"
FT                   /db_xref="InterPro:IPR038662"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZS17"
FT                   /protein_id="ACI53810.1"
FT                   /translation="MEAEAAKFIGAGLACFGMAGTALGLGNIFGSYLSGALRNPSAADS
FT                   QFGRLVFGFAVTEALGIFSLLVALLLLFAV"
FT   gene            529476..530099
FT                   /locus_tag="Rleg2_0514"
FT   CDS_pept        529476..530099
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0514"
FT                   /product="H+transporting two-sector ATPase B/B' subunit"
FT                   /note="PFAM: H+transporting two-sector ATPase B/B' subunit;
FT                   ATPase F0 complex subunit 8; KEGG: rec:RHECIAT_CH0000956
FT                   ATP synthase protein, subunit B'"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53811"
FT                   /db_xref="GOA:B5ZS18"
FT                   /db_xref="InterPro:IPR002146"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5ZS18"
FT                   /protein_id="ACI53811.1"
FT                   /translation="MFFVTPAYAEEAPAAATGTDAHAAPAAGEVHTETGVAEGEHARGP
FT                   FPPFDSTTYASQLLWLVITFSVFYLLMQKVIAPRIGAILDQRHTRLSQDLEEAGRLKAE
FT                   ADAAVQTYEGELAAARAKSNAIGAAARDAAKLKAEEDRRAVEASLSEKIKAAEVRIADI
FT                   KAKAFADVGTIAEETAAAVVEQLIGGTAAQADVAAAVAAAKKEA"
FT   gene            530103..530594
FT                   /locus_tag="Rleg2_0515"
FT   CDS_pept        530103..530594
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0515"
FT                   /product="H+transporting two-sector ATPase B/B' subunit"
FT                   /note="PFAM: H+transporting two-sector ATPase B/B' subunit;
FT                   KEGG: ret:RHE_CH00867 F0F1 ATP synthase subunit B"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53812"
FT                   /db_xref="GOA:B5ZS19"
FT                   /db_xref="InterPro:IPR002146"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5ZS19"
FT                   /protein_id="ACI53812.1"
FT                   /translation="MEFHFDATFFAFVGLVLFLALVVYLKVPGMMARSLDDRADQIRNE
FT                   LAEAKRLREEAQHLLAEYQRKRKEAEAEAAHIVAAAEREAQMLTAEAKKKTEEFVANRT
FT                   ALSEQKIKQAEVEAMKAVRSAAVDLAIAAAETVLGKQADAKVQSELFGNAVGQVKTRLN
FT                   "
FT   gene            complement(530894..531583)
FT                   /locus_tag="Rleg2_0516"
FT   CDS_pept        complement(530894..531583)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0516"
FT                   /product="Ribonuclease H"
FT                   /EC_number="3.1.26.4"
FT                   /note="PFAM: ribonuclease HII/HIII; KEGG: ret:RHE_CH00868
FT                   ribonuclease HII"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53813"
FT                   /db_xref="GOA:B5ZS20"
FT                   /db_xref="InterPro:IPR001352"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR022898"
FT                   /db_xref="InterPro:IPR024567"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5ZS20"
FT                   /protein_id="ACI53813.1"
FT                   /translation="MKPRTPPDSPQLFQAVPLVPDFRLELKARKAGHWPVAGADEAGRG
FT                   PLAGPVVAAAVILDPKRIPEGLNDSKQLSAQRREELFVQILATATVSIASSSSTRIDET
FT                   DIRKASLDAMRRAICSLAIPASYVLTDGLDVPPGLDCPGQAVIKGDARSVSIAAASIVA
FT                   KVTRDRMMARAHHVFPDYGFAAHVGYGTAQHRAGIEKLGPCSLHRMSFRPLRKVEDGPQ
FT                   MDELISE"
FT   gene            complement(531887..533044)
FT                   /locus_tag="Rleg2_0517"
FT   CDS_pept        complement(531887..533044)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0517"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: Radical SAM domain protein; SMART: Elongator
FT                   protein 3/MiaB/NifB; KEGG: rec:RHECIAT_CH0000959 putative
FT                   radical SAM domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53814"
FT                   /db_xref="GOA:B5ZS21"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR040086"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZS21"
FT                   /protein_id="ACI53814.1"
FT                   /translation="MREQSLAGQAAFAPTNTADIADAMIVSSGLRIEVDRRRGRGAGLN
FT                   PTGRFEALQRETFDDGWQTLEELPPFRTDVQIEKPRTAITRNESPDIGFDRSINPYRGC
FT                   EHGCIYCFARPTHAYMGLSAGLDFETKLFAKPDAAKLLERELAKPGYKVRAIAIGTNTD
FT                   PYQPIEKEWRIMRGILEVLNKANHPVSIVTKSAMILRDLDILQEMAAKNLVRVGISVTT
FT                   LDRKLARTMEPRAATPPRRLETIHTLSEAGIQTAVMAAPLIPALNDHELERILESAKAA
FT                   GAAEASYVILRLPLEVSPLFRDWLLQHYPDRYRHVMSLVRSMRGGKDYDADFGKRMKGA
FT                   GPYAWQIARRFEMAARRCGLTRRGMPLRDDLFVPPDGSGVQLSLL"
FT   gene            533183..533701
FT                   /locus_tag="Rleg2_0518"
FT   CDS_pept        533183..533701
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0518"
FT                   /product="putative glycosyltransferase protein"
FT                   /note="KEGG: rec:RHECIAT_CH0000960 putative
FT                   glycosyltransferase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53815"
FT                   /db_xref="GOA:B5ZS22"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZS22"
FT                   /protein_id="ACI53815.1"
FT                   /translation="MLTVVLECQDQETELAQTLSVLVAGAVEGLVSDVVVLDHGSRDGS
FT                   SRVADAAGCRFYSQWDMKDIVRSARGEWLLFVEPGARPQAGWIDEIAEYMALNKLPARF
FT                   TASRGYRRPFFQRLGRAVPPLELGLLMPKSEALAAARSGMRLAEFVKGRKLRKLASELI
FT                   PAWVVRAAR"
FT   gene            533922..534236
FT                   /locus_tag="Rleg2_0519"
FT   CDS_pept        533922..534236
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0519"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ret:RHE_CH00871 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53816"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZS23"
FT                   /protein_id="ACI53816.1"
FT                   /translation="MVRDMAYGLLAVILPTLVIAHPHSAASQTMLSCAGRSEVVNFLDK
FT                   NFAEKLTAVGLVNENAVLEVYAAESGTWTLVVTDVHGTSCILLSGDSWETMPTLPGLAT
FT                   "
FT   sig_peptide     533922..534005
FT                   /locus_tag="Rleg2_0519"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.803) with cleavage site probability 0.551 at
FT                   residue 28"
FT   gene            complement(534255..534806)
FT                   /locus_tag="Rleg2_0520"
FT   CDS_pept        complement(534255..534806)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0520"
FT                   /product="molybdenum cofactor biosynthesis protein B"
FT                   /note="TIGRFAM: molybdenum cofactor synthesis domain
FT                   protein; molybdenum cofactor biosynthesis protein B; PFAM:
FT                   molybdopterin binding domain; KEGG: ret:RHE_CH00872
FT                   molybdenum cofactor biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53817"
FT                   /db_xref="GOA:B5ZS24"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR008284"
FT                   /db_xref="InterPro:IPR012245"
FT                   /db_xref="InterPro:IPR013484"
FT                   /db_xref="InterPro:IPR036425"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZS24"
FT                   /protein_id="ACI53817.1"
FT                   /translation="MADQDDNRPFIAVGIAVLTVSDTRTPETDKSGDTLAARITEAGHR
FT                   LVDRAIVPDDREKIAARVKAWTEREEIDVVITTGGTGFTGRDVTPEALEPLFEKRMDGF
FT                   SAIFHRISYEKIGTATIQSRATAGVANATFIFALPGSPGACRDAWDGILKAQLDYRSLP
FT                   CNFVEIMPRLDEHLKRGAMK"
FT   gene            complement(534806..535702)
FT                   /locus_tag="Rleg2_0521"
FT   CDS_pept        complement(534806..535702)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0521"
FT                   /product="4-diphosphocytidyl-2C-methyl-D-erythritol kinase"
FT                   /EC_number="2.7.1.148"
FT                   /note="KEGG: ret:RHE_CH00873
FT                   4-diphosphocytidyl-2-C-methyl-D-erythritol kinase protein;
FT                   TIGRFAM: 4-diphosphocytidyl-2C-methyl-D-erythritol kinase;
FT                   PFAM: GHMP kinase; GHMP kinase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53818"
FT                   /db_xref="GOA:B5ZS25"
FT                   /db_xref="InterPro:IPR004424"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5ZS25"
FT                   /protein_id="ACI53818.1"
FT                   /translation="MPEAGLAEAFGVTEEARAKINLALHVTGQRADGYHLLDMLVTFAD
FT                   CGDRLGFLPAQTDAFTLSGRFGEMLAGDGGTNLVLRARDLLREQFGALAFPVHIHLQKN
FT                   LPVASGIGGGSADAAAALRGLMRLWGMSLPVEALASLALKLGADVPMCLESRPLIARGI
FT                   GEEIEAVPDLPAFAMVLANPLKGVSTPEVFRRLTTKNNSALSLAPGLSGSAGWLAVIDA
FT                   ARNDLEPPARQLVPEIAVISAMLQARGALLTRMSGSGATCFGIFASMAEAQDAAAALHG
FT                   ERPDWYFQATETVSGGM"
FT   gene            complement(535715..537547)
FT                   /locus_tag="Rleg2_0522"
FT   CDS_pept        complement(535715..537547)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0522"
FT                   /product="Tetratricopeptide TPR_2 repeat protein"
FT                   /note="PFAM: TPR repeat-containing protein;
FT                   Tetratricopeptide TPR_2 repeat protein; SMART:
FT                   Tetratricopeptide domain protein; KEGG:
FT                   rec:RHECIAT_CH0000964 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53819"
FT                   /db_xref="InterPro:IPR001440"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZS26"
FT                   /protein_id="ACI53819.1"
FT                   /translation="MRQRIAIRLLTSAALAAVLSLGGVGGANAEDAAKPSDVAKTDSFD
FT                   ADSVTTFSGAFLAARTADVDHDYETAIELYKKALQIEPGNPEIRQRLMISLLLNGDIKD
FT                   GVKYANDLKGDPSVERITTIVRGMDAVRRDDYKTAESILKYNGPNDLDRMMNDLLLAWA
FT                   RVGAGRGKEALAMVEKMKGPDWVRIFQNYNAGAIAIATGDVKSARKHLNDAVLDKEGGA
FT                   TAPDTFMRAVMALARLEATQGNKQKALDAVSVGDNLLPNYAPLNALRDSIEKDEKQEQQ
FT                   VKTAEEGAAGVLFSVGGALNRDGAEDIVSLYLQTANALDPNSADTLVLLGGIAEKQNQM
FT                   DRAIALYKKVPENSPMRRISELQLGLALAQGGKVDEARKHLQALIASDPKDIRSYLAYG
FT                   SVLSDAKDYEAMAANYDKAVDAIGPIPGRANWSVFFQRGIAYERLKKWDQAEPNFRKAL
FT                   ELNPDQPQVLNYLGYSWIDMNRNLDEGLGMIKKAVDLRPDDGYIIDSLGWAYFRLNRFD
FT                   DAVDELERAAQIKAGDATINDHLGDAYWRVGRKLEAVYQWNRALASEPEAAEIPKIKDK
FT                   VANGLPAVSDDAKAADKKQPDPAPVTPPPVDKKS"
FT   sig_peptide     complement(537458..537547)
FT                   /locus_tag="Rleg2_0522"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.998 at
FT                   residue 30"
FT   gene            complement(537681..538697)
FT                   /locus_tag="Rleg2_0523"
FT   CDS_pept        complement(537681..538697)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0523"
FT                   /product="Polyprenyl synthetase"
FT                   /note="PFAM: Polyprenyl synthetase; KEGG:
FT                   rec:RHECIAT_CH0000965 octaprenyl-diphosphate synthase
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53820"
FT                   /db_xref="GOA:B5ZS27"
FT                   /db_xref="InterPro:IPR000092"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="InterPro:IPR033749"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZS27"
FT                   /protein_id="ACI53820.1"
FT                   /translation="MGVVIPLEESKNKLASIKPLVDLTRADMERVNQLILSKAGSDVQM
FT                   IPEVANHLISSGGKRLRPMLTLAAASLFDYRGENHVKLATSVEFMHTATLLHDDVVDES
FT                   DLRRGKSTARMIWGNQASVLVGDFLLGQAFRMMVDVGSLDALDVLSSAACIIAEGEVLQ
FT                   LSVAKNMETTEDDYLSVIRAKTAALFAAAAEVGPIVAEAGKSGRNALKSYGMNLGLAFQ
FT                   LVDDALDYGGKAADLGKNVGDDFREGKITLPVILAYRRGTEDERAFWRDAIEAGNSTDA
FT                   NLEKALGLITKYGTLSDTIGRAVHYGTIARDALAPLPDTVWKSSLMEVIDFCIERVN"
FT   gene            538806..539033
FT                   /locus_tag="Rleg2_0524"
FT   CDS_pept        538806..539033
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0524"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ret:RHE_CH00876 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53821"
FT                   /db_xref="GOA:B5ZS28"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR018551"
FT                   /db_xref="InterPro:IPR036675"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZS28"
FT                   /protein_id="ACI53821.1"
FT                   /translation="MHELIRANDAVLLSFAESLMKDAGIHCFIADQGMSVLEGSLGMLP
FT                   RRLLVDEEMADQARRILIDAGLGDELRDRT"
FT   gene            539041..539817
FT                   /locus_tag="Rleg2_0525"
FT   CDS_pept        539041..539817
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0525"
FT                   /product="methyltransferase small"
FT                   /note="PFAM: methyltransferase small; KEGG:
FT                   rec:RHECIAT_CH0000967 putative methyltransferase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53822"
FT                   /db_xref="GOA:B5ZS29"
FT                   /db_xref="InterPro:IPR007848"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZS29"
FT                   /protein_id="ACI53822.1"
FT                   /translation="MTGEPAQTIDAFHRGAFHVVQPSGRGHRSGMDAMLLAALVADDRP
FT                   VRVADLGAGAGAAGLAVASRLAQAEVVLFERSAEMADYARRSILLPENAHLAARVGVIE
FT                   ADVTLTAKARNDAGLIDESFHHVIMNPPFNHVGDRRTPDALKAEAHAMTDGLFESWIRT
FT                   AGAIMIPGGQLSLIARPQSIAEIIAACGRRFGGIEITAIHPRQGENAVRILVTGIKGSR
FT                   ARLSLRAPLIMHEEGSHKFSPLVDDFNNGRAAYARL"
FT   gene            complement(539844..541184)
FT                   /locus_tag="Rleg2_0526"
FT   CDS_pept        complement(539844..541184)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0526"
FT                   /product="Mn2+/Fe2+ transporter, NRAMP family"
FT                   /note="TIGRFAM: Mn2+/Fe2+ transporter, NRAMP family; PFAM:
FT                   natural resistance-associated macrophage protein; KEGG:
FT                   ret:RHE_CH00878 manganese transport protein MntH"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53823"
FT                   /db_xref="GOA:B5ZS30"
FT                   /db_xref="InterPro:IPR001046"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZS30"
FT                   /protein_id="ACI53823.1"
FT                   /translation="MDALNPNANRGWRHERGEASLSDVYRTVGTGRHSSRWRRAAAFAG
FT                   PGYMVAVGYMDPGNWATSLAGGSKFGYALLTVALLSNLMAIVLQSLCARLAIASGRDLA
FT                   QACRDAFPRYVSVPLWAFAEIAIIATDIAEVIGTAIGLNLLMGIPLELGVLITALDVFV
FT                   ILFLQKLGFRWVEAFIIALLGVIAICFGVQILLADPQWGAVVTGFFPTTEIVTNPEMLY
FT                   LALGILGATVMPHNLYLHSGIVQTRAYGHTVPEKKEALTFATIDSTVALCFALLINASI
FT                   LILAAAAFNANGKTDVVELGDAYSLLSPLLGLAIAPTLFGIALLCCGLNSTVTATLAGQ
FT                   IVMEGFLKIRLKPWIRRLITRAIAIVPAAIVTIWYGDKGTAELLILTQVVLSLQLSFAV
FT                   FPLVMFTANKAKMGELVAPRWLSGIAYLIAIVIAGLNVKLLFDFVTG"
FT   gene            541417..542277
FT                   /locus_tag="Rleg2_0527"
FT   CDS_pept        541417..542277
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0527"
FT                   /product="peptidase S49"
FT                   /note="PFAM: peptidase S49; KEGG: ret:RHE_CH00879 protease
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53824"
FT                   /db_xref="GOA:B5ZS31"
FT                   /db_xref="InterPro:IPR002142"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZS31"
FT                   /protein_id="ACI53824.1"
FT                   /translation="MAGFWRKLLPKRFRKNGITIPVVRLQGPIVSGGGPFRPALNLANV
FT                   APVLEKAFAMKDAPAVAITINSPGGSPVQSRLIFTRIRELAREKQKKVLVFVEDVAASG
FT                   GYMIALAGDEIIADSTSIVGSIGVVSGGFGFPELLKKIGVERRVYTAGENKVILDPFQP
FT                   EKEKDIEYLKSLQLEIHQVFISMVRERRAGKLRDDAAVFSGLFWSGTRGLELGLVDGLG
FT                   DMRQELKRRYGQKTKLELVAAGRGLFGRRVPGVSPVSLESAASGLATGLVEAAEERALW
FT                   SRFGL"
FT   gene            542296..542487
FT                   /locus_tag="Rleg2_0528"
FT   CDS_pept        542296..542487
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0528"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rec:RHECIAT_CH0000970 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53825"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZS32"
FT                   /protein_id="ACI53825.1"
FT                   /translation="MAQLITILVLVFSAWWLYRRFVSDARKLAEKSRRAERERQTGAIG
FT                   TLVKDPVTGEYRLKRDEE"
FT   gene            542722..543657
FT                   /locus_tag="Rleg2_0529"
FT   CDS_pept        542722..543657
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0529"
FT                   /product="glycyl-tRNA synthetase, alpha subunit"
FT                   /EC_number="6.1.1.14"
FT                   /note="KEGG: ret:RHE_CH00881 glycyl-tRNA synthetase subunit
FT                   alpha; TIGRFAM: glycyl-tRNA synthetase, alpha subunit;
FT                   PFAM: glycyl-tRNA synthetase alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53826"
FT                   /db_xref="GOA:B5ZS33"
FT                   /db_xref="InterPro:IPR002310"
FT                   /db_xref="InterPro:IPR006194"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5ZS33"
FT                   /protein_id="ACI53826.1"
FT                   /translation="MNPKRSFQALILTLHSYWADKGCAVLQPYDMEVGAGTFHPATTLR
FT                   ALGPKPWKAAYVQPSRRPSDGRYGENPNRLQHYYQYQVILKPNPPNLQELYLGSLAAIG
FT                   LDPLLHDIRFVEDDWESPTLGAWGLGWECWCDGMEVSQFTYFQQVCGIECAPVAGELTY
FT                   GLERLAMYVQGVDNVYDLNFNGREGDEKISYGDVFLQAEQEYSRHNFEFANTEMLHRHF
FT                   VDAEKECRALLDAGAPADNANQRLHKCVFPAYDQCIKASHVFNLLDARGVISVTERQSY
FT                   ILRVRTLAKACGEAFLLTDAGGVNLSKEAA"
FT   gene            543733..544779
FT                   /locus_tag="Rleg2_0530"
FT   CDS_pept        543733..544779
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0530"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rec:RHECIAT_CH0000973 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53827"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZS34"
FT                   /protein_id="ACI53827.1"
FT                   /translation="MFRSRIDSVCLLKSAILYFKIAFENCAARVPRLLSWLTPCAILVL
FT                   LTSCSDFDNEFTVQSANTTIEVSTDGTAFVSESFDILVKRAVNYGGVYVDIPQRFTDAS
FT                   GGVHWRDFKLAAARRDGQDEYYSRENNVPGHSIYIGAEHCKSCSADLPIGLTKIQIAYW
FT                   LGRLVRQEGDREILFLPAYLGRVHGQGAKKTLTLRLPPGGTLRPAQPNRAVAYAIMRSA
FT                   PNEILVSIPAGKGDRVLPDIEIEYPAGTFVTLTSGKRVQWWLSDHFLPFLSMLGPLIVG
FT                   LVVILKFRPSWLACTIDNCQYQNDGKHIPGSGSLSVPELEGRCGKSGLHGVCLSSRSQT
FT                   NASHFQSG"
FT   gene            544958..545566
FT                   /locus_tag="Rleg2_0531"
FT   CDS_pept        544958..545566
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0531"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rec:RHECIAT_CH0000973 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53828"
FT                   /db_xref="GOA:B5ZS35"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZS35"
FT                   /protein_id="ACI53828.1"
FT                   /translation="MHRTVAEEYLKIRGIDRWSLAAAASILALGIAVASFSGLFLFSAA
FT                   ISGLLLTVFLVVAMFRHPERFPVATGTFEQFKQAMSLIVGLPMMAIVALVYIGTTEVIS
FT                   EQWPYLMAILLHIVGVIAVLAMLRIPTSKQWQIRNNILSLKRYFHGEINGPAMSVECYE
FT                   HYLPFAVALDVEQRWTERFNLWRESQKMEAYAPDWLITS"
FT   sig_peptide     544958..545071
FT                   /locus_tag="Rleg2_0531"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.817) with cleavage site probability 0.277 at
FT                   residue 38"
FT   gene            545682..546233
FT                   /locus_tag="Rleg2_0532"
FT   CDS_pept        545682..546233
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0532"
FT                   /product="LemA family protein"
FT                   /note="PFAM: LemA family protein; KEGG:
FT                   rec:RHECIAT_CH0000974 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53829"
FT                   /db_xref="GOA:B5ZS36"
FT                   /db_xref="InterPro:IPR007156"
FT                   /db_xref="InterPro:IPR023353"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZS36"
FT                   /protein_id="ACI53829.1"
FT                   /translation="MYVILALIVVVALYIVFIYNGLVRSRQMAEEAWSGIDVQLKRRAD
FT                   LIPNLIETVKGYAAHEKSTLEEVVALRNKAQAVPSGDVAGRAQAEGLLGQALGRVIALA
FT                   EAYPDLKANQNFAELQASLETMEGELQMARRYYNGAARDLNVKVESFPSNLVAGQFGFA
FT                   KREYFEITNEADRAVPSVKF"
FT   gene            546324..547586
FT                   /locus_tag="Rleg2_0533"
FT   CDS_pept        546324..547586
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0533"
FT                   /product="3-phosphoshikimate 1-carboxyvinyltransferase"
FT                   /EC_number="2.5.1.19"
FT                   /note="KEGG: rec:RHECIAT_CH0000975 3-phosphoshikimate
FT                   1-carboxyvinyltransferase protein; TIGRFAM:
FT                   3-phosphoshikimate 1-carboxyvinyltransferase; PFAM: EPSP
FT                   synthase (3-phosphoshikimate 1-carboxyvinyltransferase)"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53830"
FT                   /db_xref="GOA:B5ZS37"
FT                   /db_xref="InterPro:IPR001986"
FT                   /db_xref="InterPro:IPR006264"
FT                   /db_xref="InterPro:IPR013792"
FT                   /db_xref="InterPro:IPR023193"
FT                   /db_xref="InterPro:IPR036968"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5ZS37"
FT                   /protein_id="ACI53830.1"
FT                   /translation="MTRTAKLTIIPPGKPLSGRAMPPGSKSITNRALLLAGLAKGTSRL
FT                   TGALKSDDTRYMADALRAMGVSIDEPDDTTFVVTGSGRLQPPKAPLFLGNAGTATRFLT
FT                   AAAALVDGTVVVDGDEHMRKRPIGPLVEAMRTLGIDVTAETGCPPVTVKGTGRFQADRI
FT                   RIDGGLSSQYVSALLMMAAGGDRPFDIELVGEDIGALGYIDLTTAAMKAFGAKVEKTSP
FT                   VTWRVEPTGYRAADFIVEPDASAATYLWAAEVLTGGAIDLGVPSDAFSQPDARAYDMIA
FT                   RFPQLPAEIDGSQMQDAVPTLAVLAAFNETPVRFVGIANLRVKECDRIRALSSGLNRIR
FT                   PGLAREEGDDLIVKSDPALVGKRLPAEIDSFADHRIAMSFALAGLKIDGITILDPDCVG
FT                   KTFPAYWRTLAALGVTYQDKD"
FT   gene            547623..549557
FT                   /locus_tag="Rleg2_0534"
FT   CDS_pept        547623..549557
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0534"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ret:RHE_CH00885 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53831"
FT                   /db_xref="GOA:B5ZS38"
FT                   /db_xref="InterPro:IPR018702"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZS38"
FT                   /protein_id="ACI53831.1"
FT                   /translation="MGRRFFGFCLALLLMLAASAAFAAEVIDNFASAIQLEKSGAMTVA
FT                   ETITVNAEGNRINHGIFRDFPLYFTDAEGRRRSVDFDMVSVTRDGEDEPWHTESISGGI
FT                   RIYAGSADVSVTPGRHRYVFTYKTNRQIRYFDDHDELYWNVTGNGWIFPIRSATATVTL
FT                   PPGVTATETTFFTGPQGATGKNARVSETGAGLVFATTAPLDANEGLTFAVRMPKGSIDP
FT                   PSADMESTWWLKDNRNYFIGFGGLILVFAYYLRSWLKVGRDPARGVVVPRWDAPDGISP
FT                   ALVNYIDNKGFSGGGWTALASTALNLAVRGYVKLEDLKNSIVIRGTGKPLGKEKFQAGE
FT                   AELLRVAGGAGATLTIDKANGERVKSVGQSFRSAIEKEHRGKYYNSNIGYTTGGIALSA
FT                   AALVALFVFGSLQPDTIALMLVPTAISVFVAVFVAGFMRSMHRGNSLFGKIVAIIATAV
FT                   GVFVGISILAVVVLALASSLVQLHETPMLFAVGGIVLLNILYFFIMGAPTPLGARMMDG
FT                   IDGLRQYLTLAEKDRMNTAGAPEMSPQHFETLLPYAVALGVEKPWSRAFETWLAAAAAG
FT                   AAAAYAPTWYSGNFNSGSFSDRVGGFSSSMASTIASTIPSPPPSSSSSGFSGGGSSGGG
FT                   GGGGGGGGW"
FT   sig_peptide     547623..547694
FT                   /locus_tag="Rleg2_0534"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 24"
FT   gene            549623..550906
FT                   /locus_tag="Rleg2_0535"
FT   CDS_pept        549623..550906
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0535"
FT                   /product="phosphoribosylamine/glycine ligase"
FT                   /EC_number="6.3.4.13"
FT                   /note="KEGG: rec:RHECIAT_CH0000977
FT                   phosphoribosylamine-glycine ligase protein; TIGRFAM:
FT                   phosphoribosylamine/glycine ligase; PFAM:
FT                   phosphoribosylglycinamide synthetase; protein of unknown
FT                   function DUF201"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53832"
FT                   /db_xref="GOA:B5ZS39"
FT                   /db_xref="InterPro:IPR000115"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR020559"
FT                   /db_xref="InterPro:IPR020560"
FT                   /db_xref="InterPro:IPR020561"
FT                   /db_xref="InterPro:IPR020562"
FT                   /db_xref="InterPro:IPR037123"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZS39"
FT                   /protein_id="ACI53832.1"
FT                   /translation="MKVLLIGSGGREHALAWKLAQSPLMTEFYAAPGNPGIAEHAMLVP
FT                   VNIEDHEAVAAFCKDKAIDFVVVGPEAPLVAGLADRLRADGLVVFGPSAAAAQLEGSKG
FT                   FTKDICARYGIPTGAYQRFNNAPKAKAYIRDQGVPIVVKADGLAAGKGVTVAMTLDEAL
FT                   AAVDDCFEGAFGAAGAEVVVEAYLDGEEASFFCLCDGKNALPLATAQDHKRVGEGDTGV
FT                   NTGGMGAYSPAPVMTAEMVERTMKEIIEPTMRGMAESGHPFSGVFFAGLMITSRGPELI
FT                   EYNVRFGDPECQVMMMRLKSDLLPLLLATANGTLDQMSAEWSDDPALTVVMASKGYPAA
FT                   YEKNTPILSLPEAGEGEKVFHAGTGLKDGALVATGGRVLNVTASGGTVAEAKDRAYALL
FT                   DRVKWDNGFSRRDIGWRAIERETGSDKV"
FT   gene            551000..551461
FT                   /locus_tag="Rleg2_0536"
FT   CDS_pept        551000..551461
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0536"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rec:RHECIAT_CH0000978 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53833"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZS40"
FT                   /protein_id="ACI53833.1"
FT                   /translation="MRQIFLGAAILLMAGSAMASSIEVIGKTAAPAEGSIVTESCAACP
FT                   PLQAELIKKDYTVPELKPGVLQASEVRDVDGEKKIYRTEGWMGGSPVVFVSKATPETTI
FT                   AAAPSAPSADGIDMSATTAAVIGGDAKPVVAGMAEQPAALNVSDFELRF"
FT   sig_peptide     551000..551059
FT                   /locus_tag="Rleg2_0536"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.988 at
FT                   residue 20"
FT   gene            551894..553711
FT                   /locus_tag="Rleg2_0537"
FT   CDS_pept        551894..553711
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0537"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="PFAM: histidine kinase HAMP region domain protein;
FT                   chemotaxis sensory transducer; Cache type 2 domain protein;
FT                   KEGG: ret:RHE_CH00888 methyl-accepting chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53834"
FT                   /db_xref="GOA:B5ZS41"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR033480"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZS41"
FT                   /protein_id="ACI53834.1"
FT                   /translation="MKNLKISKQLILLVVGLMIAFAVATSLQIRSSVDAIYKERYDMLR
FT                   AEVQSAVSVLKLYQAKVTAGEMTLEEAQKQAYATVNAMKYDPDGYFFGYSYDIQMMFHF
FT                   DASKIGQVNKGQPDSKGKLYREELVRLGQQGGGLVEYYSTAKPGQPAGDFRKTAYAQAF
FT                   DPWKVVVVTGVYMEDLDAQINSTILTALSGSIILFFLAIAAAYLVIRGISGPLNNVHAA
FT                   LKAVAEEDVSIAIPHAGMNNEVGMMAKATQSLQEKIRERHAMSDREAAQQLALENEREN
FT                   NQRQQQDETALQARVVATIGQALEMIARGDLTVRCADLGQKYAALRDNFNDALSHLEAA
FT                   MAKVSAKGTDIGTSKEEIRRASNELSQRTERQAASLEETSAALDELTVAVRQTADGAHE
FT                   ASKRVHSVSNEATHSDAIVGQAIEAMSGIEKSSSEITKIIGVIDEIAFQTNLLALNAGV
FT                   EAARAGESGKGFAVVAQEVRELAQRSAAAAKEIKDQIARSSSQVEHGVRLVGEAGEALK
FT                   RISDQIKAANEIVAKIAHSASEQDTTLRSISSSMNQLDAATQQNAAMAEETTASAETLA
FT                   SDTDELIDLIRGFRVSAAAPALHQGRRAA"
FT   sig_peptide     551894..551968
FT                   /locus_tag="Rleg2_0537"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.818 at
FT                   residue 25"
FT   gene            complement(554083..556266)
FT                   /locus_tag="Rleg2_0538"
FT   CDS_pept        complement(554083..556266)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0538"
FT                   /product="glycyl-tRNA synthetase, beta subunit"
FT                   /EC_number="6.1.1.14"
FT                   /note="KEGG: rec:RHECIAT_CH0000980 glycyl-tRNA synthetase
FT                   protein, beta subunit; TIGRFAM: glycyl-tRNA synthetase,
FT                   beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53835"
FT                   /db_xref="GOA:B5ZS42"
FT                   /db_xref="InterPro:IPR006194"
FT                   /db_xref="InterPro:IPR008909"
FT                   /db_xref="InterPro:IPR015944"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZS42"
FT                   /protein_id="ACI53835.1"
FT                   /translation="MPNLLLELRSEEIPARMQRKAAGDLKKLVTDALVEAGLSYEGARE
FT                   YWTPRRLALDIHGLTARSADVREERKGPRTDANEKAIEGFLRGAGLSSVSEAQVVSDPK
FT                   KGDFYVAVISKPGRAAEEIVAEVMPGIIRDFPWPKSMRWGKASSRPGAMRWVRPLQSIV
FT                   CTFGPEHEETVVIPFEIDGITASNTTYGHRFHAPEAITVRRFDDYAASLEKAKVILDAE
FT                   RRKDIILHDARDIAFANGLELVEDEGLLEEVSGLVEWPQVLMGSFEEDYLSIPSEIIRL
FT                   TIKTNQKCFVTRKQGEETLSNKFILVSNIQAHDGGKEIVHGNGKVVRARLSDALHFWKR
FT                   DQGDLPDLETLTASAAKFGLDLKKPLDQRMAKLDALDVTFHAKLGTQGARVARIRALAE
FT                   ELAKITGADAALTDRAAVLAKADLRTEAVGEFPELQGLMGRKYAGLQGENGSVAAAIED
FT                   HYKPQGPSDRVPADKVAITVALADKLDTLIGFWAIGEKPTGSKDPFALRRAALGVVRIL
FT                   LERNVRLPLLTIMSQTSLLAKTGGDTVFAFAGDPAETFFDLLSFFHDRLKVYLRDQGAR
FT                   HDLIDAVLTSDADDLLMVARRVEALTAFITSEDGKNLLAGTKRATQLLAAEEKKGTVIA
FT                   DAVSPALLKLDAEKELFAAISGASKEAADAVASEDFRSAMAALSKLRGPVDRFFEDVLV
FT                   NDEDAAIRANRLALLRLIREATGTVADFSKISG"
FT   gene            556695..559004
FT                   /locus_tag="Rleg2_0539"
FT   CDS_pept        556695..559004
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0539"
FT                   /product="RNA binding S1 domain protein"
FT                   /note="PFAM: RNA binding S1 domain protein; SMART:
FT                   Resolvase RNase H domain protein fold; KEGG:
FT                   rec:RHECIAT_CH0000981 probable transcriptional accessory
FT                   protein (RNA binding S1 domain)"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53836"
FT                   /db_xref="GOA:B5ZS43"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR006641"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018974"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR023319"
FT                   /db_xref="InterPro:IPR023323"
FT                   /db_xref="InterPro:IPR032639"
FT                   /db_xref="InterPro:IPR037027"
FT                   /db_xref="InterPro:IPR041692"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZS43"
FT                   /protein_id="ACI53836.1"
FT                   /translation="MAADLRFLAARISAEINARPEQAKAAIELLDEGATVPFIARYRKE
FT                   VTGGLDDTQLRNLAERLVYLRELEARRAAIVESITGQGKMTDELMGKVAGAETKAELED
FT                   LYLPYKPKRRTRAEIARERGLGPLAETILADRGREPAALAEGFVTADVPDVKTALEGAR
FT                   DIIAEGIAENADLLGRLRAHMRQASLLKAKVVDGKQATGEKFSDYFDHSERWATAPGHR
FT                   ALAMLRGWNEEVLTLTIEADAETASPNKPVERMIAVAYEIGASRPGDRWLMEVASWTWR
FT                   VKLSMSLSLDLMRELRERAEEEAIHVFARNLKDLLLAAPAGSRATMGLDPGIRTGVKVA
FT                   VVDGTGKVVATSTVYPFQPRNDVRGAQIELASLIRKHNVELISIGNGTGSRETEKLVAD
FT                   MLAELPAPKPTKVIVSEAGASVYSASATAAAEFPDLDVSLRGAVSIARRLQDPLAELVK
FT                   IEPKSIGVGQYQHDVDQQKLSRSLDAVVEDAVNAVGVDLNTASAPLLSRVSGLGPSIAD
FT                   AIVRHRDSEGRFETRRDLLKVARLGGRTFEQCAGFLRIPNGKEPLDASSVHPEAYGVAK
FT                   KIVAACGRDLRALMGDSAMLKSVDPRQFIDEKFGLPTVRDIISELEKPGRDPRPSFKTA
FT                   AFAEGVNEISDLKPGMMLEGTVTNVAAFGAFVDIGVHQDGLVHVSQLADRFVKDPHEVV
FT                   KAGDVVKVRVVEVDAKRKRIALSMKRDDGSAAPPPRGDSRGNQGSRPQNERRPAAPKPE
FT                   SQGAFGAALAEAMKRK"
FT   gene            559138..560397
FT                   /locus_tag="Rleg2_0540"
FT   CDS_pept        559138..560397
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0540"
FT                   /product="Cyclopropane-fatty-acyl-phospholipid synthase"
FT                   /EC_number="2.1.1.79"
FT                   /note="PFAM: Cyclopropane-fatty-acyl-phospholipid synthase;
FT                   Methyltransferase type 11; Methyltransferase type 12; KEGG:
FT                   ret:RHE_CH00892 cyclopropane-fatty-acyl-phospholipid
FT                   synthase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53837"
FT                   /db_xref="GOA:B5ZS44"
FT                   /db_xref="InterPro:IPR003333"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZS44"
FT                   /protein_id="ACI53837.1"
FT                   /translation="MASAFLSIVQQIIRKGSLKLTLANGDTYMIGDDTGDMVAARLADQ
FT                   EAEDAIRRDPTMKLGEMYMQGRFILEQGNIYDFLSLVKQNTTNEIFDFKMAALLVGRIA
FT                   WQQLKSRVPVNRNKHNVAHHYDLSAKLFDLFLDEDWQYSCAYFEPPGIGLDEAQLAKKR
FT                   HIAAKLLLEPNQRILEIGSGWGGMGMYLTEATEGAEFTGITLSEEQLKVSRSRAEKRGL
FT                   AERVRFELQDYRTLTGRKFDRIVSVGMFEHVGIGNYPNFFRKVSDLLDDNGVMVLHSIG
FT                   RPKPSFGTNAFIEKYIFPGGYIPSVGEVLPPLEKAGLLVRDVEILPLHYAYTLRHWRER
FT                   FVARKAEAVALYDEQFFRMWEFYLAGSEMGFRWDELFILQIQIAKNQFTVPDNRNYIAR
FT                   NEARLKEFEARRAPLEKVTF"
FT   gene            560433..561014
FT                   /locus_tag="Rleg2_0541"
FT   CDS_pept        560433..561014
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0541"
FT                   /product="Phosphoglycerate mutase"
FT                   /note="PFAM: Phosphoglycerate mutase; KEGG:
FT                   rec:RHECIAT_CH0000983 probable phosphoglycerate mutase
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53838"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZS45"
FT                   /protein_id="ACI53838.1"
FT                   /translation="MSSAFPEIYLVRHGETEWSLSGRHTGRSDIPLTGNGEAAASKLAD
FT                   RLSGLSFSAVWSSPSARARKTCALAGFGAGAVIRDDLAEWDYGAYEGVTTKAILAERPG
FT                   WQLFRDGCPNGETSADVGARADAIIHALREAAGTILIFSSSHFLRVLAARWLGLPPEGG
FT                   AHFVLDTASISVLGYEHDLTEPVIRRWNQR"
FT   gene            561187..561999
FT                   /locus_tag="Rleg2_0542"
FT   CDS_pept        561187..561999
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0542"
FT                   /product="MltA-interacting MipA family protein"
FT                   /note="PFAM: MltA-interacting MipA family protein; KEGG:
FT                   rec:RHECIAT_CH0000984 putative outer membrane scaffold
FT                   protein, MipA family"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53839"
FT                   /db_xref="InterPro:IPR010583"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZS46"
FT                   /protein_id="ACI53839.1"
FT                   /translation="MSHRSIVSISLAIAFISFGSAAAQESGQHFWSGDWYLNVGVAGFS
FT                   APKFEGSSHNEFKFSPLISVGRQGAGPRFSSRNDNPSFALIDKGAFRAGIVGKFVPSRD
FT                   DGDGHELKGLRKVKWGAEAGGFVEVYPTDFLRARAEVRQGIRSHDGVVADLAIDAFTDI
FT                   TPDLQLSGGPRATFATRGYYDAYYGVSAKHAAESGLDPYKPTAGMQSYGAGAALTWKAT
FT                   ENLSASSFLEYKRLAGPAADSSLVRDRGSKNQVLIGVSATYKFNFSLQ"
FT   sig_peptide     561187..561258
FT                   /locus_tag="Rleg2_0542"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.843 at
FT                   residue 24"
FT   gene            562166..563125
FT                   /locus_tag="Rleg2_0543"
FT   CDS_pept        562166..563125
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0543"
FT                   /product="4-hydroxybenzoate polyprenyl transferase"
FT                   /note="TIGRFAM: 4-hydroxybenzoate polyprenyl transferase;
FT                   PFAM: UbiA prenyltransferase; KEGG: rec:RHECIAT_CH0000986
FT                   4-hydroxybenzoate octaprenyltransferase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53840"
FT                   /db_xref="GOA:B5ZS47"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR006370"
FT                   /db_xref="InterPro:IPR030470"
FT                   /db_xref="InterPro:IPR039653"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZS47"
FT                   /protein_id="ACI53840.1"
FT                   /translation="MQDTGDFNDRVSDAPSDNWVYRILPPWLWPYAQLARWDRPIGWQL
FT                   LMWPCFWSATLAANAAIGEGLYSGSLLVSHLVLYFIGAVAMRGAGCTYNDLVDHEIDME
FT                   VARTRSRPLPSGRVTRAHAKIFIGLQALVGLFVLLQFNWFTVFLGVLSLGIVALYPYAK
FT                   RFTDWPQFYLGLAFSWGALMGWAGILGGLSFAAVLLYAASVAWTIGYDTIYAHQDKEDD
FT                   ELIGVRSTARLFGDRTRVWLIGLYGLTLVLMFAAFALAGANLIAFLALFGAAGMFAWQI
FT                   VRLDINDAAQCLALFKSNNRVGLIIFFGLFVSLLFAIP"
FT   gene            complement(563207..563773)
FT                   /locus_tag="Rleg2_0544"
FT   CDS_pept        complement(563207..563773)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0544"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rec:RHECIAT_CH0000987 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53841"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZS48"
FT                   /protein_id="ACI53841.1"
FT                   /translation="MNNPVMKPAWAGTTLRLDPSRFPQQVSYAIHDCSDDVNITIDERG
FT                   AVLRKVLPSSGLPLSIALPKRVFQGVAARAIDHGDGEVTVTLELHHADPELCIPLLVAH
FT                   DLSDIAADWRGWSEAFRIPMLMVEADGVARPLEDHIGGLRTSDLKPRRRHSYFANRRPR
FT                   FLVRRTTGRLGVAMKIEGKEIIARN"
FT   gene            564071..567406
FT                   /locus_tag="Rleg2_0545"
FT   CDS_pept        564071..567406
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0545"
FT                   /product="protein of unknown function DUF1217"
FT                   /note="PFAM: protein of unknown function DUF1217; KEGG:
FT                   rec:RHECIAT_CH0000988 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53842"
FT                   /db_xref="InterPro:IPR010626"
FT                   /db_xref="InterPro:IPR023157"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZS49"
FT                   /protein_id="ACI53842.1"
FT                   /translation="MITASLAYTILSKDMTSSLNKVASQATVKKDAEYYADHINKVTSV
FT                   DDFLGDYKLYSYAMKAYGLEDMTYAKAFMKKVLESDLTDPNSYANKLSDTRYREFASAF
FT                   NFNAPEKDVQTDAQEDDLIGLYKQSFIDADKATTAESTYYSNNIDSVTTVDDLVNNTRL
FT                   RTYVLKTFNIDPTYASKDFLRQVLTSDLSDPTSVVNTQGGDKYKALAAQFSFNADGTVT
FT                   GTAQTAAQKASVIETYTLNSQSVIIDNSVGSDVVYVNKTAADYNQAYYTAKIGTITNVD
FT                   DLVADKRLTSYIKTAYSMGADFTAAALRTVLTDPGYAQLMGFTNVYNAFNFKSDGSTSS
FT                   TARVRTLDQANKLSSAASQTANYYKVTSQSSSITNVDALLADGNMARYIKDAYGLGTGF
FT                   SNADLKNILTDSAYAAAQGHADLNADFNFQADGSINGSVIQTDTQRKSTTDKSAANAAH
FT                   FNAMIDSVTSVDDIMSDPVAVSYLRTSMQVADSVSDATLRTFLVDPAAASAQGYSDVHD
FT                   LFNFKTDGSVATLYASQTAAQSASTSSKADNAAVYYQATIAGIANVDQLLSDQKLNNFV
FT                   RNAFGIPSTVTDVALRGILTDQSGTGTYADVAAAFNFKADGSLKDGLAAQTDTQIRNTK
FT                   FAAGARTDDYSARMATIANVDDLIADPAITNFLKSTYNLPLNISNADLKSYLTDATAAS
FT                   AAGYADLNADFNFAADGSLPVVSSVQTADQAQTTNDNYMARYDDEREEAIDEVASNYSS
FT                   MMADSTSLLDTAEIKSVNDFMRTNATADFKKSNDNLPDPYHVALQAFGLTEQDVPRSMM
FT                   RKILTSDAYDPNGYIASLKDERITNMARAFNFGPDGKAASPFQALPDATLAKYATDYKA
FT                   HMTMLLKAGPVKDKASKDATTEVDYFAKGMAKVKSLDDFLDDSRLTDLVLKANNLDPKD
FT                   YDKATLKKIFTSDPDDKKSYLNAKADARFKDIVAAFNFDKDGNLTRAKMGTIQNKAAEE
FT                   HTQELYVQQTMEAQQGESNDGVRLALYFSRKAPSITSIYSILGDKALYQVVTTAYSLPS
FT                   QMSGMDVTKQADLLNRFVKLEDLQDPKKVDKLVRRFTAMYDVQNSTQQSPALQILTGGG
FT                   TQSS"
FT   gene            complement(567587..569023)
FT                   /locus_tag="Rleg2_0546"
FT   CDS_pept        complement(567587..569023)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0546"
FT                   /product="FAD linked oxidase domain protein"
FT                   /note="PFAM: FAD linked oxidase domain protein; KEGG:
FT                   rec:RHECIAT_CH0000989 probable FAD-dependent oxidoreductase
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53843"
FT                   /db_xref="GOA:B5ZS50"
FT                   /db_xref="InterPro:IPR004113"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR016171"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZS50"
FT                   /protein_id="ACI53843.1"
FT                   /translation="MSSTGISTELLDRFAAIVGDKYALRGEADLAPHLVENRGLYHGSS
FT                   PLLLKPGSVEEVSAIMKLATETGTAIVPQTGNTGLVGGQTPRAGQSDIILSLERMNRIR
FT                   DVDPVANVLVADGGAILADVQKAAEAHGRLFPLSLGSEGSCRIGGNLSTNAGGTAVLAY
FT                   GNMRQLCLGLEVVLPTGEIWDGLRRLKKDNTGYDLRDLFIGAEGTLGIITGAVLKLFPQ
FT                   PLGHQVAFAGLNSVADALGLFNLASSLCGTSLTGFELMPRFGVEITTRHIDGVRDPLQA
FT                   AYPWYVLIDISTSDSAETAERMMNGVLEQGFAAGLVLDAAIASSVAQQQAIWHMRESMS
FT                   DAQKPEGGSIKHDVSVPVSRIPHFMAEAADAVLAAMPGARICAFGHMGDGNIHYNISQP
FT                   VGADKAAFIGRWREMNQIVHGLVLAHGGSISAEHGIGQLKRDELAAIRPAIEIELMRRI
FT                   KRAFDPANIMNPGKVVSLEI"
FT   gene            complement(569060..570034)
FT                   /locus_tag="Rleg2_0547"
FT   CDS_pept        complement(569060..570034)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0547"
FT                   /product="Sua5/YciO/YrdC/YwlC family protein"
FT                   /note="TIGRFAM: Sua5/YciO/YrdC/YwlC family protein; PFAM:
FT                   SUA5 domain protein; SUA5/yciO/yrdC domain; KEGG:
FT                   rec:RHECIAT_CH0000990 probable translation factor protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53844"
FT                   /db_xref="GOA:B5ZS51"
FT                   /db_xref="InterPro:IPR005145"
FT                   /db_xref="InterPro:IPR006070"
FT                   /db_xref="InterPro:IPR010923"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="InterPro:IPR038385"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZS51"
FT                   /protein_id="ACI53844.1"
FT                   /translation="MARIIDIEADRRAALEAASAALADGFAIAIPTETVYGLAADATNP
FT                   AAITRIYETKGRPRFNPLICHMADLAMAEEHAEFDPVSRALAAAFWPGPLTLVLPLKPQ
FT                   SPIHSLATAGLDSVGVRVPKGFAGALIGAFGRPLAAPSANTSGAISATSAAHVEADLGA
FT                   KVPLILDAGPSTVGVESTIVKVEGDRVRLLRPGGLAAREIERVAGRPLLRAKTASAAIE
FT                   APGMLASHYAPGAAVRLNATAVEPGEALIAFGGAAVSGTNGARIVLDLSPRGDLAEAAA
FT                   NLFDYMKRADASGASSIAFSAIPEEGLGEAINDRLQRAAAPRD"
FT   gene            complement(570123..570731)
FT                   /locus_tag="Rleg2_0548"
FT   CDS_pept        complement(570123..570731)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0548"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rec:RHECIAT_CH0000991 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0548"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53845"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZS52"
FT                   /protein_id="ACI53845.1"
FT                   /translation="MAKLRYFDAKDASRSQEPQLVAAHSEFLRTGRIPRERRHWLAEEK
FT                   RYFTHDEVAAKTGRKLQVAGEKTHQHINGFHHSIQFPKMIFHRTLEDSPHLGYCHVTAA
FT                   RTKFAHYEEVSWAFYIANFYSDIGENDNFFERIDVGYSRMYFAVAIKAGENSQDKMTID
FT                   RSVRGNGLLFRTHDPQAAIRNILLLGARNEQLREIIRQL"
FT   gene            571135..572379
FT                   /locus_tag="Rleg2_0549"
FT   CDS_pept        571135..572379
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0549"
FT                   /product="Rieske (2Fe-2S) domain protein"
FT                   /note="PFAM: Rieske [2Fe-2S] domain protein; KEGG:
FT                   rec:RHECIAT_CH0000993 probable dioxygenase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53846"
FT                   /db_xref="GOA:B5ZS53"
FT                   /db_xref="InterPro:IPR001663"
FT                   /db_xref="InterPro:IPR015879"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZS53"
FT                   /protein_id="ACI53846.1"
FT                   /translation="MDIRSNVLRQLKNRREGFSLERPFYIDEDYFQLDMEMIYYRDWLF
FT                   IGHDCELPKAGAYFTVQIGSYPVVIVRGKDNVIRAFHNSCRHRGSRVCTKEHGSSVRLV
FT                   CPYHQWTYDLEGKLAFARHMGDDFDKTGFNLKPVHCEVVAGYVFICLADTAPNFQPVRD
FT                   KIEPYVAPHRISESKVAFQSTIIEKGNWKLVWENNRECYHCAANHPELCRTYPEAPSVT
FT                   GTDGGADDPEIAGHWARCEAAGLPSKFQISPDGQFRTARMPLIEDAESYTMSGRPAVKR
FT                   SLADDISISHIGTMLLFHYPTTWNHLLGDHAISFRVLPLSANETAVTTKWLVHKDAVEG
FT                   VDYNLEELTHVWTETNDQDRRIVEENAFGIHSPAYEPGPYSSLHEGGVMQFLEWYSNFM
FT                   VNRLQGDQTKISAVA"
FT   gene            572517..572987
FT                   /locus_tag="Rleg2_0550"
FT   CDS_pept        572517..572987
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0550"
FT                   /product="BA14K family protein"
FT                   /note="PFAM: BA14K family protein; KEGG:
FT                   rec:RHECIAT_CH0000994 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53847"
FT                   /db_xref="GOA:B5ZS54"
FT                   /db_xref="InterPro:IPR012413"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZS54"
FT                   /protein_id="ACI53847.1"
FT                   /translation="MFGLSNKIATAVLAAAVVLTGFVPSQAIQMPTAPQVEKSSTVENV
FT                   QYRRYYRGDYYRPGYRPGAYYRPGYYGGYRGYSYYRPGYRHYNGYWYPLAAFGAGAVIG
FT                   GAIVAQPRYVAPAPRMGSSHVAWCANRYRSYRAYDNTFQPYNGPRQQCYSPY"
FT   sig_peptide     572517..572600
FT                   /locus_tag="Rleg2_0550"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.784 at
FT                   residue 28"
FT   gene            complement(573052..573315)
FT                   /locus_tag="Rleg2_0551"
FT   CDS_pept        complement(573052..573315)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0551"
FT                   /product="protein of unknown function DUF982"
FT                   /note="PFAM: protein of unknown function DUF982; KEGG:
FT                   rec:RHECIAT_CH0000995 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53848"
FT                   /db_xref="InterPro:IPR010385"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZS55"
FT                   /protein_id="ACI53848.1"
FT                   /translation="MKWCTSEEFAPLMLVVSGPEKYKLVASLVQAAEMLTVGWPIDDGD
FT                   EYLIAIRACRAAIHGEISAQDARAALIRAADEAGISVITAVH"
FT   gene            complement(573694..574839)
FT                   /locus_tag="Rleg2_0552"
FT   CDS_pept        complement(573694..574839)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0552"
FT                   /product="transposase IS4 family protein"
FT                   /note="PFAM: transposase IS4 family protein; KEGG:
FT                   ret:RHE_PA00071 probable insertion sequence transposase
FT                   protein, IS4 family"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53849"
FT                   /db_xref="GOA:B5ZS56"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025399"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZS56"
FT                   /protein_id="ACI53849.1"
FT                   /translation="MRHDNSVFHDVLKRIPWTAFERLVEEHQADKHVRRLSTKSQLIAL
FT                   LYGQLAGATSLREIVGSLQSHGTRLYHLGARPVSRSTFADANGLRPSAVFAELFAQMVA
FT                   RAGRGLKRAVGEAVYLIDGSSLSLAGAGSQWARFSDQACGAKMHVVYDANAERPIYAAV
FT                   TPANVNDITAAKEMPIEAGATYVFDLGYYDFGWWAKLNAAGCRIVTRLKSHTRLTVSAE
FT                   QAANADAGILFDRIGLLPQRQAKSRRNPMNRPVREIGVRIETGKVLRIFSNDLTAPAEE
FT                   IAALYKRRWAIELFFRWVKQTLKIRHFLGNSENAVRIQVAVALIAYLLLQMAKADQATV
FT                   TSPLAFARLVRTNLMHRKRIDRLLKPRHSPPGNPGQMSLQW"
FT   gene            complement(574897..575088)
FT                   /locus_tag="Rleg2_0553"
FT   CDS_pept        complement(574897..575088)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0553"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53850"
FT                   /db_xref="GOA:B5ZS57"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZS57"
FT                   /protein_id="ACI53850.1"
FT                   /translation="MGVVGWALLPLLHHTVFITGLTPFSVILGLEPRIHARCGEANMDP
FT                   RLKATAVRFKFSGHGARC"
FT   gene            complement(575089..576084)
FT                   /locus_tag="Rleg2_0554"
FT   CDS_pept        complement(575089..576084)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0554"
FT                   /product="Mg2 transporter protein CorA family protein"
FT                   /note="PFAM: Mg2 transporter protein CorA family protein;
FT                   KEGG: ret:RHE_CH00904 probable magnesium and cobalt
FT                   transporter protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53851"
FT                   /db_xref="GOA:B5ZS58"
FT                   /db_xref="InterPro:IPR002523"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZS58"
FT                   /protein_id="ACI53851.1"
FT                   /translation="MDTLPVNIPGFVWAYRFSPDEKTAVRLNNSATVADLTADNCFYWL
FT                   HLNLVDARVPALLETLTGLTEDAKSALTTRDTHATITVDEQMLYGTLIDCQRDFAEDTN
FT                   NLGWLHFAMSDRFIITTRLQPLRSVERARALIEKNPGKFSRPVDLFELLVIEFQRTLIA
FT                   IVIELTDELNLIEDFVYDNAPRDERRRLAPVRRTVVRLHRHLRTVLALMRRAAATDEDE
FT                   MPFGFDDVARRLTSRLETVDHDIYALQDRARLLHEEIDSKQSSETNRHLYLLSIMTAFL
FT                   LPPTLVTGFFGMNTANLPFAVGDYGTEYAVALIVASIAFAWWLLRRVDIL"
FT   gene            576308..578086
FT                   /locus_tag="Rleg2_0555"
FT   CDS_pept        576308..578086
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0555"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein;
FT                   Acyl-CoA dehydrogenase type 2 domain; KEGG: ret:RHE_CH00905
FT                   probable acyl-CoA dehydrogenase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53852"
FT                   /db_xref="GOA:B5ZS59"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR025878"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZS59"
FT                   /protein_id="ACI53852.1"
FT                   /translation="MYKAPVEEIAFTLKHVAGMDDAISKGLLGDLSEDLVDAVLSEAGR
FT                   FATEEVAPLADIGDRQGARLEGGEVRLPDGWRDLYRSWIAGGWNGLTAPEAFGGQALPH
FT                   MLNVAALEMWNSGSMAFALAPTLTMGAIEAVSTHGSAALKEKYLEKMVSGEWTGTMNLT
FT                   EPHAGSDLGVLKARAERRADGSYRIFGQKIFITWGEHDAADNIIHLVLARLPDAPAGTR
FT                   GISLFLVPKFLVNDDGSLGARNDLFCHSLEHKLGIHGSPTCTMIYGDGRFGDEKGAVGW
FT                   LVGEENKGLACMFTMMNNARLAVGMQGVAIAEAATQKAVAYAKERTQGRAPGWSGPGMS
FT                   PIVEHPDVARMLLTMKALTQGARAISYACAHAIDMSHRAGDVSRHWQERAALLTPIAKS
FT                   FSTDAGVDVASLGIQVHGGMGFIEETGAARYLRDARIAPIYEGTNGIQAIDLVTRKLPL
FT                   SGGEQVKGFIAELKEIAERVRRSNLDGFAETSVRLDAAISDLEAATDWLTKTLADGKAA
FT                   EALSGATPYQRLFGLVLTGCYLAKGALAESGDGRGAGRIVLCRFAAENLLAETAALRDR
FT                   VVNGAASLAAARILLA"
FT   gene            578116..578871
FT                   /locus_tag="Rleg2_0556"
FT   CDS_pept        578116..578871
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0556"
FT                   /product="Enoyl-CoA hydratase/isomerase"
FT                   /note="PFAM: Enoyl-CoA hydratase/isomerase; KEGG:
FT                   rec:RHECIAT_CH0000998 probable enoyl-CoA hydratase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53853"
FT                   /db_xref="GOA:B5ZS60"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZS60"
FT                   /protein_id="ACI53853.1"
FT                   /translation="MTDHIIVEQPSAHPGVQLIRFNRPEKKNAITRAMYRTMADALKAA
FT                   DADTTIRATAFLGTEGCFSSGNDLNDFLAAAVGGGGLEQEILDFLYALVKAEKPVISGV
FT                   DGLAIGIGTTIHLHCDLTIASSRSQFRTPFVDLALVPEAGSSLVAPRLMGQQRAFALLA
FT                   AGEGFSAAEAKDAGIIWKVVEPGEVDAVTLATAARLAAKPPEALRIARDLIRGDSGEII
FT                   ARIDEEARHFSARLKSAEARAAFEAFMRR"
FT   gene            complement(578868..579872)
FT                   /locus_tag="Rleg2_0557"
FT   CDS_pept        complement(578868..579872)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0557"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ret:RHE_CH00907 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0557"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53854"
FT                   /db_xref="GOA:B5ZS61"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR024884"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZS61"
FT                   /protein_id="ACI53854.1"
FT                   /translation="MRKTKSRNPYYNGPASDHFNGTHFFNPDGIEPLGFGDLLRWQFGG
FT                   GRQPWPKSVPSPYAAAKPDARVDGEDLRVTMVGHATMLVQVAGLNILTDPVWSERVSPF
FT                   TFAGPKRVVQPGIAFDDLPPIDLVLVSHNHYDHLDIATLKRLHAKHRPRVVTPLGNDTI
FT                   IRRAVPDMEMTSMDWGERIAHAGISIDAEPAHHWSARGGADRRMALWASFVLSTPAGKI
FT                   YHIGDTGFHHGINYKAAQQKHGGFRLAILPFGAYEPRWFMKGQHQNPREAVRGMKLANA
FT                   AYVAGHHFATFQLTDEAVDAPVKALQEAMREHDIAADRFRPLRAGEIFDVPML"
FT   gene            complement(579954..580772)
FT                   /locus_tag="Rleg2_0558"
FT   CDS_pept        complement(579954..580772)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0558"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase;
FT                   short-chain dehydrogenase/reductase SDR; KR domain protein;
FT                   KEGG: rec:RHECIAT_CH0001000 probable oxidoreductase
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53855"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZS62"
FT                   /protein_id="ACI53855.1"
FT                   /translation="MIDRTKNIALVTGASSGIGLVTAQTLVKAGYRVYGTSRKQVAGKP
FT                   GITMLICDVTDKASVEAMIAEIMQQVGRIDLVVNNAGIGLLGGAEESSIDQAQRLFDVN
FT                   LFGVARVVNAVLPIMRKQKSGRIVNMSSILGLIPSPYNAFYASTKHAIEGYSESLDHEV
FT                   RNFGIRVVLVQPGVTKTSFEENLTRVDQPLPVYDSERTRSEALMRKWMEAGDAPEVVAD
FT                   MVVKAATAKKPKLRYSAGKQSRQVRSLRRFLPERLVDSLLRKVNEFPASV"
FT   sig_peptide     complement(580701..580772)
FT                   /locus_tag="Rleg2_0558"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.994) with cleavage site probability 0.988 at
FT                   residue 24"
FT   gene            580859..581308
FT                   /locus_tag="Rleg2_0559"
FT   CDS_pept        580859..581308
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0559"
FT                   /product="transcriptional regulator, HxlR family"
FT                   /note="PFAM: helix-turn-helix HxlR type; KEGG:
FT                   rec:RHECIAT_CH0001001 putative transcriptional regulator
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53856"
FT                   /db_xref="InterPro:IPR002577"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZS63"
FT                   /protein_id="ACI53856.1"
FT                   /translation="MKNGSIPQCPVARGLKSVGDAWSILVLRDAHTGLTRFDQFRKSLG
FT                   IVPTMLTKRLKALTDDGLLEKRLYSERPPREEYVLTEAGRDFLPVLMMIGAWAHRHCDG
FT                   ELARYVDVETGSEIEPIAIDAVTGAKLGTRAMRLSAGEERDCGDQ"
FT   gene            complement(581333..582583)
FT                   /locus_tag="Rleg2_0560"
FT   CDS_pept        complement(581333..582583)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0560"
FT                   /product="(Uracil-5)-methyltransferase"
FT                   /note="PFAM: (Uracil-5)-methyltransferase; KEGG:
FT                   rec:RHECIAT_CH0001002 23S rRNA
FT                   (uracil-5-)-methyltransferase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53857"
FT                   /db_xref="GOA:B5ZS64"
FT                   /db_xref="InterPro:IPR010280"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR030390"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZS64"
FT                   /protein_id="ACI53857.1"
FT                   /translation="MSTETVTIEKLGAQGDGIAGSAGGPIYVPFALPGETVAIARVKSQ
FT                   GTIMSIATPSPDRQEPPCRHFGPDGVNGTCGGCTLQHMTDSPYRAFKRQLVIDALRSKG
FT                   LTPDVGEIVAARPGERRRVVFAARKTEKDMLIGFNQAESHHIVAIEECPISSAGIIARL
FT                   PAIRAIAAALATNAEPFRVSVLETLSGLDIAVDEVKKLSDAQRRKAVETVLGLRGIARV
FT                   SLNGEILIEPSKPLVDFGGIQVSPPPGGFTQATKPAEEAMAELVLAHAGKAKRIADLFA
FT                   GAGTFSLRLARIGRVHAVEAEAKALAALDHAARNAPGLKPVTIERRDLFRRPLMTQEFK
FT                   PYDAVIFDPPRAGAEFQCKELARSSVKKIAAVSCNPLTLARDLAILVEGGYRITGVTPI
FT                   DQFLWTSHVEVVATLEK"
FT   gene            complement(582580..583326)
FT                   /locus_tag="Rleg2_0561"
FT   CDS_pept        complement(582580..583326)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0561"
FT                   /product="hemolysin A"
FT                   /note="TIGRFAM: hemolysin A; PFAM: ribosomal RNA
FT                   methyltransferase RrmJ/FtsJ; RNA-binding S4 domain protein;
FT                   KEGG: rec:RHECIAT_CH0001003 hemolysin protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53858"
FT                   /db_xref="GOA:B5ZS65"
FT                   /db_xref="InterPro:IPR002877"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR004538"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZS65"
FT                   /protein_id="ACI53858.1"
FT                   /translation="MSDQNSQRLDQLLVSRGLFASRSRARDAVQRGTVRIAGQVVTKAG
FT                   ALIGDDAAIEIDDPAQDYVSRAALKLASALEHFRLDPAGHHCLDIGASTGGFTEVLLQR
FT                   GAAHVTAIDVGHGQMHPRIAADPRVTNKEGLNARHLTAEDIGEPADFIVSDVSFISLKL
FT                   ALAPALDIAEAGAVAVLLVKPQFEAGREAIGKGGLLKDPSSAPAVAAELERWFIEDMGW
FT                   KSLGLIPSPIAGGDGNQEYLLAGSKP"
FT   gene            583458..584450
FT                   /locus_tag="Rleg2_0562"
FT   CDS_pept        583458..584450
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0562"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mlo:mll1459 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53859"
FT                   /db_xref="InterPro:IPR025538"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZS66"
FT                   /protein_id="ACI53859.1"
FT                   /translation="MLKLFTLLVAAGIASPALANDTMAEVKTGGLIFAQSDDVSMVQED
FT                   LFISASEVRVDYVFENTSDKDVESLVAFPMPDISGQVDNNSAIADYDSDNFLHFSTVQD
FT                   GKPITAKLQQRVVSLGIDVTDELAKNNIPVLPYSDKTRDALAKLPQTIRKDWIARGLIY
FT                   PMAEADLVPLWTLRSTYWWRTTFPAKKKVSVEHRYQPAVGGTVAISFLENGQPKGERFE
FT                   EYSRKYCLDADFVRVAQQRAAEAGTNGANYTESWISYVLSTGANWAGPIRRFQLTIDKG
FT                   KPGSLISFCGSNVEKIGPTTFRMTAEDFDPAKDFDILILNPPEAEPKTP"
FT   sig_peptide     583458..583517
FT                   /locus_tag="Rleg2_0562"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.998 at
FT                   residue 20"
FT   gene            584684..586621
FT                   /locus_tag="Rleg2_0563"
FT   CDS_pept        584684..586621
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0563"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="PFAM: histidine kinase HAMP region domain protein;
FT                   chemotaxis sensory transducer; CHASE3 domain protein; KEGG:
FT                   ret:RHE_CH00912 methyl-accepting chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0563"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53860"
FT                   /db_xref="GOA:B5ZS67"
FT                   /db_xref="InterPro:IPR000727"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR007891"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZS67"
FT                   /protein_id="ACI53860.1"
FT                   /translation="MSAKNISLNGKLAATFAALILIFVAVSAFVYSKATASAAASAEQE
FT                   KSELLVNQIDDALQAMLEQAVNLRGFILFRSDSTYGDVFANRERMLKAIAAAKQTAAGE
FT                   PQLVEMIDGMQKAADLYFHELAEPQTKARKETDMPIADVVKIGVNATKGQLDGFRQASA
FT                   KIKASAREKSDALAEIRADANSDLKTTLLAGGIVASLAAAVLAWLMSRTIVRPIVGMTS
FT                   AMDRLAGGDNDITVPATDRGDEVGRMAQSVLVFKQAAIEKLRLAGETDRMRGDAERQRR
FT                   ATDEQKAREEGEIRHAIDALAGGLAELANGDMAGRIQTPFAPQYDSLRNDFNHAVEKLQ
FT                   AALQSVGRNASAINAGAGEIRSAADDLAHRTEQQAAAVEQTAAALEQVTTTVRDSAKRA
FT                   EDAGNLVERTRLGAEKSGEVVRRAVSAMQQIEKSSGEISNIIGVIDDIAFQTNLLALNA
FT                   GVEAARAGDAGKGFAVVAQEVRELAQRSAKAAKEIKALITTSGEQVVAGVSLVGETGKA
FT                   LEAIVAEVQEINHHVSAIVTATREQSIGLQEINTAVNNMDQGTQQNAAMVEEQTAASHA
FT                   LAQEANALDELLHQFKLGQTRPDAAPRAAVANARPVASPARALANKVTKAFGGRQASAA
FT                   VAVQEDWTEF"
FT   sig_peptide     584684..584782
FT                   /locus_tag="Rleg2_0563"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.334 at
FT                   residue 33"
FT   gene            complement(587109..589025)
FT                   /locus_tag="Rleg2_0564"
FT   CDS_pept        complement(587109..589025)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0564"
FT                   /product="deoxyxylulose-5-phosphate synthase"
FT                   /note="TIGRFAM: deoxyxylulose-5-phosphate synthase; PFAM:
FT                   Transketolase central region; Transketolase domain protein;
FT                   KEGG: rec:RHECIAT_CH0001005 1-deoxy-D-xylulose-5-phosphate
FT                   synthase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53861"
FT                   /db_xref="GOA:B5ZS68"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR005477"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5ZS68"
FT                   /protein_id="ACI53861.1"
FT                   /translation="MTQLPKTPLLDQVTYPADLRKLEDRDLPQLAREVRDEMIDAVSRT
FT                   GGHLGAGLGVVELTIAIHSVFDTPDDRLIFDVGHQCYPHKILTGRRDRIRTLRQEDGLS
FT                   GFTRRAESEYDPFGAAHSSTSISAGLGMAIAADLDKNDRRVIAVIGDGAMSAGMAYEAL
FT                   NNAGALDARLIVILNDNDMSIAPPTGAMSAYLARLASGRTYMGFRDFGKKLTAYLGKNI
FT                   DRAITRAVEHARGYVTGGTMFEEMGFYHIGPIDGHSFDHLLPVLRNVRDNARGPVLIHV
FT                   VTQKGKGYPPAEAAADKYHGVNKFDVITGAQARVKPNAPSYTSVFAEALVQEATLDDKI
FT                   VGITAAMPNGTGLDKLAEAFPSRCFDVGIAEQHAVTFAAGLAAEGYKPFAALYSTFLQR
FT                   AYDQVVHDVAIQGLPVRFPIDRAGFVGADGPTHAGSFDTAFLTTLPGFVVMAAADEAEL
FT                   KHMVRTAVAYDAGPISFRYPRGEGVGVDMPVRGEILRIGKGRIVKEGTKVALLSFGTRL
FT                   ADCLLAAEDLDAAGLSTTVADARFAKPLDHDLIRQFARHHEMVITVEEGSVGGFGSQVM
FT                   QYLSSEGLLDNGLKIRSLVMPDIWMEQAKPEAMNAHAGLDRAGIVSTVFRALGRGVAVG
FT                   VAG"
FT   gene            589314..591293
FT                   /locus_tag="Rleg2_0565"
FT   CDS_pept        589314..591293
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0565"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rec:RHECIAT_CH0001006 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0565"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53862"
FT                   /db_xref="GOA:B5ZS69"
FT                   /db_xref="InterPro:IPR001736"
FT                   /db_xref="InterPro:IPR025202"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZS69"
FT                   /protein_id="ACI53862.1"
FT                   /translation="MGTIVAAHAYVNNEVAYVAWDIDAKIDGCLGFEVVRVYLDEQGNV
FT                   SKRPDGSEDRVTCAAWVAFKGQRNPHWLPQTTSLWPVQKLSWRDLTLRKRRNEMKRRPD
FT                   EVRVRYEIRPLGDLKPGMQAAPDPTPALVEINKRDANGKPIEKAGGTFEKIAVKAYDGP
FT                   PRPLGYLGPAVASNPVHVTRKRGQFESTFTNGILAAQWLRNVLLEDGVKQPNELIDMIS
FT                   TPSNGIRKYLAGDVIPMLKEFMNAPGRFLLALYELEDEELLELLLANKDRLRIILANTG
FT                   KVGDAWDVRNAPARKALIDAGVEIHHRMFNNSSQIGHNKFVVHLPPDGTERSVFTGSTN
FT                   WTATGLAGQSNNALIVRNDAVAAAYVAYWGRMLEDNATLEAPVEFDDGMPDNQQSKKFR
FT                   RSNETPSIIPTGNGASLETWFSPNMQSRRKGKAIPPDLREVYRMMRRAEHAVLFLAFYP
FT                   GQSGKDCIVGEAIDIGLKDQKLIVTGAVSSPQAMPNYVPGKDNDPDDPDDDEEGVSPHT
FT                   FDEANVSIVRASRIDDRQLLADFGAEELTAKKVGAIIHDKVLVIDPLSDECVVVLGSHN
FT                   LGFKASYANDENMLIVKGDRALAEAYAVHILDVYDHYRFRAVEAELKRQGKKGWSGFLN
FT                   VDDSWQDGYVNRTKGALTRYFAAG"
FT   gene            complement(591337..592260)
FT                   /locus_tag="Rleg2_0566"
FT   CDS_pept        complement(591337..592260)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0566"
FT                   /product="Pirin domain protein"
FT                   /note="PFAM: Pirin domain protein; KEGG: ret:RHE_CH00914
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0566"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53863"
FT                   /db_xref="InterPro:IPR003829"
FT                   /db_xref="InterPro:IPR008778"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR012093"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZS70"
FT                   /protein_id="ACI53863.1"
FT                   /translation="MSFFPGKDPLPGDAFACDAIENLIIPRTSDIGGFQVRRALPTRQR
FT                   RLVGPFIFFDRMGPAILKPNEALDVKPHPHIGLSTVTYLFDGEIRHRDSLGTEKVIRPG
FT                   DINLMTAGRGIVHSERTPDNLRGHPLLMSGLQTWLALPDDKEEIDPSFAHTEKSDMPLI
FT                   ETAGVRGRVVIGSFEGMTSPVGVFSDTLYVDLSLQPGAKFPFGAAHEERAVYVLSGEVV
FT                   ISGDRFAADQLLVFRPGDPITLEAGSDGCHLMLFGGAALNSKRYIWWNFVSSSKERIEK
FT                   AKEEWRSGRFDIVPGDEEEFVPLPEG"
FT   gene            592452..592985
FT                   /locus_tag="Rleg2_0567"
FT   CDS_pept        592452..592985
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0567"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bam:Bamb_5223 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0567"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53864"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZS71"
FT                   /protein_id="ACI53864.1"
FT                   /translation="MEFGGASAVFERVFIMGNGGTGKTWLAQRVGERLGQPIIHLDDIH
FT                   WEPGGYGVARCRSLRDTMVKAAAETDRWVMEGVYGELANMALGRVTALIWIDLPEELCI
FT                   ANIRERGIQGGGTETQFAGLLKWVAEYRIRANNWNSFDAHARLFSAFPGPKWLLSDRDA
FT                   VTRLAGSLPLSRDR"
FT   gene            complement(593031..593798)
FT                   /locus_tag="Rleg2_0568"
FT   CDS_pept        complement(593031..593798)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0568"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR
FT                   domain protein; KEGG: rec:RHECIAT_CH0001008 putative
FT                   short-chain dehydrogenase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0568"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53865"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZS72"
FT                   /protein_id="ACI53865.1"
FT                   /translation="MTDRLKGKVAIISGGATGMGGAASKLFAAEGARVAIIDRNGQAAD
FT                   ETVKQIRDAGGEADCWTADVSDEAAVNSAVAGVEDRYGAVTVLFNHAGTIVIKPFLETT
FT                   LQEWDWLHAVNVRSMFLMTKAVLPKMIAAGGGSIVCTSSISAVAATPMEVLYDTTKGAV
FT                   HMFARAIAVEFRDRNIRCNAVCPGFIRTPHGLREVADLQALGVDVSDAAIAAQQGRIGE
FT                   PEDVARAALYLASDESNFVNGAHLFVDNGFTAI"
FT   sig_peptide     complement(593712..593798)
FT                   /locus_tag="Rleg2_0568"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.994 at
FT                   residue 29"
FT   gene            complement(593946..594197)
FT                   /locus_tag="Rleg2_0569"
FT   CDS_pept        complement(593946..594197)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0569"
FT                   /product="exodeoxyribonuclease VII, small subunit"
FT                   /note="TIGRFAM: exodeoxyribonuclease VII, small subunit;
FT                   PFAM: Exonuclease VII small subunit; KEGG:
FT                   rec:RHECIAT_CH0001009 exodeoxyribonuclease VII protein,
FT                   small subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0569"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53866"
FT                   /db_xref="GOA:B5ZS73"
FT                   /db_xref="InterPro:IPR003761"
FT                   /db_xref="InterPro:IPR037004"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5ZS73"
FT                   /protein_id="ACI53866.1"
FT                   /translation="MTDSAKPEVSGLSFEKAVAELESIVARLERGDVALDESIEIYERG
FT                   EALKKHCETLLSAAENRIEKIRLDRAGKPQGVEPLDGA"
FT   gene            complement(594200..595135)
FT                   /locus_tag="Rleg2_0570"
FT   CDS_pept        complement(594200..595135)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0570"
FT                   /product="histone deacetylase superfamily"
FT                   /note="PFAM: histone deacetylase superfamily; KEGG:
FT                   rec:RHECIAT_CH0001010 probable deacetylase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0570"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53867"
FT                   /db_xref="InterPro:IPR000286"
FT                   /db_xref="InterPro:IPR023696"
FT                   /db_xref="InterPro:IPR023801"
FT                   /db_xref="InterPro:IPR037138"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZS74"
FT                   /protein_id="ACI53867.1"
FT                   /translation="MSTRLYEHPIFLEHVTPAGHPERSDRIRAINVALEHPNFERLERR
FT                   QAPEASEDAVLLAHPEEHLTAVMREIPDEEDRINQLEADTYASQKSLQAALTGIGGAMA
FT                   AVDDVFSGAADNVFVAARPPGHHAEKMTAMGFCFFNNAAIAARHAQKRHGAERVAIIDW
FT                   DVHHGNGTQDIFWDDPSVLFCSTHQMPLYPGSGAKDEKGKHNTIVNAPLSPNVGSDHFR
FT                   EAFKSRVLPAVADFRPDLIIISAGFDAHHRDPLAQINLTGEDFDWATGRVLELADRHAK
FT                   NRVVSLLEGGYDLEGLAESAGMHILRMMKG"
FT   gene            595324..595725
FT                   /locus_tag="Rleg2_0571"
FT   CDS_pept        595324..595725
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0571"
FT                   /product="putative thioesterase protein"
FT                   /note="KEGG: rec:RHECIAT_CH0001011 putative thioesterase
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0571"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53868"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZS75"
FT                   /protein_id="ACI53868.1"
FT                   /translation="MSQSKRPGVTEIHVPFRDVDMTGQMFLASYISYAESVIASFWLAR
FT                   PEVEDEPVYIASKITCVLHRPLHYDEPALFTAAVDKIGVRSIGFIVSIDTGEERAAEVE
FT                   IIWQARAQEDQQPVSLPEETRDWLYGFLD"
FT   gene            complement(595732..596382)
FT                   /locus_tag="Rleg2_0572"
FT   CDS_pept        complement(595732..596382)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0572"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="PFAM: regulatory protein GntR HTH; GntR domain
FT                   protein; KEGG: ret:RHE_CH00919 transcriptional regulator
FT                   (activator) protein, AsnC/GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0572"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53869"
FT                   /db_xref="GOA:B5ZS76"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZS76"
FT                   /protein_id="ACI53869.1"
FT                   /translation="MSENVGRWLRDEIENAILSYEFAPGERLDETVLANRFGVSRTPVR
FT                   EALMQLDAIGLIEIRPRRGAVVIDPGPHRIYEMFEVMAELEGLAGALAARRLDKTSREA
FT                   ITATHSRCEQSAGAGDSDAYYYDNEEFHKAIYAASRSDFLQEQCVQLHRRLRPYRRLQL
FT                   RVRNRLSTSFSEHCAIVDAIFAGDGDEARRLLRTHVGIQGERFSDLVASMAAR"
FT   gene            596546..597970
FT                   /locus_tag="Rleg2_0573"
FT   CDS_pept        596546..597970
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0573"
FT                   /product="Malonyl-CoA decarboxylase"
FT                   /EC_number="4.1.1.9"
FT                   /note="PFAM: Malonyl-CoA decarboxylase; KEGG:
FT                   ret:RHE_CH00920 malonyl-CoA decarboxylase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0573"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53870"
FT                   /db_xref="GOA:B5ZS77"
FT                   /db_xref="InterPro:IPR007956"
FT                   /db_xref="InterPro:IPR035372"
FT                   /db_xref="InterPro:IPR038351"
FT                   /db_xref="InterPro:IPR038917"
FT                   /db_xref="InterPro:IPR042303"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZS77"
FT                   /protein_id="ACI53870.1"
FT                   /translation="MPEASFFTDMLQSITDHGRQLLFSGSRNTQAAAKADLQTLCEMLL
FT                   SSRGEASGMALAAEILDRWGGLESAGAQQFFHMLHETFGPDTVRLDQAMENYRTDKSSA
FT                   AVIALHQAAEPRRQELLRRLNHAPNGTARLVRMRQQLLASKDRSEAYHALDADFTHLFG
FT                   SWFNRGFLTLRPIDWSTPANILEKIIKYEAVHEIASWEELRRRLAPADRRCFAFFHPRL
FT                   AEEPLVFVEVALTRSVPNAIADVLDEGREQINADEATTAVFYSISNCQDGLRGISFGNF
FT                   LIKQVVEDLRRDLPGLKNFVTLSPVPGFARWLAKARDPAGARSLSKAALETLNLLDDPN
FT                   WPDEEKSRTELERVLLPLAARYFLTERTPEGRPVDPVARFHLGNGARLERVNFLGDRSQ
FT                   KAVQQAHGLMVNYLYKLDDIVANHEALAQRGEVIASPAVKSLLNQNDEGRRGGNGQQGS
FT                   RAFAQIMNSTLGGGRK"
FT   gene            597967..599481
FT                   /locus_tag="Rleg2_0574"
FT   CDS_pept        597967..599481
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0574"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="PFAM: AMP-dependent synthetase and ligase; KEGG:
FT                   rec:RHECIAT_CH0001014 long-chain-fatty-acid-CoA ligase
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0574"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53871"
FT                   /db_xref="GOA:B5ZS78"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZS78"
FT                   /protein_id="ACI53871.1"
FT                   /translation="MSNHLFDAMRAAAPGNAPFMRIGAAQTWTYGDAFALSGRIASAMD
FT                   TLGIRPGDRVAVQVEKSAEALILYLACLRSGAVYLPLNTAYTLAELDYFIGDAEPRLVV
FT                   VASAARAGVEKIAKQYGAIVETLDADGSGSLLDLARDEPADFVDASRSADDLAAILYTS
FT                   GTTGRSKGAMLTHGNLLSNALTLRDYWRVTADDRLIHALPIFHTHGLFVATNVTLLAGA
FT                   SMFLLSKFDADEVVSLMPQATMLMGVPTFYVRLLQSPRFGKEAAASIRLFVSGSAPLLA
FT                   ETHSQFQARTGHAILERYGMTETNMNTSNPYEGKRVAGTVGLPLPDVTVRVTDPATGEV
FT                   LPAGQTGMIEIKGPNVFKGYWRMPEKTAAEFTADGFFISGDLGKIDRDGYVHIVGRGKD
FT                   LVISGGYNIYPKEVESEIDQIEGVVESAVIGVPHPDFGEGVTAVVVCKPGAGLDEKSIV
FT                   SALQDRLARYKQPKRIIFAEDLPRNTMGKVQKNILRQQYADLYTGT"
FT   gene            599574..600923
FT                   /locus_tag="Rleg2_0575"
FT   CDS_pept        599574..600923
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0575"
FT                   /product="Dicarboxylate carrier MatC domain protein"
FT                   /note="PFAM: Citrate transporter; Dicarboxylate carrier
FT                   MatC domain protein; KEGG: ret:RHE_CH00922
FT                   dicarboxylate-carrier protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0575"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53872"
FT                   /db_xref="GOA:B5ZSS3"
FT                   /db_xref="InterPro:IPR004680"
FT                   /db_xref="InterPro:IPR009827"
FT                   /db_xref="InterPro:IPR030676"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZSS3"
FT                   /protein_id="ACI53872.1"
FT                   /translation="MGIEILAIGLLVAMFIIATIQPINMGALAFAGAFVLGSMTIGMKT
FT                   TDIFAGFPSDLFLTLVAVTYLFAIAQINGTIDWLVECAVRLVRGHIGLIPWVMFLVAAV
FT                   ITGFGALGPAAVAILAPVALSFAIQYRIHPVMMGLMVIHGAQAGGFSPISIYGGITNQI
FT                   VAKAGLPFAPTSLFLSSFFFNLAIAVLVFFVFGGAKVMRQVPASSFGPLPELHPEGVSA
FT                   SIRGHGGTPAKPIRDHAYGTAADTAATLRLNNERITTLIGLTALGIGALVFKFNVGLVA
FT                   MTVAVALALLSPKTQKAAIDKVSWSTVLLIAGIITYVGVMEKAGTVDYVANGISSLGMP
FT                   LLVALLLCFTGAIVSAFASSTALLGAIIPLAVPFLMQGHVSAIGVVAAIAISTTIVDTS
FT                   PFSTNGALVVANAPDDSREQVLRQLLIYSALIAIIGPIVAWLVFVVPGLV"
FT   sig_peptide     599574..599669
FT                   /locus_tag="Rleg2_0575"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.652) with cleavage site probability 0.423 at
FT                   residue 32"
FT   gene            601202..602305
FT                   /locus_tag="Rleg2_0576"
FT   CDS_pept        601202..602305
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0576"
FT                   /product="transcriptional regulator, LuxR family"
FT                   /note="PFAM: regulatory protein LuxR; KEGG:
FT                   rec:RHECIAT_CH0001016 probable transcriptional regulator
FT                   protein, LuxR family"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0576"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53873"
FT                   /db_xref="GOA:B5ZSS4"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZSS4"
FT                   /protein_id="ACI53873.1"
FT                   /translation="MVQSTDVSSHLTDLIYGSLFGECSWQDFLDSVAQTSPGGKAALHY
FT                   HDLTSSVAHVPFMSGFSQAEVDQFSSHFAAVNPWIPRLGLVPVGQGLCGDEIFPREELI
FT                   KSEFYNDWLKRQAGCETSVGVSIIREENRTFILSTSTSSADPDLNREAAERYTILAPHL
FT                   KRAFDFIRKRDLFAPHEHASQTLFDSIGVGLIYVSEQGKVRRWNKSAEALMEAGLPVRI
FT                   TADGKLELQCQKSAAVLEFLTSRNGMQTKPHTAIVKGRNQDSYRLTLVRLQSDAFTEFL
FT                   EGPTVALIAEPMMASPLGERRDLLMQLYKLTATEVRIASSIASGHSAREVAVADEISYE
FT                   TVRTHLRNIYSKLGVNSQAGLVSLLMR"
FT   gene            complement(602348..602962)
FT                   /locus_tag="Rleg2_0577"
FT   CDS_pept        complement(602348..602962)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0577"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rec:RHECIAT_CH0001021 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0577"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53874"
FT                   /db_xref="InterPro:IPR009097"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZSS5"
FT                   /protein_id="ACI53874.1"
FT                   /translation="MIRTKIDTLWFKRCCAFHLQFRPDRQALSTLCLLQDSIERDSAAS
FT                   LSRVPAASLHMTVVTLVKAAAQFSIPNEEVWKRNGERWTEIVERLIDETPPFDVHFHEV
FT                   AASEAAIFVKAEEPAELHRLRSAISQAICFEEWRPTPPSIAHITLFRFFAEEPVPAVSF
FT                   DAGCLPMGVRAGSLTLLEEHVYPNVEIDILSEPVLRGKSAE"
FT   gene            complement(603142..603528)
FT                   /locus_tag="Rleg2_0578"
FT   CDS_pept        complement(603142..603528)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0578"
FT                   /product="Ectoine synthase"
FT                   /note="PFAM: Ectoine synthase; Cupin 2 conserved barrel
FT                   domain protein; KEGG: rec:RHECIAT_CH0001022 L-ectoine
FT                   synthase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0578"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53875"
FT                   /db_xref="GOA:B5ZSS6"
FT                   /db_xref="InterPro:IPR010462"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZSS6"
FT                   /protein_id="ACI53875.1"
FT                   /translation="MFVRSLKEVEQTERFVDWGNGTSHRLLTNDDGMGFTVCHTVVRAN
FT                   TQALLQYRNHLEACYCIQGEGEVEDMDGNVFPIGVGDIYVLDKHDRHYLRGGKDRDLIL
FT                   VSIFNPPLKGTERHDLNNRSGSEY"
FT   gene            603778..604671
FT                   /locus_tag="Rleg2_0579"
FT   CDS_pept        603778..604671
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0579"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: rec:RHECIAT_CH0001023 probable
FT                   transcriptional regulator protein, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0579"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53876"
FT                   /db_xref="GOA:B5ZSS7"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZSS7"
FT                   /protein_id="ACI53876.1"
FT                   /translation="MQLPPLNALRAFEATARLMSLSKAGDELHVTHAAISHQLRHLEAW
FT                   LGRKLLQKSGRGVALTPAGSEYYLAVSGSLAAIAHATGNMRRDHNMRSITVGCIPSIAS
FT                   RWLVPALPSFRESDPDLDVRIVYAKAEERFDDESLDVLITMGEDLSGGRESRLLFSRRN
FT                   QPVASIHYLAKRNWTVGSVPFAAADLLHDESVDGWKEWFRKTDIKAPEPVRGPIFQDFN
FT                   ILATAVIAGHGVALCPVEVFRREIDRGDLVVLSDISTAETQGYYLITSAWAKKPVRRFT
FT                   EWFLRECRSAGSPIIE"
FT   gene            605285..606430
FT                   /locus_tag="Rleg2_0580"
FT   CDS_pept        605285..606430
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0580"
FT                   /product="acyltransferase 3"
FT                   /note="PFAM: acyltransferase 3; KEGG: ret:RHE_CH00927
FT                   putative acetyltransferase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0580"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53877"
FT                   /db_xref="GOA:B5ZSS8"
FT                   /db_xref="InterPro:IPR002656"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZSS8"
FT                   /protein_id="ACI53877.1"
FT                   /translation="MVKSEAGSPYIYGIDALRFVCALMVTMFHLGFASWASPLYLRPYK
FT                   MPVIENIAQPGWVGVELFFVISGLVIINSAASATAMSFLKGRILRLYPAVWICGALTLL
FT                   FIATQDVNRRIIKNYLRSITLYPGGPWIDGQYWTLACEICFYALVFILCAAGQRARMPA
FT                   LALGLSLASTGFIALLNAFPDSEVLAIFTDTAWRAVPFYYGCQFAIGIYIYIWLLSQTR
FT                   MSRVSWVGFVFALAAGATQIYMAAGSTSERTLAAAGHSFSPFPAIFLWVAGLIFIAASV
FT                   AYGRQISHLPKAFLQAVKTLGSMTYPLYLLHFAIGIQLLDWLTDLGMTPLPALGLAIAI
FT                   VCLMSLAVCKWGEPPIRGALRIVFERLGEWAPGFQAKESRV"
FT   gene            complement(606579..607142)
FT                   /locus_tag="Rleg2_0581"
FT   CDS_pept        complement(606579..607142)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0581"
FT                   /product="BioY protein"
FT                   /note="PFAM: BioY protein; KEGG: ret:RHE_CH00928 biotin
FT                   transporter protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0581"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53878"
FT                   /db_xref="GOA:B5ZSS9"
FT                   /db_xref="InterPro:IPR003784"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZSS9"
FT                   /protein_id="ACI53878.1"
FT                   /translation="MSTRDLVLTALFAAIIVALGLLPPIPLGFIPVPITAQSLGVMMAG
FT                   VVLGARRGAIAVLIVLLLVAIGLPVLSGGRGGLAIFASPTAGFLIGWIFAAFVTGYLSE
FT                   RLINDRQSGLVQTVSFFLTAMVGGIVVLYAFGITYLATVAGLGFPKAFVGSMAFVPGDV
FT                   IKAFVAALLGRAVMVGYPLLPARA"
FT   sig_peptide     complement(607032..607142)
FT                   /locus_tag="Rleg2_0581"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.862) with cleavage site probability 0.422 at
FT                   residue 37"
FT   gene            complement(607167..607775)
FT                   /locus_tag="Rleg2_0582"
FT   CDS_pept        complement(607167..607775)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0582"
FT                   /product="cobalt transport protein"
FT                   /note="PFAM: cobalt transport protein; KEGG:
FT                   ret:RHE_CH00929 biotin transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0582"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53879"
FT                   /db_xref="GOA:B5ZST0"
FT                   /db_xref="InterPro:IPR003339"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZST0"
FT                   /protein_id="ACI53879.1"
FT                   /translation="MQSLYVEGNSIMHRLSPRVKLLSLAIFSIVLFITGNLVLLFLAVL
FT                   AAAILYSMVGLPLGAALRRLRPIFLTIAVVALFNLLFNPWQQALVPPLRLTALMLLAAA
FT                   VTATTSITAFIDEVTALARPLERTGRVRADDIGLALGLVLRFVPEIVDRYQAIREAHRA
FT                   RGLKVRPASLLAPLIILTLKDADNIAAAIDARGIRRHGS"
FT   sig_peptide     complement(607635..607775)
FT                   /locus_tag="Rleg2_0582"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.614) with cleavage site probability 0.505 at
FT                   residue 47"
FT   gene            complement(607775..608449)
FT                   /locus_tag="Rleg2_0583"
FT   CDS_pept        complement(607775..608449)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0583"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: rec:RHECIAT_CH0001027 probable cobalt/biotin ABC
FT                   transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0583"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53880"
FT                   /db_xref="GOA:B5ZST1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZST1"
FT                   /protein_id="ACI53880.1"
FT                   /translation="MDIEFEGAGVSFGARVALEPLTLGISGRRIGVIGLNGSGKTTFAR
FT                   LINGLTKPTVGRVTVNGRDTADEKTAAADVGFIFQSPQNQIIMPIVRDDIAFGLKRRGF
FT                   TKAEIEAKVEGVLARFGAEALAGRRAHELSGGELQVAALCSVLATGPGILILDEPTNQL
FT                   DLKNRALVEGIIAGLAESAIVITHDLELIAGFERVLLFHEGRLAADAPATEAIARYREI
FT                   AL"
FT   gene            608741..609976
FT                   /locus_tag="Rleg2_0584"
FT   CDS_pept        608741..609976
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0584"
FT                   /product="protein of unknown function DUF1006"
FT                   /note="PFAM: protein of unknown function DUF1006; KEGG:
FT                   rec:RHECIAT_CH0001029 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0584"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53881"
FT                   /db_xref="InterPro:IPR009351"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZST2"
FT                   /protein_id="ACI53881.1"
FT                   /translation="MTNLLSNSDARRVFLAKQGLSAPPNRALTKEGLLQLIGELGFVQV
FT                   DSIQTVERAHHQILFSRNQTYRREHLTALLEKDGALFEHWTHDASILPSAFFVYWKHKF
FT                   RHQEKVIVERWRKWRGEGFEAAFEETYERVERDGAILARDIKADGHVSGGWWNWHPNKT
FT                   ALEYFWHTGKFAIAGRSNFQKIYDLTDRVIPAEFREPEVSREEFIDWACRSALSRLGFA
FT                   THGEISAFWSLVSPDEAKTWVAAHRDELIEVLIEPALGAKPRPSWAFADFLSTLDSYPG
FT                   APPRIRVLSPFDPMIRDRNRTERLFGFFYRIEVFVPEPKREYGYYVFPLLEGDRLIGRI
FT                   DMKADRKKSTLDVKRLWLEPGVKPSAGRLERLEAELDRVARFAGVEKVVLMEGWRGNEL
FT                   SSPVTAPSQGRP"
FT   gene            complement(610266..611369)
FT                   /locus_tag="Rleg2_0585"
FT   CDS_pept        complement(610266..611369)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0585"
FT                   /product="3,4-dihydroxy-2-butanone 4-phosphate synthase"
FT                   /note="TIGRFAM: 3,4-dihydroxy-2-butanone 4-phosphate
FT                   synthase; PFAM: 34-dihydroxy-2-butanone 4-phosphate
FT                   synthase; GTP cyclohydrolase II; KEGG:
FT                   rec:RHECIAT_CH0001030 GTP cyclohydrolase II protein
FT                   (riboflavin biosynthesis)"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0585"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53882"
FT                   /db_xref="GOA:B5ZST3"
FT                   /db_xref="InterPro:IPR000422"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="InterPro:IPR032677"
FT                   /db_xref="InterPro:IPR036144"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZST3"
FT                   /protein_id="ACI53882.1"
FT                   /translation="MSYDQKRVVDAIRAFEAGEIVVVMDDNDRENEGDLIVAAVHTTPE
FT                   KMAFIVRHTSGIVCAPMPKEEAKRLNLNAMVAENDSAHTTAFTVSVDFKHGTTTGISAD
FT                   DRTLTVRNLANPNVGAADFVRPGHIFPLVSREGGVLMRSGHTEAAVDLCKLAGLPPIGV
FT                   ISELVNDDGTVTRGPQVVDFAEQHGLKLVSVADLIAYRQRKETLVEHGTSFDIDTPFGK
FT                   AKAHTYSLPWDPMQHLAVVFGDIRDGVDIPVRLHPENVAEDLFGKNSPVDFYMQKISEE
FT                   GRGVIVYLREGSVGVGHYDNGRKARNQGREAHAEAQTRDSEWLEIGLGAQILKDLGVSS
FT                   IKLLTSRERHYVGLEGFGIKISKTEIC"
FT   gene            complement(611379..612476)
FT                   /locus_tag="Rleg2_0586"
FT   CDS_pept        complement(611379..612476)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0586"
FT                   /product="Chorismate synthase"
FT                   /EC_number="4.2.3.5"
FT                   /note="PFAM: chorismate synthase; KEGG:
FT                   rec:RHECIAT_CH0001031 chorismate synthase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0586"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53883"
FT                   /db_xref="GOA:B5ZST4"
FT                   /db_xref="InterPro:IPR000453"
FT                   /db_xref="InterPro:IPR020541"
FT                   /db_xref="InterPro:IPR035904"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5ZST4"
FT                   /protein_id="ACI53883.1"
FT                   /translation="MSHNTFGHLFRVTTWGESHGPALGCVVDGCPPGLRFKLEDLQVWL
FT                   DKRKPGQSRFVTQRREDDLVKVLSGVMLDADGETMTTTGTPISMLIENTDQRSKDYGEI
FT                   ARQFRPGHADYTYDLKYGIRDYRGGGRSSARETAARVAAGGIARLVVPGVTVRGALVQI
FT                   GKHKIDRRAWDWDQVGQNPFFSPDAAIVPVWEEYLDGIRKNGSSIGAVVEVIAEGVPAG
FT                   LGAPIYSKLDQDIASLLMSINAVKGVEIGNGFAAAETSGEDNADEMRMGNDGVPIFLSN
FT                   NAGGILGGISTGQPVVARFAVKPTSSILTERQSIDADGKNVDVRTKGRHDPCVGIRAVP
FT                   IGEAMVACAIADHYLRDRGQTGRLK"
FT   gene            complement(612629..615817)
FT                   /locus_tag="Rleg2_0587"
FT   CDS_pept        complement(612629..615817)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0587"
FT                   /product="diguanylate cyclase/phosphodiesterase with
FT                   PAS/PAC sensor(s)"
FT                   /note="TIGRFAM: PAS sensor protein; diguanylate cyclase;
FT                   PFAM: GGDEF domain containing protein; EAL domain protein;
FT                   PAS fold-3 domain protein; KEGG: mlo:mlr2027 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0587"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53884"
FT                   /db_xref="GOA:B5ZST5"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR006189"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZST5"
FT                   /protein_id="ACI53884.1"
FT                   /translation="MGSFILLSRLSDNKQLRRVLKNTRVSFLVSSLVALVVIMVGFGLD
FT                   RANTQSYERELHIRTESEANLIRARVMAEINMDLSMVRDLANLISVSAANGEEMERQIN
FT                   WLLIQNPSFIHIAVAPDFIIDNVYPRLPGNEEIGRDVRATLFSRQAMTPAAGDQSARFY
FT                   GPVSTDGRDGFAIFFPVFVKENGQRRLWGAVELVIDQQMFYEATGLMPARDRENRERFP
FT                   HLNHLSIALRDIGSPARAATAAPFFGSSEIDDKNPMRQKIGFAGGKWELSVVPNSGWDA
FT                   IPENRTELRLIVAAAGCIIIVPIFFATLLLGERNRNITELETREAKLKELSQRLDLALE
FT                   SSNIGIWELEDHSSSLLWDARAAALHGKPAQEGSRALDEWLAAILPEDREIAEVHFFSC
FT                   SIAGAACTAQYRILPADGGIRHLRSVGAFYTDAGGVSRTIGIVWDVTADAETTDTLRKA
FT                   KDMSEVKNAELELALEELSSREGQLAELSSRLDLALNSYQCGIWEARPDRGGSIWNERM
FT                   HELYGLAPRNGFMTEETWLGCIHPEDRGLALESARHFKKNGDTHTLVCRVIVDGGAVRY
FT                   VRSVGKVHQTGTGEMKIMGIAFDATEDVLMTIRLKAAKDEAVAKNIELELAKNRIEHNS
FT                   LHDPLTALANRRKLDIALEELTNDGRRQRQKFSILHIDLDRFKEINDTLGHAAGDAMLV
FT                   HASKVLAKNVRGSDIVARIGGDEFVILALDVGDTEMAQLSARIIEEMRQPIDFQGFSCR
FT                   CGVSIGVALANGIHVDARKVLINADIALYRAKSTGRNRFEFFNHNLQADIVNTKRTADE
FT                   ILAGIDNGEFTAWYQPQFSARTMELTGVEALVRWKHPAKGWLAPDKFLRIADEINVVQM
FT                   LDRIVLETALRDKMRWTAQGIAVPKVSVNVSARRLHDGSLLESLADLHIRPGELSFELV
FT                   ESIFLDESEDVVSHNLEHIKALGIDIEIDDFGTGHTSIVSLLKLKPKRLKIDRQLVQPI
FT                   VGATQERALVRSIIDIARSLGVETVAEGVETAAHAELLRDLGCDILQGYAFSRPLSFDD
FT                   FTTEATGAGWRLAS"
FT   sig_peptide     complement(615674..615817)
FT                   /locus_tag="Rleg2_0587"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.828) with cleavage site probability 0.690 at
FT                   residue 48"
FT   gene            616045..616305
FT                   /locus_tag="Rleg2_0588"
FT   CDS_pept        616045..616305
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0588"
FT                   /product="protein of unknown function DUF1344"
FT                   /note="PFAM: protein of unknown function DUF1344; KEGG:
FT                   rec:RHECIAT_CH0001032 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0588"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53885"
FT                   /db_xref="InterPro:IPR009780"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZST6"
FT                   /protein_id="ACI53885.1"
FT                   /translation="MRFVVATLLATASFLSPMSGFAESADVEATIKKVDTANLVLTLDD
FT                   GKTYQAPEEFNFDGLEAGVKVIVFYTEVDGKRVINDLDIVK"
FT   sig_peptide     616045..616113
FT                   /locus_tag="Rleg2_0588"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.649 at
FT                   residue 23"
FT   gene            616433..616675
FT                   /locus_tag="Rleg2_0589"
FT   CDS_pept        616433..616675
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0589"
FT                   /product="Domain of unknown function DUF1902"
FT                   /note="PFAM: Domain of unknown function DUF1902; KEGG:
FT                   rec:RHECIAT_CH0001033 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0589"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53886"
FT                   /db_xref="InterPro:IPR015066"
FT                   /db_xref="InterPro:IPR035069"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZST7"
FT                   /protein_id="ACI53886.1"
FT                   /translation="MKHASIIVRADWDEEAGVWVASSNDIEGLAIEADTLEALEPKVVA
FT                   AITDLFELNGFTSSLPEIPIHIMAEQLVRIPNPTY"
FT   gene            complement(616890..617480)
FT                   /locus_tag="Rleg2_0590"
FT   CDS_pept        complement(616890..617480)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0590"
FT                   /product="Phosphoglycerate mutase"
FT                   /note="PFAM: Phosphoglycerate mutase; KEGG:
FT                   rec:RHECIAT_CH0001034 phosphoglycerate mutase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0590"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53887"
FT                   /db_xref="GOA:B5ZST8"
FT                   /db_xref="InterPro:IPR001345"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZST8"
FT                   /protein_id="ACI53887.1"
FT                   /translation="MLIYVIRHGQTDWNAERRLQGQKDIPMNATGLEQARQNGVALGEI
FT                   LGDTVDEFDFVASPLQRTRATMEIVRGAMGLPPLAYRTDPRLVEISFGDWEGSTLKELK
FT                   ATQRERVAERNASKWDFIPPGDDAESYEILSWRTGSWLQSVDRPTVCVTHGGVIRTLFQ
FT                   MIADLPKSSAAEGGIPQDQIVRIDATERTIVWL"
FT   gene            complement(617502..618320)
FT                   /locus_tag="Rleg2_0591"
FT   CDS_pept        complement(617502..618320)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0591"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   rec:RHECIAT_CH0001035 enoyl-[acyl-carrier-protein]
FT                   reductase (NADH) protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0591"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53888"
FT                   /db_xref="GOA:B5ZST9"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR014358"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZST9"
FT                   /protein_id="ACI53888.1"
FT                   /translation="MAQASGLMAGKRGVIMGVANNRSIAWGIAKAIHAQGGEVALTYQG
FT                   DALKKRVEPLAAEIGATLVGHCDVADEATIDEVFGNVEKLWGKIDFLVHAIGFSDKDEL
FT                   TGRYVDTSADNFAKTMQISVYSFTSVARRAEKLMTDGGAMLTLTYYGAEKVMPNYNVMG
FT                   VAKAALEASVKYLAVDLGPQNIRVNAVSAGPIKTLAASGIGDFRYILKWNEYNAPLRRT
FT                   VTIEEVGDVGLYLLSDLSRSVTGEVHHADSGYHVIGMKAVDAPDISVVKD"
FT   gene            complement(618443..619663)
FT                   /locus_tag="Rleg2_0592"
FT   CDS_pept        complement(618443..619663)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0592"
FT                   /product="heat shock protein DnaJ domain protein"
FT                   /note="PFAM: heat shock protein DnaJ domain protein;
FT                   chaperone DnaJ domain protein; KEGG: rec:RHECIAT_CH0001036
FT                   molecular chaperone protein DnaJ"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0592"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53889"
FT                   /db_xref="GOA:B5ZSU0"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR002939"
FT                   /db_xref="InterPro:IPR008971"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZSU0"
FT                   /protein_id="ACI53889.1"
FT                   /translation="MRDPYKILGVKRDAAADEIKAAWRNMAKSAHPDHNQGDPTATARF
FT                   AEIGRAYETLKDPRKRSLFDNAVRMAEAKKNEQTIMQQRQAAREAAVRAKAAQANAERV
FT                   MEELARAAQKAAADGSRQQAGSAEPADEMVDRIFGAQARAAAGGQAQARAHQAQYQQAQ
FT                   SQQTQNQQAQNQQAQNQQASEAGRRVDGDATEGDTKSDEEAGEAGPNAGANLPLPLSIL
FT                   TSLVRRFTGAKDTGLEKAPDEVATATVTIDDVLKSGWITASLPEGREIGFALPAGTRDG
FT                   HELRLKGQGFKLPGMQRGDAVINIRIAPDPRFTVDGFDLHAVLPLSIENAVLGTEARIE
FT                   GPSGPLDITIPAWSGSDKTIKIPGQGLPREEGGRGDLVVELRIILWEKPDDKVTDLMRS
FT                   MREGLFL"
FT   gene            complement(619942..620400)
FT                   /locus_tag="Rleg2_0593"
FT   CDS_pept        complement(619942..620400)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0593"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ret:RHE_CH00940 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0593"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53890"
FT                   /db_xref="InterPro:IPR032635"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZSU1"
FT                   /protein_id="ACI53890.1"
FT                   /translation="MEVIAKSYRHTKGLRRRSSTFFVIGAAMLSLSGCLAGGMDFLSEA
FT                   KVDRSVATGTVPQTPPSTDTLSDEMTVRNAVTSADVQRLEGQPLPWANASTGSAGVIDT
FT                   IVENNESGQVCRQFRTTRHSYVGIAKFYGKTCLVGGGNWQLLSFQPES"
FT   sig_peptide     complement(620290..620400)
FT                   /locus_tag="Rleg2_0593"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.985) with cleavage site probability 0.857 at
FT                   residue 37"
FT   gene            620466..621086
FT                   /locus_tag="Rleg2_0594"
FT   CDS_pept        620466..621086
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0594"
FT                   /product="pyridoxamine 5'-phosphate oxidase"
FT                   /EC_number="1.4.3.5"
FT                   /note="KEGG: rec:RHECIAT_CH0001038 pyridoxamine
FT                   5'-phosphate oxidase protein; TIGRFAM: pyridoxamine
FT                   5'-phosphate oxidase; PFAM: pyridoxamine 5'-phosphate
FT                   oxidase-related FMN-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0594"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53891"
FT                   /db_xref="GOA:B5ZSU2"
FT                   /db_xref="InterPro:IPR000659"
FT                   /db_xref="InterPro:IPR011576"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="InterPro:IPR019576"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5ZSU2"
FT                   /protein_id="ACI53891.1"
FT                   /translation="MSANELTSGDFTESGEPFKLFAEWLGEAEASEPNDPNAVALATVD
FT                   EDGLPNVRMVLLKGFDDNGFVFYTNFESQKGREILGQKKAAMCFHWKSLRRQVRLRGPV
FT                   EIVTDAEADAYFKTRARGSRIGAWASKQSRPLESRFALEKAVAEYTARYAIGEIPRPAH
FT                   WSGFRIRPTSIEFWKDQNFRLHDRIEFRRPLPEGAWDKVRMYP"
FT   gene            complement(621093..622130)
FT                   /locus_tag="Rleg2_0595"
FT   CDS_pept        complement(621093..622130)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0595"
FT                   /product="polysaccharide deacetylase"
FT                   /note="PFAM: polysaccharide deacetylase; KEGG:
FT                   rec:RHECIAT_CH0001039 putative polysaccharide deacetylase
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0595"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53892"
FT                   /db_xref="GOA:B5ZSU3"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZSU3"
FT                   /protein_id="ACI53892.1"
FT                   /translation="MTGLLKRLAKRAAIGAGLELSWLIAAAGLMRQARGRGVVFTLHHV
FT                   RPHVPEAFEPNAHLEITPGFLDTVLRRLKREGYRFVRLDQVPALLAEPEGGKPFAAFTL
FT                   DDGYINNLEHALPVFEQHRAPFTVFVAKGFAEGSHSIWWETLAILLRRSGELRFDFGRG
FT                   SERLALDDPQQQWDAFDRFAAFIHRSDEARAVAAIDMLARENGIEPTDITRALVMEPGQ
FT                   LQRLATHPLATLGAHTISHRALARLPEAEARIEMQVSADYVEAVTGLRPKTIAYPYGTP
FT                   EAATSREAAIARNLGFELAVTTQPGLPAAAQTGYLSRISLNGFYQKRRYVSALASGIPL
FT                   KLMGK"
FT   gene            622347..623630
FT                   /locus_tag="Rleg2_0596"
FT   CDS_pept        622347..623630
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0596"
FT                   /product="Serine-type D-Ala-D-Ala carboxypeptidase"
FT                   /EC_number="3.4.16.4"
FT                   /note="PFAM: beta-lactamase; peptidase S11
FT                   D-alanyl-D-alanine carboxypeptidase 1; Sporulation domain
FT                   protein; KEGG: rec:RHECIAT_CH0001040 D-alanyl-D-alanine
FT                   carboxypeptidase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0596"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53893"
FT                   /db_xref="GOA:B5ZSU4"
FT                   /db_xref="InterPro:IPR001967"
FT                   /db_xref="InterPro:IPR007730"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR018044"
FT                   /db_xref="InterPro:IPR036680"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZSU4"
FT                   /protein_id="ACI53893.1"
FT                   /translation="MRTLLAAVLTVTLAVSAPLAALAGSASLVLDARTGKVLAAENADT
FT                   LNHPASLTKMMTLYLTFEALKRGKIAWDTPIKMSKYAASRPPTKLGVKAGGTITVREAV
FT                   YGMIIKSANDAASAMGEKLGGSESGFARMMTAKARQLGMSRTVFVNASGLPDGRQVTTA
FT                   RDMSTLAIALMKNYPNEYRLFSVASFNFRGRTVRGHNNLMYRYQGMDGIKTGYTNASGF
FT                   NLVSAVRDGNRRVVGVVLGGRTARSRDDKMAGLLDRYLGRASSSGGARLVASVGAREPV
FT                   EVASAADDSDVPVPLSAPRPADDLAAKSLAYADDAVVPLERPVAMDEILNAGKAPKMSA
FT                   EKTDGDWQIQISAAPSADAARALLAQAKSEGGAPLVSASPYTEAVGKGANKIYRARFVG
FT                   FASKDAAVSACDALKQRSYDCMLLPDHG"
FT   sig_peptide     622347..622418
FT                   /locus_tag="Rleg2_0596"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.958 at
FT                   residue 24"
FT   gene            623760..624077
FT                   /locus_tag="Rleg2_0597"
FT   CDS_pept        623760..624077
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0597"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rec:RHECIAT_CH0001041 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0597"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53894"
FT                   /db_xref="InterPro:IPR004518"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZSU5"
FT                   /protein_id="ACI53894.1"
FT                   /translation="MLRRLADQFEISSAAHVAANGIERDADWFLLKLQEEMGELTQAWN
FT                   RLTGRGRAKGRSPEEMRRDLADETADLLGHLLLFARSNDIDLAAAIERKWLFQPAEAPK
FT                   S"
FT   gene            complement(624094..624585)
FT                   /locus_tag="Rleg2_0598"
FT   CDS_pept        complement(624094..624585)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0598"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   rec:RHECIAT_CH0001044 probable acetyltransferase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0598"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53895"
FT                   /db_xref="GOA:B5ZSU6"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZSU6"
FT                   /protein_id="ACI53895.1"
FT                   /translation="MAEVEIRRFAEGDADDVLSVILPIQREEFGIDITADAQPDLRVIP
FT                   DFYQSGKGEFWVAVKDGAIVGTLGLKDIGNHQAALRKMFVAADVRGREHGVAALLLDRM
FT                   FAHARDAGLTDIFLGTTDKFVAAHRFYEKNGFTEIAKSALPRAFPLMAVDTKFYRHKVG
FT                   "
FT   gene            complement(624603..626018)
FT                   /locus_tag="Rleg2_0599"
FT   CDS_pept        complement(624603..626018)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0599"
FT                   /product="peptidase U62 modulator of DNA gyrase"
FT                   /note="PFAM: peptidase U62 modulator of DNA gyrase; KEGG:
FT                   ret:RHE_CH00950 Zn-dependent protease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0599"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53896"
FT                   /db_xref="GOA:B5ZSU7"
FT                   /db_xref="InterPro:IPR002510"
FT                   /db_xref="InterPro:IPR025502"
FT                   /db_xref="InterPro:IPR035068"
FT                   /db_xref="InterPro:IPR036059"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZSU7"
FT                   /protein_id="ACI53896.1"
FT                   /translation="MTTDLLTLFDADEATMRGLVAEALAGADDGELFIEHAQAEALTFD
FT                   NGRLKGGSFNTEQGFGLRAVAGEAVGYAHAGDLSVAALKRAADAVGAVTRGYSGSYAAA
FT                   PQGTNKKFYGDQNPIGQPSFEEKVKVLQDIDAYLRGKNDKVRQVTASVAASWQVVDILR
FT                   ADGHRVRDIRPMTRINISVMVGEGDRQESGSYGSGGRIGFGDFIAEGSWQYGADEALRQ
FT                   ALVNLEAIDAPAGTMDVVLGSGWPGVMLHEAVGHGLEGDFNRKKTSAFAGLLGQMVAAP
FT                   GVTVVDDGTIDNRRGSITIDDEGTPSGYNVLIENGKLVGYMQDRQNARLMGMQPTGNGR
FT                   RQGYAHVPMPRMTNTYMLGGDKTPEEIIASVKKGIYAVSFGGGQVDITSGKFVFGCTEA
FT                   YLIENGKVGAPIKGAMLIGNGPDAMKRVSMIGNDMKLDTGIGNCGKGGQWVPVGVGQPH
FT                   LRMDQITVGGTQT"
FT   gene            626359..626778
FT                   /locus_tag="Rleg2_0600"
FT   CDS_pept        626359..626778
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_0600"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_0600"
FT                   /db_xref="EnsemblGenomes-Tr:ACI53897"
FT                   /db_xref="UniProtKB/TrEMBL:B5ZSU8"
FT                   /protein_id="ACI53897.1"
FT                   /translation="MIYFDFDEKQLVVRGYQKAKVQKHIATGDVIAREECKGGAGIASP
FT                   LINKLGEFFGNQYSTFEIPASGQSSDGCFTASSYNILFSKPAAALRDEIERRTGRRLEI
FT                   YSPSRHRDGSADEMPGYIVDAGDHSEYVCSFSEYD"
FT   gene            complement(626989..627630)
FT                   /locus_tag="Rleg2_0601"
FT   CDS_pept