(data stored in SCRATCH zone)

EMBL: CP001193

ID   CP001193; SV 1; circular; genomic DNA; STD; PRO; 501946 BP.
XX
AC   CP001193; ABKO01000000-ABKO01000027;
XX
PR   Project:PRJNA20179;
XX
DT   18-OCT-2008 (Rel. 97, Created)
DT   12-DEC-2013 (Rel. 119, Last updated, Version 3)
XX
DE   Rhizobium leguminosarum bv. trifolii WSM2304 plasmid pRLG202, complete
DE   sequence.
XX
KW   .
XX
OS   Rhizobium leguminosarum bv. trifolii WSM2304
OC   Bacteria; Proteobacteria; Alphaproteobacteria; Rhizobiales; Rhizobiaceae;
OC   Rhizobium/Agrobacterium group; Rhizobium.
OG   Plasmid pRLG202
XX
RN   [1]
RC   Publication Status: Online-Only
RP   1-501946
RX   DOI; 10.4056/sigs.44642.
RX   PUBMED; 21304679.
RA   Reeve W., O'Hara G., Chain P., Ardley J., Brau L., Nandesena K., Tiwari R.,
RA   Malfatti S., Kiss H., Lapidus A., Copeland A., Nolan M., Land M.,
RA   Ivanova N., Mavromatis K., Markowitz V., Kyrpides N., Melino V., Denton M.,
RA   Yates R., Howieson J.;
RT   "Complete genome sequence of Rhizobium leguminosarum bv trifolii strain
RT   WSM2304, an effective microsymbiont of the South American clover Trifolium
RT   polymorphum";
RL   Stand Genomic Sci 2(1):66-76(2010).
XX
RN   [2]
RP   1-501946
RG   US DOE Joint Genome Institute
RA   Lucas S., Copeland A., Lapidus A., Glavina del Rio T., Dalin E., Tice H.,
RA   Pitluck S., Chain P., Malfatti S., Shin M., Vergez L., Lang D., Larimer F.,
RA   Land M., Hauser L., Kyrpides N., Mikhailova N., Yates R., Ardley J.,
RA   Tiwari R.P., O'Hara G., Howieson J., Brau L., Reeve W.;
RT   "Complete sequence of plasmid2 of Rhizobium leguminosarum bv. trifolii
RT   WSM2304";
RL   Unpublished.
XX
RN   [3]
RP   1-501946
RG   US DOE Joint Genome Institute
RA   Lucas S., Copeland A., Lapidus A., Glavina del Rio T., Dalin E., Tice H.,
RA   Pitluck S., Chain P., Malfatti S., Shin M., Vergez L., Lang D., Larimer F.,
RA   Land M., Hauser L., Kyrpides N., Mikhailova N., Yates R., Ardley J.,
RA   Tiwari R.P., O'Hara G., Howieson J., Brau L., Reeve W.;
RT   ;
RL   Submitted (13-OCT-2008) to the INSDC.
RL   US DOE Joint Genome Institute, 2800 Mitchell Drive B100, Walnut Creek, CA
RL   94598-1698, USA
XX
DR   MD5; a2bdc43b31219b03706661fcb9c0a6b8.
DR   BioSample; SAMN00000679.
DR   EnsemblGenomes-Gn; EBG00000998696.
DR   EnsemblGenomes-Gn; EBG00000998698.
DR   EnsemblGenomes-Gn; EBG00000998699.
DR   EnsemblGenomes-Tr; EBT00001525961.
DR   EnsemblGenomes-Tr; EBT00001525962.
DR   EnsemblGenomes-Tr; EBT00001525963.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00489; ctRNA_p42d.
DR   RFAM; RF00490; S-element.
XX
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 4024175
CC   Source DNA and organism available from Wayne Reeve
CC   (W.Reeve@murdoch.edu.au)
CC   Contacts: Wayne Reeve (W.Reeve@murdoch.edu.au)
CC             David Bruce (microbe@cuba.jgi-psf.org)
CC   Annotation done by JGI-ORNL and JGI-PGF
CC   Finishing done by JGI-LLNL
CC   Finished microbial genomes have been curated to close all gaps with
CC   greater than 98% coverage of at least two independent clones. Each
CC   base pair has a minimum q (quality) value of 30 and the total error
CC   rate is less than one per 50000.
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. it is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..501946
FT                   /organism="Rhizobium leguminosarum bv. trifolii WSM2304"
FT                   /plasmid="pRLG202"
FT                   /strain="WSM2304"
FT                   /mol_type="genomic DNA"
FT                   /note="biovar: trifolii"
FT                   /db_xref="taxon:395492"
FT   gene            complement(169..1107)
FT                   /locus_tag="Rleg2_5615"
FT   CDS_pept        complement(169..1107)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5615"
FT                   /product="protein of unknown function DUF303 acetylesterase
FT                   putative"
FT                   /note="PFAM: protein of unknown function DUF303
FT                   acetylesterase putative; KEGG: rec:RHECIAT_CH0002780
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5615"
FT                   /db_xref="EnsemblGenomes-Tr:ACI58790"
FT                   /db_xref="InterPro:IPR005181"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="UniProtKB/TrEMBL:B6A307"
FT                   /protein_id="ACI58790.1"
FT                   /translation="MRKTISVGLGALIAMYVLGGTSARHEIFPWPQLSVLRKTVGAEKA
FT                   APPSRYIFDDKERLIGDETKTPVTCPTQTDRTAVLLILGQSNAANDGGQRHRSNYGARV
FT                   INAFGKQCFIAASPLLGSTDTKGEYWTLLGNKLIASGQNDSVILAPLAFSGSEVARWAA
FT                   GGDLNPVLVDTMKQLQASGYRITSVLWVQGEKDLVIGNTAEAYGQRFMSMVDTLRQHGV
FT                   GAPVYISIASKCLEPSNGGFKEHIPDNAIVRAQLALSKSGHGIREGVNSDALLDGDDRY
FT                   DDCHIGGTGAEKVSQAWLTLLRGDRRLEPSG"
FT   sig_peptide     complement(1048..1107)
FT                   /locus_tag="Rleg2_5615"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.994) with cleavage site probability 0.984 at
FT                   residue 20"
FT   gene            complement(2010..2405)
FT                   /locus_tag="Rleg2_5616"
FT   CDS_pept        complement(2010..2405)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5616"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5616"
FT                   /db_xref="EnsemblGenomes-Tr:ACI58791"
FT                   /db_xref="UniProtKB/TrEMBL:B6A308"
FT                   /protein_id="ACI58791.1"
FT                   /translation="MDSLDNFPKEHVDAVRGYWDNQINYEEKPRFIELLTMLNLARATS
FT                   RYSVDFSPEGKRIGAILNKQLSDWENDYYAVQPLMHCVEKFMGDGDNPDACAEVLQYGL
FT                   AFRGANGRVYLNMRGRRLENKIMIGRR"
FT   gene            2874..5093
FT                   /locus_tag="Rleg2_5617"
FT   CDS_pept        2874..5093
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5617"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5617"
FT                   /db_xref="EnsemblGenomes-Tr:ACI58792"
FT                   /db_xref="UniProtKB/TrEMBL:B6A309"
FT                   /protein_id="ACI58792.1"
FT                   /translation="MNIPPFGKRKSTPLIGWWSMLEEEERLVRSDGASVQFLGFVNQGD
FT                   EPGKRGLNDRRWMRFEADDTIRSMQFLVQWRDVFSPQSPRALIWRLDYARSLEQSGIVA
FT                   LDYQEWVAMDRFICDALVCWPQREVTGLRPTLIAVSGGWHQGQWREEYYRTFDMAYLGG
FT                   RVDETVSKPSVIRQETPRQWRFVPATQEASAEDIVAIHERLADARPEAIEALVVGLLPK
FT                   RPHLQSGERFLVPLRQYGGQTQWLYIDDEIITDRIVAHTHKPSWMFRIDNAALIGTIDR
FT                   KRRTEFKFDHAWQPKKIGAVKREYGTFSHVFRNRLRDLCENGLWQWEEVCLQLHSPESE
FT                   GKGSVKQTCIQRPKRVRLDEIVSVAGRVATVRLVIAESLDGSDYADKIFSDAFNDNPAP
FT                   LNSSEWEQFEFQADAFSLMDGSTQQQLELREIVAGSGSVTDGCEGLFCYRDNDSEYLLV
FT                   VIREGRRANHQAGKWVLDHNASRSKNQQSGVPPISDERWYRMARFSRDALLAWPDTDIF
FT                   GPGPSGLAELGGCFQGRWEPELRRWQRNHLKTSENDPSTGRYNPEASLLLPWKAFDPGA
FT                   DVGAPSERIEAALRRLADRSAGDENIGQTRRLRWLRADGRAIFYLHGWQTLRAPPDGDP
FT                   YQAPVFEYLDDDITVHLYPKRFDEYDMQSLALIEVNPASGLYGKVEPTQSLYQQRRPTE
FT                   EIWYRVVTAIESQIDRISEQLAIHGLYTVHGYDGYATRTLVLNRS"
FT   gene            complement(5141..6016)
FT                   /locus_tag="Rleg2_5618"
FT   CDS_pept        complement(5141..6016)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5618"
FT                   /product="FHA domain containing protein"
FT                   /note="PFAM: Forkhead-associated protein; KEGG:
FT                   ret:RHE_PE00147 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5618"
FT                   /db_xref="EnsemblGenomes-Tr:ACI58793"
FT                   /db_xref="GOA:B6A310"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="UniProtKB/TrEMBL:B6A310"
FT                   /protein_id="ACI58793.1"
FT                   /translation="MAFSFFRGNKPSLLQTGPGGQSRSHVLDRPEMSIGRAANADIVVD
FT                   DPFLAPIHARIEKQSDGGFIIRRMGLNPIMLRGEALLQTASLKAGDSFRLGKDVEFQFV
FT                   VKAAAKEAPKKEASKTGDDKPKKPLLKQPAFLAGIGLAYLAIVGIIGYVILSDSGSTEG
FT                   GPTAERINAEAARIPTCIKNARRMRQVSEASFNGAVGGRVGRDGDATYAALSLAAEPSD
FT                   DAALAKAAEPIVEAYKRTALAALASENRGNKTLALSLYQQTYDLVPDINCSAARFALQR
FT                   RAAVKPPARR"
FT   gene            complement(6019..6921)
FT                   /locus_tag="Rleg2_5619"
FT   CDS_pept        complement(6019..6921)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5619"
FT                   /product="type II secretion system protein"
FT                   /note="PFAM: type II secretion system protein; KEGG:
FT                   ret:RHE_PE00148 putative pilus assembly protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5619"
FT                   /db_xref="EnsemblGenomes-Tr:ACI58794"
FT                   /db_xref="GOA:B6A311"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="UniProtKB/TrEMBL:B6A311"
FT                   /protein_id="ACI58794.1"
FT                   /translation="MSQIPLAPIAVVFAGITAALFVWWIGDLLGSIQVVRRSRGGDGPP
FT                   PNVVDSIGMRTPVEFVLLHFEPWLADYGAQLEQKLIYGGRPFGGVTGREYIALLVVLSL
FT                   FGFILLGVLFGIASGSIIGGLVAGLILGLIPAIYFWVVADDKMQDRKERISREFPYFLD
FT                   LVVMTQQAQATLPESLRLYAEAAPGTVMSEEIDQTLKDVALGTGMVEALQRLERRMTAE
FT                   EVIRVIRAVIQGEVEGSNRVELLREHARDLRFRRWEKADRASEKLKAKIVMPAMMIVVS
FT                   ILLLVLAPAIVEMMSSGMF"
FT   gene            complement(6921..7784)
FT                   /locus_tag="Rleg2_5620"
FT   CDS_pept        complement(6921..7784)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5620"
FT                   /product="type II secretion system protein"
FT                   /note="PFAM: type II secretion system protein; KEGG:
FT                   ret:RHE_PE00149 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5620"
FT                   /db_xref="EnsemblGenomes-Tr:ACI58795"
FT                   /db_xref="GOA:B6A312"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="InterPro:IPR042094"
FT                   /db_xref="UniProtKB/TrEMBL:B6A312"
FT                   /protein_id="ACI58795.1"
FT                   /translation="MDISILQIFTVALGAVTAGLLVWGAPVRWPAPLLRATERDIALAS
FT                   EAAQVFGRDAVPPYTMILAYGITAIVVFLVVSLIFGPIFGIVIAIPVAFFLPKAVIRYF
FT                   LQRRWLQIESQLPYAVDQIVSAVRTGKPLAVAVNAVADTGQMPASREFERIAREQKLGI
FT                   GLVEALDRHGRTVPSLHFKMVDAALGLFARQGGDISEPLTEMSKSFKEIWKLDQKITTS
FT                   SSQARMNFRVVNGGALFMILMIFFGQPELIDKVFGNAIGIVIAIVGAILYATGFFWMRS
FT                   MMKVSV"
FT   sig_peptide     complement(7710..7784)
FT                   /locus_tag="Rleg2_5620"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.696) with cleavage site probability 0.687 at
FT                   residue 25"
FT   gene            complement(7839..9737)
FT                   /locus_tag="Rleg2_5621"
FT   CDS_pept        complement(7839..9737)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5621"
FT                   /product="type II secretion system protein E"
FT                   /note="PFAM: type II secretion system protein E; KEGG:
FT                   ret:RHE_PE00150 putative bacterial type II secretion system
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5621"
FT                   /db_xref="EnsemblGenomes-Tr:ACI58796"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B6A313"
FT                   /protein_id="ACI58796.1"
FT                   /translation="MLLKISYEDGSGREVIPLSANETYFVGESSTLTLPAGAGVVRLRG
FT                   SHVSSPQFVLRKSGQGWSVQHHGRNPTRVDDQPLRAGTPVAVSAGMSIWVPNVTIELVE
FT                   PAAAAEAVTQFPDQERVLALQMEIHERLLKDTQYDRLVKSSDFGREDTRNRIRERLDMF
FT                   IKEALDGAPQDLVILVIKNAVYRWLAKRIARTGRRDASSTAASLSREEQDNRRLFDVGK
FT                   ALISALQLKLNFESTRADFAQLDTRFSAAFQSRQALFNAGDRYEIAHMHLRSNIEELMY
FT                   RWGTISELMDLDVISEIMVTRYDEIYVEKFGLLERYPFAFANERQLMKVIERIAVDSNR
FT                   SINESEAMADFRMPDGSRVNAVIPPLAVKGACLTIRKFGGKSRLDISKLVTAGALSEPM
FT                   RAFLEAAVRARKNIVVSGGTGSGKTTLLNSLSQFIPIGERVVAVEDTSELQLDGIHVVY
FT                   LQSRPKTAESETSVTIRDLVRNALRMRPDRIIVGECRGAEAIDMLQAMNTGHAGSMTTA
FT                   HANTPQDMMTRLEVMVLQGQSSLPVMAIRQQIVAAVELVVQLNRLESGRRAVTEISEVI
FT                   GIDPDTGLVIVEPIFHLVGRAGGQAVHAFTGYLPSFVAELVEFGEDGEIEKLDMFV"
FT   gene            complement(9758..10696)
FT                   /locus_tag="Rleg2_5622"
FT   CDS_pept        complement(9758..10696)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5622"
FT                   /product="Flp pilus assembly protein CpaB"
FT                   /note="TIGRFAM: Flp pilus assembly protein CpaB; KEGG:
FT                   ret:RHE_PE00151 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5622"
FT                   /db_xref="EnsemblGenomes-Tr:ACI58797"
FT                   /db_xref="GOA:B6A314"
FT                   /db_xref="InterPro:IPR031571"
FT                   /db_xref="UniProtKB/TrEMBL:B6A314"
FT                   /protein_id="ACI58797.1"
FT                   /translation="MNWKLIAAVIVGLITGVLLYFWTESVKNEQVAYAFMRLQPDRKVT
FT                   RGQAITPDMLAEPVMLPESFGALAKLAVPAASAYQEWLKDRTAAADIPAGSVLLFQYFD
FT                   DNDGGRLTTMIAPGKRALTLPVNAASAVGHFVEPGSYVDILGTVDEPVEPVAPAAAAQP
FT                   GTPGQAPAVPGQAPVAAGQPQAPAQPPSPVEQMLKNYLTQYPGADENDVNAYRKQAQDY
FT                   KLGISSRTRVVTRTFLQNVKVLAVGAATTAEGAVTKANSTYNNVTVEVTPAEAEMLIFA
FT                   MGQSNGSLNLVLRNPADNTVEELPSINWTRM"
FT   gene            complement(10693..11610)
FT                   /locus_tag="Rleg2_5623"
FT   CDS_pept        complement(10693..11610)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5623"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5623"
FT                   /db_xref="EnsemblGenomes-Tr:ACI58798"
FT                   /db_xref="UniProtKB/TrEMBL:B6A315"
FT                   /protein_id="ACI58798.1"
FT                   /translation="MRQGARISVHLLATAFGIGLVAMVAATPGRAEVYKDFRATLNSML
FT                   AGILGAPERAPRDLVINGQPLEFTPYQSDRSISDITDEWLRVLAVNTRPALPKSNDREE
FT                   LTAVIAANMLIVPKTSRIRDDLAVVVRFFDGDGEAALDYMRRQDPANPSARAPIPGVSI
FT                   MIRRPAGAPVTEVLMTRFEDVASSLPAFAAPADAGKLPPSLRPPAGVEVLSDIGDRDKG
FT                   HTSRTVVSKGSLSAVRWSDARAELLTRDGFTIEAPPAQRGGVTALYGRRGSVEANVLYT
FT                   SSKSDGRTVEVIQIRQPFVGGITP"
FT   sig_peptide     complement(11515..11610)
FT                   /locus_tag="Rleg2_5623"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.948) with cleavage site probability 0.715 at
FT                   residue 32"
FT   gene            complement(11612..12289)
FT                   /locus_tag="Rleg2_5624"
FT   CDS_pept        complement(11612..12289)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5624"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ret:RHE_PE00153 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5624"
FT                   /db_xref="EnsemblGenomes-Tr:ACI58799"
FT                   /db_xref="GOA:B6A316"
FT                   /db_xref="UniProtKB/TrEMBL:B6A316"
FT                   /protein_id="ACI58799.1"
FT                   /translation="MPGLPSTHTDPAGAPAGGLMMRLHRDRRGLASIEFVLAAPVILLI
FT                   VIFMIHANRISTKKVGTMLAMRNAAFAEANGLDCTSDFSNVFPLPSLPALPGRDAMSCS
FT                   RTPSHEGDGDPQRTFVWDDVQNTLKSDGRDFGDMVGDLANEKPQLVTATADRVYKFRDS
FT                   DDLDTIRSIRWKDAFTVDDATLFASHNNDTTRRGYDPTLRREIRDVADDSGDLFDGVFP
FT                   GAK"
FT   gene            complement(12261..13901)
FT                   /locus_tag="Rleg2_5625"
FT   CDS_pept        complement(12261..13901)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5625"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ret:RHE_PE00154 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5625"
FT                   /db_xref="EnsemblGenomes-Tr:ACI58800"
FT                   /db_xref="GOA:B6A317"
FT                   /db_xref="InterPro:IPR028087"
FT                   /db_xref="UniProtKB/TrEMBL:B6A317"
FT                   /protein_id="ACI58800.1"
FT                   /translation="MTPTLIKRLHRDERGFLSPIILYMTIALALMIVWILNTGQMIYDK
FT                   QRTQDTADAAALVHADWEARYLNIMAMNNVASSQATVVMATSVAFQLTTAELALRSTAI
FT                   LAKLAEYSFTEGFGPASLLPPMPPMPYCPGWQKVPIVGGIIYGACLAFQGFRATEATIA
FT                   IAYTVKAQIDYDPWGLINKSSDIIDGMNDLNDYLVESFPQRVGNEALHLVRLNKADHVV
FT                   FHPPCESCNDAGEGAGGNLPVDRDGVNPAAAYAEMCLAMSRGTEGQDPFLMRGEFANRG
FT                   FPNGKGPLTAGGVDGSHIRDFVNHKSGIDSTLVNFYIFYEAFGPAYLSKIPFKAIIEQY
FT                   ADLSWWEELTLDASFFVAEEFFGIEFGVVNPFQLPIDVPPRYSDSQTKDENDFTRKFDM
FT                   IWNQVCGPAGAAISVAGAALPVISFPKPYWLKGRVPFNFTPFGGEQLDDYQTLAIVSRA
FT                   PRARLQIRIFKDKTPSAYALAQSWVHNYTAFDLYTQDWLASLAPATLADDTGEVSNTIK
FT                   QSPAADSFTGLTRVFDKGGANAWAAVNTH"
FT   gene            complement(13898..14695)
FT                   /locus_tag="Rleg2_5626"
FT   CDS_pept        complement(13898..14695)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5626"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ret:RHE_PE00155 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5626"
FT                   /db_xref="EnsemblGenomes-Tr:ACI58801"
FT                   /db_xref="GOA:B6A318"
FT                   /db_xref="InterPro:IPR012495"
FT                   /db_xref="UniProtKB/TrEMBL:B6A318"
FT                   /protein_id="ACI58801.1"
FT                   /translation="MRAELERPLFDGAFWSSILHSRTFWIPEDHGALFGTFAIAMILLA
FT                   SMLLLPRLSARRRRISELHGDSSGSTTMMDFVLVTPVFVFFMFVVFQFAILAKNHLFTH
FT                   YAAYAAARSARVYFCPALPITIRSFIDVKTCDDDAAPGKADLAARLALIPAAPYDQLKC
FT                   VGACQPPEEALKSLADASGLSKNWRAMRNQARYMFDPQNVTVTVDRAPMALYAAINRSP
FT                   HVPVTAKVEARFLLLEYAGWVFARGQRKDGRYYTISKAEVNLL"
FT   gene            complement(14701..15264)
FT                   /locus_tag="Rleg2_5627"
FT   CDS_pept        complement(14701..15264)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5627"
FT                   /product="peptidase A24A prepilin type IV"
FT                   /note="PFAM: peptidase A24A prepilin type IV; KEGG:
FT                   ret:RHE_PE00156 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5627"
FT                   /db_xref="EnsemblGenomes-Tr:ACI58802"
FT                   /db_xref="GOA:B6A319"
FT                   /db_xref="InterPro:IPR000045"
FT                   /db_xref="UniProtKB/TrEMBL:B6A319"
FT                   /protein_id="ACI58802.1"
FT                   /translation="MDMTYDLTLMPAAAALAVACATTAAVLDHRQGHIPNAVTYPCLLA
FT                   GFMLAAAGGGLAGIGLAFAGLIAAGMIFIIAFAAGSCGGGDVKLMAALGAILGLWPAID
FT                   VTLASLMVGGVIALFSMARRVQWSVLARNVGLFALLLPAGFRDAASVLKPRETHHTVRF
FT                   GVAAALGLFWCLFMPDSTPLSLVR"
FT   sig_peptide     complement(15190..15264)
FT                   /locus_tag="Rleg2_5627"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.993) with cleavage site probability 0.859 at
FT                   residue 25"
FT   gene            complement(15279..15482)
FT                   /locus_tag="Rleg2_5628"
FT   CDS_pept        complement(15279..15482)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5628"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5628"
FT                   /db_xref="EnsemblGenomes-Tr:ACI58803"
FT                   /db_xref="GOA:B6A320"
FT                   /db_xref="UniProtKB/TrEMBL:B6A320"
FT                   /protein_id="ACI58803.1"
FT                   /translation="MFGKLKTLAIALHQDERGDMAQIVLAVALIVIPLMLLLLAFGKQI
FT                   GEWFNEKNTALSDAERIPEPGQ"
FT   gene            15992..16123
FT                   /locus_tag="Rleg2_5629"
FT   CDS_pept        15992..16123
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5629"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5629"
FT                   /db_xref="EnsemblGenomes-Tr:ACI58804"
FT                   /db_xref="UniProtKB/TrEMBL:B6A321"
FT                   /protein_id="ACI58804.1"
FT                   /translation="METMSSILILALVLIPLMMFFPTAVQMMATLFGMSTVLVGMPL"
FT   sig_peptide     15992..16066
FT                   /locus_tag="Rleg2_5629"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.990) with cleavage site probability 0.432 at
FT                   residue 25"
FT   gene            16123..17265
FT                   /locus_tag="Rleg2_5630"
FT   CDS_pept        16123..17265
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5630"
FT                   /product="type II secretion system protein E"
FT                   /note="PFAM: type II secretion system protein E; KEGG:
FT                   ret:RHE_PE00157 putative bacterial type II secretion system
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5630"
FT                   /db_xref="EnsemblGenomes-Tr:ACI58805"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B6A322"
FT                   /protein_id="ACI58805.1"
FT                   /translation="MKAVSDDAAEQATFQVLTRALDKLLGPIRFLLEDPSVSEILINGT
FT                   SDIFVERRGKLERADTRFASREDLESAARSIAQFSGKRLTPEEPSVEARLPDGSRVQMI
FT                   QPPAARTGLCISIRRFLKEHRSIRDLVTQGSLTEASLSLLQAAVGLQKNVIISGGTGTG
FT                   KTTMLNALSEAFADHERIIVIEDTSELQIRKEHVVYLEVTKPDRFGRGGASIRDLFRSS
FT                   LRMRPDRIIVGECRGGEALDMIQAMTSGHSGSLSTVHANTPYDALHRLETLALMSDIDM
FT                   PLRPLRAQIASAVDVVVQIARFKRTGRRRVIEISEIKGLNEDGQYIVESIYKLEGDGHS
FT                   NSDGALLWTGVVPSFAADAVEELQGAERAEWMEPAARETA"
FT   gene            complement(17584..18714)
FT                   /locus_tag="Rleg2_5631"
FT   CDS_pept        complement(17584..18714)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5631"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rec:RHECIAT_PA0000344 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5631"
FT                   /db_xref="EnsemblGenomes-Tr:ACI58806"
FT                   /db_xref="InterPro:IPR019039"
FT                   /db_xref="UniProtKB/TrEMBL:B6A323"
FT                   /protein_id="ACI58806.1"
FT                   /translation="MNDRIHPAREIPFPDLIAGLKRAQGLGHVHRRQNATGTLQLYIYT
FT                   PRCVYEDGWDQFSLIARGLIVDEGAGRVVATPFPKFFNVGERHGEVPDLPFEAFEKLDG
FT                   SLIIVFNDAGRWHAATKGAFDSEQALWAQARLDAHDLSGLSPDTTYLFEAVYPENRIVV
FT                   RYAEPAMVMLAAYHASGLEVTYDEVRTTSQALGWRAAERHEFGNMADMMLHTATLPRDN
FT                   EGFVVRFTNGLRLKLKGSEYRRIHALISRCTPLAMWEAMAAGDDMAAIRRDLPEEFWSD
FT                   FDNIVRLLTKEYAAMERKVAALAASVAHLSDKELGLSLNSLPADVGPYVFGLRKAGAIA
FT                   GKSRDALMRSIRPTGNVLPGYQPSYAMGRVIDEATS"
FT   gene            complement(19177..19722)
FT                   /locus_tag="Rleg2_5632"
FT   CDS_pept        complement(19177..19722)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5632"
FT                   /product="Sarcosine oxidase gamma subunit"
FT                   /note="PFAM: Sarcosine oxidase gamma subunit; KEGG:
FT                   rec:RHECIAT_PA0000343 sarcosine oxidase protein, gamma
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5632"
FT                   /db_xref="EnsemblGenomes-Tr:ACI58807"
FT                   /db_xref="InterPro:IPR007375"
FT                   /db_xref="InterPro:IPR027266"
FT                   /db_xref="UniProtKB/TrEMBL:B6A324"
FT                   /protein_id="ACI58807.1"
FT                   /translation="MPDLPQHRPVLAGTAYSGISGAGIRLEALPEGHLLHVLGTIEPAA
FT                   LAAELAKAGFTNSSIRKAGFRQWFVAGNEPLSPAGLDALTTALAGKAFVMDQSHGRVRI
FT                   GVSGRYSRLLLSKGTAVDLDPSVFPEGHSAMTMMGHISVQIVRTGDDSFELTVLRSFAE
FT                   SLWDELRHMAASAEKEGA"
FT   gene            complement(19715..22669)
FT                   /locus_tag="Rleg2_5633"
FT   CDS_pept        complement(19715..22669)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5633"
FT                   /product="sarcosine oxidase, alpha subunit family"
FT                   /note="TIGRFAM: sarcosine oxidase, alpha subunit family;
FT                   PFAM: glycine cleavage T protein (aminomethyl transferase);
FT                   FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; Glycine cleavage T-protein barrel; KEGG:
FT                   rec:RHECIAT_PA0000342 sarcosine oxidase protein, alpha
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5633"
FT                   /db_xref="EnsemblGenomes-Tr:ACI58808"
FT                   /db_xref="GOA:B6A325"
FT                   /db_xref="InterPro:IPR006222"
FT                   /db_xref="InterPro:IPR006277"
FT                   /db_xref="InterPro:IPR013977"
FT                   /db_xref="InterPro:IPR027266"
FT                   /db_xref="InterPro:IPR029043"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR041117"
FT                   /db_xref="InterPro:IPR041854"
FT                   /db_xref="InterPro:IPR042204"
FT                   /db_xref="UniProtKB/TrEMBL:B6A325"
FT                   /protein_id="ACI58808.1"
FT                   /translation="MTSFRLSSGGRIDRATTLGFTFDGKALAGHPGDTLASALLANGVQ
FT                   LVGRSFKYHRPRGILTAGAAEPNALVTTGSGGRTEPNTRATMIELYEGLAAKSQNRWPS
FT                   LGFDVGAVNGFLSPFLSAGFYYKTFMWPAPLWEKLYEPVIRKAAGLGRASYEADPDIYE
FT                   KCWAHCDLLVIGAGPAGLAAALTAGRAGARVILADEGPELGGSLLSRGTVEDKPADALL
FT                   NELLAELEELENVRRLPRMTVFGWYDDNVFGAVERVQKHVALPDPERPVERLWRIVARQ
FT                   AILATGAEERPLVFGGNDIPGVMMAGAMRSYLNRQAVAPGKSTVIFTTNDAGYRTAADL
FT                   EAAGLAVAAIVDSRADAGKGWQGRAEVLKGARVIDAFGGQRLRGVSVETTGGIRRIEAD
FT                   ALAMSGGWSPIIHLACHRGGKPQWSDEAAAFLAPAAQDGLAVAGSAAGLAQTTACLGDG
FT                   AAKAAAALKAIGFAAAEPAFAVAPEAAQGSKPLWSVKGSKGKAFVDYQNDVHLKDLGLA
FT                   VREGYGHVELAKRYTTSGMATDQGKLSNINAIGILAEARGVSPAEVGTTTFRPFYTPVS
FT                   FGALTGASRGKDFQPARKSPLHGWAKKNGAVFVETGLWYRSSWFPRAGEATWRDSVDRE
FT                   VLNIRKNAGLCDVSTLGKIEIFGRDAATFLDRIYCNGFAKLALGKARYGIMLREDGFIY
FT                   DDGTTSRFGDEHFFMTTTTALAAGVLTHLEFCAQTLWPELDVCFASSTDQWAQMAIAGP
FT                   KSRAILAEIVDEDLSDAAFPFMSARKVSLFGGRLEGRLFRISFSGELAYELAVPAGYGE
FT                   SVADAVMASGEKHGICAYGAEALGVLRIEKGHVTHAEINGTVTPGDLGFGRMVSSTKPD
FT                   FIGKAMLAREGLQDPERPRLVGVKPLNPASGFRTGSHILAEGAAATLENDQGYISSSAF
FT                   SPTLGHTIGLALVRRGPERIGEKVTVWNGLRNEFTDAVLCHPVFIDPENEKLHA"
FT   gene            complement(22666..22947)
FT                   /locus_tag="Rleg2_5634"
FT   CDS_pept        complement(22666..22947)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5634"
FT                   /product="sarcosine oxidase, delta subunit family"
FT                   /note="TIGRFAM: sarcosine oxidase, delta subunit family;
FT                   PFAM: Sarcosine oxidase delta subunit heterotetrameric;
FT                   KEGG: rec:RHECIAT_PA0000341 sarcosine oxidase protein,
FT                   delta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5634"
FT                   /db_xref="EnsemblGenomes-Tr:ACI58809"
FT                   /db_xref="GOA:B6A326"
FT                   /db_xref="InterPro:IPR006279"
FT                   /db_xref="InterPro:IPR038561"
FT                   /db_xref="UniProtKB/TrEMBL:B6A326"
FT                   /protein_id="ACI58809.1"
FT                   /translation="MASLISCPHCGARPKEEFSIRGDAGLARPAPDAGADAWFDYVYLR
FT                   DNPRGSHSEYWHHSSGCRRWLIVERDTVTHVVHGVRDAALAKLGGDLA"
FT   gene            complement(22960..24210)
FT                   /locus_tag="Rleg2_5635"
FT   CDS_pept        complement(22960..24210)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5635"
FT                   /product="sarcosine oxidase, beta subunit family"
FT                   /note="TIGRFAM: sarcosine oxidase, beta subunit family;
FT                   PFAM: FAD dependent oxidoreductase; KEGG:
FT                   rec:RHECIAT_PA0000340 sarcosine oxidase protein, beta
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5635"
FT                   /db_xref="EnsemblGenomes-Tr:ACI58810"
FT                   /db_xref="GOA:B6A327"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR006278"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B6A327"
FT                   /protein_id="ACI58810.1"
FT                   /translation="MRYSALSIFLNGLRGNKGWAPAWRDPAPKPHYDVVIVGGGGHGLA
FT                   TAYYLAKEFGITNVAVLEKGYLGSGNIGRNTTIIRSNYLLPGNNPFYELSMKLWEGLEQ
FT                   DFNFNAMVSQRGVLNLFHSDAQRDAYTRRGNAMRLHGVDAELLDRQAVRKKLPFLDFDN
FT                   ARFPVMGALYQPRGGTVRHDAVAWGYARGADSRGVDIITQCEVTGIRSENGKVTGVETS
FT                   RGFIGCGKLALAAAGNSTVVADMAGLRLPIESHVLQAFVSEGLKPFIDNVVTFGAGHFY
FT                   VSQSDKGGLVFGGDIDGYNSYAQRGNLASVEHVAEAGLAMIPSLSRVRYLRSWGGVMDM
FT                   SMDGSPIIDRTHIDNLYLNAGWCYGGFKATPASGFCYAHLIARNTPHQTARAFRLDRFA
FT                   RGYPIDEKGVGAQPNLH"
FT   gene            24298..25257
FT                   /locus_tag="Rleg2_5636"
FT   CDS_pept        24298..25257
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5636"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: helix-turn-helix- domain containing protein
FT                   AraC type; ThiJ/PfpI domain protein; KEGG:
FT                   rec:RHECIAT_PA0000339 putative transcriptional regulator
FT                   protein, AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5636"
FT                   /db_xref="EnsemblGenomes-Tr:ACI58811"
FT                   /db_xref="GOA:B6A328"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:B6A328"
FT                   /protein_id="ACI58811.1"
FT                   /translation="MSSPDSKNVQEIGFILIPGFALMSYASATEPLRAANLLAGREIYR
FT                   LSIFSPDGGPARSSSGVSVPAEPLPARGSGLGTAFVCAGGLPRDWRYPGVLACLRQLSR
FT                   EGVRIGGISGGPYLMAAAGLLAGRDFTIHWEHAAALLEAFPELTPRQARFMIDGNRITC
FT                   GGGIAPLDMMHVLIAERMGPDFARRVSDWYLHTEVNEPAAPQRASLAERYGVHHPGLLS
FT                   VLERMEETIEMPLDRAAMARIAGVTVRHLDRLFSAHLKTSFLDQYHRIRLQHAHRLLKQ
FT                   SPLSVSEIAVATGFSSLSHFSRMFRAVYGIAPREARRE"
FT   sig_peptide     24298..24384
FT                   /locus_tag="Rleg2_5636"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.793) with cleavage site probability 0.760 at
FT                   residue 29"
FT   gene            25328..26011
FT                   /locus_tag="Rleg2_5637"
FT   CDS_pept        25328..26011
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5637"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="PFAM: helix-turn-helix domain protein; Cupin 2
FT                   conserved barrel domain protein; KEGG:
FT                   rec:RHECIAT_PA0000338 putative transcriptional regulator
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5637"
FT                   /db_xref="EnsemblGenomes-Tr:ACI58812"
FT                   /db_xref="GOA:B6A329"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:B6A329"
FT                   /protein_id="ACI58812.1"
FT                   /translation="MKSKLEAAKQPEQAHSERAPFSQDPHAVREPKENNLEMAIGHEVR
FT                   AYRKKLGITVTDLAAATGISLGMLSKIENGNISPSLTTLQSLSRALGVPMTAFFRRFEE
FT                   PRNAVFVKAGQGIELERRGTRAGHQYNLLGHIDNNTSGVIVEPYLITLTADSDTFPTFQ
FT                   HEGMEFLYMLEGEVIYRHGDQLFQMQPGDSLFFDADAPHGPEQLVELPSKYLSIISYPQ
FT                   QNSRS"
FT   gene            26101..27006
FT                   /locus_tag="Rleg2_5638"
FT   CDS_pept        26101..27006
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5638"
FT                   /product="glutamine amidotransferase class-II"
FT                   /note="PFAM: glutamine amidotransferase class-II; KEGG:
FT                   ret:RHE_PE00421 amidophosphoribosyl transferase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5638"
FT                   /db_xref="EnsemblGenomes-Tr:ACI58813"
FT                   /db_xref="GOA:B6A330"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:B6A330"
FT                   /protein_id="ACI58813.1"
FT                   /translation="MCGIVGLFLKDKSLEPQLGNLLSDMLITMTDRGPDSAGIAIYGGS
FT                   TEGKAKITIQSANPGVDFEGLAADLAKAGIRAEVSIKSTHAVIELDASKLGTVRKALEE
FT                   IRPTVRLMGSGESVEIYKEIGLPKDVVKRFDVRAMGGTHGIGHTRMATESAVTTLGAHP
FT                   FSTGADQCLVHNGSLSNHNNLRRELVREGMTFETQNDSEVAAAYLTAEMAKGKDLGEAL
FT                   TGALDDLDGFFTFVVGTKSGFGVVRDPIACKPAVMAETDQYVAFGSEYRALVNLPGIEN
FT                   ARVWEPEPATVYFWDHDKAA"
FT   gene            27062..27748
FT                   /locus_tag="Rleg2_5639"
FT   CDS_pept        27062..27748
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5639"
FT                   /product="glutamate synthase alpha subunit domain protein"
FT                   /note="PFAM: glutamate synthase alpha subunit domain
FT                   protein; KEGG: ret:RHE_PE00420 formyl-methanofuran
FT                   dehydrogenase domain 3 protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5639"
FT                   /db_xref="EnsemblGenomes-Tr:ACI58814"
FT                   /db_xref="GOA:B6A331"
FT                   /db_xref="InterPro:IPR002489"
FT                   /db_xref="InterPro:IPR012061"
FT                   /db_xref="InterPro:IPR036485"
FT                   /db_xref="UniProtKB/TrEMBL:B6A331"
FT                   /protein_id="ACI58814.1"
FT                   /translation="MPTFDLSNTPLRELNSALHALSKGANDTEFEVINPRGSHSVAVGI
FT                   DSPVTVAVKGSVGYYCAGMNDGGRVTVHGSAGPGVAENMMSGTVVIEGDASQYAGATGR
FT                   GGLLVIKGNAASRCGISMKGIDIVVHGSIGHMSAFMGQSGHLVVLGDAGEALGDSLYEA
FT                   KLFVRGEVKSLGSDCIEKEMRPEHLEKLAELLDKAGVTDVRPEEFKRYGSARKLYNFNI
FT                   DNADAY"
FT   gene            27763..29091
FT                   /locus_tag="Rleg2_5640"
FT   CDS_pept        27763..29091
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5640"
FT                   /product="ferredoxin-dependent glutamate synthase"
FT                   /note="PFAM: FMN-dependent alpha-hydroxy acid
FT                   dehydrogenase; dihydroorotate dehydrogenase;
FT                   ferredoxin-dependent glutamate synthase; KEGG:
FT                   ret:RHE_PE00419 glutamate synthase large subunit 2 protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5640"
FT                   /db_xref="EnsemblGenomes-Tr:ACI58815"
FT                   /db_xref="GOA:B6A332"
FT                   /db_xref="InterPro:IPR002932"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR024188"
FT                   /db_xref="UniProtKB/TrEMBL:B6A332"
FT                   /protein_id="ACI58815.1"
FT                   /translation="MSYHNPYTPPRKSATFDDYTLAEIRRAAATGIYDIRGAGTKRKVP
FT                   HFDDLLFLGASISRYPLEGYREKCDTTVVLGSRFAKKPITLKTPITIAGMSFGALSGNA
FT                   KEALGRGATIAGTSTTTGDGGMTDEERGHSQTLVYQYLPSRYGMNPKDLRRADAIEVVV
FT                   GQGAKPGGGGMLLGQKISDRVANMRNLPKGIDQRSACRHPDWTGPDDLEIKIMELREIT
FT                   DWEKPIYVKVGGARPYYDTALAVKAGADVVVLDGMQGGTAATQDVFIENVGMPTLACIR
FT                   PAVQALQDLGMHRKVQLIVSGGIRSGADVAKALALGADAVAIGTAALVAIGDNDPHWEE
FT                   EYQKLGTTAGAYDDWHEGKDPAGITTQDPELAKRLDPVAAGRRLANYLKVMTLEAQTIA
FT                   RACGKNHLHNLEPEDLVALTIEASAMAQVPLAGTNWIPGKTGF"
FT   gene            29172..30479
FT                   /locus_tag="Rleg2_5641"
FT   CDS_pept        29172..30479
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5641"
FT                   /product="glutamine synthetase, type III"
FT                   /note="TIGRFAM: glutamine synthetase, type III; PFAM:
FT                   glutamine synthetase catalytic region; KEGG:
FT                   rec:RHECIAT_PA0000334 glutamine sinthetase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5641"
FT                   /db_xref="EnsemblGenomes-Tr:ACI58816"
FT                   /db_xref="GOA:B6A333"
FT                   /db_xref="InterPro:IPR008146"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR017536"
FT                   /db_xref="InterPro:IPR027303"
FT                   /db_xref="InterPro:IPR036651"
FT                   /db_xref="UniProtKB/TrEMBL:B6A333"
FT                   /protein_id="ACI58816.1"
FT                   /translation="MTLDLSQYASEKGIKYFMISYTDLFGAQRAKLVPAQAIADMQKDG
FT                   AGFAGFATWLDLTPAHPDLFAVPDASSVIQLPWKKDVAWVAADCVMDDQPVEQAPRVLL
FT                   KKLVAEAAKEGLRVKTGVEPEFFLISADGSVISDQFDTAEKPCYDQQAVMRRYDVIAEI
FT                   CDYMLELGWKPYQNDHEDANGQFEMNWEYDDVLQTADKHSFFKFMVKSVAEKHGLRATF
FT                   MPKPFMGLTGNGCHAHISVWDIDGKVNAFADKEMAFGLSAQGKTFLGGIMKHASALAAV
FT                   TNPTVNSYKRINAPRTTSGATWSPNTVTWTGNNRTHMVRVPGPGRFELRLPDGAVNPYL
FT                   LQAIIIAAGLNGIRSQADPGRHYDIDMYAEGHLVKDAPRLPLNLLDALRAYDADEGLKQ
FT                   AMGAEFSAAYLKLKHREWNAYCSHFTQWERDSTLDI"
FT   gene            30577..31461
FT                   /locus_tag="Rleg2_5642"
FT   CDS_pept        30577..31461
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5642"
FT                   /product="formyltetrahydrofolate deformylase"
FT                   /note="TIGRFAM: formyltetrahydrofolate deformylase; PFAM:
FT                   formyl transferase domain protein; amino acid-binding ACT
FT                   domain protein; KEGG: rec:RHECIAT_PA0000333
FT                   formyltetrahydrofolate deformylase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5642"
FT                   /db_xref="EnsemblGenomes-Tr:ACI58817"
FT                   /db_xref="GOA:B6A334"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR004810"
FT                   /db_xref="InterPro:IPR036477"
FT                   /db_xref="InterPro:IPR041729"
FT                   /db_xref="UniProtKB/TrEMBL:B6A334"
FT                   /protein_id="ACI58817.1"
FT                   /translation="MKNVVLTVSCKSTRGIVAAISSYLADKGCNIIDSSQFDDLDTGKF
FT                   FMRVSFISEEGLSGSEIGADFSPVAAPFSMDYEFHDSEKRMKVLLMVSRFGHCLNDLLY
FT                   RWKIGALPIDIVGVVSNHFDYQKVVVNHDIPFHHIPVTKANKVQAEARIMEVAEQTGTE
FT                   LIVLARYMQILSDEMCQKMSGKIINIHHSFLPSFKGANPYKQAYGRGVKLIGATAHYVT
FT                   ADLDEGPIIEQDTARITHAQSPDDYVSIGRDVESQVLARAIHAHIHHRTFINGNRTVVF
FT                   PASPGSYASERMG"
FT   gene            31465..32364
FT                   /locus_tag="Rleg2_5643"
FT   CDS_pept        31465..32364
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5643"
FT                   /product="Methenyltetrahydrofolate cyclohydrolase"
FT                   /EC_number="3.5.4.9"
FT                   /note="PFAM: tetrahydrofolate dehydrogenase/cyclohydrolase;
FT                   KEGG: rec:RHECIAT_CH0000772 folD1"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5643"
FT                   /db_xref="EnsemblGenomes-Tr:ACI58818"
FT                   /db_xref="GOA:B6A335"
FT                   /db_xref="InterPro:IPR000672"
FT                   /db_xref="InterPro:IPR020630"
FT                   /db_xref="InterPro:IPR020631"
FT                   /db_xref="InterPro:IPR020867"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B6A335"
FT                   /protein_id="ACI58818.1"
FT                   /translation="MVEVIDGKNVAASVIQTVKSATAALEKSSGVTAGLAVVIVGDDPA
FT                   SHAYVGSKGRMAKECGFKSVQHTLPAETSQEELAALVATLNADPSIHGILVQLPLPKPL
FT                   DSEPIIQSILPEKDVDGLSIANAGKLAIGDLRTGLVSCTPAGAMVFVRRTHGEDLSGLN
FT                   AVVIGRSNLFGKPMAQLLLNANATVTIAHSRTKNLAEVCRNADILVAAVGRPEMVRADW
FT                   VRPGATVIDVGINRVPAPERGEGKTRLVGDVAFAEVSEVASTITPVPGGVGPMTIAMLM
FT                   ANTVIAAHRTAGQTPPKF"
FT   gene            32456..33589
FT                   /locus_tag="Rleg2_5644"
FT   CDS_pept        32456..33589
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5644"
FT                   /product="glycine cleavage T protein (aminomethyl
FT                   transferase)"
FT                   /note="PFAM: glycine cleavage T protein (aminomethyl
FT                   transferase); Glycine cleavage T-protein barrel; KEGG:
FT                   smd:Smed_3311 glycine cleavage T protein (aminomethyl
FT                   transferase)"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5644"
FT                   /db_xref="EnsemblGenomes-Tr:ACI58819"
FT                   /db_xref="GOA:B6A336"
FT                   /db_xref="InterPro:IPR006222"
FT                   /db_xref="InterPro:IPR013977"
FT                   /db_xref="InterPro:IPR027266"
FT                   /db_xref="InterPro:IPR028896"
FT                   /db_xref="InterPro:IPR029043"
FT                   /db_xref="UniProtKB/TrEMBL:B6A336"
FT                   /protein_id="ACI58819.1"
FT                   /translation="MALSWRFSVLADRHRALGSKLEDWSGMGTAWTYDKDMSEEHVAVR
FT                   TKAGIMDVSGLKKVHLVGPHAIAVLDAMTTRDLTKIYPGRSVYATMLNERGHFTDDCIV
FT                   YRTGPNAWMLVHGSGSGHEEIVRQAAGRNCAVLFDDDLHDLSLQGPLAVDYLAKYVPGI
FT                   RDLKYFHHMQTTLFGAPVMISRTGYTGERGYEIFVRGQDAVMVWDRIVEEGKEMGIIPC
FT                   CFSVLDMLRVESYLLFYPYDNSQMYPFADQPPGDSLWELGLDFTVSPGKTGFRGAEEHA
FT                   RLKGKERFKIFGMLIDADGPADLGDEVFADGKKVGVITCPSYSSLTKKSMAIARLDVDK
FT                   AVHGTKLEVRGKTVKASATAHTLPFDDPEKKKRTAVG"
FT   gene            33601..34206
FT                   /locus_tag="Rleg2_5645"
FT   CDS_pept        33601..34206
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5645"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ret:RHE_PE00414 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5645"
FT                   /db_xref="EnsemblGenomes-Tr:ACI58820"
FT                   /db_xref="UniProtKB/TrEMBL:B6A337"
FT                   /protein_id="ACI58820.1"
FT                   /translation="MLVAGIKSRPVYTGLTIQPNARRHIFALEGEGAKALLDQRAALDE
FT                   TALSRSEILYVARGSQGSGLDEALRHLGADMFFTAPTIATLLFRLKGSLATAHMGTRLY
FT                   IAGTEGFIGQAMLVALDYGMDYASVITEHRGSLARRVQCVHCKGITDDVTASPFTCSHC
FT                   GLTLLVRDHYSRRLAAFQGVNIDAEEPGSAPDPEELFL"
FT   gene            34203..35168
FT                   /locus_tag="Rleg2_5646"
FT   CDS_pept        34203..35168
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5646"
FT                   /product="oxidoreductase FAD/NAD(P)-binding domain protein"
FT                   /note="PFAM: ferredoxin; oxidoreductase FAD/NAD(P)-binding
FT                   domain protein; Oxidoreductase FAD-binding domain protein;
FT                   KEGG: ret:RHE_PE00413 probable ferredoxin protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5646"
FT                   /db_xref="EnsemblGenomes-Tr:ACI58821"
FT                   /db_xref="GOA:B6A338"
FT                   /db_xref="InterPro:IPR000951"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:B6A338"
FT                   /protein_id="ACI58821.1"
FT                   /translation="MSGGTEIPVRVARITPIAERVKRFRFERLDGKPMPYFSGGAHIIV
FT                   SMNDGGHMRRNAYSLMSPPHDCAAYEISVLHVEDSRGGSTFMHEKVSEGDELRVSYPVN
FT                   LFQPDWRGRKHLLIAGGIGITPFIAMMEQFSREGANFELHYAIRTRDRGAYWRELLERY
FT                   GSHRIKIHCDAEGAAIPLTRLLDSQPLGTHLYVCGPTGMIDGVLKTGVNAGWPEQNLHS
FT                   ERFLSSLPGKPFTMELIRSGKTVKVGHHESMLEAIEAAGVDAPFLCRGGACGQCETGVV
FT                   TCDGKLLHNDVYLTSEEKASGRKVMICVSRFEGNRLHLDL"
FT   gene            35203..36243
FT                   /locus_tag="Rleg2_5647"
FT   CDS_pept        35203..36243
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5647"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ret:RHE_PE00412 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5647"
FT                   /db_xref="EnsemblGenomes-Tr:ACI58822"
FT                   /db_xref="InterPro:IPR021848"
FT                   /db_xref="UniProtKB/TrEMBL:B6A339"
FT                   /protein_id="ACI58822.1"
FT                   /translation="MAIAFKQETFRNDFSYGNSPENIRRFPFPFERDEYMYSVNMEPHV
FT                   RGRAGTVFENLIDVDEHYVAEMHDRALVLKEDPLRYQALPHMMSAQWDTLELLMEEQAA
FT                   GNPDHFTLIRNGDQWRWINRPLGIDDSFTFGDASTLPYEPFEYITRQAQGDFCIVDQRD
FT                   GNLWMDAGMVTTQADWSLDFDIGMNFMEWHGPVPLAHQIGVFDRALKFLLNLQQGKPTR
FT                   RFNWTMTINPRLDTSPENYHKWGPDRTTVTSGNVGEKVYLRVELQSLWRLPRSNAILFV
FT                   IRCYLMNMDELVTVPKWARRFPRVLKTLPPELIDYKGLTRFRETTIDWLSKYDDGAPTS
FT                   PGIFPD"
FT   gene            36341..37678
FT                   /locus_tag="Rleg2_5648"
FT   CDS_pept        36341..37678
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5648"
FT                   /product="flavin-containing monooxygenase FMO"
FT                   /note="PFAM: flavin-containing monooxygenase FMO; KEGG:
FT                   ret:RHE_PE00411 probable monooxygenase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5648"
FT                   /db_xref="EnsemblGenomes-Tr:ACI58823"
FT                   /db_xref="GOA:B6A340"
FT                   /db_xref="InterPro:IPR000960"
FT                   /db_xref="InterPro:IPR020946"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B6A340"
FT                   /protein_id="ACI58823.1"
FT                   /translation="MTRVAVIGAGPSGLAQLRAFQSAAQKGAEIPEIVCFEKQSDWGGL
FT                   WNYTWRTGLDEYGEPVHGSMYRYLWSNGPKECLEFADYSFEEHFGKPIASYPPRAVLWD
FT                   YIKGRVEKANVRHWVRFSTPVRMVRFDEATKKFTVTAHNRVEDRMYDEEFDYVVVASGH
FT                   FSTPNVPYFEGVKTFNGRVLHAHDFRDALEFKGKDILLVGRSYSAEDIGSQCWKYGAKS
FT                   VTTSYRSKPMGFKWPENFEERPLLTKLENRTAHFLDGSTKDVDAVILCTGYQHHFPFLP
FT                   DDLRLKTSNRLWADSLYKGVIFDKNPQLFYIGMQDQFYTFNMFDVQAWWARDVMMGRIA
FT                   LPPEEELQANFDMWRAREETLEDAEQMIWYQGDYVKELLAETDYPSFDIEGTNRTFMEW
FT                   EHHKAHNIMGFRDHAYRSLMTGTMSPKHHTPWVEALDDSKEEYLRN"
FT   gene            37805..38407
FT                   /locus_tag="Rleg2_5649"
FT   CDS_pept        37805..38407
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5649"
FT                   /product="methyl-accepting chemotaxis sensory transducer
FT                   with Pas/Pac sensor"
FT                   /note="TIGRFAM: PAS sensor protein; PFAM: PAS fold-3 domain
FT                   protein; KEGG: ret:RHE_PE00410 putative chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5649"
FT                   /db_xref="EnsemblGenomes-Tr:ACI58824"
FT                   /db_xref="GOA:B6A341"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:B6A341"
FT                   /protein_id="ACI58824.1"
FT                   /translation="MDFQTSILGRMNGFLYRCRADENYTMLEMTDGIERIFGYPPDEIV
FT                   GNRTRTFTSIMYEEDVPLMDEIVGRALDKRVDWTMEYRIRHAMGHLIWVTETGGGIWDQ
FT                   KGELLYLEGSIINIESLYQRIDERTADMRVTASKTNEILQSLRYLKLLAVNAGIEAARA
FT                   GTAGSGFAVLAAEMRTLANSSEEAARAISEAQRKAEG"
FT   gene            38618..39340
FT                   /locus_tag="Rleg2_5650"
FT   CDS_pept        38618..39340
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5650"
FT                   /product="septum site-determining protein MinC"
FT                   /note="TIGRFAM: septum site-determining protein MinC; PFAM:
FT                   Septum formation inhibitor MinC; KEGG:
FT                   rec:RHECIAT_PA0000326 cell division inhibitor protein MinC"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5650"
FT                   /db_xref="EnsemblGenomes-Tr:ACI58825"
FT                   /db_xref="GOA:B6A342"
FT                   /db_xref="InterPro:IPR005526"
FT                   /db_xref="InterPro:IPR013033"
FT                   /db_xref="InterPro:IPR016098"
FT                   /db_xref="InterPro:IPR036145"
FT                   /db_xref="InterPro:IPR038061"
FT                   /db_xref="UniProtKB/TrEMBL:B6A342"
FT                   /protein_id="ACI58825.1"
FT                   /translation="MTKVLTDARSIRIKGRSFLAVMLSPDLPFDDWLARLDDLAARSAG
FT                   FFLGRPVVLDLTDLQIDRPQLKELIAELAKRNVSIMGIEGARPSILGSGMPPALKGGRS
FT                   ASDIEVQANEPAGSPVKPEVAAIRPATTQSIVIREPVRSGQSVIFPEGDVTIVGSVASG
FT                   AEVIAGGSVHIYGALRGRAMAGSIGNASARIFCRKLEAELVAIDGVYKMAEDMAANLRG
FT                   QAVQLWLEDDAIMAEKMT"
FT   gene            39417..40232
FT                   /locus_tag="Rleg2_5651"
FT   CDS_pept        39417..40232
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5651"
FT                   /product="septum site-determining protein MinD"
FT                   /note="TIGRFAM: septum site-determining protein MinD; PFAM:
FT                   Cobyrinic acid ac-diamide synthase; KEGG: ret:RHE_PE00408
FT                   cell division inhibitor MinD protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5651"
FT                   /db_xref="EnsemblGenomes-Tr:ACI58826"
FT                   /db_xref="GOA:B6A343"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR010223"
FT                   /db_xref="InterPro:IPR025501"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B6A343"
FT                   /protein_id="ACI58826.1"
FT                   /translation="MGKVIVVTSGKGGVGKTTSTAALGAALAQRNEKVVVVDFDVGLRN
FT                   LDLVMGAERRVVYDLINVIQGDAKLTQALIRDKRLETLFLLPASQTRDKDNLTAEGVER
FT                   VINDLKRYFDWIICDSPAGIERGATLAMRHADVAVVVTNPEVSSVRDSDRIIGLLDAKT
FT                   AKAERGERMEKHLLLTRYDANRAERGDMLKVDDVLEILSIPLLGIVPESMDVLRASNIG
FT                   APVTLAESRSPAAMAYFDAARRLAGELVPMAIPEEKRNIFGKIFGRRAA"
FT   gene            40229..40489
FT                   /locus_tag="Rleg2_5652"
FT   CDS_pept        40229..40489
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5652"
FT                   /product="cell division topological specificity factor
FT                   MinE"
FT                   /note="TIGRFAM: cell division topological specificity
FT                   factor MinE; PFAM: Septum formation topological specificity
FT                   factor MinE; KEGG: rec:RHECIAT_PA0000324 cell division
FT                   inhibitor protein MinE"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5652"
FT                   /db_xref="EnsemblGenomes-Tr:ACI58827"
FT                   /db_xref="GOA:B6A344"
FT                   /db_xref="InterPro:IPR005527"
FT                   /db_xref="InterPro:IPR036707"
FT                   /db_xref="UniProtKB/TrEMBL:B6A344"
FT                   /protein_id="ACI58827.1"
FT                   /translation="MNIFRLFNKQRTAPAARERLQVLLAHERSSAGSDLVTLLREEILA
FT                   VIAKHVELDHDKVQVTIDRNEFVSTLEIDVEIPLNAAVQAA"
FT   gene            complement(40531..40911)
FT                   /locus_tag="Rleg2_5653"
FT   CDS_pept        complement(40531..40911)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5653"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: smd:Smed_5161 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5653"
FT                   /db_xref="EnsemblGenomes-Tr:ACI58828"
FT                   /db_xref="UniProtKB/TrEMBL:B6A345"
FT                   /protein_id="ACI58828.1"
FT                   /translation="MKNARNNELSDRRSAAAEAKAALLNAYRDAKDKAEPTRQAKQAER
FT                   QAVAAAREERRAERERVKREELEQAKAAEAERQAAAEAAARADADAREAADKDRIARVI
FT                   ADEAARKAARDLRYANRKARKS"
FT   gene            complement(41056..41277)
FT                   /locus_tag="Rleg2_5654"
FT   CDS_pept        complement(41056..41277)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5654"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ret:RHE_CH00434 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5654"
FT                   /db_xref="EnsemblGenomes-Tr:ACI58829"
FT                   /db_xref="UniProtKB/TrEMBL:B6A346"
FT                   /protein_id="ACI58829.1"
FT                   /translation="MTDTHSKSRQRAEIAFGNVQSQFLARSRAVEEIDQTVRAREEKTL
FT                   RLREAREAKELQDRLMAAAGPVKRNKKK"
FT   gene            complement(41631..41840)
FT                   /locus_tag="Rleg2_5655"
FT   CDS_pept        complement(41631..41840)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5655"
FT                   /product="cold-shock DNA-binding domain protein"
FT                   /note="PFAM: Cold-shock protein DNA-binding; SMART: Cold
FT                   shock protein; KEGG: smd:Smed_4458 putative cold-shock
FT                   DNA-binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5655"
FT                   /db_xref="EnsemblGenomes-Tr:ACI58830"
FT                   /db_xref="GOA:B6A347"
FT                   /db_xref="InterPro:IPR002059"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012156"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:B6A347"
FT                   /protein_id="ACI58830.1"
FT                   /translation="MTTGTVKWFNSTKGFGFIQPDDGGADAFVHISAVERAGMREIVEG
FT                   QKIGYELERDNKSGKMSACNLQAA"
FT   gene            complement(42136..44505)
FT                   /locus_tag="Rleg2_5656"
FT   CDS_pept        complement(42136..44505)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5656"
FT                   /product="glycine cleavage T protein (aminomethyl
FT                   transferase)"
FT                   /note="PFAM: glycine cleavage T protein (aminomethyl
FT                   transferase); Glycine cleavage T-protein barrel; KEGG:
FT                   ret:RHE_PE00406 probable aminomethyltransferase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5656"
FT                   /db_xref="EnsemblGenomes-Tr:ACI58831"
FT                   /db_xref="GOA:B6A348"
FT                   /db_xref="InterPro:IPR006222"
FT                   /db_xref="InterPro:IPR013977"
FT                   /db_xref="InterPro:IPR018959"
FT                   /db_xref="InterPro:IPR027266"
FT                   /db_xref="InterPro:IPR029043"
FT                   /db_xref="UniProtKB/TrEMBL:B6A348"
FT                   /protein_id="ACI58831.1"
FT                   /translation="MRELHPAMTGLRPAVPSLVHYPGIPALPEGTERYRAKGGGSVVVR
FT                   VGPGDRISVIDTEGGQVCEISFLDEKGRFLAAGFGTAFSNSAEGLKAILQGEDESAART
FT                   RAALERRSADLSAAGALSIFGAGSSPGSRADFAISMKGLLIVAAPAGAMSPEAQDTATP
FT                   IEIRINRSLVIRDYASALPEPAADPIEDIRIRAATAAAYFVRAGEFIQIIDVYGRQCTD
FT                   FQAFAARKVDKGLDLALDSTVTRTLLSRSYPMPGLPSKAFDRDFEPLVEIVQDTVGRHD
FT                   AFATACNSRYYDDMGYPGHVNCTDNFNAALAPYGIAGRKGWEALNYFYNTNIDHNNQLY
FT                   LDEPWSRPGDYVLMRALTDLVCVSSSCPDDIDAANGWDPTDIHVRTFSGKEKFSRAVAY
FT                   RMTPDADAELTRETAFHPRLSALTRDYTEYRGYWLPNRFSAEGPVKEYWACRERAAVID
FT                   LSPLRKFEVTGPDAEELLQYCLTRDVRKLSTGQVVYSAMCYENGGMIDDGTLFRLGDKN
FT                   FRWIGGDDFSGVWLRQQAEKKGFKAWVRSSTDQMHNIALQGPKSRDILKEIIWTAPRQP
FT                   TIGELEWFRFTVGRIGGFEGAPVVVSRTGYTGELGYEIFCHPKDALTVFDGVWEAGQPH
FT                   GLKPMGLEALDMVRIEAGLIFAHHEFTDQTDPFEAGIGFTVPLKSKQDDFIGRDALIRR
FT                   KEHPRHLLVGLDVKANEAVGHGDCVHIGRAQVGVVTSATRSPILGKTIALARIDVMHAS
FT                   PGTEVEIGKLDGHQKRLPATIVPLSHYDPQKTRPRS"
FT   gene            44758..46542
FT                   /locus_tag="Rleg2_5657"
FT   CDS_pept        44758..46542
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5657"
FT                   /product="amino acid permease-associated region"
FT                   /note="PFAM: amino acid permease-associated region; KEGG:
FT                   ret:RHE_PE00405 probable amino acid transporter, permease
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5657"
FT                   /db_xref="EnsemblGenomes-Tr:ACI58832"
FT                   /db_xref="GOA:B6A349"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:B6A349"
FT                   /protein_id="ACI58832.1"
FT                   /translation="MTDVMEAGISSGTEGKLVRALDWKGAFWVAAGVPPLVLFSIGGIA
FT                   GTTGKLAFLVWIISMVMGFLQSFTYAEIAGMFANKSGGASVYGATAWLRYSKFIAPLSV
FT                   WCNWFAWSPVLSLGCAIAAGYILNAFFPIPAADSQMVLDWISAHAASITADSPRVAEYI
FT                   AAHAGTTPDDAVRALLSTDGVAALTPWIRSWSLFSFSIPFLATANVNATFFIGGILMLI
FT                   IFAIQHRGISETASVQKWLAIIVLVPLLIIGLYPIVSGHILAANVTGLVPPTAAYSGAD
FT                   GSWSNGGWTLFLGGLYIAAWSTYGFETAVCYTRELKNPKTDTFKAIFYSGLACCLFFFL
FT                   VPLAFQGVLGHAGMLAPGIVDGTGVAEALGGLIGAGRVVTQLLVVLMIMALFLAIMTAM
FT                   AGSSRTLYQGSKDGWLPKYLDHVNENGAPTRAMWTDFAFNLFLLAIASDTGGYFFVLAV
FT                   SNVGYIIFNFLNLNSGWIHRMDSGHIERPWKAPTWLIGLNTVLAFVNALFLGAGAKVWG
FT                   YSNALWVGFIFAALILPVFAYRHYVRDGGKFPAGAMEDLGLVGQDLGVKKAGLLPYLAL
FT                   AGGLAIVLIANVIFQLPA"
FT   gene            complement(46640..47671)
FT                   /locus_tag="Rleg2_5658"
FT   CDS_pept        complement(46640..47671)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5658"
FT                   /product="aldo/keto reductase"
FT                   /note="PFAM: aldo/keto reductase; KEGG:
FT                   rec:RHECIAT_PA0000323 probable alcohol dehydrogenase
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5658"
FT                   /db_xref="EnsemblGenomes-Tr:ACI58833"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:B6A350"
FT                   /protein_id="ACI58833.1"
FT                   /translation="MDYRKLGPSGTVVTAYCLGTMTFGAEADEAASHKLLDDYFAWGGN
FT                   FIDTADVYSAGKSEEIIGRWLKARPTEARQAIVATKGRFPMGNGPNDIGLSRRHLGQAL
FT                   DDSLRRLGLEQIDLYQMHAWDALTPIEETLRFLDDAVSSGKIGYYGFSNYVGWHIAKAS
FT                   EIAKARGYTRPVTLQPQYNLLVRDIELEIVAACQDAGMGLLPWSPLGGGWLTGKYKRDE
FT                   MPTGATRLGENPNRGGESYAPRNAMERTWAIIAAVEEIAKAHGVSMAQVALAWTAAQPA
FT                   ITSVILGARTPEQLADNLGAMKLKLSDEDMTRLNEVSAPQPFDYPYGKGGINQRHRKIE
FT                   GGR"
FT   sig_peptide     complement(47588..47671)
FT                   /locus_tag="Rleg2_5658"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.939) with cleavage site probability 0.897 at
FT                   residue 28"
FT   gene            complement(47894..49162)
FT                   /locus_tag="Rleg2_5659"
FT   CDS_pept        complement(47894..49162)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5659"
FT                   /product="amine oxidase"
FT                   /note="PFAM: amine oxidase; FAD dependent oxidoreductase;
FT                   KEGG: rec:RHECIAT_PA0000322 putative amine oxidase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5659"
FT                   /db_xref="EnsemblGenomes-Tr:ACI58834"
FT                   /db_xref="GOA:B6A351"
FT                   /db_xref="InterPro:IPR002937"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B6A351"
FT                   /protein_id="ACI58834.1"
FT                   /translation="MPGDNGTSVEQDVVIIGAGAAGIAAARRLQAIRPDISILLLEAGD
FT                   RLGGRAWTVGLPGAADIALDLGCGWLHGARSNPWTGIADEVGLTVDRTPAPWNGGRQLQ
FT                   RDDAQIHAAQEAIGAYFERLESHEGDDTDLAEMLEPGNAWNGQIRAIGTYITGAELECS
FT                   SVVDYTRYDPGPGPDWRVREGYGNLISRYGRPVPARLGVEVTRIDHRHAGRIDIETNQG
FT                   GLRARAVLVTVSTNVLAAEKIAFDPPLPEKIEAAARLPLGLADKLFLRLDNQEVLPADT
FT                   HMLGSVSRGATGTYQLRPLGAPVVEAYFAGDLAHDLEREGSEAAFSFAADELAAEFGAD
FT                   IRKELSVAAISAWAAAPHIGGSYSYAEPGASDLRAVLAAPHDQRIFFAGEACSRARYST
FT                   AHGAYETGVAAADLIAGSLSSKV"
FT   gene            49279..50259
FT                   /locus_tag="Rleg2_5660"
FT   CDS_pept        49279..50259
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5660"
FT                   /product="Exonuclease RNase T and DNA polymerase III"
FT                   /note="PFAM: Exonuclease RNase T and DNA polymerase III;
FT                   SMART: Exonuclease; KEGG: rec:RHECIAT_PA0000321 probable
FT                   polymerase protein, epsilon subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5660"
FT                   /db_xref="EnsemblGenomes-Tr:ACI58835"
FT                   /db_xref="GOA:B6A352"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:B6A352"
FT                   /protein_id="ACI58835.1"
FT                   /translation="MSVQRDSQLDMFAKPSPATARARAPSRRPPSQPAGHSDEEMARTL
FT                   EESGNYRILRKLTARPIATARRPGFSRLGVILDTETTGLNHRSDEIIEIGAVAFTFDDD
FT                   GGIGDIVGIYGGLQQPSRPIPAEITRLTGITDAMVEGQVIDMWSLSALIEPADLIIAHN
FT                   AGFDRPFCEAFSTIFAGKAWACSVSEIDWSARGFEGTKLGYLVGQAGYFHDGHRAVDDC
FT                   HALLEILDREQGDGESPFAELYRASQRSRIRIFAEHSPFEMKDHLKARGYRWSDGSDGR
FT                   LKSWWIEVGEDDLGDELSYLRSDIYRWRDADPPTVRLTAFDRFKL"
FT   gene            50447..50593
FT                   /locus_tag="Rleg2_5661"
FT   CDS_pept        50447..50593
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5661"
FT                   /product="protein of unknown function DUF1127"
FT                   /note="PFAM: protein of unknown function DUF1127; KEGG:
FT                   ret:RHE_PE00401 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5661"
FT                   /db_xref="EnsemblGenomes-Tr:ACI58836"
FT                   /db_xref="InterPro:IPR009506"
FT                   /db_xref="UniProtKB/TrEMBL:B6A353"
FT                   /protein_id="ACI58836.1"
FT                   /translation="MNVARSFNNWRKYRQTVAELGRMSARELDDLGIGRGDIRNVARAA
FT                   IAR"
FT   gene            51199..52035
FT                   /locus_tag="Rleg2_5662"
FT   CDS_pept        51199..52035
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5662"
FT                   /product="4-deoxy-L-threo-5-hexosulose-uronate
FT                   ketol-isomerase"
FT                   /EC_number="5.3.1.17"
FT                   /note="PFAM: 5-keto 4-deoxyuronate isomerase; KEGG:
FT                   ret:RHE_PE00400 5-keto-4-deoxyuronate isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5662"
FT                   /db_xref="EnsemblGenomes-Tr:ACI58837"
FT                   /db_xref="GOA:B6A354"
FT                   /db_xref="InterPro:IPR007045"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR021120"
FT                   /db_xref="InterPro:IPR027449"
FT                   /db_xref="UniProtKB/TrEMBL:B6A354"
FT                   /protein_id="ACI58837.1"
FT                   /translation="MQIDVRHASHPEAVREYDTETLRRHFLVETVFAGGEIRLTYSHYD
FT                   RMVIGGATPLADGLALTAPTAIGQETFLAERELGALNIGGAGRIVVDGTSYDLAKYDCL
FT                   YAGKGAKDVRFESVDAANPAKFYLVSTPAHQAHPTVLLTREKARHLTPGDAATANKRSI
FT                   YQFIHPEVCQSCQLTLGFTMIEPGSVWNTMPAHTHDRRMEAYLYFDLEAEQRVFHFMGE
FT                   PQQTRHMLVANEQAVISPPWSIHSGAGTKNYSFIWAMAGDNKSFTDMDHIAIADLR"
FT   gene            52041..52796
FT                   /locus_tag="Rleg2_5663"
FT   CDS_pept        52041..52796
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5663"
FT                   /product="2-deoxy-D-gluconate 3-dehydrogenase"
FT                   /note="TIGRFAM: 2-deoxy-D-gluconate 3-dehydrogenase; PFAM:
FT                   short-chain dehydrogenase/reductase SDR; KR domain protein;
FT                   KEGG: rec:RHECIAT_PA0000318 putative 2-deoxy-D-gluconate
FT                   3-dehydrogenase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5663"
FT                   /db_xref="EnsemblGenomes-Tr:ACI58838"
FT                   /db_xref="GOA:B6A355"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR011286"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B6A355"
FT                   /protein_id="ACI58838.1"
FT                   /translation="MANPFDLTGRTAVVTGANTGIGQAIAAALAEAGASIVAVGRSSME
FT                   ETEALVKQAGSRFHVVKADLGTIEPVKGIVAEAIQTFGGLDILVNNAGIIRRADALDFT
FT                   EEDWDAVIDVNLKTAFFLSQAAGRHMVDKGRGKIINIASLLSFQGGIRIPSYTASKSGL
FT                   AGLTKLLACEWAGKGVNVNAIAPGYFVTNNTTALREDADRNAAILARIPAGRWGTPAEL
FT                   GGAAVFLASSASDYVHGTVLPVDGGWLAR"
FT   gene            52974..53720
FT                   /locus_tag="Rleg2_5664"
FT   CDS_pept        52974..53720
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5664"
FT                   /product="GntR domain protein"
FT                   /note="PFAM: regulatory protein GntR HTH; GntR domain
FT                   protein; KEGG: rec:RHECIAT_PA0000317 putative
FT                   transcriptional regulator protein, GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5664"
FT                   /db_xref="EnsemblGenomes-Tr:ACI58839"
FT                   /db_xref="GOA:B6A356"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B6A356"
FT                   /protein_id="ACI58839.1"
FT                   /translation="MTDRDNAVFNTIRQPPNLRSGLADTLMAQIESGDLKPGQRLPTEQ
FT                   AIMRTTGVSRTIVREALATLRAKGLITTRQGLGAFVSNDPNPRSFSIIPNDLQSIDEIL
FT                   RVLELRMGVEYEAAGLAALRRTPEDLDRMQDRLDALDKALEEGGYGAQEDYAFHRSILV
FT                   ATQNSYYGRLFDTFGDLMVPRQWARLDKMTAAERKRHAARMRREHHAIFAAIRDGEEAA
FT                   ARRAIRTHLSKSAARFEELRDASTSS"
FT   gene            complement(53724..57026)
FT                   /locus_tag="Rleg2_5665"
FT   CDS_pept        complement(53724..57026)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5665"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rec:RHECIAT_PA0000316 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5665"
FT                   /db_xref="EnsemblGenomes-Tr:ACI58840"
FT                   /db_xref="GOA:B6A357"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="UniProtKB/TrEMBL:B6A357"
FT                   /protein_id="ACI58840.1"
FT                   /translation="MAPNLDRSFQMPRRDDLGLFTISNGSGLTISALPNGTLFAIEYAD
FT                   DKGAVQINQIQGSPLIGGIGRLYLRIGGARPDVVEIVGPRANGSFGYDATSFCWSGKTG
FT                   DIAYDVRLELHPSETAWFWRVSLRHPKEKTLPADLVLIQDVGLGDRGFLMNSEAYASQY
FT                   VDHHIADHPAFGPVVMNRQNLKQGGARSPWLAQGCLDGTAAYATDAMQLVQAKDRLGDR
FT                   LVGPFGASLPSERRQQETACPAIRSKPLAISASGAGATFFAVFAADHPEASSDADLARL
FT                   DGLAATGSVAAGLEGVTPVRSLLQDASLLEVEPLDKKAIGRLYPERSLEERAGGKLLSF
FT                   FTPDGALNRHVVLREKELLVARRHGAIVRSGANMLLDDSTLAATCWMQGIFAAQLTIGN
FT                   TSFHKLFSVSRDPYNLTRASGLRILADLGAGWQLLAVPSAFEMGLNDCRWIYQCSERTI
FT                   TVAAVASGEDAAMQWTVSAEGKPCRFLVFGHVVLGEREYDAGGQIAVDAARKRIAFRPD
FT                   PAWLWGERYPDAGYWLVSSTPDAIEEIGGDELLYTDGVARNGAFVALRSRPTQALSFAV
FT                   VGSMTNAEEAERLAQRYEAGVTEAAMLAPASKFWRNAVRGLTIDNPSPDLAAQTTLLPW
FT                   LAHDAIVHLSVPHGLEQYTGAAWGTRDACQGPIEFLLAYEHDREAKEVVKTVFSEQYLE
FT                   KGDWPQWFMLEPYANIRAGDSHGDVIVWPLKALCDYIEATGDLAILDEKVSWRDEKTMQ
FT                   KAPKADSIAVHVDKLLDTVRGQFIPGTHLIRYGEGDWNDSLQPADPHLRDWMVSSWTVA
FT                   LLYEQIVRYSAILRRLGHGKKARNNKAKLLRKIATAMRRDFNRHLVRDGIVAGYGIFDP
FT                   AHDGVELLLHPSDSRTGLSYSLIAMTQAMLGGLFTPDQRRDHMKLIEEHLLFPDGVRLM
FT                   EKPATYAGGPETLFRRAESSSFVGREIGLMYVHAHLRYCETLALDGEANELWKAISLVN
FT                   PIAVTTALPQASLRQRNTYFSSSDAAFHDRYQAAAQWARVKAGKVAVDGGWRIYSSGPG
FT                   LYARSFVENILGLKRRFGRRRRKPLLPAVHASVELQTDHAAWRRLMKPKPDA"
FT   gene            complement(57128..58666)
FT                   /locus_tag="Rleg2_5666"
FT   CDS_pept        complement(57128..58666)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5666"
FT                   /product="drug resistance transporter, EmrB/QacA subfamily"
FT                   /note="TIGRFAM: drug resistance transporter, EmrB/QacA
FT                   subfamily; PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   rec:RHECIAT_PA0000315 putative multidrug resistance
FT                   transporter protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5666"
FT                   /db_xref="EnsemblGenomes-Tr:ACI58841"
FT                   /db_xref="GOA:B6A358"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR004638"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B6A358"
FT                   /protein_id="ACI58841.1"
FT                   /translation="MERVEPAHPDARPAIVWLGFIAMCIGMFMAILDVQVVATSLPTIQ
FT                   SALGIDPDQMSWIQTAYLIAEVVAIPLTGLLTRLLTMRWLFVVAIGLFVTASAGCAASG
FT                   SFGELVAWRVLQGFSGGTLIPSVFSAVFILFPNERQALATTVAGVLAVLAPTVGPIVGG
FT                   WLTETYSWHWLFLINIVPGIASAILAAFFLPRQPADPSELRHLDGLSLLLMATALTTLE
FT                   LSLKEAPTSGWTSTYVLSLLAICLVSGGVFIARTLRRDRPIVDLGNFVDRNFLVGSTLS
FT                   FVLGIGLFGSVYLMPVFLAFVRGHDALEIGMTMLVTGIAQLVTAPIAVALEKRLDARLL
FT                   SAAGFALFAIGVGMSAFQDPRSDYDAMFWPQIVRGVAIMFCLLPPTRLALGTLPADRIP
FT                   DASGLFNLMRNLGGAIGIALIDTIIYTRSEPLGQGLWARLQAGDIDAATFVGAPLQAIL
FT                   GHHGEFDADTTALLDPLVQTAASVQAINEAWMVVAILTGCALLCVPFARRPAST"
FT   gene            complement(58879..59787)
FT                   /locus_tag="Rleg2_5667"
FT   CDS_pept        complement(58879..59787)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5667"
FT                   /product="flagellin domain protein"
FT                   /note="PFAM: flagellin domain protein; KEGG:
FT                   rec:RHECIAT_PA0000314 flagellin C protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5667"
FT                   /db_xref="EnsemblGenomes-Tr:ACI58842"
FT                   /db_xref="GOA:B6A359"
FT                   /db_xref="InterPro:IPR001029"
FT                   /db_xref="InterPro:IPR001492"
FT                   /db_xref="InterPro:IPR042187"
FT                   /db_xref="UniProtKB/TrEMBL:B6A359"
FT                   /protein_id="ACI58842.1"
FT                   /translation="MTSINTNNSAMAALQTLRSINSNLETTQNSVSTGYRVDTASDNAA
FT                   YWSIATTMRSDNKALSAVSDALGLGAAKVDTAYTAMDSAIDVVDEIKSKLVAATEDGVD
FT                   KSKVQEEISQLQEQLMSIAQSASFSGENWVAGADGTKSVVSSFVRDGSGAVSVKMTDYV
FT                   LDTSSAGNVLFGMSGGSIETSTGILGTADASGDSVYSLDITNFTTGQIQSALSTIESAL
FT                   SAMTSAGAQLGSISTRIDLQEDFVGALSDSIDSGVGRLVDADMEEESSKLSALQTQQQL
FT                   AIQSLSIANSSSQNILSLFRG"
FT   gene            60142..61815
FT                   /locus_tag="Rleg2_5668"
FT   CDS_pept        60142..61815
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5668"
FT                   /product="extracellular solute-binding protein family 5"
FT                   /note="PFAM: extracellular solute-binding protein family 5;
FT                   KEGG: rec:RHECIAT_PA0000262 putative ABC transporter,
FT                   substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5668"
FT                   /db_xref="EnsemblGenomes-Tr:ACI58843"
FT                   /db_xref="GOA:B6A360"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:B6A360"
FT                   /protein_id="ACI58843.1"
FT                   /translation="MFHNISVHAGLAAATALTALVAFGAGSAAAESVLTMHIEEQTSWV
FT                   QNFNPFDLAGRRQSTMDFIYEPLVIFNAEDGGKPVFRLATAYKFSEDMKSVTYTLRPGV
FT                   KWSDGQPLTSADVKYTIDLMLKNAALDTVGVGQTVASVETPSATEVKVDLKAVNSDFPE
FT                   TLADLAIVPEHIWKDVSDPVAFKNEKPVGSGPMTELRRFTPQVYEQCRNPNYWDAASLH
FT                   VDCLRLPQISGNDQMLAILPEGNMDWIGSFIPQIDKTFVGLDADHNGYWQPPAETVAFQ
FT                   MNFKSGNDGNLEAYKDLNFRHAFSLAMDRKSMVDIAGFGYPVVNEHATGLPPRFESWRN
FT                   KDAEGGKDAFMGFDTEKASKILDDAGYKKGADGFRTTPSGKPIAFPIIVPNGWTDWIDA
FT                   VQIAVEGLRAAGINASVATPEYEQWRKEIIDGSFEVVMNSRADGATPFRGYYQSLSTAY
FT                   GGRITGAPSRYSNPKLDALFDQYLQATSDDDHKKIFNDIQMLIADDFPVVPVFNGPTWY
FT                   QFSSKRFTGWVTDKDPVMNPEDHDNNRMRLMHLLRLKPVS"
FT   sig_peptide     60142..60234
FT                   /locus_tag="Rleg2_5668"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.831 at
FT                   residue 31"
FT   gene            61834..62814
FT                   /locus_tag="Rleg2_5669"
FT   CDS_pept        61834..62814
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5669"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: aha:AHA_3094 peptide ABC
FT                   transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5669"
FT                   /db_xref="EnsemblGenomes-Tr:ACI58844"
FT                   /db_xref="GOA:B6A361"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B6A361"
FT                   /protein_id="ACI58844.1"
FT                   /translation="MRISSRRLGVYAVALAFAIVVNFILPRLMPGSPVDAMVAQLGPRA
FT                   TPAAVEAIKARFGAVDQPMLWQFADYLKGLVTLDLGVSVKYYPQTVVQVLGRSTLWTIF
FT                   LVTTAIIFSLCVGVVLGAVSAWRRGGRFDTIVSPLSVIMISVPPVIVALTTLFVFAVSL
FT                   RWFPVGYAYDPNLDPAFNFTFVGSVFAHAILPVLTLSPFLIGEFQTTMRSSMISVLGED
FT                   YVTMGRAKGLSHLTVMFGYGARNAMLPVLTNLALMLGAVFGGSIVTEIVFNYPGLGLTL
FT                   YTASIARDYPVIQGQLLLMTLATLGANFLVDIIYGFVDPRLREAA"
FT   gene            62814..63716
FT                   /locus_tag="Rleg2_5670"
FT   CDS_pept        62814..63716
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5670"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: ret:RHE_PE00330 putative
FT                   peptide ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5670"
FT                   /db_xref="EnsemblGenomes-Tr:ACI58845"
FT                   /db_xref="GOA:B6A362"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR025966"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B6A362"
FT                   /protein_id="ACI58845.1"
FT                   /translation="MSFTLWPIFKQKKALAGLIIIAILWLMALFAPLVAPGEPGARVGR
FT                   SHQPPSIEHVLGTTKMGRDVYRQFVWGARSSLSVGFATGIAITVLGTAIGLVAGYAGGR
FT                   TDACLDLATNAVLVIPNMPLLILLASFAGTVGPMTIMTIIALTSWPWGARMTRSQTMAL
FT                   RNRDFVTASKMIGEPAWRIIFVEILPNLTTLIGINLVGSIIYAIVAQTTLEYLGFGDPL
FT                   KVSWGTMLYNAQNSSAIMVGAWWDIGVPALGIALTGLGLALLNFTFDEIANPQLRSGPA
FT                   LTRWFRLNRARNRELELGR"
FT   sig_peptide     62814..62918
FT                   /locus_tag="Rleg2_5670"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.955) with cleavage site probability 0.917 at
FT                   residue 35"
FT   gene            63713..64528
FT                   /locus_tag="Rleg2_5671"
FT   CDS_pept        63713..64528
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5671"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: vha:VIBHAR_07043 ABC-type transporter ATPase
FT                   componen"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5671"
FT                   /db_xref="EnsemblGenomes-Tr:ACI58846"
FT                   /db_xref="GOA:B6A363"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B6A363"
FT                   /protein_id="ACI58846.1"
FT                   /translation="MSDNLLEIEKLNVDYLVDKGEFRAVKDVSFTIGRGEIFGLAGESG
FT                   CGKSTIAYAITRLSKAPAWISSGSIRLDGQDLLKLPERELQTIRWKRIGMVFQSAMNSL
FT                   NPLMRVEAQFHDVLRRHTGCSQAESRARAEEMFRLVGIPTHRIGDYPHQFSGGMRQRIV
FT                   IAICLALRPELIIMDEPTTALDVVVQREILEQVVDLQRSYGFSVLFITHDLHLMAQLCR
FT                   RIGVMLKGELVEVGDVSQVAHAPRHEYTRKLWNAIPQLPDNRHLSGVVA"
FT   gene            64525..65469
FT                   /locus_tag="Rleg2_5672"
FT   CDS_pept        64525..65469
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5672"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related;
FT                   Oligopeptide/dipeptide ABC transporter domain protein;
FT                   SMART: AAA ATPase; KEGG: ret:RHE_PE00328 putative peptide
FT                   ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5672"
FT                   /db_xref="EnsemblGenomes-Tr:ACI58847"
FT                   /db_xref="GOA:B6A364"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B6A364"
FT                   /protein_id="ACI58847.1"
FT                   /translation="MKAEANPVVAEAVIRLEGIERNFGAVRALKGVSFSLFPGRALALV
FT                   GESGCGKTTCARIIARLDKASGGRLFFRGQELTARGDAGAEHRYRREVQMVFQDPFSSL
FT                   NPAFTVSHHLARPLQLHRQSGVKADLAEEITRLLASVGLEPDVTRQKFPHELSGGQRQR
FT                   VNIARALAVAPSVLVADEPTSMLDVSIRKDILDLLARVKRENDLAMLYITHDIATAAHV
FT                   AEEIVVMFAGQMVEWGDTERVLSDPRHPYTRLLLSAVPDGSRPFVTGGSARFLEQAEKV
FT                   RALSRPESADIEQVGPNHFIRALGVSNAGMPKS"
FT   gene            65522..67543
FT                   /locus_tag="Rleg2_5673"
FT   CDS_pept        65522..67543
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5673"
FT                   /product="Beta-N-acetylhexosaminidase"
FT                   /EC_number="3.2.1.52"
FT                   /note="PFAM: Glycoside hydrolase, family 20, catalytic
FT                   core; KEGG: rec:RHECIAT_PA0000313 probable
FT                   beta-N-acetylhexosaminidase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5673"
FT                   /db_xref="EnsemblGenomes-Tr:ACI58848"
FT                   /db_xref="GOA:B6A365"
FT                   /db_xref="InterPro:IPR015882"
FT                   /db_xref="InterPro:IPR015883"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR025705"
FT                   /db_xref="InterPro:IPR029018"
FT                   /db_xref="UniProtKB/TrEMBL:B6A365"
FT                   /protein_id="ACI58848.1"
FT                   /translation="MSIPRPKTLRLETLWNPPADGKEFSYVLRLKNLGNEPISGFSLCI
FT                   SGPGRVDPAGRVEGATVSKRLSNFTEFQPPADFVLAAGETWTISVYALSWQFRHWTDGA
FT                   TSAYLALSDGGTIVLGIEPTRSSVSNAALKRGAEIYPVPANAPVQVSIIPWPNHVAVAS
FT                   RRPLPAGFAPRAQSAEGEAAAQSFAALVDHLFAVEGIVRTEAEGAVPVALKDAAGFGAE
FT                   AYRLSFDEERLTVEASSRTGFLYGLVTLGQIWRGARLHPGVFQFPASGEIVDEPAMGWR
FT                   GLHLDVARQFYGAAEVKKLIAVLAWNKLNRFHWHLSDDEAWRVEIDAYPALTAVGAWRG
FT                   HGLAVPPLLGSSPARTGGYYTKPVIRDIVAEAKSFGVEIVPEIDMPGHCYAMQQAIPEL
FT                   RDPAEVGSYYSVQGFPDNCINPALEKTYEIVETILTELIELFPFKTIHLGADEVPLGAW
FT                   SGSPAALDRLRNVAGDAVADAHAKRLNVVTNTHGADDIHGSGAAILQAEFLERVQRFLA
FT                   SKGCITGGWEEAAHGDVIDKAKSYLCSWRNVEVSAELAERGYEMVVCPGQVYYLDMALR
FT                   PDWDEPGASWAGTSDAEKLYNFDPVGGWTAAQKQRLLGIQACIWSEPMTDRAVFDRLVF
FT                   PRLSGLAETGWTKPSSKSWERFKALAGLMPLLYGLQES"
FT   gene            complement(67731..68399)
FT                   /locus_tag="Rleg2_5674"
FT   CDS_pept        complement(67731..68399)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5674"
FT                   /product="haloacid dehalogenase, type II"
FT                   /note="TIGRFAM: haloacid dehalogenase, type II;
FT                   HAD-superfamily hydrolase, subfamily IA, variant 2
FT                   (HAD-like); PFAM: Haloacid dehalogenase domain protein
FT                   hydrolase; KEGG: atu:Atu3405 haloalkanoic acid
FT                   dehalogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5674"
FT                   /db_xref="EnsemblGenomes-Tr:ACI58849"
FT                   /db_xref="GOA:B6A366"
FT                   /db_xref="InterPro:IPR006328"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:B6A366"
FT                   /protein_id="ACI58849.1"
FT                   /translation="MAIFRPKYITFDCHGTLINFQMAEAARDLYGDRMNEQKMLEFIKD
FT                   FSAYRLDEVIGDWKPYADVVHNALSRTCKRNGIDFRDEDARLVYERVPTWGPHADVPAG
FT                   LAKVAKEIPLVILSNAMNAQIMSNVGKLGAPFHAVYTAEEAGAYKPHFRAFEYMLDMLG
FT                   CGPEDILHCSSSFRYDLMSAHDLGIKNKVWVNRGHEPANPYYGYTEIADISELPGVVGL
FT                   "
FT   gene            68705..69727
FT                   /locus_tag="Rleg2_5675"
FT   CDS_pept        68705..69727
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5675"
FT                   /product="Methyltransferase type 12"
FT                   /note="PFAM: O-methyltransferase family 2;
FT                   methyltransferase small; Methyltransferase type 12; KEGG:
FT                   rec:RHECIAT_CH0000851 putative SAM-dependent
FT                   methyltransferase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5675"
FT                   /db_xref="EnsemblGenomes-Tr:ACI58850"
FT                   /db_xref="GOA:B6A367"
FT                   /db_xref="InterPro:IPR001077"
FT                   /db_xref="InterPro:IPR016461"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B6A367"
FT                   /protein_id="ACI58850.1"
FT                   /translation="METIAEDADAGVVSPELVVDALFACRKTAAIRAAIELDLFTHIGE
FT                   GKTAALLASATSASERGVRILCDYLVVNGFLTKESGEYRMTAATRMFLDRNSPAYMGSA
FT                   VEFVAAPEILDNFLRDPAAVVRNGGSPGLANMSPDNPVWLKFARGMGSFTGLSAKLLAD
FT                   EISGWGKPLKKVLDIAAGPGLFGIEIAKALPSAEIVAVDWAAVLELSRQNAERAGVADR
FT                   YRTIAGSAFDVDWGTDYDLVLLPNFLHHFDLPTCAGLLRKIIANLAAGGRIVAVDFVPN
FT                   EDRVSPPFPAAFSWEMLASTPAGQAYTQDELTEMARLAGLTGVTVKPMPPTPASLILFE
FT                   "
FT   gene            complement(69743..70945)
FT                   /locus_tag="Rleg2_5676"
FT   CDS_pept        complement(69743..70945)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5676"
FT                   /product="ROK family protein"
FT                   /note="PFAM: ROK family protein; KEGG:
FT                   rec:RHECIAT_PA0000310 probable transcriptional regulator
FT                   protein, ROK/CRP family"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5676"
FT                   /db_xref="EnsemblGenomes-Tr:ACI58851"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B6A368"
FT                   /protein_id="ACI58851.1"
FT                   /translation="MKAISGTNLEQAKSHNRRVVIEAVRTNGPLSRAAIARMTALTAQT
FT                   VSNIVEELERSHLLVPAEAQKLARGQPIIPYSINPAGAYSIGLELGRQRASGVLTDLSG
FT                   AVCARIERHVEHPDPQRAMPVLQSIVEDIQQAFEFDRNRLLGVGMALPGRYADGGITSL
FT                   SPQNLPGWQDFPVGHELEQRVKVPVLVENDATAAAIGERLHGVARGLSSFVYLFLAGGG
FT                   GIGAGMFLDGHLYKGSRNNAGEIGHIIVEPHGKLCSCGKRGCLDRYISPTVAYEFMGIT
FT                   NAEELSPDDLDARIAGGGEGLDAWLDQAVQPLRQTLDFLELAFDPQTIVFGGSISTSLM
FT                   RRLAERLEPLHVPIDPNRARSVPRVMIGMTGKDTAILGAAALPIFSETNPRFDVLQKPV
FT                   G"
FT   gene            complement(71022..72245)
FT                   /locus_tag="Rleg2_5677"
FT   CDS_pept        complement(71022..72245)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5677"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   rec:RHECIAT_PA0000309 probable transporter, permease
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5677"
FT                   /db_xref="EnsemblGenomes-Tr:ACI58852"
FT                   /db_xref="GOA:B6A369"
FT                   /db_xref="InterPro:IPR004750"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B6A369"
FT                   /protein_id="ACI58852.1"
FT                   /translation="MSRLFPDVFRNPAIRASMIAIFTFGMAGAMTAPYRSIVGIRELGL
FT                   SDGLYSFLAFASAAVNVVISVLLGNLADRLGEYRSAMIGACFFGIVGYGMVYAFPSATV
FT                   FIISGLLPLPIYGALNSLLFANARAAMHGMNRNDMVTANSGVRAMISLSWVLIPGITGL
FT                   VLSGASSMLPAYLFAAISCLLCQGIIVFSLPKRAGTEMAAAHHLSYLGALRQVVSPRIS
FT                   AHIAGVALITSTLHLNDALLPLIATGAAHGALSDVGILVGIVALLEIVFIIVWSRIARK
FT                   TGQMTALAAGTIIYAVFLSLLGFASEPWHLYALTLLAGIGAAAIISFPITYLQDLIADR
FT                   PGLGSALISVNIFASAGIGALVFAAGTWATGYSGTAMLGAVTGLSGITILGLLQRRNAV
FT                   APVDAEVQ"
FT   sig_peptide     complement(72150..72245)
FT                   /locus_tag="Rleg2_5677"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.943) with cleavage site probability 0.721 at
FT                   residue 32"
FT   gene            complement(72342..73118)
FT                   /locus_tag="Rleg2_5678"
FT   CDS_pept        complement(72342..73118)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5678"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   ret:RHE_PE00386 short chain dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5678"
FT                   /db_xref="EnsemblGenomes-Tr:ACI58853"
FT                   /db_xref="GOA:B6A370"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B6A370"
FT                   /protein_id="ACI58853.1"
FT                   /translation="MTKSIAIVTGAAGDIGAAIAARLADDHDVVFLADIDAAAASAVAA
FT                   KLGPDDRFVAAGCDVTSEASIADLVRRAADTGVVRTLVNNAGAARATSLHETTPEIWRA
FT                   DNALNLEAAFLCFRAFEPMLKASKGSVVNIASVNGMNVFGHPAYSAAKAGLLHFTRLVA
FT                   VEYGKFGIRSNAVAPGTVKTQAWEKRAAANPNVFEEARRWYPLQRVVDPLDVANAVAFL
FT                   AGPLAAAISGVCLPVDCGLTAGQAELARTFSQSEHY"
FT   sig_peptide     complement(73056..73118)
FT                   /locus_tag="Rleg2_5678"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.725) with cleavage site probability 0.660 at
FT                   residue 21"
FT   gene            complement(73144..74007)
FT                   /locus_tag="Rleg2_5679"
FT   CDS_pept        complement(73144..74007)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5679"
FT                   /product="transcriptional regulator, RpiR family"
FT                   /note="PFAM: helix-turn-helix protein RpiR; sugar isomerase
FT                   (SIS); KEGG: rec:RHECIAT_PA0000307 putative transcriptional
FT                   regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5679"
FT                   /db_xref="EnsemblGenomes-Tr:ACI58854"
FT                   /db_xref="GOA:B6A371"
FT                   /db_xref="InterPro:IPR000281"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR035472"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:B6A371"
FT                   /protein_id="ACI58854.1"
FT                   /translation="MDIFSTLQEDKGRLSPSESRIAEIIVNDFEFAVNASIIELAERAK
FT                   VSPPTVTRFCRRLGCESFSDFKVQLARTAHIGVRYLKPESKSTDPADVAQDIITKAQNA
FT                   LFLLHRSLDLAAIEAAVSFIAKADMIYAFGSGGNSSMIADELQNRLFRLGLRITASSDH
FT                   SMQLMMAAAAKPGDVLIGSSFSGRNMELVRAFELARGAKVKTIALTQTASPVAKAAEIV
FT                   VPIDLPEGNNIYRPTSTRIAYIATVDILSSLVAYAVQPKATTTLRRIKQQLVIHRDGDD
FT                   RQLLGD"
FT   gene            complement(74029..74418)
FT                   /locus_tag="Rleg2_5680"
FT   CDS_pept        complement(74029..74418)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5680"
FT                   /product="Endoribonuclease L-PSP"
FT                   /note="PFAM: Endoribonuclease L-PSP; KEGG: ret:RHE_PE00384
FT                   probable translation initiation inhibitor protein, YjgF
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5680"
FT                   /db_xref="EnsemblGenomes-Tr:ACI58855"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:B6A372"
FT                   /protein_id="ACI58855.1"
FT                   /translation="MPIKRYGTVQTGAGGKALPFARAVEADGWLYVSGQVAMEDGEIID
FT                   GNIIAQTHKTIANVLAILDEAGYGVEDVVRVGVWLDDPRDFWTFNKIYQEYFGEHPPAR
FT                   ACVQSSMMVDCKVEIDCVAYKKKDG"
FT   gene            74530..75012
FT                   /locus_tag="Rleg2_5681"
FT   CDS_pept        74530..75012
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5681"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rec:RHECIAT_PA0000305 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5681"
FT                   /db_xref="EnsemblGenomes-Tr:ACI58856"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:B6A373"
FT                   /protein_id="ACI58856.1"
FT                   /translation="MRDPFQNPFPSDSARQAIWEMLVLRDIDAFLAADWSKVEHDFVEE
FT                   GFIGIDAQKQVSPDRWRLAFPTLSAYRQEWLKQAKDFAEQSFAEDARTAIFTTTTLEDI
FT                   EIEGEMALVRKKFDGGIAKADGTRDILQWQTLYYCRLHQGRWKISGFTGYLPNPMG"
FT   gene            75043..76518
FT                   /locus_tag="Rleg2_5682"
FT   CDS_pept        75043..76518
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5682"
FT                   /product="Microcystin LR degradation protein MlrC-like
FT                   protein"
FT                   /note="PFAM: MlrC domain protein; Microcystin LR
FT                   degradation protein MlrC-like; KEGG: rec:RHECIAT_PA0000304
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5682"
FT                   /db_xref="EnsemblGenomes-Tr:ACI58857"
FT                   /db_xref="GOA:B6A374"
FT                   /db_xref="InterPro:IPR009197"
FT                   /db_xref="InterPro:IPR010799"
FT                   /db_xref="InterPro:IPR015995"
FT                   /db_xref="UniProtKB/TrEMBL:B6A374"
FT                   /protein_id="ACI58857.1"
FT                   /translation="MRIFTAALATETNTFSPICVDRRAFEASLYAPPGQHPETPTLCTA
FT                   PITVGRRVTRDKGWQLIEGTATWADPAGLVNRATYEELRDEILGQLRAAMPVDAVVMGL
FT                   HGAMVAAGYEDTEGDLLSRMRQIIGPDVLICAELDPHSHLTAKRVAALNFAVYFKEFPH
FT                   TDFVDRAEDLWRIAVDTLEGRVKPLISVFDCRMIDVFPTSREPMRSFVDKIMQIEKDDP
FT                   DILSISVIHGFMVGDVPEMGTKLLVVTDDKPEKGAALARELGLELFSKRGTFMVPQIDE
FT                   RQAVSRAIAATAWPVVIADVWDNPGGGTAGDATVILAELLARGVRSAVIGTIWDPVAVQ
FT                   ICFAAGEGAEIPLRFGAKSAPGTGNPIDGTVKVVRLVKNAEMQFGESLAPFGDAAHIVL
FT                   DGIDIILNSTRAQSFDPSLFSVMGIDPEKQKILVIKSTNHFFASFSRIAAEILYCSAGT
FT                   PYPNNPATTPYRRAPKTIWPIVADPHGRERGAA"
FT   gene            76519..77619
FT                   /locus_tag="Rleg2_5683"
FT   CDS_pept        76519..77619
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5683"
FT                   /product="alanine racemase domain protein"
FT                   /note="PFAM: alanine racemase domain protein; KEGG:
FT                   rec:RHECIAT_PA0000303 putative amino acid processing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5683"
FT                   /db_xref="EnsemblGenomes-Tr:ACI58858"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR026956"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="InterPro:IPR042208"
FT                   /db_xref="UniProtKB/TrEMBL:B6A375"
FT                   /protein_id="ACI58858.1"
FT                   /translation="MHDASFAVVARAGDRIADLSTPRPVIDEDRLAANIARVQSYMDEH
FT                   GLNFRPHIKTHKIPALAVAQIAAGAKGINCQKVSEAEVFAEAGFGDILITFNIIGQQKL
FT                   ERLARLNEKIPALKVVADSETTIDGLAAHFSGHKPLTVLVECDTGGGRCGVQRPEEAAS
FT                   LARRIAAADGLTFGGIVTYPKPQSAASVEAFITETLDCLKSDGIDCPIVSNGGTPSLFE
FT                   AHLVPSATEHRAGTYIYNDRQMVRMGHCTEDDCAMHVLATVVSRPTADRAVIDAGSKAL
FT                   TSDLQGFSDYGLIVGYPQARISSLSEEHGVIDLANCTGPRPQIGEKLFIIPNHTCVVSN
FT                   LFDTMVFHRGGVVTRVERVAARGLVW"
FT   gene            77919..82778
FT                   /locus_tag="Rleg2_5684"
FT   CDS_pept        77919..82778
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5684"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bvi:Bcep1808_2635 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5684"
FT                   /db_xref="EnsemblGenomes-Tr:ACI58859"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B6A376"
FT                   /protein_id="ACI58859.1"
FT                   /translation="MAETPGRQTIGGAGAATSAGILFQKQIGAIIGAWLVAEQPFDQRL
FT                   DLGAAKPVWLRFETEAPVDDILVGTSTGGFVAVQAKTTASLSREIGSPFGKTVSQFVRH
FT                   WLACREGDGSLRWNRPLDARVDRLVLAVGPQAPVMIREVLPAALRLKAQPGGGELNDAQ
FT                   RRAFADFEACVEQAWSQATALPYEPATARDLAALISVVAFDPVGLARQAVVASLVGMVA
FT                   SPADAAAVLSALEALCGELMAQRGGVDLATVRRKLMGRGISLRPPPDFRRDIERLMAHS
FT                   TATAATLERFEVIEVVEGDRVTIGRECQDAVRGAAIKGDLLIVGEPGAGKSGVLNALAR
FT                   DLRLEGRDVVELAVDRYSVDTLEGLRQELGLTHGVVETLKAWDDTEPAWLIIDALDATR
FT                   GGRGEGVFRTLIEQVMASGGRWNVIASIRTFDLRMGQQFRTLFKGTPPVEGMMEPGFPA
FT                   VRHVRVPSWTQSEFAQLLARAPVLAAALANAPRALQDLAAIPFNTRLVSDLVKDGVITS
FT                   DFSHIATQSELLQLYWEHRVERYAAPARACILRIVTAMVEARALRASFAVAAQSDASAL
FT                   DDLEREGVLISVDNRRWIQFRHHLLFDFAAARIMLDPEELIQGDLRFGKAEARGLMLAP
FT                   ALSFVLREIWMREPDRAEFWTAAGHILSDRDGDPVIRSATGRICAEYPLAVSDMKVLAG
FT                   RIVAGDEEAAQAFVHSCGALVTRLEDFPETSLTPWVGLVLEIAPNVAPVAGTLRFLLFR
FT                   IVESVEDAAQRKNLGIAARALLEYSLGLEQPRNAVSAAVDLVAETYGTDVMASRTLLAK
FT                   ILTPERLTLHAAEEVPALCRKIEQIGTLDPAFTELIYQKTYGFDVIGDQETMMGDSQIM
FT                   PFRSNSRQDYAMARYSLSEFFETFLELHPSHAVSAVVQATEAYVVREHSRIDKMLNTEL
FT                   EVAGRRIRLREDWSHIWAHDPDKSYGHDAESLVKKLLNHLRCTETDAAVRIAERLIQTA
FT                   SLAIFWSRLFLVATEREDSLAGILLPIAMQEDFLTLPDTRKDAVGVVAKGYPGLEEAVR
FT                   SDFEEAVGRFDFSRYQRPDEARASFERRLFGAIGPTNLATERARRIAGEQGDIEDVQND
FT                   RLFTVRATMEPPEPYYWIQGLDQNSPANRKLIGAIEEAKQALGTEGDALGAVGLEAALD
FT                   AMKELAALIDRDKQNPHLVIYAEGQISQALIRLVERKILPSPEDDAATTRFLEMFSIAE
FT                   ASAGPRVEEDTETDFERGASWGSPAPRVDAAQMALDIVLQRPDLYPDLEPAIDLLLNDR
FT                   HPAVRLQALLRIVRIWHLDRNGFWRRLSARLSGEGNQSVIDHVSAAVLGRVVHEEPEKV
FT                   ETLALALLERFNGEPARQARMRDTVSDLLAILWVTHERRASLEVVASWIAEPAAHSAEI
FT                   LKILRTLRGALIAGLKDQAVLEERGLRHRSQKIASEVVLTANRVLKAYYENDRSAPEQS
FT                   EKARDCALLLDAVCMELFFAAGAGRDTGVAEGSLRGDAMATFFDEVSPTLQALGDFATP
FT                   QTVYYLIQLLEFLLPANPARTFDLTVHALRSGGRRTGYQFESLGADLLVRLVGVFLADH
FT                   KELFDDDARRAALIDCLEIFMEAGWPAARRLLYRLPELIQ"
FT   gene            82814..84220
FT                   /locus_tag="Rleg2_5685"
FT   CDS_pept        82814..84220
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5685"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bvi:Bcep1808_2634 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5685"
FT                   /db_xref="EnsemblGenomes-Tr:ACI58860"
FT                   /db_xref="UniProtKB/TrEMBL:B6A377"
FT                   /protein_id="ACI58860.1"
FT                   /translation="MAAILAAIDRQPQAGATNPYAGAGDEVFHEHDTRVFFFDRLMRLL
FT                   GWELGPGGNVAEEARIKADTTKFVDYLGVNAITRAPALILEAKSWDKPNITGKGRWRHE
FT                   TKPNLIVAAVKHINSDGPKDKSPVTGEWHDNLSQLARYVRLFKEQHEHDVPCAVLSSGQ
FT                   WLLIFKTPVATFCNSDVNDQQFCLIERDDYVAQAHVIFEQMARVKLADTAPTRIRSTQL
FT                   ANYVRAGSFTAAYHGLLINYEASGSPLFVQQPRILVYPAIFVQRDDNALFTVIDAEIPI
FT                   VLQLSRTDDGEETLAPHINEVAAAAAKLLASCTAELAIPIQPSGLDEFPGFPESSAVAA
FT                   GGLALGEPRKLLIQPVRTAPNNWLAVTGTLPHYLHEAPVLQCRFHAWSECQVVHCSIGA
FT                   NAVNSPSIDRPRAFFIDTKLHHCAHQTVADRRADRCHIKAIDARTCCKACAYHVSCWST
FT                   AESLVLPCGT"
FT   gene            complement(84533..85666)
FT                   /locus_tag="Rleg2_5686"
FT   CDS_pept        complement(84533..85666)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5686"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; TOBE domain protein;
FT                   Transport-associated OB domain protein; SMART: AAA ATPase;
FT                   KEGG: rec:RHECIAT_PA0000297 probable sugar uptake ABC
FT                   transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5686"
FT                   /db_xref="EnsemblGenomes-Tr:ACI58861"
FT                   /db_xref="GOA:B6A378"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040582"
FT                   /db_xref="UniProtKB/TrEMBL:B6A378"
FT                   /protein_id="ACI58861.1"
FT                   /translation="MGQLLLNKVQKFYGDYEVLKGVQLDVKNGEFVVFVGPSGCGKSTL
FT                   LRMIAGLDATTAGDIVIDGIRVNDLPPVRRGIAMVFQSYALYPHMTVFENIAFPLRVEK
FT                   MEEAKLKARVENAARILHLEQRLQQKPGMLSGGQRQRVAIGRAIVREPKIFLFDEPLSN
FT                   LDAALRADMRIELAKLHRQLKATMIYVTHDQVEAMTMADRIVVLDAGDISQTGAPLELY
FT                   HKPANQFVAGFIGNPKMNFLPVTCKGASAAGVEVEYRGQTALLPVTPRDGISGKTLTLG
FT                   IRPEHIQLNGGDIVFTVTPTVIERLGANTVAYASLNGEAENFCAMLPGSVGIRADTPVS
FT                   TGINAADCHLFDEAGIAFERRVELTEIDMNVINPTAA"
FT   gene            complement(85758..86963)
FT                   /locus_tag="Rleg2_5687"
FT   CDS_pept        complement(85758..86963)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5687"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   KEGG: ret:RHE_PE00370 probable sugar uptake ABC
FT                   transporter, substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5687"
FT                   /db_xref="EnsemblGenomes-Tr:ACI58862"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:B6A379"
FT                   /protein_id="ACI58862.1"
FT                   /translation="MALALLGSTAMTTVTAHAADKEISWIYCGDTIDPVHTKYIKQWEE
FT                   KNTGWKITPEVVGWAQCQDKATTLAAAGTPVAMAYVGSRTLKEFAQNDLIVPVPMTDDE
FT                   KKTYYPHIVDTVTFEGNQWGVPIAFSTKALYWNKDLFKQAGLDPEKPPKTWAEEIEMAK
FT                   TIKEKTGIPGFGLSAKTFDNTMHQFMHWVYTNNGSVIGADGKVTLDSPQILAALKAYKD
FT                   IVPYSEEGPTAYEQNEVRAIFLDGKVAMIQAGSGAADRLKKTQISWGITTLPLGPDAKG
FT                   PGTLLITDSLAIFKGSGVEDKATEFAKFITSPDVQSEYELQGGAGLTPLRPSAKVDEFV
FT                   AKDPYWKPLIDGISYGGPEPLFTDYKGFQNSMIEMIQSVVTGKAEPEAALKKAAGEVEA
FT                   FK"
FT   sig_peptide     complement(86907..86963)
FT                   /locus_tag="Rleg2_5687"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 19"
FT   gene            complement(87037..87894)
FT                   /locus_tag="Rleg2_5688"
FT   CDS_pept        complement(87037..87894)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5688"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: ret:RHE_PE00369 probable
FT                   sugar uptake ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5688"
FT                   /db_xref="EnsemblGenomes-Tr:ACI58863"
FT                   /db_xref="GOA:B6A380"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B6A380"
FT                   /protein_id="ACI58863.1"
FT                   /translation="MSSAAMIDRYRWWEIILIYCGIALFLFFVLAPFFEGFMVSLKPLS
FT                   QLFSSPYRFWPENGSFEAYRTMWVSVPGFGRYIFNSFFISIIVTLIVLCLVIPAAYAFA
FT                   KFEFKGMGILLGAFLTVNMFSGAVLLIPLFRLMRSMGVLNTYLAMIVPGVAFLIPSAIW
FT                   LLRTYMIRIPQELNEAAYMDGASHFYTLRRVILPIAMPGIIVVAITTFIGAYAQQFIFA
FT                   LTFNSKTEYMPLPVGLFAYFGKQEVIWNELMAASFVGIAPAMVVIFFLQRYLVGGLTAG
FT                   AVKQ"
FT   gene            complement(87891..88775)
FT                   /locus_tag="Rleg2_5689"
FT   CDS_pept        complement(87891..88775)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5689"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: ret:RHE_PE00368 probable
FT                   sugar uptake ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5689"
FT                   /db_xref="EnsemblGenomes-Tr:ACI58864"
FT                   /db_xref="GOA:B6A381"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B6A381"
FT                   /protein_id="ACI58864.1"
FT                   /translation="MSVQRSAFIFAWILLLPAVLYVLAIVAYPLVDTFILSFTDASLKK
FT                   TTNWVGWVNYQKIFNATFAEVIFRTFVWTFFSVALKMVIGTFGATMLNAAVPGRSLFRL
FT                   LTMPPWIVPMAIGIFMWGWMYNGQFGMISGVLQRLGLVDGPVAFLAYGSTAFWATIVTD
FT                   VWIGVPLVTIYFLAAIQSIPKDLYEAAWTDGAGRWYRFRRITLPLMVPAIITMSMLSLI
FT                   ATFNSFDIIWILTQGGPSGETTTMIIDTYQTAIGSKKYGEGAARAVLICIFLSLFCFAY
FT                   FRVTRRLNPEKRA"
FT   sig_peptide     complement(88701..88775)
FT                   /locus_tag="Rleg2_5689"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.879) with cleavage site probability 0.695 at
FT                   residue 25"
FT   gene            complement(88789..89946)
FT                   /locus_tag="Rleg2_5690"
FT   CDS_pept        complement(88789..89946)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5690"
FT                   /product="oxidoreductase domain protein"
FT                   /note="PFAM: oxidoreductase domain protein; Oxidoreductase
FT                   domain; KEGG: ret:RHE_PE00367 probable oxidoreductase
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5690"
FT                   /db_xref="EnsemblGenomes-Tr:ACI58865"
FT                   /db_xref="GOA:B6A382"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR004104"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B6A382"
FT                   /protein_id="ACI58865.1"
FT                   /translation="MKVGIIGLGFRLGYLGYVFKAIDSSFDIVGYVDPEPAGLPGLTEK
FT                   GVSVGKAYGSPEELLASEKLDLLMIGSPNHLHLDHIRLGLQAGLKVFCEKPIVTTIAES
FT                   IELAHLMAKFGHERLMVGLVLRYSPLYKDLRAIQAEGKLGQIVSIEASEHIEPYHGAFF
FT                   MRDWRRYERYSGSFMLEKCCHDLDLYNGVVGARPERVASFGGRKSFIPANDPAREGIND
FT                   LELFHRKPSGWMGSDKVFDSDADIIDYQVAIVEYENGVGMNFHTNLNVPDQFRRFAIMG
FT                   SRGMAEGDFVRGYLDVHEQLTGNKVIENKYAATELSQHYGADEQMASDLLESVRTGLEL
FT                   PVSTLNALEAGILALAMDEARMKKTVVDLRPVWDRFDEALHARAA"
FT   gene            90244..91131
FT                   /locus_tag="Rleg2_5691"
FT   CDS_pept        90244..91131
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5691"
FT                   /product="Carboxymethylenebutenolidase"
FT                   /EC_number="3.1.1.45"
FT                   /note="PFAM: dienelactone hydrolase; KEGG:
FT                   rec:RHECIAT_PA0000292 probable dienelactone hydrolase
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5691"
FT                   /db_xref="EnsemblGenomes-Tr:ACI58866"
FT                   /db_xref="GOA:B6A383"
FT                   /db_xref="InterPro:IPR002925"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B6A383"
FT                   /protein_id="ACI58866.1"
FT                   /translation="MTRMTAKDFPQELLELYDYYAHGRITKREFLDRAGKFAVGGVTAA
FT                   AILASLSPDYALATQVEFTDPDISAEYITYPSPKGNGDVRAYLVRPTKAAGKVGAVVVV
FT                   HENRGLNPYIEDVARRVAKAGFIALAPDGLTSVGGYPGNDEKGKELQQKVDPEKLMNDF
FT                   FAAVEFLMKSDLTTGKVGITGFCYGGGVANAAAVAYPELAAAVPFYGRQPRAEDVPKIK
FT                   APLLLHYAGLDKGINEGWPAYEAALKSSQKTYEAYVYPDVNHGFHNDSTPRYDEAAAKL
FT                   AWQRTVDWFTKYLA"
FT   gene            91389..92522
FT                   /locus_tag="Rleg2_5692"
FT   CDS_pept        91389..92522
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5692"
FT                   /product="putative amidase expression-regulating protein"
FT                   /note="KEGG: mrd:Mrad2831_4419 putative amidase
FT                   expression-regulating protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5692"
FT                   /db_xref="EnsemblGenomes-Tr:ACI58867"
FT                   /db_xref="GOA:B6A384"
FT                   /db_xref="InterPro:IPR000709"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="InterPro:IPR039570"
FT                   /db_xref="UniProtKB/TrEMBL:B6A384"
FT                   /protein_id="ACI58867.1"
FT                   /translation="MTSSEWRVGVLFSRSGISEITETEHFLGTALAIEEVNAAGGVLGK
FT                   PIVPIAYDPGGDQTAYRNLARRLLADDDVNIIFGASMSASRKAVLPIVERHNGLLFYPS
FT                   MYEGFEYSENVVYTGATLNQNTFALAEYLLRHHGRRILFVGADYIYPRESNRVMRDVLE
FT                   AKGGEVVSERYLPLHADEQTLRSVISDIVRLEPDAIFSTIVGRPAQRFYRMYAEAGIDR
FT                   KRVPIASLTMAESEIREIGADACTGHILSATYFQTVETEANARFVAAFKARFGQDFTTS
FT                   VWSQPAYAQVHLFARALARAGSLDTHRISEEILLEDFLAPEGRINFDADTRHLWLHPRI
FT                   GVARADGLFDIAWQAPGPIRPDPYLTASRFEDVWLEA"
FT   gene            92524..93147
FT                   /locus_tag="Rleg2_5693"
FT   CDS_pept        92524..93147
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5693"
FT                   /product="ANTAR domain protein with unknown sensor"
FT                   /note="PFAM: ANTAR domain protein; KEGG: mrd:Mrad2831_4420
FT                   response regulator receiver and ANTAR domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5693"
FT                   /db_xref="EnsemblGenomes-Tr:ACI58868"
FT                   /db_xref="GOA:B6A385"
FT                   /db_xref="InterPro:IPR005561"
FT                   /db_xref="InterPro:IPR008327"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:B6A385"
FT                   /protein_id="ACI58868.1"
FT                   /translation="MAGPNRIVQDLRRARVLVVHPRDEDGNLLIAHLKRLGCEVRATWP
FT                   LPPALPPDIDTVFLHVEDVHVEHALEIIDLQQTAIIAILTYESPTALQAIIDLNAHGVI
FT                   SKPLRPLGILTQFALARYRHSYEKRLAGKVQKLEETLKSRRLVEKAVSALRVMNGLDEE
FT                   AAYKLLRDQATSKRVPMATIAESIIAAQDTMKSLGLSIGAKTQI"
FT   gene            93342..94187
FT                   /locus_tag="Rleg2_5694"
FT   CDS_pept        93342..94187
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5694"
FT                   /product="Nitrilase/cyanide hydratase and apolipoprotein
FT                   N-acyltransferase"
FT                   /note="PFAM: Nitrilase/cyanide hydratase and apolipoprotein
FT                   N-acyltransferase; KEGG: mrd:Mrad2831_4421
FT                   nitrilase/cyanide hydratase and apolipoprotein
FT                   N-acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5694"
FT                   /db_xref="EnsemblGenomes-Tr:ACI58869"
FT                   /db_xref="GOA:B6A386"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:B6A386"
FT                   /protein_id="ACI58869.1"
FT                   /translation="MSIKTSTARMATVATVQFEPIVGDRAHNLAAIERLARAAKAKGAE
FT                   IVVLPELADSGYSFHDGDEVAALAGPVPGGLSAETLCRLARELCLYIVSGVAEQDGDRF
FT                   YNSALLCGPDGYIGKYRKLHLWNNENRLFRKGDIGLPVFDLPFGRIGIAICYDGWFPET
FT                   FRELALAGAELVCVPTNWVPMAGAESIAEPMANILHKAAAHTNGLYIACADRIGVERGQ
FT                   SFIGRSLIVGPQGWPISGPASADREEILLAQIDLSSVTETRTLNSFNHLLGDRRADVYG
FT                   "
FT   gene            94218..95366
FT                   /locus_tag="Rleg2_5695"
FT   CDS_pept        94218..95366
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5695"
FT                   /product="Extracellular ligand-binding receptor"
FT                   /note="PFAM: Extracellular ligand-binding receptor; KEGG:
FT                   mrd:Mrad2831_4422 extracellular ligand-binding receptor"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5695"
FT                   /db_xref="EnsemblGenomes-Tr:ACI58870"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:B6A387"
FT                   /protein_id="ACI58870.1"
FT                   /translation="MQMKTIILTLASAAFATAAFAEDPIKIGVPVGLSGANSVVAPSVV
FT                   QAAELAVEEINAKGGVLGRPLALEIADDASGAAGAQKAFDSLVFQKEVNVVISMETSAA
FT                   RNAGLPIISKGDVPYIYTSFYEGKSCNAKLFVNAWVPEQQVPPVVDNFIGKQGAKKFFL
FT                   IGSDYSFGRGMLTFAKAYIEKAGGKVVGEEYLPMDGSDWTAIISKVRSSGADAIITSTA
FT                   GGAPNVTLTKQLRSSGVSLPYGNLAVDEGTAKSMGTDAKDIFLSASYVTGIDSPENKAF
FT                   LSAMEKKFGKELRTPNDLSVPQYEAIYLYKAAVEKAGSTDTADVLKALPDVSFTGPRGK
FT                   ISMNKQHHAPLTMYLGQVKDDGSVAVVDSFKDVDPGNQCPNL"
FT   sig_peptide     94218..94283
FT                   /locus_tag="Rleg2_5695"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 22"
FT   gene            95418..96251
FT                   /locus_tag="Rleg2_5696"
FT   CDS_pept        95418..96251
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5696"
FT                   /product="inner-membrane translocator"
FT                   /note="PFAM: inner-membrane translocator; KEGG:
FT                   mrd:Mrad2831_4423 inner-membrane translocator"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5696"
FT                   /db_xref="EnsemblGenomes-Tr:ACI58871"
FT                   /db_xref="GOA:B6A388"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:B6A388"
FT                   /protein_id="ACI58871.1"
FT                   /translation="MTLFLDIVSTAAILFIVAAGLLAIFGVLKIINFAHGAWLTIGSYC
FT                   AVVVSGFGLNPWLAIPFAFLVGAILGGMAERFIVRPLYRRPLDAILATWGLGIVIGQLI
FT                   TLWFGRDVQFTPALLPGTFDLFGTGYSAYRLFAIAAAIGLGLGFTLLLDGTRLGLSARA
FT                   VIMNETLARGLGIDTEKVRLATFMIGTGLAALAGVLLAPLTSVDPNMGVAWLTGAFMLV
FT                   MVAGSSFAALAGACLIFGAAQVLVSTYFSPILGGITVAVLCAITLRIRPKGFARA"
FT   sig_peptide     95418..95528
FT                   /locus_tag="Rleg2_5696"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.609) with cleavage site probability 0.314 at
FT                   residue 37"
FT   gene            96244..98001
FT                   /locus_tag="Rleg2_5697"
FT   CDS_pept        96244..98001
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5697"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: inner-membrane translocator; ABC transporter
FT                   related; SMART: AAA ATPase; KEGG: mrd:Mrad2831_4424 ABC
FT                   transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5697"
FT                   /db_xref="EnsemblGenomes-Tr:ACI58872"
FT                   /db_xref="GOA:B6A389"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B6A389"
FT                   /protein_id="ACI58872.1"
FT                   /translation="MRDRQKLRLVLLLALALAALLLIVFGPMFLGRFSLNVLTRSMIYA
FT                   MLAITVDLLWGYTGVLTFGQAAFFGVGAYATAMVLTHIGASPALFVVALVAAVLVPLVL
FT                   GLAVGWLSFYHGSTPLYATVISLVVPIVVTQLVFSGGTWTGSSSGLVGYDTLPLGLPGY
FT                   FRLSGACLLALAIVAIVFVRSDAGRLLVAIRDNEARVAYLGMNPARLKIVLTGVLAGVC
FT                   GLAGFLYANASGVVAPENTGFVFGTELVVWTALGGRGTIIGPMFGAIGIDYLSASLSGD
FT                   LPFLWQLIVGALFVVMIILLPGGLASLVTRFLKTANSNSTLKSLPTRIVARNGPAAGKS
FT                   LLSIRGLGKSYGSLSVLKGIDLEIGAGELVSLVGPNGAGKTTLMRCLSDGTEKVEGQVD
FT                   VIGTNIAGRAPERIVALGVGRKFQVASIFDSMTIGECLKMARLSRETPNPVRSSAEIML
FT                   PPAAAEILTLTGMAEMLDKPVVLLSHGQRQALELAMVVALEPRIILLDEPTAGLTKIER
FT                   MTIGTILKKLTDEMGFAAILVEHDLDFVREISSRIVVLHQGKLVLDGTVNDVVNSETVR
FT                   TIYAGGAHG"
FT   sig_peptide     96244..96348
FT                   /locus_tag="Rleg2_5697"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.360 at
FT                   residue 35"
FT   gene            97994..98701
FT                   /locus_tag="Rleg2_5698"
FT   CDS_pept        97994..98701
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5698"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: mrd:Mrad2831_4425 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5698"
FT                   /db_xref="EnsemblGenomes-Tr:ACI58873"
FT                   /db_xref="GOA:B6A390"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B6A390"
FT                   /protein_id="ACI58873.1"
FT                   /translation="MADAFKLELSSVSSGYGAVDVVNGVSLAIRPGEIFALMGKNGMGK
FT                   TTLLKTILGFLRAGKGKIEVDGAPITDRKPAELIASGIGYAPQELPLFQDLSIRDNLRL
FT                   ALKVDRDLASALERVYFYFPFLKDRLTQKAGTLSGGEQKMLILARALMLRPKLLLIDEI
FT                   SEGLQPSVVQNIAKALRDDREKRGTTILLVEQNLDFTLSVADRWAILKLGAIEDESTNG
FT                   PDSRSRVLQHLKI"
FT   gene            98713..99873
FT                   /locus_tag="Rleg2_5699"
FT   CDS_pept        98713..99873
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5699"
FT                   /product="Amidase"
FT                   /note="PFAM: Amidase; KEGG: reh:H16_A1469 amidase"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5699"
FT                   /db_xref="EnsemblGenomes-Tr:ACI58874"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/TrEMBL:B6A391"
FT                   /protein_id="ACI58874.1"
FT                   /translation="MQDRWNAFMPYPDADVGHAPIGSLFGLRLAVKDLFDVAGYPTAAG
FT                   NAAVLVASGIKRATAPLVQTLLEAGACFVGKTNTDELAYSLIGGNIHFGMPINPRDPTL
FT                   IPGGSSSGSAVAVAAGLADLGLGTDTSGSIRLPAAINGLIGWRPTHGSLDNRALRPLAP
FT                   SFDVPGFMTRSLESMAAVMSAVGMPAANDRPISILIPEDIFETIDGTIADEMIASIRSA
FT                   AMPIRRIDFISSFSLADLAVAFTTILQKEAWESNKTLFERSPDAIAPDIAARLRAGSRL
FT                   DDGEMREARRIRTLFSGEIERLLCENMVIALPTLAMNPPTRDAGPESFAAFRSACIKLL
FT                   CLAGLSGCPQLAFPIASRVGNASLSLFGARSTDSLLMNVARRIGAE"
FT   gene            100057..100275
FT                   /locus_tag="Rleg2_5700"
FT   CDS_pept        100057..100275
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5700"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rec:RHECIAT_PA0000289 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5700"
FT                   /db_xref="EnsemblGenomes-Tr:ACI58875"
FT                   /db_xref="UniProtKB/TrEMBL:B6A392"
FT                   /protein_id="ACI58875.1"
FT                   /translation="MPTVAATSITPPDQHLVTAREALEPLYEKLELQTESLVLAAALEA
FT                   GWSPDEATEALAALRLQDALFTLGRTN"
FT   gene            complement(100320..100757)
FT                   /locus_tag="Rleg2_5701"
FT   CDS_pept        complement(100320..100757)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5701"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ret:RHE_PE00365 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5701"
FT                   /db_xref="EnsemblGenomes-Tr:ACI58876"
FT                   /db_xref="GOA:B6A393"
FT                   /db_xref="InterPro:IPR006750"
FT                   /db_xref="UniProtKB/TrEMBL:B6A393"
FT                   /protein_id="ACI58876.1"
FT                   /translation="MTVFILIACLGGVLVGLSRQLNGRLSISTTPLIASFWNHAVGFIV
FT                   LTCLGLVVGGLLPAGAAEAPWYIYLGGPIGVVFVAAGSWAIARIGAVNTALLIIGGQMV
FT                   TGVAMDYARAAPTSFWANATGIVLIVGGMMVSRRRRKSGGS"
FT   gene            complement(100754..101239)
FT                   /locus_tag="Rleg2_5702"
FT   CDS_pept        complement(100754..101239)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5702"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rec:RHECIAT_PA0000290 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5702"
FT                   /db_xref="EnsemblGenomes-Tr:ACI58877"
FT                   /db_xref="GOA:B6A394"
FT                   /db_xref="InterPro:IPR006750"
FT                   /db_xref="UniProtKB/TrEMBL:B6A394"
FT                   /protein_id="ACI58877.1"
FT                   /translation="MTIEAARNPHPIYFIGAFATGGLLTFMVHLNGELARYANPLFSSW
FT                   TAHGTGMVAAVILLLALYRRRAPTAGKTARAPLWAYLGGVSGAATVILTSTAVNSPLGL
FT                   SGTLALGLAGQVAFSLAADNWGLFGLPKRRPDMRDIAALGLVVTGGALIILFGRGGA"
FT   gene            101418..101657
FT                   /locus_tag="Rleg2_5703"
FT   CDS_pept        101418..101657
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5703"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rec:RHECIAT_PA0000220 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5703"
FT                   /db_xref="EnsemblGenomes-Tr:ACI58878"
FT                   /db_xref="UniProtKB/TrEMBL:B6A395"
FT                   /protein_id="ACI58878.1"
FT                   /translation="MRKLFRLLLTIALAVVVFTGFRWYRYVSNTDSPYDEIGITLNNAM
FT                   PGPINSWGCAKLKTTFAGSLPPLGCAAADATQWK"
FT   sig_peptide     101418..101477
FT                   /locus_tag="Rleg2_5703"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.789) with cleavage site probability 0.415 at
FT                   residue 20"
FT   gene            complement(101722..103488)
FT                   /locus_tag="Rleg2_5704"
FT   CDS_pept        complement(101722..103488)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5704"
FT                   /product="TrkA-C domain protein"
FT                   /note="PFAM: Citrate transporter; TrkA-C domain protein;
FT                   KEGG: oan:Oant_3754 TrkA-C domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5704"
FT                   /db_xref="EnsemblGenomes-Tr:ACI58879"
FT                   /db_xref="GOA:B6A396"
FT                   /db_xref="InterPro:IPR004680"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="UniProtKB/TrEMBL:B6A396"
FT                   /protein_id="ACI58879.1"
FT                   /translation="MRVDQWLSLLIIALMMGAFVWGRYRYDVVAVSSLLVAVIAGIVPA
FT                   KSAFSGFSDDIVIIVGSALIVSAAISRSGIMDLALRRFSPERRGPRMQLIILVAIVAAL
FT                   SAFVKNIGALAIMIPVAVQMARKSRVSPSMFLMPMSFASLLGGLMTQIGTSPNIIVSRV
FT                   REEITGQPFTMFDYTPVGLALSVAGVVFLGLFYKLLPERSRVETSMDEAVAIKNYTTEA
FT                   KVIMPSGAIGRSVSWLQKPAGGDAMVTAIIGGGGQRRTPLPDTVLKDGDLLIIEGEQSA
FT                   LDKIVSEAKLQLSDRKHEAETRQDISSVEAIVGEHSRLIGVSAKDVALFHNTGLNLLAV
FT                   SRRDRRFTERLGEIKIRNGDVVVLQGDLQKLPDLLREWGCLPLVARDLKLGNARNGMIP
FT                   VMILLATMGATAFGGIPVATAFFAAAFLMVVTGSVPLREVYHHLDAPILIMLAALIPIS
FT                   DSLRTTGTTEIIADLLSRTAEMLPPFGALTLILVAAMAVTPFLNNAATVLVMAPIAATF
FT                   AAKLGFRPDAFLMAVAIGAGCDFLTPIGHQCNTLVMGPGGYRFGDYARLGLPLSLIVVL
FT                   VSVPALLAVWPI"
FT   gene            103682..106333
FT                   /locus_tag="Rleg2_5705"
FT   CDS_pept        103682..106333
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5705"
FT                   /product="DNA ligase D"
FT                   /note="TIGRFAM: DNA ligase D; DNA ligase D,
FT                   3'-phosphoesterase domain protein; DNA polymerase LigD,
FT                   polymerase domain protein; DNA polymerase LigD, ligase
FT                   domain protein; PFAM: DNA primase small subunit; ATP
FT                   dependent DNA ligase domain protein; ATP dependent DNA
FT                   ligase; KEGG: ret:RHE_PE00252 ATP-dependent DNA ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5705"
FT                   /db_xref="EnsemblGenomes-Tr:ACI58880"
FT                   /db_xref="GOA:B6A397"
FT                   /db_xref="InterPro:IPR012309"
FT                   /db_xref="InterPro:IPR012310"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014143"
FT                   /db_xref="InterPro:IPR014144"
FT                   /db_xref="InterPro:IPR014145"
FT                   /db_xref="InterPro:IPR014146"
FT                   /db_xref="InterPro:IPR033651"
FT                   /db_xref="UniProtKB/TrEMBL:B6A397"
FT                   /protein_id="ACI58880.1"
FT                   /translation="MASDNLSTYRSKRDFKKTAEPSGEKQIARSNRRRFIIQKHDATRL
FT                   HYDLRLELDGVFKSWAVTKGPSLDPHDKRLAVEVEDHPLDYGDFEGTIPKGQYGGGTVM
FT                   LWDRGYWEPEGKKSPEQALAKGDFKFTLEGERLHGSFVLVRMRNDRDGGKRTNWLLIKH
FT                   HDAFSVEENGAAVLEENDTSVASGRTMDAIATGKGRKPKPFMIKGGDIKADAVWDSNQG
FT                   LAAEERKEEGRAGRTPKTAAKVDLPDFIAPQLCQTLERPPAGEGWIHEIKFDGYRIQMR
FT                   ILDGEVTLKTRKGLDWTGKYPEVAEAASALPDAIIDGEICALDDHGVPDFAALQAALSE
FT                   GRTGDLVYFAFDLLYEGGEDLRSLPVIERKARLQSLLADAGDDPRLRFVEHFETGGDAV
FT                   LRSACKLSLEGIVSKQSDAPYQSGRTDSWAKSKCRAGHEVVIGAYAKTNGKFRSLLVGV
FT                   YRGDHFVYVGRVGTGYGAKKVETLLPKLQALETAKSPFTGIGAPKKEAEVTWVKPKLVA
FT                   EIEFAGWTADGIVRQAAFKGLREDKPAREVKAERPAKPAETDVPEPEPAAEVKARPARR
FT                   KGAKAEVMGVMISNPDKPLWPDANDRKPVTKEELARYYEAVGGWMIAHIEGRPCSIIRA
FT                   PDGLGGEQFFQRHAMPGTSNLLELVKVFGDKKPYLQIDRVEGLAAVAQIGAVELHPWNC
FT                   QPHKPEVPGRLVFDLDPGPDVPFSTVVSAAREMHDRLDALGLVSFCKTTGGKGLHVVTP
FT                   LAINKRKPLSWAEAKSFAHDVCQQMARDNPDLYLIKMTKSLRNGRIFLDYLRNDRMATA
FT                   VAPLSPRARPGATVSMPLTWTQVKSDLDPKRFTIRTVPALLSKSSAWEDYSDGQRPLEQ
FT                   AIKRLSKVSNAA"
FT   gene            106525..107580
FT                   /locus_tag="Rleg2_5706"
FT   CDS_pept        106525..107580
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5706"
FT                   /product="periplasmic binding protein"
FT                   /note="PFAM: periplasmic binding protein; KEGG:
FT                   pde:Pden_1168 periplasmic binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5706"
FT                   /db_xref="EnsemblGenomes-Tr:ACI58881"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:B6A398"
FT                   /protein_id="ACI58881.1"
FT                   /translation="MTIRLFSGLRLIFVIGGLLLSSSAWAERVVTDQIGRKVHIPDHVS
FT                   RVVILQHQTLNITIQLDAMDKVVGVLEEWKKQLGANYVRLAPLLPTLATPGGLTKANIE
FT                   ELLKLDPDVVFVTNYAPADMVKQIEDAGLPVVAISLLDVPPEEAVKLNPTVKDEPAAID
FT                   AGFATGVRLIADILDRKEQGEAMIAVTQKYRKLVADRLGDIPEDKRVPVYMANPNLETY
FT                   GHGKYTGLMMDRAGAHNVAHEIAGYKQVSMEDVLKWNPAVIFVQERYPSVVDEIKSTAS
FT                   WQTIDAVKNSQVYLMPQYAKAWGYPEPEAMSIGELWMAQKLYPDRFKDIDMQKEAETYY
FT                   KEFFRADYAGE"
FT   sig_peptide     106525..106605
FT                   /locus_tag="Rleg2_5706"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 27"
FT   gene            107577..108611
FT                   /locus_tag="Rleg2_5707"
FT   CDS_pept        107577..108611
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5707"
FT                   /product="transport system permease protein"
FT                   /note="PFAM: transport system permease protein; ABC-3
FT                   protein; KEGG: pde:Pden_1169 transport system permease
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5707"
FT                   /db_xref="EnsemblGenomes-Tr:ACI58882"
FT                   /db_xref="GOA:B6A399"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:B6A399"
FT                   /protein_id="ACI58882.1"
FT                   /translation="MSEHGALRRSPGMTIGVLLVILAFAAIASLGIGRYDISFGRVVEI
FT                   LVGRLNSPHVPITPTEANVVFTIRMPRILLTLLAGSGLALSGATMQGLFRNPLVGPQVM
FT                   GVSSGAAFGGVLAILFDLTRYGLLGSSFVFGLSALVLVYVLNGVVARRNVLALVLAGVI
FT                   VSGFFAALVSLVQYLADTEDKLPAMVFWLLGSFATANWEKLFLVAAPMLIGSLVLLGLR
FT                   WRINLLSLGDEDARALGVEVEPLRWAILILVSCIVAAQVAVSGIVGWVGLVVPHMARML
FT                   VGPDHRVMMPASLIIGALYLLAIDTVARTATSSEIPLGILTALIGTSVFAFVLRQTQRG
FT                   TRGL"
FT   sig_peptide     107577..107663
FT                   /locus_tag="Rleg2_5707"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.893) with cleavage site probability 0.629 at
FT                   residue 29"
FT   gene            108601..109389
FT                   /locus_tag="Rleg2_5708"
FT   CDS_pept        108601..109389
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5708"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: pde:Pden_1170 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5708"
FT                   /db_xref="EnsemblGenomes-Tr:ACI58883"
FT                   /db_xref="GOA:B6A3A0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B6A3A0"
FT                   /protein_id="ACI58883.1"
FT                   /translation="MVSDPPKLRITEASQSYDGRRWQFRGLDLDLKSGEITVILGPNGR
FT                   GKSTLLRVLAGVLKPTSGELQLNPCTGFVPQEFSGSFPYTVLDTVLMGRARHVGLFRTP
FT                   SKIDIDKAMDALNATGMSGFASRNIDALSGGERQLVLIARALAGENEVLLLDEPASALD
FT                   LKNQDKVLALIGDLADREKLAIAFTTHQPNHAVTVADKVLLMLPEATTIFGPTGAVLTE
FT                   TNLEALYGIPVRSARIGDNEREETTFAPLFRSRKRKGISA"
FT   gene            109386..110108
FT                   /locus_tag="Rleg2_5709"
FT   CDS_pept        109386..110108
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5709"
FT                   /product="molybdenum ABC transporter, periplasmic
FT                   molybdate-binding protein"
FT                   /note="TIGRFAM: molybdenum ABC transporter, periplasmic
FT                   molybdate-binding protein; KEGG: eca:ECA3093 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5709"
FT                   /db_xref="EnsemblGenomes-Tr:ACI58884"
FT                   /db_xref="GOA:B6A3A1"
FT                   /db_xref="InterPro:IPR005950"
FT                   /db_xref="UniProtKB/TrEMBL:B6A3A1"
FT                   /protein_id="ACI58884.1"
FT                   /translation="MTAIVRVFSAGSLRHAFPVIIDAFTAATGIRISLSLGPAGLLRER
FT                   IEAGEEFDLFASANMAHPRRLVEIGMAEQVICFARNRLCVIARADLGLTTKNFVDVLAD
FT                   PGVKIGTSTPGDDPGGDYAFEVFDRIETQHRGLGSALKRRAHQLVGGRNSQPAPGGTAA
FT                   LIRDREADLMMSYFSNARLLISETTLSLVEIPPLFAPKIEYGLALRRNASDQARLLMEF
FT                   MLGKSGQTALREAGFTLP"
FT   gene            110262..110987
FT                   /locus_tag="Rleg2_5710"
FT   CDS_pept        110262..110987
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5710"
FT                   /product="GntR domain protein"
FT                   /note="PFAM: regulatory protein GntR HTH; GntR domain
FT                   protein; KEGG: smd:Smed_4324 GntR domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5710"
FT                   /db_xref="EnsemblGenomes-Tr:ACI58885"
FT                   /db_xref="GOA:B6A3A2"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B6A3A2"
FT                   /protein_id="ACI58885.1"
FT                   /translation="MDVRAMLEEVATLGGAPKKSMKDFVVQKIATFIATGILKAGDPLP
FT                   SERELAAALSVSRETVRGAILILSTHGILSVAQGTRTVVASEDVGELAVQAARYRDIAA
FT                   YSLDNVHEARLLIEAQVVRAAAVKMEEATLDYLRKSIAAQEAACDDPVRFLICDREFHT
FT                   AIYRSSGNAVLADMAADLYSYLLSHRRRVVSQPGTIATSIADHRLILAGLETRDPDAAC
FT                   AAFAIHETRIYTTTKLLLA"
FT   gene            111039..112031
FT                   /locus_tag="Rleg2_5711"
FT   CDS_pept        111039..112031
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5711"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase;
FT                   short-chain dehydrogenase/reductase SDR; 3-beta
FT                   hydroxysteroid dehydrogenase/isomerase;
FT                   dTDP-4-dehydrorhamnose reductase; Male sterility domain; KR
FT                   domain protein; KEGG: bid:Bind_2080 NAD-dependent
FT                   epimerase/dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5711"
FT                   /db_xref="EnsemblGenomes-Tr:ACI58886"
FT                   /db_xref="GOA:B6A3A3"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B6A3A3"
FT                   /protein_id="ACI58886.1"
FT                   /translation="MHILIIGAGGMIGRKLAASLARSGCLGAQTITRMTLVDIAPPPVP
FT                   SGAVAAVEALAADISEGDAAQALAARRADVIFHLAAIVSGEAERNFELGYRVNLDGTRA
FT                   LLEAIRHEGSRQAYVPRFVFSSSIAVYGSPFPDPIPDDYVQAPLTSYGVQKAISELLLA
FT                   DYSRRGFIDGVGIRLPTIVIRPGAPNAAASGFFSGILREPLSGQRAVLPVEETVKHWLA
FT                   SPRSAVKFLIHAATLDTSSLGARRTLTMPGVAATVADQIAALRRAAGPEAVELIDRRRD
FT                   EVIEGIVAGWPKSFAPDRATQLGFTAETSVDELIEVYLAEDAPGAPRAD"
FT   gene            112180..113247
FT                   /locus_tag="Rleg2_5712"
FT   CDS_pept        112180..113247
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5712"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; TOBE domain protein;
FT                   Transport-associated OB domain protein; SMART: AAA ATPase;
FT                   KEGG: rec:RHECIAT_PC0000118 probable sugar ABC transporter,
FT                   ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5712"
FT                   /db_xref="EnsemblGenomes-Tr:ACI58887"
FT                   /db_xref="GOA:B6A3A4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005116"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040582"
FT                   /db_xref="UniProtKB/TrEMBL:B6A3A4"
FT                   /protein_id="ACI58887.1"
FT                   /translation="MAGVQFADVRKSFGVHPVIRGVDIDIADGEFVILVGPSGCGKSTL
FT                   LRMLAGLENISGGEIKIGGRVVNTLPPKDRDIAMVFQNYALYPHMTVEQNMGFSLMLNK
FT                   APKAEAEKRVKYAAGILGLDKLLDRYPRQLSGGQRQRVAMGRAIVRDPEVFLFDEPLSN
FT                   LDAKLRVAMRAEIKELHQRLKTTTVYVTHDQIEAMTMADKIVVMHDGIVEQIGSPLELY
FT                   DKPANLFVGGFIGSPAMNMIKGRLDPEDARQFVAANGTRLPVANPPASAVGRELVYGLR
FT                   PEYISLDPNGVPAEIVVIEPTGYETHLTVRLGGSDVSCVFRERVNARPGEAIRVAIDAS
FT                   HVHLFDAEGGQRLTD"
FT   gene            113404..114708
FT                   /locus_tag="Rleg2_5713"
FT   CDS_pept        113404..114708
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5713"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   KEGG: rec:RHECIAT_PC0000119 probable sugar ABC transporter,
FT                   substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5713"
FT                   /db_xref="EnsemblGenomes-Tr:ACI58888"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="UniProtKB/TrEMBL:B6A3A5"
FT                   /protein_id="ACI58888.1"
FT                   /translation="MTIKRREFLAASAAVAGAAGFGIKPSFAQAEPTYTPESGASLRLL
FT                   RWTPFVKGDEEAWLANTKKFTEATGVEVRIDKESWEDIRPKAAVAANVGSGPDLIMCWF
FT                   DDAHQYPDKLVDLTELGNYLGNKYEGWYDGVKGYATRGDTFIAMPLTAIGNAVVYRDSH
FT                   VKAAGFNEFPNDTAGFLELCKAMKAKGTPAGFPHGKAVGDGNNYAHWLLWSHNGMMVDE
FT                   GGKVTINSPETLASINYAKELYATFIPGTESWQDVNNNRAFLAGQVSLIANGVSVYYTA
FT                   KNDPKLAEIAKDIRTTNFPIGPVGKSVELCQTSSLLLFKHSKYPEAAKAYIKFMMEADQ
FT                   MNAWIQGSSAYCCQPLKAFAKNPIWTADPVHAPYARASEKLRPNGYAGPLGYASAATMA
FT                   DYVLVDMYAAAVTGQMSPEDAMKEAERRANRYYRV"
FT   sig_peptide     113404..113490
FT                   /locus_tag="Rleg2_5713"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.682 at
FT                   residue 29"
FT   gene            114854..115786
FT                   /locus_tag="Rleg2_5714"
FT   CDS_pept        114854..115786
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5714"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: rec:RHECIAT_PC0000120
FT                   probable sugar ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5714"
FT                   /db_xref="EnsemblGenomes-Tr:ACI58889"
FT                   /db_xref="GOA:B6A3A6"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B6A3A6"
FT                   /protein_id="ACI58889.1"
FT                   /translation="MSMANSGDRRGPVSSLLQNNNVLGFLFMLPAAVFLVCFLTYPLGL
FT                   GVWLGFTDTRIGRDGIFIGLENYQFLMDDSVFWLSVFNTILYTSVASVLKFALGLWLAM
FT                   LLNQHLPYKSFFRAIVLLPWVVPTVLSALAFWWIYDSQFSIISWSLMKLGLISGPINFL
FT                   GDPINARISVIVANVWRGIPFVAISLLAGLQTIPASLQEAASLDGATSWQRFRYVTLPM
FT                   LTPIIAVVMTFSVLFTFTDFQLIYVLTKGGPVNATHLMATLSFQRGIPGGQLGEGAAIA
FT                   VAMVPFLLGAIMFSFFGLQRRKWQQGGQD"
FT   gene            115797..116732
FT                   /locus_tag="Rleg2_5715"
FT   CDS_pept        115797..116732
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5715"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: rec:RHECIAT_PC0000121
FT                   probable sugar ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5715"
FT                   /db_xref="EnsemblGenomes-Tr:ACI58890"
FT                   /db_xref="GOA:B6A3A7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B6A3A7"
FT                   /protein_id="ACI58890.1"
FT                   /translation="MSTRSNTVDRANAADRANTANQVVTDNAEGMSYLNRLPRRIVMLY
FT                   LPMAVFVFVLLFPFYWMAITAVKPNEQLTDYSNYSPFWVVGPTLAHIKYLFLETSYPGW
FT                   LWNTMLVAVCSTFLSLVASVLGAYAIERVRFTGSRSVGLVIFLAYLVPPSILFIPLAFI
FT                   VFKLGIYDSRLALIFTYPTFLIPFCTWLLMGYFRSIPFELEESALVDGANRWQILTKII
FT                   LPLAVPGLISAGIFAFTLSWNEFIYALTFIQSSENKTIPVGVLTELVRGDVFEWGALMA
FT                   GALFGSLPVVILYSFFVDYYVSSMTGAVKE"
FT   gene            116821..117501
FT                   /locus_tag="Rleg2_5716"
FT   CDS_pept        116821..117501
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5716"
FT                   /product="alkyl hydroperoxide reductase/ Thiol specific
FT                   antioxidant/ Mal allergen"
FT                   /note="PFAM: alkyl hydroperoxide reductase/ Thiol specific
FT                   antioxidant/ Mal allergen; Redoxin domain protein; KEGG:
FT                   rec:RHECIAT_CH0002612 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5716"
FT                   /db_xref="EnsemblGenomes-Tr:ACI58891"
FT                   /db_xref="GOA:B6A3A8"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B6A3A8"
FT                   /protein_id="ACI58891.1"
FT                   /translation="MGDQKRPLQPGEAAPGFALATANFDGMVSFADLSGRPFLIGFFRG
FT                   LHCPFCRRQLEQLAAVQPTLYAAGVETVAVINTPVERARLYFRHRPTPITLLCDPDCRT
FT                   HRAYGVPHAEFLPDGSREQPEWPYRTTMAQFQTARINPTGELPEPLHPMEANTILNAKD
FT                   GFELVEADHVIFENHATQLVGHYLVKANGTIGWARIEALDGPNSLSIFPTTAEIIAAAG
FT                   SLGR"
FT   gene            complement(117538..118131)
FT                   /locus_tag="Rleg2_5717"
FT   CDS_pept        complement(117538..118131)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5717"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: ret:RHE_CH00601
FT                   probable transcriptional regulator protein, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5717"
FT                   /db_xref="EnsemblGenomes-Tr:ACI58892"
FT                   /db_xref="GOA:B6A3A9"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:B6A3A9"
FT                   /protein_id="ACI58892.1"
FT                   /translation="MARTRSETMQENRGKLIAAARKAFAEKGYTAASMDELTADAGLTR
FT                   GALYHNFGDKRGLLAAVVDQIDMEMAARAKAIGARAGNDWQGLLAEGAAYIEMALNPEV
FT                   QRIVLLDGPAVLGDPSQWPSQNTCLQVTKSTVERLIAQGVLKPLDAEATARLLSGAALN
FT                   AALWIAASENPQSVLPKAVEAFHALAAGLLSERL"
FT   gene            118289..118687
FT                   /locus_tag="Rleg2_5718"
FT   CDS_pept        118289..118687
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5718"
FT                   /product="Endoribonuclease L-PSP"
FT                   /note="PFAM: Endoribonuclease L-PSP; KEGG: atc:AGR_C_2721
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5718"
FT                   /db_xref="EnsemblGenomes-Tr:ACI58893"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="InterPro:IPR038743"
FT                   /db_xref="UniProtKB/TrEMBL:B6A3B0"
FT                   /protein_id="ACI58893.1"
FT                   /translation="MTEREAIFPADRHALYEEHGYSAAIRSGDLLFVSGQVGSRPDGTA
FT                   EPDFERQVRLAFENLQATLSAAGCTIDDIVDVTTFHTDPENQFATIMAVKQQIFSKPPY
FT                   PNWTALGVNWLAGFDFEIKVIARIPAST"
FT   gene            119014..119478
FT                   /locus_tag="Rleg2_5719"
FT   CDS_pept        119014..119478
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5719"
FT                   /product="NUDIX hydrolase"
FT                   /note="PFAM: NUDIX hydrolase; KEGG: mlo:mlr1881
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5719"
FT                   /db_xref="EnsemblGenomes-Tr:ACI58894"
FT                   /db_xref="GOA:B6A3B1"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="UniProtKB/TrEMBL:B6A3B1"
FT                   /protein_id="ACI58894.1"
FT                   /translation="MALRSAGLLIYRRVSNDLEVLLVHPGGPFWAGKDEAAWSIPKGLV
FT                   EPDEDELAAAMRETAEELGVAIDGRVTPLGEYRQPGGKIVVAWSIEADPALDVNAIRSS
FT                   EFQMEWPPRSGQMKSFPEVDRAGWFSLAEAGTKLLKGQRPMLADLLKHQK"
FT   gene            119652..119933
FT                   /locus_tag="Rleg2_5720"
FT   CDS_pept        119652..119933
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5720"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: smd:Smed_4426 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5720"
FT                   /db_xref="EnsemblGenomes-Tr:ACI58895"
FT                   /db_xref="UniProtKB/TrEMBL:B6A3B2"
FT                   /protein_id="ACI58895.1"
FT                   /translation="MNGISKTLNDMTLVERSSLLDTVADALEATAEEAEGEGDARFVAN
FT                   SICIANTIRGLSGQLAPRDLRAAELLLEQGIMLVHQFSSRVKPGGMKH"
FT   gene            complement(119976..122021)
FT                   /locus_tag="Rleg2_5721"
FT   CDS_pept        complement(119976..122021)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5721"
FT                   /product="band 7 protein"
FT                   /note="PFAM: band 7 protein; KEGG: rec:RHECIAT_PC0000244
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5721"
FT                   /db_xref="EnsemblGenomes-Tr:ACI58896"
FT                   /db_xref="GOA:B6A3B3"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR017037"
FT                   /db_xref="UniProtKB/TrEMBL:B6A3B3"
FT                   /protein_id="ACI58896.1"
FT                   /translation="METLQYLSPMGWKAIEIAVTLIVLAILFRWSGVIRYIPNDRLGIL
FT                   EKLWSFRGSVDNGFIALYGEAGFQPEVVRGGLHFFMPFQYAMHRANLVTIPQGQIGYVF
FT                   ARDGEPLPPTQTLASNVDADDFQDVRGFLTKGGQKGPQRKILREGTYAINLAQFIVLTA
FT                   QSTYAVNLNASEQGLFADMSTLISERSGFEPVVIHDAEDLIGVVTIHDGPALPDGEIIA
FT                   PTVANNPKDPNFHNNFQDPEKFLNAGGYRGRQLQVLADGSYFLNRIFATVELVEKTIID
FT                   VGTVGVVVSYTGRRSADISGQSYRHGELVETGARGVWSTPLLPGKYAFNTYAGNIIIVP
FT                   TTNFVLKWTKEQFGEHRLDENLSEVSLITKDAFEPVLPLSVVVHIDYMKAPLVVQRFGD
FT                   IKRLVEQTLDPMVSAYFKNIAQTKTLIELLQERSEIQRKSGDEMREKFNSYSLELQEVL
FT                   IGTPRANNGQNSIEQILIQLRERQIAVEKVETYKLQEAAAVQERTLREKQALAEQQAKI
FT                   TTSALTIEISENEGKAQLARTRQQAETIQVTAKAEAEKVRLAGLGEADRIKAVALADAE
FT                   RIKATGLADAQKVRAIGLAEAEATEKKVAAFGGPDYQLHSQVLMRFAEAIENGRLPLVP
FT                   QIQVGGAGGEKGAANGLVEMMLSMLVADRLGRPASPAAVPAPIEQQ"
FT   gene            complement(122462..123763)
FT                   /locus_tag="Rleg2_5722"
FT   CDS_pept        complement(122462..123763)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5722"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: General substrate transporter; major
FT                   facilitator superfamily MFS_1; KEGG: atc:AGR_C_4589
FT                   benzoate transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5722"
FT                   /db_xref="EnsemblGenomes-Tr:ACI58897"
FT                   /db_xref="GOA:B6A3B4"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B6A3B4"
FT                   /protein_id="ACI58897.1"
FT                   /translation="MYGEGKLAIQDLAIFKERVRSPNIIIALCGLLILFDGYDLIVYGA
FT                   VAPALLGEASWGLTPGLVGRAASITLFGMLLGALVAGTLADRIGRRKVIIGSLLSFSVM
FT                   MIGSGLAPNFLVFEGTRFLAGLGLGALFPTVTALIIEFSPPKRKAIAYSIALLGYLAGG
FT                   IISGILGMLLIQKYGWRPLMIIGGAPSLLLPFFIRLIPESPEWLATKSRQPEANQIANQ
FT                   YGLPNPVARPVAPRQAGIVSLFSEGRLLPTLNAWGIHFCSLLLTFGMVNWLPTIMNKMG
FT                   YDLGSALLFSVTLNLGAAIGLLIGARIADRGNVKIVVSGMFLLGACSIWLLTQVDQGLQ
FT                   VYGLVALAGTGTIGTQILANILVGNLYPVEIRGTGLGFSLGIGRIGGMIGPAIGGAVLG
FT                   AGLAPQWNFYIFATVGALGCILALMTLLYSKKAD"
FT   gene            complement(123945..124397)
FT                   /locus_tag="Rleg2_5723"
FT   CDS_pept        complement(123945..124397)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5723"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="PFAM: regulatory protein MarR; KEGG: pol:Bpro_2058
FT                   transcriptional regulator, MarR family"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5723"
FT                   /db_xref="EnsemblGenomes-Tr:ACI58898"
FT                   /db_xref="GOA:B6A3B5"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B6A3B5"
FT                   /protein_id="ACI58898.1"
FT                   /translation="MYKLTDSVPYLLNRAGVRIAEVFAQRIAEDNLSVAMYRVLAMLKE
FT                   RRESTLGDLADVVSVEISTLSRLVGTLAKRKLVSRTRPEDNGRIVIVRLTPQGEALTER
FT                   LMPLAVELERTAVQGMSDEEVAALKKALRRMHSNLPAISGKGKVAG"
FT   gene            124598..125137
FT                   /locus_tag="Rleg2_5724"
FT   CDS_pept        124598..125137
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5724"
FT                   /product="flavin reductase domain protein FMN-binding"
FT                   /note="PFAM: flavin reductase domain protein FMN-binding;
FT                   KEGG: atc:AGR_C_4599 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5724"
FT                   /db_xref="EnsemblGenomes-Tr:ACI58899"
FT                   /db_xref="GOA:B6A3B6"
FT                   /db_xref="InterPro:IPR002563"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:B6A3B6"
FT                   /protein_id="ACI58899.1"
FT                   /translation="MSATAALGIAPAPAPISDAFRSTMRRFPATVTVISACRNGADHGM
FT                   TATAVTSLSMDPPSLIICLNNRTYLHDMLLEVPEFAVSILTDRQAAVSEGFSGKIAPER
FT                   RFDAADWVRHERGMMVLDSAHASVICRRTGAVPYGTHTIFIGQVVDTRLSQDTIALMYE
FT                   NSKYCAPLHALPASQN"
FT   gene            125148..126380
FT                   /locus_tag="Rleg2_5725"
FT   CDS_pept        125148..126380
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5725"
FT                   /product="Acyl-CoA dehydrogenase type 2 domain"
FT                   /note="PFAM: Acyl-CoA dehydrogenase type 2 domain; KEGG:
FT                   atc:AGR_C_4598 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5725"
FT                   /db_xref="EnsemblGenomes-Tr:ACI58900"
FT                   /db_xref="GOA:B6A3B7"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013107"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:B6A3B7"
FT                   /protein_id="ACI58900.1"
FT                   /translation="MNNTAALFPASARVENACLADRIAPMLDEIRAGARDTEKSGRVPA
FT                   RNIDLLRSVGYFDIVKPARFGGDEGSFAELVDANIQLSSACASTGWVAGLLSAHQWLLA
FT                   MFDERVQQEVWGSNPDALLCGSYAPVRAAERVEGGFRLSGDWAFASGCENAQWALCAAI
FT                   IPPNREGERSVPTFLLVPATDYTIAETWDVVGLAGTGSKSLILKDVFVPEYRILTFPDA
FT                   TSGRTPGGRGYKGIGLFNIPLLMGIPFCLGSAAVGAAKGALDSYIDHIGTRVTRGAVAG
FT                   GNSKIAEFPTIQLRVAEAAASVDAAREIVLRDIARAQQLAQDREDGLREITEEDRILAR
FT                   RSQSFAVSLALRAVEALNASTGGLGLQMSNPVQRAWRDANAVGRHISMNWDAVGTMVGQ
FT                   QLLGLPPKGQF"
FT   gene            126428..127408
FT                   /locus_tag="Rleg2_5726"
FT   CDS_pept        126428..127408
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5726"
FT                   /product="amidohydrolase 2"
FT                   /note="PFAM: amidohydrolase 2; KEGG: atc:AGR_C_4595
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5726"
FT                   /db_xref="EnsemblGenomes-Tr:ACI58901"
FT                   /db_xref="GOA:B6A3B8"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR032465"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:B6A3B8"
FT                   /protein_id="ACI58901.1"
FT                   /translation="MQGKIALEEHFAIPETLQDSAGFVPGDYWTELSARLLDIQDKRLR
FT                   LMDTHGIEKMILSLNAPAVQAIPDKAKAVEISRRANDFLAEQCVKNPNRFLGFAALPLQ
FT                   DPDAATQELQRCVTTMGFVGALVNGFSQEGDGTTPLYYDLPQYRPFWAEVEKLDVPFYL
FT                   HPRNPLPQDSRIYAGHSWLMGPTWAFAQETAVHALRLMGSGLFDEHPALRIIVGHMGEG
FT                   LPYMMWRIDNRNAWVKVEKSYPAKRPIADYFNENFYITTSGNFRTQSLIDAMLEIGADR
FT                   ILFSADWPFENVDHAANWFDSATISEADRLKIGRTNAVSLFKLDR"
FT   gene            127410..128468
FT                   /locus_tag="Rleg2_5727"
FT   CDS_pept        127410..128468
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5727"
FT                   /product="iron-containing alcohol dehydrogenase"
FT                   /note="PFAM: iron-containing alcohol dehydrogenase; KEGG:
FT                   atc:AGR_C_4594 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5727"
FT                   /db_xref="EnsemblGenomes-Tr:ACI58902"
FT                   /db_xref="GOA:B6A3B9"
FT                   /db_xref="InterPro:IPR001670"
FT                   /db_xref="InterPro:IPR034786"
FT                   /db_xref="InterPro:IPR039697"
FT                   /db_xref="UniProtKB/TrEMBL:B6A3B9"
FT                   /protein_id="ACI58902.1"
FT                   /translation="MVAPFRYTVGAAQIIFGRGSLSRLAEAIAGQGGTRALILSTQHQK
FT                   AEAERIAASLGPLAAGLFADAAMHTPVDVTERAMAAYNRAGADCVVAIGGGSTIGLGKA
FT                   IAYRNDAPQIVVATTYAGSEVTPILGQTENGQKTTVRGPGILPEVVIYDPELTLGLPVN
FT                   ISVSSGLNAMAHAVEGLYAQDRNPISSMMAIEGLHALKQALPQIVNTPGDIESRSEALY
FT                   GSWLCGTVLGAVGMALHHKLCHTLGGSFDLPHAETHAVILPHSAAYNAVAATDALKPAA
FT                   DLFGGSLGGGLYDFAASIGAPMRLRDLGMKEADLHPAAELAARNPYWNPRPIERDAIRA
FT                   LLQSAWEGARPR"
FT   gene            128489..129340
FT                   /locus_tag="Rleg2_5728"
FT   CDS_pept        128489..129340
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5728"
FT                   /product="Hydroxyquinol 1,2-dioxygenase"
FT                   /EC_number="1.13.11.37"
FT                   /note="PFAM: intradiol ring-cleavage dioxygenase; Catechol
FT                   dioxygenase domain protein; KEGG: rha:RHA1_ro01857
FT                   6-chlorohydroxyquinol-1,2-dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5728"
FT                   /db_xref="EnsemblGenomes-Tr:ACI58903"
FT                   /db_xref="GOA:B6A3C0"
FT                   /db_xref="InterPro:IPR000627"
FT                   /db_xref="InterPro:IPR007535"
FT                   /db_xref="InterPro:IPR015889"
FT                   /db_xref="UniProtKB/TrEMBL:B6A3C0"
FT                   /protein_id="ACI58903.1"
FT                   /translation="MPEYFSEERSVEAVNARMGQGINPRLAELMASLVKHLHAFAKDIS
FT                   LTQEEWELAISFLTHTGHLCHDERQEFILLSDTLGFSMLVDAINNRRPPGATENTVFGP
FT                   FHVEGAPVRQMGENISLDGKGESCLFIGRVLDLDGSPIEGAKIDVWSDNADGFYDVQQP
FT                   DLQPKWNNRGVFVTGADGAYSFIGIKPVSYPIPDDGPVGQLLASLGRHSYRPAHTHYLI
FT                   TASGYQKLVTHTFVGDDPYLESDTVFGVKNSLIAPFERIDHPTIWRSDFDFVLTPVETT
FT                   RR"
FT   gene            129337..129633
FT                   /locus_tag="Rleg2_5729"
FT   CDS_pept        129337..129633
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5729"
FT                   /product="YCII-related protein"
FT                   /note="PFAM: YCII-related; KEGG: atc:AGR_C_4590
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5729"
FT                   /db_xref="EnsemblGenomes-Tr:ACI58904"
FT                   /db_xref="InterPro:IPR005545"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:B6A3C1"
FT                   /protein_id="ACI58904.1"
FT                   /translation="MIVVRYAVSDPGKAAERSRLLEQHKAYLYGAAIRILLSGPSAPPA
FT                   EGKGSTAVVIADVETLAEFETFSAGDPFVRAGVYRSVDVFEWRPSFGLLLDSL"
FT   gene            complement(129691..130743)
FT                   /locus_tag="Rleg2_5730"
FT   CDS_pept        complement(129691..130743)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5730"
FT                   /product="DNA polymerase LigD, ligase domain protein"
FT                   /note="TIGRFAM: DNA polymerase LigD, ligase domain protein;
FT                   PFAM: ATP dependent DNA ligase domain protein; ATP
FT                   dependent DNA ligase; KEGG: rec:RHECIAT_PA0000196 putative
FT                   ATP-dependent DNA ligase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5730"
FT                   /db_xref="EnsemblGenomes-Tr:ACI58905"
FT                   /db_xref="GOA:B6A3C2"
FT                   /db_xref="InterPro:IPR012309"
FT                   /db_xref="InterPro:IPR012310"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014146"
FT                   /db_xref="UniProtKB/TrEMBL:B6A3C2"
FT                   /protein_id="ACI58905.1"
FT                   /translation="MTRSRRPSLPFLNESNATLQSRPIRKRDPDQPSLPFDPMPARVEP
FT                   CLALLKPKVPIGPDWLYEAKWDGYRLAIHIEPKGVRVITRGGHDWTHRFPTIAAAAKEL
FT                   GVTTGILDGEAVVLDDHGRSDFGALQRSLGGRGGKRASSESILYAFDLLYLDGHDLTGT
FT                   ELAVRRHLLKDLIPEDNRTIRFSEEIDLPAEDLLEHACHHHMEGIIAKHRDRPYSSGRT
FT                   GDWLKIKCVESESFMIVGYEQSAAARGGIGSLLLAGKRGFDWISVGSVGTGFSASDAAQ
FT                   LKKTLDRLKTNRPVVPLKGKRYVFVQPTLIAEIEFRGWTDDGSLRHASYKGLREVQDNA
FT                   AVFDMTGFDR"
FT   gene            complement(130809..130868)
FT                   /pseudo
FT                   /locus_tag="Rleg2_5731"
FT   gene            complement(130876..132081)
FT                   /locus_tag="Rleg2_5732"
FT   CDS_pept        complement(130876..132081)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5732"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   cps:CPS_4013 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5732"
FT                   /db_xref="EnsemblGenomes-Tr:ACI58906"
FT                   /db_xref="GOA:B6A3C3"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B6A3C3"
FT                   /protein_id="ACI58906.1"
FT                   /translation="MARVRIQDNVLVAVMIACVGTCYGFGLSLFPQIIPDMRKDLAFDY
FT                   AFVGTVTGLVQFSTVAFAVLGTWLVHRIGAARTVVASVSLCGLCLSSIPISDNLYVVAG
FT                   LLMVAGATGASTFVPMINLASRVVRAEQRGFAMSLISSAPAFGVLINSALVAAYAGSGH
FT                   WQMVWFLTGAATIALAVVTHILFGRAGLFDSGTSHETLAPTAGGSASLRSIMPWVTLIF
FT                   ALGFINGLMPYPYLTYLSPFLREELGYSVGFASWLWATIGAVGISAGFAIGTISSRLGS
FT                   RYAMLTCYSSFLAAGALVVLEPSMELSILSGVFFSLGFYPIYGLLPAYVSHRATPRVAV
FT                   TVLGICTVFQGIGGTTGNFFGGVIKTSTESFSGIYLAVAVTAAVAAAMTISLPKDQRVQ
FT                   AV"
FT   gene            complement(132392..133576)
FT                   /locus_tag="Rleg2_5733"
FT   CDS_pept        complement(132392..133576)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5733"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   lch:Lcho_4332 major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5733"
FT                   /db_xref="EnsemblGenomes-Tr:ACI58907"
FT                   /db_xref="GOA:B6A3C4"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B6A3C4"
FT                   /protein_id="ACI58907.1"
FT                   /translation="MKIAPQQRIYVCFFLFAVSLGALLSRMPDLQVALGVDKSELGLTL
FT                   IGAAIGALISLTLSSPVIARLGARTTAFITVLGTSALLSLVPWIGAAPVVFCVLFVEGL
FT                   LAGALEINLNVEIDRIEAQLGRGVMNRAHGFWSLGFFVTALVSSVVRQAGISMQLHLAV
FT                   TFVAVLVLGVWAISGMRNAPARTPLNEGKAPLVALPTRSLMPLCVIGIAAFLVEGAGID
FT                   WSAIYMRDVFSVEPFIGGLGLTLFTFCMALARLFVDPLVDRFGPRAVATMLLVLSAIGI
FT                   CAVWGAPHAYVALAGFALMGAGCSAVYPLAVSAAAQRIDRAAHLNVAALGQMTFVVFFL
FT                   APPLLGFIAEHAGIRTSYLVCLPLIIYALFSVKVLAQRRAACDGSVASVRSVNG"
FT   gene            complement(133712..134626)
FT                   /locus_tag="Rleg2_5734"
FT   CDS_pept        complement(133712..134626)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5734"
FT                   /product="Gluconolactonase"
FT                   /EC_number="3.1.1.17"
FT                   /note="PFAM: SMP-30/Gluconolaconase/LRE domain protein;
FT                   KEGG: ret:RHE_PF00485 probable gluconolactonase precursor
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5734"
FT                   /db_xref="EnsemblGenomes-Tr:ACI58908"
FT                   /db_xref="GOA:B6A3C5"
FT                   /db_xref="InterPro:IPR005511"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR013658"
FT                   /db_xref="UniProtKB/TrEMBL:B6A3C5"
FT                   /protein_id="ACI58908.1"
FT                   /translation="MAEASIYEIHDPRFRQLIVTSAALDELYSGCRWAEGPVWFNDANQ
FT                   LLWSDIPNQRMLRWTPESGVSVYRQPSNFANGHTRDRQGRLISCEHGMRRVTRTEIDGS
FT                   ITVLADRFEGVRLNSPNDVVVKSDGTIWFTDPTYGIMSDYEGYRAVPEQPTRNVYRLDP
FT                   ATGGLAAVVTDFIQPNGLAFSPDESILYVADSAASHDESLPRHIRAFDVVDGLRLENGR
FT                   VFCLIDSGIPDGIRTDVNGNLWSSAGDGVHCFDPAGKLIGKIRVPQTVANLTFGGPKRN
FT                   RLFIAATRSIYSVYVAVSGAQMP"
FT   gene            complement(134641..135591)
FT                   /locus_tag="Rleg2_5735"
FT   CDS_pept        complement(134641..135591)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5735"
FT                   /product="inner-membrane translocator"
FT                   /note="PFAM: inner-membrane translocator; KEGG:
FT                   ret:RHE_PF00484 probable sugar ABC transporter, permease
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5735"
FT                   /db_xref="EnsemblGenomes-Tr:ACI58909"
FT                   /db_xref="GOA:B6A3C6"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:B6A3C6"
FT                   /protein_id="ACI58909.1"
FT                   /translation="MTPVLRLFSKPWIWSWLAALTVWFLTIMVTLGASTLGLSQAALTF
FT                   AAFSVIVGLGQMFVITLGPGNIDLSVPATMTLAGTVALKLMNVENGMILPGLLIAIVLG
FT                   LAVGLGNYALIKALRIPPIIATLSMSFIVQSAAIWTNRGLRIKPPGMLAEFTTSNTLGV
FT                   PNVAIVALLISLFAWFLLEKTIYGRWISAIGQSMPAARMAGIPVDGTRFVTYLFCAVLA
FT                   SLAGYLLACFSGGAALNMGSEYLLMSIAVVVIGGTAVAGGDSNVPGIWGASLFMFLVVS
FT                   MLNTYGVGAGIRLIMTGLIIISVIMLAGGRRAGMR"
FT   sig_peptide     complement(135466..135591)
FT                   /locus_tag="Rleg2_5735"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.991) with cleavage site probability 0.616 at
FT                   residue 42"
FT   gene            complement(135588..136535)
FT                   /locus_tag="Rleg2_5736"
FT   CDS_pept        complement(135588..136535)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5736"
FT                   /product="inner-membrane translocator"
FT                   /note="PFAM: inner-membrane translocator; KEGG:
FT                   ret:RHE_PF00483 probable sugar ABC transporter, permease
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5736"
FT                   /db_xref="EnsemblGenomes-Tr:ACI58910"
FT                   /db_xref="GOA:B6A3C7"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:B6A3C7"
FT                   /protein_id="ACI58910.1"
FT                   /translation="MTFRLSSDALRLAIPALSLTLLLAAVFWLQPRAMSYVGLNLLFNL
FT                   AVPIALATIAQMLVMAVNDLDLSMGTFVSFVACVTATFLRDAPLTGILILAGAIAIYAG
FT                   LGVVIHLRNLPSIVVTLGMSFVWGGLAVLLLPAPGGQAPDWVRWLMTVKPPLAPMAIVA
FT                   SIAIAAVAHLLVMRSSLGVLIRGIGGNQRSVERAGWSIVAARAGAYGLAGLFAVLAGIA
FT                   LVGLTTSADANIALRYTLLSIAGVILGGGEFIGGRVSPVGAVIGALTLTLAGSFLSFLR
FT                   ISPDWQIGAQGAILIVVLALRLMLNRLEKREKRR"
FT   sig_peptide     complement(136434..136535)
FT                   /locus_tag="Rleg2_5736"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.958) with cleavage site probability 0.447 at
FT                   residue 34"
FT   gene            complement(136532..137983)
FT                   /locus_tag="Rleg2_5737"
FT   CDS_pept        complement(136532..137983)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5737"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: ret:RHE_PF00482 probable sugar ABC transporter, ATP
FT                   binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5737"
FT                   /db_xref="EnsemblGenomes-Tr:ACI58911"
FT                   /db_xref="GOA:B6A3C8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B6A3C8"
FT                   /protein_id="ACI58911.1"
FT                   /translation="MDEVLKAVIAVDGAKVSFGAVRALDGVTLRVMPGECVGLVGHNGA
FT                   GKSTIVSVINGGLTPHEGSVASDGERLERYGINAARARGVRCVFQELSLCPNLSIVENT
FT                   RIMHRHLGGFGWRRRAAGIIEKSLDAVFPGHGIDSGRAVGDLSIAERQMVEISMAFSDA
FT                   GVAPRLVILDEPTSSLDASLARQMLDHVRRFVAAGGSVIFISHILHEILETSDRIVVMK
FT                   DGRVVAERPADGFDHHGLVEAMGTVAKKETAQRSTRDQSTAPLILSHQTKGLPFTARKG
FT                   EIIALAGLAGHGQTELLLALHAAQSSNWLPERDPLVTFVAGDRRLNGVFELWSILRNFS
FT                   IASLGDLTRRGLILANDEETKGADWKRRIEIRTPDMANRILSLSGGNQQKVLFARALAT
FT                   RAPIVLMDDPMRGVDVGTKQEVYAIIREEAAHGRTFIWYSTEMDEVRLCDRVYVFREGR
FT                   ITAELAGDAVNETNIIAASFEGVAA"
FT   gene            complement(138056..139072)
FT                   /locus_tag="Rleg2_5738"
FT   CDS_pept        complement(138056..139072)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5738"
FT                   /product="putative sugar ABC transporter, substrate-binding
FT                   protein"
FT                   /note="KEGG: ret:RHE_PF00481 probable sugar ABC
FT                   transporter, substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5738"
FT                   /db_xref="EnsemblGenomes-Tr:ACI58912"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:B6A3C9"
FT                   /protein_id="ACI58912.1"
FT                   /translation="MTIRKMLLASAAIACAAMPVSAFADTSAKKIALSNNYAGNSWRQA
FT                   MLTSWGKVTGEAVKAGTVAAADPFTTAENQATEQAAQIQNMILQGYDAIVLNAASPTAL
FT                   NGAVKEACDAGITVVSFDGIVTEPCAWRIAVNFKEMGRSEVEYLSKKLPEGGNLLEIRG
FT                   LAGVFVDDEISAGIHDGVKQYPQFKVVGSVHGDWAQDVAQKAVAGILPSLPDIVGVVTQ
FT                   GGDGYGAAQAIAATDRKMPTIIMGNREDELKWWKEQKDGKGYETMSVSIAPGVSTLAFW
FT                   VAQQILDGKEVKKDLVVPFLRIDQDNLETNLANTQAGGVANVEYTQADAIKVIESAK"
FT   sig_peptide     complement(138998..139072)
FT                   /locus_tag="Rleg2_5738"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.997 at
FT                   residue 25"
FT   gene            139352..140590
FT                   /locus_tag="Rleg2_5739"
FT   CDS_pept        139352..140590
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5739"
FT                   /product="putative signal transduction histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   KEGG: ret:RHE_PF00480 probable two-component sensor
FT                   histidine kinase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5739"
FT                   /db_xref="EnsemblGenomes-Tr:ACI58913"
FT                   /db_xref="GOA:B6A3D0"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B6A3D0"
FT                   /protein_id="ACI58913.1"
FT                   /translation="MLQLTPAAMFDHYLGISRLLAGQLDFRSAIRSVAAEVAHIIPHDH
FT                   LDVCVLLEGGNYHTAYETGIETAWGDLAGAPVVNSPIRSLLWGEVEFLLAEDAMTDPRF
FT                   HFEGAFKRPIVEESLRSRLHVPMKVQGTIIAALSCSSRTAGVYTMEDIERARIIADLLT
FT                   PYFFALQAAEQAQRSAIVEAEARAREEGLRQGALKLTEALEQERQRIGMDLHDQTLADL
FT                   TRLARRIDRLSRNGEVTPEALEPVSRSLQHCMQDLRQIIEQAKPSVLQLFGLAQAIEHH
FT                   LDRSTRDTGQAIEWGLVDETHGALERLEPTVSVALFRIAQEAINNAVRHAAPLAVTVRL
FT                   EADEERLSIEISDDGTGLAKARGRIGGGIDNMKTRARLISARFTTGPGHNNRGTVVRVV
FT                   LPLTPPDPASGPD"
FT   gene            140604..141326
FT                   /locus_tag="Rleg2_5740"
FT   CDS_pept        140604..141326
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5740"
FT                   /product="two component transcriptional regulator, LuxR
FT                   family"
FT                   /note="PFAM: response regulator receiver; SMART: regulatory
FT                   protein LuxR; KEGG: ret:RHE_PF00479 probable two-component
FT                   response regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5740"
FT                   /db_xref="EnsemblGenomes-Tr:ACI58914"
FT                   /db_xref="GOA:B6A3D1"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:B6A3D1"
FT                   /protein_id="ACI58914.1"
FT                   /translation="MKVLIVEDDPLHRSYLHEAVNAALPECDTVIEAENGTVGEKLARD
FT                   HKSAHIVMDLQMTSRNGIEAARTIWKERPETRILFWSNYSDEAYVRGVSRIVPDGAAYG
FT                   YVLKSASDERLKLALRSIFIESQCVIDREVRGLQQKSLGQTNGFTDSEYEILVDIALGL
FT                   TDRAIAKRRGLSLRSVQNRLQQLYDKLDVYQSAGDDHEDGRFNLRARAVTVAFLRKLLN
FT                   YSALERADAELQEWLDGK"
FT   gene            complement(141363..143687)
FT                   /locus_tag="Rleg2_5741"
FT   CDS_pept        complement(141363..143687)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5741"
FT                   /product="diguanylate cyclase/phosphodiesterase"
FT                   /note="TIGRFAM: diguanylate cyclase; PFAM: GGDEF domain
FT                   containing protein; EAL domain protein; MHYT domain
FT                   protein; KEGG: rec:RHECIAT_CH0000188 putative sensory
FT                   box/GGDEF family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5741"
FT                   /db_xref="EnsemblGenomes-Tr:ACI58915"
FT                   /db_xref="GOA:B6A3D2"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR005330"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:B6A3D2"
FT                   /protein_id="ACI58915.1"
FT                   /translation="MFTVLSCIADQHDWTLLFVALSICCFGSLTAVFMLTRAQECVQQH
FT                   HHYWLIAAAVVLGASTWATHFIAMLAYAGPVPIGYDGPLIILSIIAAIVLFAGAVEIAF
FT                   MNGGQLVQASGGVLFGVAIAAMHFVGLLAITPFSMVSLALDKSIVACALAIGFGIVAVA
FT                   ALRHSASRRFHIFAGAACIVLAICSLHTVSMSGVQITPSAEPVHADLSSVDRIAIAIAV
FT                   SIISTLILLGAAAALFLDRHLTDLRGLANASFEGLVIAQENVVIDLNEKFAAMAGKAAA
FT                   LLKGQPVEAVLAIERRLGIDTCQGAVLCDGQDTIPVEILARTIEYRGRECQVIAVRDLT
FT                   ERHEASRRIEHMARHDSLTGLANRREFDQRFEMAMARAAETPSGLALLALDLDRFKLVN
FT                   DTFGHAEGDAVLQRVAQVLLRTLPADVTIARMGGDEFCIILENASRQQTEALSADLQHA
FT                   FAQEFADLATSSGFGASIGIALYPEHGVTDRRLRNNADMALYRAKSGGRGRACTFEAAM
FT                   DIELHAKRQLEHDLRHAVAKGELFLVYQRIVDTSSQEPCGYEALLRWRHASRGVLAPAD
FT                   FIAAAEESGCIIPIGIWVLEEACSEAASWRTPLTIAVNISPVQFLMPNLVEQFSHILAK
FT                   TGLQPDRLELEITETALFHDRAAVLSTLGQLRAMGIRVVLDDFGTGYSSLANLRDFPFD
FT                   KLKIDRRFLAGIGADPTIRALFENVIEMASTLNLPVIAEGVETQEQLAILHASHPAQMQ
FT                   GFLFGKPEAAPSSRAPLKAIA"
FT   gene            complement(143888..144709)
FT                   /locus_tag="Rleg2_5742"
FT   CDS_pept        complement(143888..144709)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5742"
FT                   /product="protein of unknown function DUF1206"
FT                   /note="PFAM: protein of unknown function DUF1206; KEGG:
FT                   rec:RHECIAT_PC0000073 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5742"
FT                   /db_xref="EnsemblGenomes-Tr:ACI58916"
FT                   /db_xref="GOA:B6A3D3"
FT                   /db_xref="InterPro:IPR009597"
FT                   /db_xref="UniProtKB/TrEMBL:B6A3D3"
FT                   /protein_id="ACI58916.1"
FT                   /translation="MSKGFRFDVLAKGGYTARGVVFLLIAGLALFSGVAGGRPETKSAL
FT                   STLLSQPFGRIWVGMIGLGLLGFVAWRLAQSLADSDGHGRNGKALAIRAALLGSAVTYL
FT                   GLAGYALSRAIFLGGGSEGSGEKGLAGWIMSQPFGSYLAIAVGAGFVIGGIVTVAKGVT
FT                   RKFERYVKIPDSKGIVTLICVYGLVARGVVFAITGILFAYAGFRVDPQQAGSMGDALEW
FT                   VRQLPFGSFLYIAVAAGLAAFGIYNLVEARYRVISNPSLADARRSIPLTGS"
FT   sig_peptide     complement(144596..144709)
FT                   /locus_tag="Rleg2_5742"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.719) with cleavage site probability 0.690 at
FT                   residue 38"
FT   gene            complement(145054..146103)
FT                   /locus_tag="Rleg2_5743"
FT   CDS_pept        complement(145054..146103)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5743"
FT                   /product="transcriptional regulator, LacI family"
FT                   /EC_number="5.1.1.1"
FT                   /note="PFAM: regulatory protein LacI; periplasmic binding
FT                   protein/LacI transcriptional regulator; KEGG:
FT                   ret:RHE_PE00360 putative transcriptional regulator protein,
FT                   LacI family"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5743"
FT                   /db_xref="EnsemblGenomes-Tr:ACI58917"
FT                   /db_xref="GOA:B6A3D4"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:B6A3D4"
FT                   /protein_id="ACI58917.1"
FT                   /translation="MVSIVSVAKAAGVSNKTVSRVINGEPYVTEETRERVEKAIRDLGY
FT                   VPNMAARLIRSNRSNTFGIITDYVSTTPYSVDIVRGIQDWANANGKTILIANTGGSSER
FT                   EVEIWKMFQSHRIDGVLYVTMYRRIVDPETGDVSIPTVMINCRQQTRELLPSIEPDDYQ
FT                   GARDLTRYLLERGHRRIGYIRLNPILLGAELRLDAFRRTTSEFGLTESDLSISLGMDGP
FT                   VGAENNYVFAAATEMLKQDDRPTAIMSGNDEMAIQIYIAAMALGLRIPQDVSIVGFDDF
FT                   RTVTMALKPELTTAALPYYDLGRDGAKWLNDLIGGEKIYPGSRVISCKLVERSSAAFGP
FT                   RQASRSSTA"
FT   gene            146275..147534
FT                   /locus_tag="Rleg2_5744"
FT   CDS_pept        146275..147534
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5744"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   KEGG: ret:RHE_PE00359 probable sugar ABC transporter,
FT                   substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5744"
FT                   /db_xref="EnsemblGenomes-Tr:ACI58918"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:B6A3D5"
FT                   /protein_id="ACI58918.1"
FT                   /translation="MKKLLGASALALVCIAASAKAETINILVEGGGEMLQKAAAEKFTA
FT                   ETGIKVNFTVVPYQGVFDKFSAEIASGSSAFDVVTIDVVWNAKFASHVEDLAPLFTDTV
FT                   RKDLPPALLADAKIGDKLIGMPAWANAEIVFYRKDLFDKPEEQKAFQAKYGYPLAPPQT
FT                   WQQWRDIAKFFTRDTDGDGKADFWGTDTIGSFSEEWMAHVLQAGSPGVILDKDGKVIID
FT                   NEAHKKALEFYIAPHCIDHSVPENVNEIGWGEAQNLFYQGKTAMMKFWAHAYKMTPTDS
FT                   KVSGKVGVVPMLAGDAGIAAIPGPWYNVIPSTSQHKDAAKKFIAFAIANNALGIEAPLG
FT                   LAATNSAYNSYASKPGYEHFTPLLETLHAPATQGRPMNEKYQEIVDEAVLPAVQQALTC
FT                   KADVGKVLTDAKETIEDILD"
FT   sig_peptide     146275..146340
FT                   /locus_tag="Rleg2_5744"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.895 at
FT                   residue 22"
FT   gene            147595..148476
FT                   /locus_tag="Rleg2_5745"
FT   CDS_pept        147595..148476
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5745"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: ret:RHE_PE00358 probable
FT                   sugar ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5745"
FT                   /db_xref="EnsemblGenomes-Tr:ACI58919"
FT                   /db_xref="GOA:B6A3D6"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B6A3D6"
FT                   /protein_id="ACI58919.1"
FT                   /translation="MSGEDRFVLCMLAPALAILGVLVAYPVGLLVFDSFFKVDTITPHI
FT                   REWIGLKNYIDALTSKRVAESAFRTIQYSIFALFFEFTFGFCAALLFSALPGHSRWHRT
FT                   IFTLPLMVPPIVAGLLWRFLLVGNIGILNYGLVHLGVISDPDAIAWLSDEDIVIYSVSF
FT                   ADIWLTTSFVALVSYAGLTNIPKDLLEAARIDGANAFKRFWHVTLPLMRPVIAVVVIVR
FT                   GVDAAKTFDLIWIQTQGGPNHASEVFSMNIYQRMVRFGDLGEASASGTLFLIVMMLLAA
FT                   AAYWKIWRPVHA"
FT   sig_peptide     147595..147669
FT                   /locus_tag="Rleg2_5745"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.720) with cleavage site probability 0.673 at
FT                   residue 25"
FT   gene            148469..149305
FT                   /locus_tag="Rleg2_5746"
FT   CDS_pept        148469..149305
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5746"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: ret:RHE_PE00357 probable
FT                   sugar ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5746"
FT                   /db_xref="EnsemblGenomes-Tr:ACI58920"
FT                   /db_xref="GOA:B6A3D7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B6A3D7"
FT                   /protein_id="ACI58920.1"
FT                   /translation="MLSARRLNFNGMVINAAALVLVLSYALPYIYLLMTSIKPAADVQQ
FT                   IPPSFFPAVISFENFRDVLQSSTLPRAFASSLTVAVLTTILSLAAAVPAAYVATQYRRR
FT                   ITTLFLLFALVTRMVPSVSLGVPLFQLLKSLGLLDTVPGLVLAHTSAAVPLALLLMAAF
FT                   FEGVPKDLEEAARMDGCTRFQAFLKVILPIMTGGIAVTALFTFITSWNEFLYALLLTSE
FT                   ATKTAPIVIAEYNSVYGLAWGAMTAAAVLYSLPVIIITLALQKQIVGGLTFGAVKG"
FT   sig_peptide     148469..148549
FT                   /locus_tag="Rleg2_5746"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.640) with cleavage site probability 0.597 at
FT                   residue 27"
FT   gene            149319..150461
FT                   /locus_tag="Rleg2_5747"
FT   CDS_pept        149319..150461
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5747"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: ret:RHE_PE00356 probable sugar ABC transporter,
FT                   ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5747"
FT                   /db_xref="EnsemblGenomes-Tr:ACI58921"
FT                   /db_xref="GOA:B6A3D8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040582"
FT                   /db_xref="UniProtKB/TrEMBL:B6A3D8"
FT                   /protein_id="ACI58921.1"
FT                   /translation="MADIELRNVNKIYGNNFHALHDLNFNIRDGEFMVFVGPSGCGKST
FT                   ALRMIAGLESISSGELRIGDRVVNDVDPKDRDIAMVFQSYALYPHKTVRENIAFPLLMA
FT                   GLPKSDIASRVDEAARILELTALLDRKPALLSGGQRQRVAMGRAIVRQPSAFLMDEPLS
FT                   NLDAKLRVQMRAEIASLQRKLNVTTIYVTHDQVEAMTMGDRVAVMKGGVLQQVDTPQNL
FT                   YGRPDNVFVAAFIGSPSMNLYEAVLNGRTVTLGSNSFEIPDRVFECRPSLNGASNRQIL
FT                   LGIRPEHMNDAAIRPSSAEISAPVTLVEALGSESMVHLNIDAPWVDAGDPDAIADIGDE
FT                   KAAVARFSPKSTARAGDIARIAVDAEELHFFDPDTRTSIW"
FT   gene            150515..151876
FT                   /locus_tag="Rleg2_5748"
FT   CDS_pept        150515..151876
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5748"
FT                   /product="Inulin fructotransferase (DFA-I-forming)"
FT                   /EC_number="4.2.2.17"
FT                   /note="KEGG: ret:RHE_PE00355 putative inulin
FT                   fructotransferase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5748"
FT                   /db_xref="EnsemblGenomes-Tr:ACI58922"
FT                   /db_xref="GOA:B6A3D9"
FT                   /db_xref="InterPro:IPR007742"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="UniProtKB/TrEMBL:B6A3D9"
FT                   /protein_id="ACI58922.1"
FT                   /translation="MVGENCYDVTKYPAGNPREDIGAVINSIIADIKNRQAVADVNDGG
FT                   KPGSVIYIPPGDYRLVTQVVIDVSYLKIVGSGHGFTSSSIRFNTPASELAHWHEVWPGG
FT                   SRILVDTSPEAADGEAAGAAFYVKRGGNPRISSVEFADFCIDGLHFIDDGSGQNDAENT
FT                   YRNGKTGIYVGSANDSFRITGMGLIYLEHGVTVHDADALAIDNNFIAECGNCIELKGMG
FT                   QASRIANNFVGAGYRGHSIYAENYAGILVSSNNVFPRGASSVHFSGVVRSSVTGNRFHS
FT                   FYPGMLVFAANCCENLVSSNHFLRDREPWAPMQKYDNGLDDLFGLLQIDGSNNSLIANH
FT                   ISETIDTKYIKPPEVKPVIINVVSGSGNYIASNHIVATAEISQKDKSDAPNSACFSTQV
FT                   SALLSTGNSTLLDVTTVLVQKESVRNTVLDSGNDEQVVMDRTVNAFRGTPVPGQ"
FT   gene            151990..153651
FT                   /locus_tag="Rleg2_5749"
FT   CDS_pept        151990..153651
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5749"
FT                   /product="Beta-fructofuranosidase"
FT                   /EC_number="3.2.1.26"
FT                   /note="KEGG: ret:RHE_PE00354 putative
FT                   beta-fructofuranosidase protein; PFAM: Glycosyl hydrolase
FT                   family 32 domain protein; SMART: glycoside hydrolase family
FT                   32"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5749"
FT                   /db_xref="EnsemblGenomes-Tr:ACI58923"
FT                   /db_xref="GOA:B6A3E0"
FT                   /db_xref="InterPro:IPR001362"
FT                   /db_xref="InterPro:IPR013148"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="InterPro:IPR023296"
FT                   /db_xref="UniProtKB/TrEMBL:B6A3E0"
FT                   /protein_id="ACI58923.1"
FT                   /translation="MAKATVSFASGERLEFWASGPGAVTISHYGEILWHVPVFETHPSY
FT                   YSYHHREAGSVVVEWDRPEAFLWAYAYDPATVAEAGIKLWEFSTDEILIRAGKEIDTWL
FT                   RSDPGRPRIHFSPCRNWMNDPVGLCRIGDCWHLFYQFHPCGGDWGPMHWGHATSPDLFT
FT                   WTHMPVFLHPEQNLWRLGATGGAFSGNAFHDRDGSLMFFYTERLPAYDLFKGYREIQKI
FT                   ARPDRRMIKAESISTVLEQRPEGVEHDFRDPKVWWDEASGAYRMVLGASLHGDPAVLLY
FT                   GSEDLLEWKYLGPLYRAPPFFREQGARAIECPDFFPIDGKWVLIMGFVGHRDPDSGRHN
FT                   LLYGLVGGFIDDRFLPDSDALQLLDFGSDFYAMQTFATGGRQIAFAWLFNWEFRKPAGS
FT                   PYSGELSLPRQLSLDARKRICMRPADEVEAALTHAPLSSAEPGRYVLDEVSIDIRLNGI
FT                   LDGTRITATEAGQLSFSIVVEDQNVSVQLPHDDGSIRYAAAIADATDLRVIHDKGILEI
FT                   FADGGAVCGTRRNYLNVRPDTLVIMSKAHVSVFSGE"
FT   gene            complement(153778..154185)
FT                   /locus_tag="Rleg2_5750"
FT   CDS_pept        complement(153778..154185)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5750"
FT                   /product="alkylhydroperoxidase like protein, AhpD family"
FT                   /note="TIGRFAM: alkylhydroperoxidase like protein, AhpD
FT                   family; PFAM: Carboxymuconolactone decarboxylase; KEGG:
FT                   ret:RHE_PE00353 putative carboxymuconolactone decarboxylase
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5750"
FT                   /db_xref="EnsemblGenomes-Tr:ACI58924"
FT                   /db_xref="GOA:B6A3E1"
FT                   /db_xref="InterPro:IPR003779"
FT                   /db_xref="InterPro:IPR004675"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="UniProtKB/TrEMBL:B6A3E1"
FT                   /protein_id="ACI58924.1"
FT                   /translation="MATVKLLSDQEAAAIPAVQAVFDDIRATRKTDFINNFWRALANDP
FT                   ANLKRVWETLKSVMTVEGALDPLTREMIYIAVSTANACQYCVQSHTAAARARGMTDAQH
FT                   GELLTIIGLAAQTNHLALAMQVPPDPEFEVR"
FT   gene            154475..155404
FT                   /locus_tag="Rleg2_5751"
FT   CDS_pept        154475..155404
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5751"
FT                   /product="Taurine dioxygenase"
FT                   /EC_number="1.14.11.17"
FT                   /note="PFAM: Taurine catabolism dioxygenase TauD/TfdA;
FT                   KEGG: ret:RHE_PE00352 putative taurine dioxygenase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5751"
FT                   /db_xref="EnsemblGenomes-Tr:ACI58925"
FT                   /db_xref="GOA:B6A3E2"
FT                   /db_xref="InterPro:IPR003819"
FT                   /db_xref="InterPro:IPR042098"
FT                   /db_xref="UniProtKB/TrEMBL:B6A3E2"
FT                   /protein_id="ACI58925.1"
FT                   /translation="MSNPVLVNQIIPESDVIPLTGRVGAEIKGVRLGGDLSDATVAAIN
FT                   QLLLKHKVIFFRDQGHLEDSEQEAFARRLGDLVPHPTQGPVAGTASILNLDSSRGGGRA
FT                   DQWHTDVTFVDAYPKFSVLRGVVIPAAGGDTIWSNTHAAYESLPAPLKLLAENLWAIHS
FT                   NAYDYAAVRPRATAEEKKHFEEVFTSTIYETEHPVVRVHPETGERSLLLGNFVQRLVGL
FT                   SKSDSAKLYEVFQSYVTAPENTVRWRWRAGDVAIWDNRATQHYAVNDYGDQHRVVRRAT
FT                   VDGDVPVSIDGRRSITHVKTAKPQAKAA"
FT   gene            complement(155509..156936)
FT                   /locus_tag="Rleg2_5752"
FT   CDS_pept        complement(155509..156936)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5752"
FT                   /product="aspartate ammonia-lyase"
FT                   /note="TIGRFAM: aspartate ammonia-lyase; PFAM: fumarate
FT                   lyase; KEGG: rec:RHECIAT_PA0000281 aspartate ammonia-lyase
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5752"
FT                   /db_xref="EnsemblGenomes-Tr:ACI58926"
FT                   /db_xref="GOA:B6A3E3"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR004708"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR018951"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="UniProtKB/TrEMBL:B6A3E3"
FT                   /protein_id="ACI58926.1"
FT                   /translation="MTKSEITTIRVEHDLIGDRDVPATAYYGVHTLRAVENFPITGQTL
FT                   KESADLIASLAAIKQAAAQANASLGLLDQERADAIIAACVEIRDGALHDHFVVDLIQGG
FT                   AGTSTNMNANEVIANRALEIMGYGRGEYQHLHPNEHVNLSQSTNDVYPTALKLAAWIGV
FT                   HRLVDAMAILRRAFEAKAVEFADVLKMGRTQLQDAVPMTLGQEFGTYALMLAEDEARLS
FT                   EAVSLIREINLGATAIGTGITAHPRYAALVRERLSEIVGVDLVTSPDLVEATQDCGSFV
FT                   QLSGVLKRVAVKLSKTCNDLRLLSSGPRAGFNEINLPARQAGSSIMPGKVNPVIPEVVN
FT                   QVAFEVIGNDVTITMAAEAGQLQLNAFEPVIFYSLYRSLSHLTNACLTLEANCIQGITA
FT                   NRDRLRQTVEQSIGIVTALNPYIGYRNATEVALEAHHSGRGVYEILLERGLMQKEHLDA
FT                   VLRPETLTRPSEKLSFS"
FT   gene            complement(157037..158140)
FT                   /locus_tag="Rleg2_5753"
FT   CDS_pept        complement(157037..158140)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5753"
FT                   /product="L-asparaginase II"
FT                   /note="PFAM: L-asparaginase II; KEGG: rec:RHECIAT_PA0000280
FT                   L-asparaginase II protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5753"
FT                   /db_xref="EnsemblGenomes-Tr:ACI58927"
FT                   /db_xref="InterPro:IPR010349"
FT                   /db_xref="UniProtKB/TrEMBL:B6A3E4"
FT                   /protein_id="ACI58927.1"
FT                   /translation="MTPSEDFVVTDRGGIVENSHRVHAAVVDAKGRRLYALGNPERMML
FT                   ARSAAKPAQALAILETEGFAGYGFDDADIALMCASHSSEERHIARTRTMLSKIKAEEAD
FT                   LRCGGHPSLSETVNRSWIKQDFVPTAVCSNCSGKHVGMLAGARAIGAGMEGYHLPDHPM
FT                   QGRVKRTVAELCDLDVRDVEWGIDGCNLPTPAFPLDRLARIYAKLAAAADGDGAGEGPS
FT                   TRGAALARIFHAMAHHPDMVAGEGRYCTALMRAFNGAVIGKLGADASYAIGVRASDETR
FT                   RLGTDGALGISVKIEDGNLEILYAVVMEILERLGIGSPEIRSQLAPFHHPQRVNTMGVT
FT                   TGGVSFPFKMRGSKADGDDPRLAALAR"
FT   gene            complement(158212..159684)
FT                   /locus_tag="Rleg2_5754"
FT   CDS_pept        complement(158212..159684)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5754"
FT                   /product="amino acid permease-associated region"
FT                   /note="PFAM: amino acid permease-associated region; KEGG:
FT                   ret:RHE_PE00349 L-asparagine permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5754"
FT                   /db_xref="EnsemblGenomes-Tr:ACI58928"
FT                   /db_xref="GOA:B6A3E5"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004840"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniProtKB/TrEMBL:B6A3E5"
FT                   /protein_id="ACI58928.1"
FT                   /translation="MTVMESNRTEAEGQVFAEEDLGYHKALKPRQIQMIAIGGAIGTGL
FT                   FLGAGGRLAAAGPALVLVYALCGFFAFLVLRALGELIVHRPTSGSFVSYAREFYGEKLA
FT                   FAVGWLYWLTWAMTAVADVTAVALYMNFFKAYVPWIAMIDQWVFALAALVLVLAMNLLS
FT                   VKVFGELEFWFSLVKVLALVVFLVVGVYFVVTGTPIDGHVPGLNTITDFGGMFPNSVLP
FT                   ALVVIQGVVFAYASIELIGTAAGETENARKVMPRAIRTVVLRLVVFYVGSVLLLSLLLP
FT                   YTAYKGGESPFVTFFGKIGIQGADVVMNLVVLTAVLSSLNAGLYSTGRILHSMAISGSA
FT                   PAALAKMNRSGVPYGGIAVTAVVTAFGVVLNALVPAEAFEIGLNVAALGIIAAWGVIVL
FT                   CQLKLWQLSRQGKMVRPEFRMFGAPYTGLLTLGFLAVVVILMALDYPVGTYTVASLALI
FT                   IPALVVGWLLMRERIYTIAAERGEDRGGFDLA"
FT   gene            complement(159829..160533)
FT                   /locus_tag="Rleg2_5755"
FT   CDS_pept        complement(159829..160533)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5755"
FT                   /product="GntR domain protein"
FT                   /note="PFAM: regulatory protein GntR HTH; GntR domain
FT                   protein; KEGG: rec:RHECIAT_PA0000278 L-asparagine operon
FT                   transcriptional regulator protein (repressor), GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5755"
FT                   /db_xref="EnsemblGenomes-Tr:ACI58929"
FT                   /db_xref="GOA:B6A3E6"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B6A3E6"
FT                   /protein_id="ACI58929.1"
FT                   /translation="MNDLENWLSDSAILSRKSASELVFEELRNLILSGRFAEGSKLPSE
FT                   AKLAAKYGVSRPIVREALRSLQILGLTETRTGSGTYVLAAGGGDIRYGDYSARDLMEAR
FT                   PFVEVSAAGWAALRRDDDELSRLLGLCDRMEQEEDTEAWVRLDSDFHGLIAEASKNAVF
FT                   RDIVDDVREAMAQQSGLLTVLGPRRQESNEEHRAIVEAIRRGSEAEARAAMEIHLKQVE
FT                   AAVSRIIGSEQR"
FT   gene            complement(160585..161295)
FT                   /locus_tag="Rleg2_5756"
FT   CDS_pept        complement(160585..161295)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5756"
FT                   /product="GntR domain protein"
FT                   /note="PFAM: regulatory protein GntR HTH; GntR domain
FT                   protein; KEGG: ret:RHE_PE00347 putative L-asparagine operon
FT                   transcriptional regulator (repressor) protein, GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5756"
FT                   /db_xref="EnsemblGenomes-Tr:ACI58930"
FT                   /db_xref="GOA:B6A3E7"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B6A3E7"
FT                   /protein_id="ACI58930.1"
FT                   /translation="MGSWLSEKQEIHRRNAAEAVFEDVRTAIVDRKLALGTRLPSEVQL
FT                   AERYGISRAIVREALRSLQTLGFTQTKTGRGTFVVSESPARQLGGGAYSARDLIEARPC
FT                   IEIPAAGWAALRRSKEQLASLSSLCDRMDDEEDVRTWVRMDAAFHGEIAEASGNAIFRK
FT                   VVADVRGALSTQSELVEHVRGRRKASNAEHRRILEAVAAGTEEDARVAMAEHLLEVKRS
FT                   IIGIADERRTAPKV"
FT   gene            complement(161399..162220)
FT                   /locus_tag="Rleg2_5757"
FT   CDS_pept        complement(161399..162220)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5757"
FT                   /product="allantoin catabolism protein"
FT                   /note="TIGRFAM: allantoin catabolism protein; PFAM: protein
FT                   of unknown function DUF861 cupin_3; Cupin 2 conserved
FT                   barrel domain protein; KEGG: rec:RHECIAT_PA0000276
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5757"
FT                   /db_xref="EnsemblGenomes-Tr:ACI58931"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR017627"
FT                   /db_xref="UniProtKB/TrEMBL:B6A3E8"
FT                   /protein_id="ACI58931.1"
FT                   /translation="MDKTEYYSKLGGLPPQTQLLSGKAVFTTAYAVIPRGVMSDIVTSL
FT                   LPHWTGTRAWVLSRPLSGFSETFSQYVMEVQPGGGSDRPEPDKRAEAVLFVVEGGMTVE
FT                   LEGVSHTLRAGSFAYLPAGSVWRLKNDGSAPAIFHWIRKAFQEVEGLEPPPAIVTHEDE
FT                   HPAAAMPDTDGRWGTTRFIDPADVRYDMHVTIVTLEPGAVIPFMETHVMEHGLYVLEGK
FT                   AVYRLNEDWVEVEAGDFMWLRAFCPQACYAGGPGRFRYLLYKDVNRHMKLW"
FT   gene            complement(162305..164140)
FT                   /locus_tag="Rleg2_5758"
FT   CDS_pept        complement(162305..164140)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5758"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related;
FT                   Oligopeptide/dipeptide ABC transporter domain protein;
FT                   SMART: AAA ATPase; KEGG: rec:RHECIAT_PA0000275 putative
FT                   peptide ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5758"
FT                   /db_xref="EnsemblGenomes-Tr:ACI58932"
FT                   /db_xref="GOA:B6A3E9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B6A3E9"
FT                   /protein_id="ACI58932.1"
FT                   /translation="MGIVQAQSIETASTVLSVEGLTTSFLVDGAWKPVVRDVSFTVAPG
FT                   ETVAIVGESGSGKSVTSLSIMRLLQADMSRIEGRVTLGGRDLLALPEPAMRQVRGNEVA
FT                   MIFQEPMTSLNPLFTIGDQISEALLCHSAMSRADARAETIRLLEKVRIPSAASRFDEYP
FT                   HRFSGGMRQRVMIAMALASRPKLLIADEPTTALDVTIQGQILDLIKMLQEEEGTSVLFI
FT                   THDMGVVAEIADRTVVMYRGEQVESGITADIFHRGKHPYTRALLSAVPVLGSMQGRQRP
FT                   LRFPVVNTATGQSDSPAEAADTVAPTPVLEVKNLTKRFDIHSGLFNRLTSRVHAVENVS
FT                   FDLHAGETLSLVGESGCGKSTTGRAIMRLIEPQAGSVLVEGREVLGLDRKDLREMRKSV
FT                   QMIFQDPFASLNPRMTVGAAIAEPYLEHRMGSAREAREVVADLLVKVGLSPDMAARYPH
FT                   EFSGGQRQRICIARALALQPKVIVADESVSALDVSIKAQVINLMLDLQQSLNLAFLFIS
FT                   HDMAVVERVSHRVAVMYLGEIVEIGPRAAVFENPQHPYTKKLIAAVPVPDPDRRHEKRM
FT                   VANDEIKSPMRSVDYQPPATVYREVGPGHLVMADR"
FT   gene            complement(164162..165358)
FT                   /locus_tag="Rleg2_5759"
FT   CDS_pept        complement(164162..165358)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5759"
FT                   /product="pyridoxal phosphate-dependent enzyme"
FT                   /note="TIGRFAM: pyridoxal phosphate-dependent enzyme; PFAM:
FT                   Cys/Met metabolism pyridoxal-phosphate-dependent protein;
FT                   aromatic amino acid beta-eliminating lyase/threonine
FT                   aldolase; L-seryl-tRNA selenium transferase; KEGG:
FT                   rec:RHECIAT_PA0000274 L-seryl-tRNA(sec) selenium
FT                   transferase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5759"
FT                   /db_xref="EnsemblGenomes-Tr:ACI58933"
FT                   /db_xref="GOA:B6A3F0"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR018319"
FT                   /db_xref="UniProtKB/TrEMBL:B6A3F0"
FT                   /protein_id="ACI58933.1"
FT                   /translation="MPNDIRPSLGLRPVINVSGTMTSLGASIVVPEAIEAMASILPHFV
FT                   EINDLQRKASAVIARLTGGEAGFVTASCSAGISLAVAGAITGDNLLAIEKLPDAVSEKN
FT                   EVLVQMGHVVSYGAPVDQAIRLAGGKVVLVGQATSTHRFHMEKAITDKTAAAVFVVSHH
FT                   VVDYGLLNLKEFVEIAHARGVPVIVDAASEYDLRIFLEQGADIALYSGHKFLGGPTSGI
FT                   VAGRKELVRHAFLQNMGIGRGMKVGKESIFGVMAALEAWEKRDHAGIRERETSSLNLWK
FT                   RTLDGRPGVSALIEPDPTNNPLDRLRLIVDPEQAHITAWDLADALARGDPPIIVRDHEV
FT                   EHRYFYLDPCNLHPGQDVIVANRLAEELDKARASNEIIATPIENRSRHRFDGVLRWPD"
FT   gene            complement(165428..165925)
FT                   /locus_tag="Rleg2_5760"
FT   CDS_pept        complement(165428..165925)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5760"
FT                   /product="Endoribonuclease L-PSP"
FT                   /note="PFAM: Endoribonuclease L-PSP; KEGG: ret:RHE_PE00343
FT                   putative translation initiation inhibitor protein, YjgF
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5760"
FT                   /db_xref="EnsemblGenomes-Tr:ACI58934"
FT                   /db_xref="InterPro:IPR013813"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:B6A3F1"
FT                   /protein_id="ACI58934.1"
FT                   /translation="MNQFPNAAGKVENSPYQRLAALGIKLPPPPPPIANFVTHVVEGNM
FT                   LYLSGQGPREADGFLHAGKVGANVGVDEAYRHARLTGINLLAVMHDALGDLSRVKRVVK
FT                   LLGMVNAVPEFEDHPSVINGCSDLLIAVFGAAGEHARSAVGFGSLPGNITVEIEAIVAL
FT                   NG"
FT   gene            complement(165980..166849)
FT                   /locus_tag="Rleg2_5761"
FT   CDS_pept        complement(165980..166849)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5761"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: rec:RHECIAT_PA0000272
FT                   probable peptide ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5761"
FT                   /db_xref="EnsemblGenomes-Tr:ACI58935"
FT                   /db_xref="GOA:B6A3F2"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR025966"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B6A3F2"
FT                   /protein_id="ACI58935.1"
FT                   /translation="MADIAIKSAESEGSKFVRRLLKRKTVAFGLLILAIFVLLAVFAPV
FT                   VAPYSPSKLSIVNRLKPPGGAFFFGTDEFGRDVFSRTIFAGRLSLLVGVAVVSLSAVIG
FT                   VTLGLLAGFFQKLDTPIARLIDAMMAFPDILLAIALVAALGPSLTTVIIALSIVYAPRL
FT                   ARIVRASTLVIRELPYVEAARALGISTFHIMIRHVLRNLLSPILVQATFLFASAMLAEA
FT                   GLSFLGLGVSPEIPTWGTMIAAGRQYIGQADWMTLFPGVAIILSVLSLQMVGDGLRDML
FT                   DPRLRKDL"
FT   gene            complement(166849..167790)
FT                   /locus_tag="Rleg2_5762"
FT   CDS_pept        complement(166849..167790)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5762"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: ret:RHE_PE00341 probable
FT                   peptide ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5762"
FT                   /db_xref="EnsemblGenomes-Tr:ACI58936"
FT                   /db_xref="GOA:B6A3F3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B6A3F3"
FT                   /protein_id="ACI58936.1"
FT                   /translation="MIRYILQRFFGMIVVMFLVVTIVFVIVRVTPGDPAPVMLGPDATP
FT                   QDIADLRARLGLDQSLGLQYLYYIGQLLKGDLGQSIFLNMPVTSALLDRAEPTFFLTLF
FT                   SLAIASIIALPIGIYAAYRRGSFVDQAATTLAMFAASIPSFWLGLILMQFFAVRLNLFP
FT                   VSGYGGPGSTFADRMYHLTLPAFALGIVSSALILRFTRASMLDVLGDDYIRTARAKGLV
FT                   ERKVILKHALKNALIPILTVLGLTAAVLISGAVVTETVFGLPGVGNLVVSAVLRRDYPV
FT                   IQGALLVIAALYVLINFAIDMLYLLVDPRVRY"
FT   gene            complement(167872..169398)
FT                   /locus_tag="Rleg2_5763"
FT   CDS_pept        complement(167872..169398)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5763"
FT                   /product="extracellular solute-binding protein family 5"
FT                   /note="PFAM: extracellular solute-binding protein family 5;
FT                   KEGG: rec:RHECIAT_PA0000270 probable peptide ABC
FT                   transporter, substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5763"
FT                   /db_xref="EnsemblGenomes-Tr:ACI58937"
FT                   /db_xref="GOA:B6A3F4"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:B6A3F4"
FT                   /protein_id="ACI58937.1"
FT                   /translation="MKTLVAFLLGTALVALPSTLLAQEKGGVINVATIGEPPTLDPMSS
FT                   TADLVGIVTQHIFETLYTFDKSWNVTPLLAESLPEISADGKTYTIKLRTGIKFHDNSDM
FT                   TSDDVVASLGRWMKIASRGKQVAGFIDKITAADASTVTITLKQPYAPLTSLLAFNNSAA
FT                   IIIPAEKQDEPMKDFIGTGPYMLKERKADQYIQLVRFDGYKSREGDSNGYGGARHQYLD
FT                   EIRFVPVPDPNTRVEAAISGQYDYVDSIAVESYDKLKASNASQPVMLKPFGYPVFVFNT
FT                   KEGVAGNVEVRKAIRQALSMEDMLAAAFGSKDFYALDGAIYPKTFSWSTDAGVEGAYNV
FT                   ADPEGAAAAAKKAGYNGEPIRILTSRQYEFHYKMAQVAAEYLKLAGFTVDMQVVDWATL
FT                   TQRRTDPKLWDIYITHSPFLPEPALIGSLSTSSPGWWDTPARKAAVDAFTSEVDPKKRV
FT                   ALWADVQKAIYTDAPFMKIGDFNAVAAKSVKLEGVDAAPWPYFWNASIKK"
FT   sig_peptide     complement(169330..169398)
FT                   /locus_tag="Rleg2_5763"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 23"
FT   gene            169616..170200
FT                   /locus_tag="Rleg2_5764"
FT   CDS_pept        169616..170200
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5764"
FT                   /product="protein of unknown function DUF1349"
FT                   /note="PFAM: protein of unknown function DUF1349; KEGG:
FT                   rec:RHECIAT_PA0000269 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5764"
FT                   /db_xref="EnsemblGenomes-Tr:ACI58938"
FT                   /db_xref="InterPro:IPR009784"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="InterPro:IPR015987"
FT                   /db_xref="UniProtKB/TrEMBL:B6A3F5"
FT                   /protein_id="ACI58938.1"
FT                   /translation="MNIDFNDGKWLNEPASWQADATGLTITTDEKTDFWRETHYGFTRD
FT                   SGHFLAFPTTESFTAQIRIQGEFRTLYDQAGLMVRLDESRWVKTGVEFTDDEAFLSTVI
FT                   TDGRSDWSVSQPFKELEDFRIRVTVANGALRIQASRDGRRWPLLRLAPFPAAGHYEVGP
FT                   AACTPERSGLMVRFSEFSIGPAITTDLHDLS"
FT   gene            complement(170197..170607)
FT                   /pseudo
FT                   /locus_tag="Rleg2_5765"
FT   gene            complement(170637..171158)
FT                   /locus_tag="Rleg2_5766"
FT   CDS_pept        complement(170637..171158)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5766"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5766"
FT                   /db_xref="EnsemblGenomes-Tr:ACI58939"
FT                   /db_xref="UniProtKB/TrEMBL:B6A3F6"
FT                   /protein_id="ACI58939.1"
FT                   /translation="MFRNKLVAAFCAVVTLPAPAFATDSTQMISTLERFNDGSGAQQLA
FT                   IKLAGLVEKADWPGLNALSKQIQDEDGPLLSELAGVGELGEAEQRKIALAMRPCQTANV
FT                   LIRAIAIAIGDGRFQPIVRGGTVMIDGTEVDSNFAKHMWTCEVLGQLPHKTSIGSKCLM
FT                   TGACKDDPDL"
FT   sig_peptide     complement(171090..171158)
FT                   /locus_tag="Rleg2_5766"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 23"
FT   gene            complement(171367..171594)
FT                   /locus_tag="Rleg2_5767"
FT   CDS_pept        complement(171367..171594)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5767"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5767"
FT                   /db_xref="EnsemblGenomes-Tr:ACI58940"
FT                   /db_xref="UniProtKB/TrEMBL:B6A3F7"
FT                   /protein_id="ACI58940.1"
FT                   /translation="MKLISVDRGANLMVAANLEELHILYAALNEICNGIEIFEFETRIG
FT                   ARLEEVNRVMRALDEILNSLPLVTARGENE"
FT   gene            complement(172747..173085)
FT                   /locus_tag="Rleg2_5768"
FT   CDS_pept        complement(172747..173085)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5768"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5768"
FT                   /db_xref="EnsemblGenomes-Tr:ACI58941"
FT                   /db_xref="UniProtKB/TrEMBL:B6A3F8"
FT                   /protein_id="ACI58941.1"
FT                   /translation="MAGSILISDKVGIPLNSFGMYYLIERIRNEFHVEDEIFKREIYET
FT                   LDDQGMPFIVLNRQGKLGFNAFVRAAERAYDKAREEESFLIYGHLWRPLFDLLEADPRY
FT                   DTSRSGLS"
FT   gene            complement(173088..181571)
FT                   /locus_tag="Rleg2_5769"
FT   CDS_pept        complement(173088..181571)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5769"
FT                   /product="filamentous haemagglutinin family outer membrane
FT                   protein"
FT                   /note="TIGRFAM: filamentous haemagglutinin family outer
FT                   membrane protein; adhesin HecA family; PFAM: Haemagluttinin
FT                   repeat-containing protein; filamentous haemagglutinin
FT                   domain protein; KEGG: bhe:BH06670 filamentous
FT                   hemagglutinin"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5769"
FT                   /db_xref="EnsemblGenomes-Tr:ACI58942"
FT                   /db_xref="InterPro:IPR008619"
FT                   /db_xref="InterPro:IPR008638"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="InterPro:IPR025157"
FT                   /db_xref="InterPro:IPR041620"
FT                   /db_xref="UniProtKB/TrEMBL:B6A3F9"
FT                   /protein_id="ACI58942.1"
FT                   /translation="MSREQSKSTTAIGGVAGANERPGRSLARLARQSLALLLSSLLVFQ
FT                   PMLANAQSVSASTTAPAANQPGVGSAPNGVPLIDIVTPNSQGLSHNKYDNFNVGTPGLI
FT                   LNNFKGEIGNSNLGGVTPGNPNLNSSGPASVILNEVTSGNRSALNGAIEVFGGRADVVI
FT                   ANPNGITCDGCGFINTPHATLTTGAPQLGADGKLNGFSVSGGDVTIGPNGGNFSAGSGA
FT                   VDLFDIVSRSVHVNGPVYGKSLRVTAGASNFDYATGDAQALAPISGTPEYAIDGTALGA
FT                   MQADRIKIVVTENGAGVRMSGDLAANTNELSLSADGKISLGNVSGEQGVSISSKSKVTA
FT                   AKVTSKAKATIAADQGITLDTVAAGGDIALSSGSGLLSVGGEVNSAANVLMSSAAGIAA
FT                   GSVVAGNALTLSSTAGNIQIAGAVKSADALTITATSGAISAASLVSGNNVALSAGADIG
FT                   ISGDVLAQGNVTASGRSIAAATIASGVDFAATAHSANGTLALQQAGSMSLAATNGSITV
FT                   SNALLSSGNLSATATQNIAYNKLQSLSNAALMASGQISYGNPTSATGNLTLTTTNIDLS
FT                   NGAAGNIAAGGTLTLNADSANLSNNSLTLGGLALNLSGSADLSGATINAVTGAGGSGDI
FT                   AINADGLSTSASTALLAADDLTLTLLSLTNAGQLAAKDALTLKISGNFTNNATGLAYAG
FT                   HDASLFIGGVLTNNQGAILSGNDLEIAGTASGLRNTGVTNISGLIQAGNDMSILTSELT
FT                   NKRAATPQWTTGTLISSGVLTGFTLNPAAAGLPFGYLETADQNMFQLYAGVDPGLWQDY
FT                   EPLLWSKATLADGTTYRAWTWISADGPEKVTPIIDWIRARVPRDANGNPVADPNNPSRY
FT                   FIVDEVNFSGSDESTTYSWDWSSHLSQSVYEDRLIGTLSPEATIRASRNLTIDATNLTN
FT                   SYSSIEAGGDATLKGSTLTNTGVTLFRTTTTTCSAQGACTAYDASGHANPSKNIANGTT
FT                   IVSSVQAIGGVSANIKAHGALSVDFGSVNNTSAAGSMAGGASVAAASNPGDPLSALSGL
FT                   TAGGTLFNVNSGLGTTLVASTNPRSGGFGDPIPGQTFLFETRAKFLDVGTFYGSAYFMG
FT                   KIGYQPETTVPFLGDAYFENQLIDTQLRQLVGEGLGRSTFIAGNSAIEQMKTLLDNGVT
FT                   YAKDHGLAVGQGLTPEQAAALTESIVLYQMQTVNGVQVLAPVVYVAAADRQKLTGAGAV
FT                   MAGGSVDMNVDDLANSGLIASNGGLTIAGKTIQGSGTFLSRGDTVLNATNGITLAAQTM
FT                   TIGGQNMVNTNAGVTASGNVQLAGGSGDLALKGVKVNAGGSAQLSGTNVTLAAAKVDNG
FT                   GQQNATGTQVASGGALTIKATDNVNIIGSSAKAGTTLDVTADNGSVAVVSTDVARNNQS
FT                   GYTRTLSTDQQQSQLSSGTNATITAGDDILLSGSSVKAGGNIALSAGDDINITAAQEQS
FT                   ASTFGKKSASSITHVGSEIAAGGDLSVKAGNGSGDHDLNIVGSKLAADGKVALKADGDV
FT                   TIAEATDTATLDTKLSSKGGFLGTSEKTTTHLETTTAVGSAITGGGGVDIESGKDTVIS
FT                   ASKIEAGKEGGTTPASLNITTGGDLVIASGKDTTAKDDKGSRSGFLSKGSSSHKSYDET
FT                   TVASELGASGNINLSAGGAAVIAGSKADADGSINISGDSVSVVGAQETHELEEQRKKSG
FT                   FGIGGGGGFISIYGSQQNKGAQASTLNVGSALSAGEDVNLTAKATDLNIMGSSVDAERD
FT                   INLSAARDVNVTPGAESFSQSEQEKKSGFGLSFSAGNGGISIGIGAQRSKDSSAQQSDT
FT                   NAASTLSAGRDLNISAGNNLNLQAAQASAERDVNLFATNDINLLSAADKTNYEEIHEKT
FT                   FAGVTLSVSSQVSQAASSIMNSAERLAGDTRVNAVTNTAIAGLGFYQGYKGLKEAYKQL
FT                   TDTSPTAEGLSFSVSLTAGVNHQENSSSSSSSTPVVTDIRAGRSITLEAENGSITSDGA
FT                   QIAAGYDKFGLPTISDDPLAGDIFLSADKGNINLSAATGTSDTSSKNSSYSFGVGVKWE
FT                   CGTKSKCVPGVSVSGSYGKGNDGTTGLTNYNTHVNGTGDITILTNDLTLRGATVTGNSV
FT                   TAAVRNLTVQSLVDTATAEAHQLNLSGSIGTDGFSASGSTQKATGDAAIVSEQSGIRAG
FT                   TGGLDLTVDKKTTLVGGLLTSQASEALNHLETGTLEVTDVDTHSRWKADTYGASIGSGG
FT                   LSLAKVNDGESETGKAYSAIGGNIGIAITDPEHQTQDIGTIRRDTDNTNTSLPGLPDLQ
FT                   NILRDQYKTQADLQAAQKTMATLVGDIASELYKQSTTQAERDLWKEGGAGRALLHAIGG
FT                   GILGGVNGWEGAIKAALGGAATTLMAPAIAKLVKGMLKGTKYEGTAEGDALAKLIGASL
FT                   ATAVGEAVGGAEGAGYGAANYQYNYLYHDEKAAKLKAESNLAACKTKPQSCSQAEVANL
FT                   QQEISRYDALDELRDAQVQYACAYGGRLMCLSALQDTYRAAISYAAAHAGYSDQDAYNA
FT                   YLRERGIDPNQMAAEAWEIYQLRQSLSETIGDRDAQDMQITLNGLGLGAGIGAGAAAIY
FT                   LAPSAFSAAVACARSSVCFYEMGLMVADAAFGEAVGGASYGISFAVASGQLILRKGDQI
FT                   IGVLDQATGKPVQLTEDGLQALRATLPPAPTATARVITLSSDSPTTIIARGSVDFDAFK
FT                   RLNVVDPATGKIQPGEASAAAELENYLGGTLGRAEGGSADFVFQSGPYAGKTVDFMLTP
FT                   NNVRQAGMANQFFEKNLSAFTENLQLHIDKADLVPLDMRFLTQKNQEMLLNLVDSLPVS
FT                   QKSKIILMR"
FT   gene            complement(181745..182428)
FT                   /locus_tag="Rleg2_5770"
FT   CDS_pept        complement(181745..182428)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5770"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5770"
FT                   /db_xref="EnsemblGenomes-Tr:ACI58943"
FT                   /db_xref="UniProtKB/TrEMBL:B6A3G0"
FT                   /protein_id="ACI58943.1"
FT                   /translation="MTKRAFAVAGLSIIAVLLASCGTKDPAMVASERVAKSTEILNARK
FT                   QKGALILARFVYPGLFGPVRCPGDIRLRKLVNGAPDELAAPVGFWTAYRWLLPEQKKPA
FT                   DPKGNLLNPIGDAKDYERAFQPIAPGTYVVTYASCELSSPNGTLKLEAGGDHDGLFSYI
FT                   SALEGSSTITIGEGQIVDAGYFRVQGTKTHPVVVGQEASAAEREVMREVLPGAYSSITF
FT                   KKFGE"
FT   sig_peptide     complement(182357..182428)
FT                   /locus_tag="Rleg2_5770"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.984) with cleavage site probability 0.320 at
FT                   residue 24"
FT   gene            complement(182523..183077)
FT                   /locus_tag="Rleg2_5771"
FT   CDS_pept        complement(182523..183077)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5771"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5771"
FT                   /db_xref="EnsemblGenomes-Tr:ACI58944"
FT                   /db_xref="UniProtKB/TrEMBL:B6A3G1"
FT                   /protein_id="ACI58944.1"
FT                   /translation="MRFVRFLTLLLLAATLASCVTSDPRLVSALKKTSVSQIRVETAPD
FT                   ITMGGFFDRTKPDPQLPAVVRTLQSTMARELTGLPGGPVKGRLVVTLHRVDVSSKAGRV
FT                   IAGNDSYIQGTVRLEDAKTGQLIAEAQSIRGEDKGVRGDGEIGIVIAMAMNAAQSQGED
FT                   ALAQKLSNSFTRNVKTWLTQK"
FT   sig_peptide     complement(183009..183077)
FT                   /locus_tag="Rleg2_5771"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.822 at
FT                   residue 23"
FT   gene            complement(183123..183590)
FT                   /locus_tag="Rleg2_5772"
FT   CDS_pept        complement(183123..183590)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5772"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: btr:Btr_1170 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5772"
FT                   /db_xref="EnsemblGenomes-Tr:ACI58945"
FT                   /db_xref="GOA:B6A3G2"
FT                   /db_xref="UniProtKB/TrEMBL:B6A3G2"
FT                   /protein_id="ACI58945.1"
FT                   /translation="MTTRSISTNKHANTLSRSTALILALSMSLAGCAGREARPVASTNP
FT                   SDSAFDCAGIAREFEANERQISSTVKERTDAQGKNIVLGATGVLLFLPALFFMDPKSPE
FT                   KVEIDALRNRNNVLTSIAKSKGCPAPKSQLTELYKHLDSKPKPASSSDSRN"
FT   sig_peptide     complement(183477..183590)
FT                   /locus_tag="Rleg2_5772"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.491 at
FT                   residue 38"
FT   gene            complement(183604..185325)
FT                   /locus_tag="Rleg2_5773"
FT   CDS_pept        complement(183604..185325)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5773"
FT                   /product="Polypeptide-transport-associated domain protein
FT                   ShlB-type"
FT                   /note="PFAM: Hemolysin activator HlyB domain protein;
FT                   Polypeptide-transport-associated domain protein ShlB-type;
FT                   KEGG: btr:Btr_0409 hemolysin activation protein precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5773"
FT                   /db_xref="EnsemblGenomes-Tr:ACI58946"
FT                   /db_xref="GOA:B6A3G3"
FT                   /db_xref="InterPro:IPR005565"
FT                   /db_xref="InterPro:IPR013686"
FT                   /db_xref="InterPro:IPR027282"
FT                   /db_xref="InterPro:IPR034746"
FT                   /db_xref="InterPro:IPR035251"
FT                   /db_xref="UniProtKB/TrEMBL:B6A3G3"
FT                   /protein_id="ACI58946.1"
FT                   /translation="MTTEIRYCLVAGAALAAAIAPAYAQTPADDFNRRQEERSQTQRLD
FT                   ALRRATPGGGQDAENGALPAGPGKGACFDITRVEIDGATLLSAQEIGKVTAPYSNRCVG
FT                   LAEINAVLRDVTHLYIDHGYVTSRAYVPQQDIRKTRILRLLVVEGTLSDIYLNGQKVAG
FT                   NGSLATAFPGLIGRVVNIRDIEQGLDQMNRLQANDAKSAMLPGPKDGTSILNIENRPGR
FT                   PWHVSVANNNMGQESTGFSRSSASLGYDGLLGINDQWNFSYEHSGPDYSWENDGNGYGN
FT                   SYSGSVSVPYGYSTLSLSGSWYQYESAVEGNFSTLETSGNSGQAGLGIDRVISRDKDSI
FT                   TTVRSGLTYKQTNNFLLGNLIEVGSRRYTVGDIGISHSRRMFGGIWMFDASFDKGLGLF
FT                   DAVNPGDPGAGNADPRFSKFNATISVTQPFQTAGRQFEFTSLLSAQYSPDNLLGAEQIS
FT                   LGGYSNVRGTRESVLFGNNGMFSHNEIVWRTQSNQGGGAAAKAFGELRPYLGFDYGHVY
FT                   AQKRFDISGGDLASWTAGIRAVGGNISADLGYSDIVASSLDDVDGGLFYFSASAHW"
FT   sig_peptide     complement(185251..185325)
FT                   /locus_tag="Rleg2_5773"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 25"
FT   gene            complement(185338..185952)
FT                   /locus_tag="Rleg2_5774"
FT   CDS_pept        complement(185338..185952)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5774"
FT                   /product="Invasion associated locus B family protein"
FT                   /note="PFAM: Invasion associated locus B family protein;
FT                   KEGG: gbe:GbCGDNIH1_1665 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5774"
FT                   /db_xref="EnsemblGenomes-Tr:ACI58947"
FT                   /db_xref="InterPro:IPR010642"
FT                   /db_xref="InterPro:IPR038696"
FT                   /db_xref="UniProtKB/TrEMBL:B6A3G4"
FT                   /protein_id="ACI58947.1"
FT                   /translation="MKTFLKSSMKRGLRTSAPILISIACATPSFSQSPGTQEPEQVQAP
FT                   TQSAPALKSQKFDDWYYRCTGAAGAEACEVAQVAQVTKDGKPVNILTLAISAPPAAPSD
FT                   KDKGKPRLMLTALLPLNVFLPSGLSIRADGKPVAKLDYRNCNQTGCWAQLALDTKMTAA
FT                   LKKGAAAEGLVRLMNGQDVNIRFSLKGLKPALDELQSVAAK"
FT   sig_peptide     complement(185857..185952)
FT                   /locus_tag="Rleg2_5774"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.990 at
FT                   residue 32"
FT   gene            186747..187550
FT                   /locus_tag="Rleg2_5775"
FT   CDS_pept        186747..187550
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5775"
FT                   /product="Hydroxyethylthiazole kinase"
FT                   /EC_number="2.7.1.50"
FT                   /note="PFAM: hydroxyethylthiazole kinase; KEGG:
FT                   ret:RHE_PE00337 hydoxyethylthiazole kinase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5775"
FT                   /db_xref="EnsemblGenomes-Tr:ACI58948"
FT                   /db_xref="GOA:B6A3G5"
FT                   /db_xref="InterPro:IPR000417"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/Swiss-Prot:B6A3G5"
FT                   /protein_id="ACI58948.1"
FT                   /translation="MQSRTTPGAMLTAMREKPPLVQCITNYVAMNIAANVLLAAGASPA
FT                   MVHAAEEADEFAGIASALTVNIGTLSTQWIDGMQAAAKATTAAGKPWVLDPVAHYATAF
FT                   RRDAVAGLLALKPTIIRGNASEIIALAGGESRGQGVDSRDPVEQAEGSARWLAERQQAI
FT                   VAVTGAVDFVTDGERAVRITGGSALMPQVTALGCSLTCLVGAFAATAPEDLFGATVAAL
FT                   ATFAIAGEEAALGAAGPGSFAWRFLDALHALDAETLDARARISAA"
FT   sig_peptide     186747..186896
FT                   /locus_tag="Rleg2_5775"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.733) with cleavage site probability 0.727 at
FT                   residue 50"
FT   gene            187547..188182
FT                   /locus_tag="Rleg2_5776"
FT   CDS_pept        187547..188182
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5776"
FT                   /product="thiamine-phosphate pyrophosphorylase"
FT                   /EC_number="2.5.1.3"
FT                   /note="KEGG: ret:RHE_PE00336 thiamine-phosphate
FT                   pyrophosphorylase protein; TIGRFAM: thiamine-phosphate
FT                   pyrophosphorylase; PFAM: thiamine monophosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5776"
FT                   /db_xref="EnsemblGenomes-Tr:ACI58949"
FT                   /db_xref="GOA:B6A3G6"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022998"
FT                   /db_xref="InterPro:IPR034291"
FT                   /db_xref="InterPro:IPR036206"
FT                   /db_xref="UniProtKB/TrEMBL:B6A3G6"
FT                   /protein_id="ACI58949.1"
FT                   /translation="MKTFDLSLYLVLDPDLCAGIGMVETARRAVAGGATMVQLRDKHAG
FT                   TTAMIETGRALKQALDGTGARLIVNDDVEAAIAIGADGLHIGQEDMDAVRARAMIGPDM
FT                   ILGLSVETAALAASVDPSLVDYTGIGPVFATPTKADHKQPIGFHGLARLVAASPVPSVA
FT                   IGGLKAEHVAKVFAAGASGLAVVSAISGTPDPEAATRRIAAEIRKARA"
FT   gene            188179..189012
FT                   /locus_tag="Rleg2_5777"
FT   CDS_pept        188179..189012
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5777"
FT                   /product="phosphomethylpyrimidine kinase"
FT                   /EC_number="2.7.4.7"
FT                   /note="KEGG: rec:RHECIAT_PA0000265 phosphomethylpyrimidine
FT                   kinase protein; TIGRFAM: phosphomethylpyrimidine kinase;
FT                   PFAM: Phosphomethylpyrimidine kinase type-1"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5777"
FT                   /db_xref="EnsemblGenomes-Tr:ACI58950"
FT                   /db_xref="GOA:B6A3G7"
FT                   /db_xref="InterPro:IPR004399"
FT                   /db_xref="InterPro:IPR013749"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:B6A3G7"
FT                   /protein_id="ACI58950.1"
FT                   /translation="MIRNVLSIAGSDPSGGAGIQADLKAFSARGVYGMAVLTALTAQNT
FT                   QGVSGVHLVPPAFVADQINAVFADVRFDAVKIGMIANAGIAEAVATALDAALAALPADR
FT                   RGIPIVIDPVMIAKGGAALLAPEAVDVLTRRLLPLATLLTPNLPEAAALLHQPVATNRA
FT                   EMAAQAEQLRALGPAAVLVKGGHLDSDDSPDVLATADGLHWFEARRVPTKNTHGTGCTL
FT                   SSALAAELAKGASVPEAVAIAKDYLAGAVAAAGSLTVGSGHGPVQHFHALWKVTG"
FT   gene            189228..189707
FT                   /locus_tag="Rleg2_5778"
FT   CDS_pept        189228..189707
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5778"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   ret:RHE_PE00334 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5778"
FT                   /db_xref="EnsemblGenomes-Tr:ACI58951"
FT                   /db_xref="GOA:B6A3G8"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:B6A3G8"
FT                   /protein_id="ACI58951.1"
FT                   /translation="MPDLLVSLYSRKLADLNRKADHAGVSIRPALPPELHIVVEWVRQQ
FT                   FSENWASEVSVAFSRQPVACLISVDGGKLLGFACYDTTARGFFGPTGVDPEARGKGIGL
FT                   ALFSACLQAMKTLGHAYAFIGDAGPVDFYAKTAGAITIPAPDKGIYEGMLRRMPT"
FT   gene            189732..190754
FT                   /locus_tag="Rleg2_5779"
FT   CDS_pept        189732..190754
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5779"
FT                   /product="Beta-N-acetylhexosaminidase"
FT                   /EC_number="3.2.1.52"
FT                   /note="PFAM: glycoside hydrolase family 3 domain protein;
FT                   KEGG: rec:RHECIAT_PA0000263 putative
FT                   beta-N-acetylhexosaminidase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5779"
FT                   /db_xref="EnsemblGenomes-Tr:ACI58952"
FT                   /db_xref="GOA:B6A3G9"
FT                   /db_xref="InterPro:IPR001764"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR036962"
FT                   /db_xref="UniProtKB/TrEMBL:B6A3G9"
FT                   /protein_id="ACI58952.1"
FT                   /translation="MSSTPLALFVGLPNPVLSDEEFALFRETNPLGLFVGRRNQREPEQ
FT                   TKRLIERFREAVGRDDAPVFTDQEGGRVQHLDAGPWPLFRSFGQFAELARRDFALGKKA
FT                   LRLSSQAMGAMMTELGLSSGCSPVLDLVFETTSAVIGARSFGPDPDVIAALGPEVIDGL
FT                   LEAGNMPVMKHIPGHGRATLDSHKERPVVDASRVTLAATDFKPFVALKDTPWAMVAHVV
FT                   YSAYDKERPASVSPVMHDVIRNEMGYEGVLISDCIFMESLSGTLPERVRQVLDAGFDIA
FT                   LHSHGDVRESEAAAKAARPLTDAALKRIAAGTARLGNLKVDVRAAHRQVEDMFASALVS
FT                   "
FT   sig_peptide     189732..189788
FT                   /locus_tag="Rleg2_5779"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.795) with cleavage site probability 0.794 at
FT                   residue 19"
FT   gene            190798..192444
FT                   /locus_tag="Rleg2_5780"
FT   CDS_pept        190798..192444
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5780"
FT                   /product="extracellular solute-binding protein family 5"
FT                   /note="PFAM: extracellular solute-binding protein family 5;
FT                   KEGG: rec:RHECIAT_PA0000262 putative ABC transporter,
FT                   substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5780"
FT                   /db_xref="EnsemblGenomes-Tr:ACI58953"
FT                   /db_xref="GOA:B6A3H0"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:B6A3H0"
FT                   /protein_id="ACI58953.1"
FT                   /translation="MKKYLLAAAALTLLSGSAMAQTVLTANIEPATTWVRNFNPFNQTS
FT                   SRQSTLDFIYEPLVIFNRFDSNKPVYRLAESFTLSDDLKSIDFKLRPNLKWSDGKPLTS
FT                   ADVKFTYDYLKKFPALDFVSIWSFITDVKAVDGQTVRFTLANPSSLAAEQISQLPIVPE
FT                   HVWKDVADPVTFANENPVGSGPLTEVPRFTGQTYDQCRNPNYWDNAHLKVDCMRFPQLA
FT                   DNNQMLTATADGTLDWGVSFIPDIDNVYVSKDPAHFHYWYSPSSMVAFLFNLETANENN
FT                   KKAFIDLKFRRAVSMALDRKTMIDVAGYGYPTLNEDPGLMGELYKSWADPSVKSDFGKF
FT                   ATYDADAAKALLDEAGYKDKDGDGFRDNPDGSKISFSIIVPSAWTDWIDTVNLAVEGMQ
FT                   AVGIDAKIETPEEAVWTGNLINGTFDAAINSLPASASPYYPYKRAFSASDKGKTRFTAQ
FT                   RWFNPEVEKLVTEFTQTADLAKQKDAMNKAQRIVAENMPMIPVFNNPNWYQYNTKRFTG
FT                   WSTKENPFVNPSISRTNPARLLNLLALEPVK"
FT   sig_peptide     190798..190860
FT                   /locus_tag="Rleg2_5780"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 21"
FT   gene            192552..193529
FT                   /locus_tag="Rleg2_5781"
FT   CDS_pept        192552..193529
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5781"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: ret:RHE_PE00331 putative
FT                   peptide ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5781"
FT                   /db_xref="EnsemblGenomes-Tr:ACI58954"
FT                   /db_xref="GOA:B6A3H1"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B6A3H1"
FT                   /protein_id="ACI58954.1"
FT                   /translation="MAFLLRRLVFYMAAFIAAATINFFLPRLMPGDPVQIMFSSAGTEL
FT                   PPESLQALKLTFGFVDGPLWQQYLTYLGSIFTGDLGRSIKYFPLPVTSVLGHALIWTVS
FT                   LMGTATIISFAFGTLLGIAAAWRRGSRFDVFVSVGAIFATSVPAVVTSLIVLFIFGFTL
FT                   GWFPNGYAADPSLDPAFSLQYLGSVAYHGILPMVTLCTVLIGGFTVTMRNNMINLLGED
FT                   YIVMARAKGLSDRHVMLWYAARNALLPTVSSLAIAIGTILGGSLVTEVVYNYPGLGNIL
FT                   YQAILARDYPVIQGQLLIMTATMLIANFIVDVSYILLDPRLKGA"
FT   gene            193531..194409
FT                   /locus_tag="Rleg2_5782"
FT   CDS_pept        193531..194409
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5782"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: rec:RHECIAT_PA0000260
FT                   putative ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5782"
FT                   /db_xref="EnsemblGenomes-Tr:ACI58955"
FT                   /db_xref="GOA:B6A3H2"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR025966"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B6A3H2"
FT                   /protein_id="ACI58955.1"
FT                   /translation="MKTLLRNRKALTGLVIIAVIVIVAIAAPLLTQYDPAARTGRPHQP
FT                   PSLDHILGTTRIGQDVFARLIYGARTSLAVGFGAGLLITLVGTALGIISGYRGGKTDEV
FT                   VSFFTNMVLVVPNLPLLLVLAAFIGQASPVVIALILGATSWAWGARVTRAETLSVKHKD
FT                   FVKSAEMMGEPQWRIMTFEIFPNVISIVGINFIGSVIFAIITEATLEFLGLGDPRAISW
FT                   GTMLYNAQKASALSVGAWWDILTPCFALAFLGIGMSLLNFAVDEIANPRLRTGNHLKRW
FT                   SLLVRSGEGRL"
FT   sig_peptide     193531..193611
FT                   /locus_tag="Rleg2_5782"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.929 at
FT                   residue 27"
FT   gene            194406..195209
FT                   /locus_tag="Rleg2_5783"
FT   CDS_pept        194406..195209
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5783"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: ret:RHE_PE00329 putative peptide ABC transporter,
FT                   ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5783"
FT                   /db_xref="EnsemblGenomes-Tr:ACI58956"
FT                   /db_xref="GOA:B6A3H3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B6A3H3"
FT                   /protein_id="ACI58956.1"
FT                   /translation="MTQPLLSVRNLTIDYIGEEKDFRAVDDVNFDVAPGEVFGLAGESG
FT                   CGKSTIAFAISRLHKPPALIRKESRILLDGRDVLDLDRQALAAFRWREVAMVFQSAMNS
FT                   LNPVLRIETQFYDMLHTHKGMSRAAARERTAEMLRLVDIAPDRMRDYPHQFSGGMRQRI
FT                   VIAICMALDPKLVVMDEPTTALDVVVQREILQRINELRRRFGFSVLFITHDLGLMVQFC
FT                   DRIGIMLSGRLVEQKAAEAIYRAPEHDYTKKLWASFPSLHGGVLL"
FT   gene            195206..196105
FT                   /locus_tag="Rleg2_5784"
FT   CDS_pept        195206..196105
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5784"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related;
FT                   Oligopeptide/dipeptide ABC transporter domain protein;
FT                   SMART: AAA ATPase; KEGG: ret:RHE_PE00328 putative peptide
FT                   ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5784"
FT                   /db_xref="EnsemblGenomes-Tr:ACI58957"
FT                   /db_xref="GOA:B6A3H4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B6A3H4"
FT                   /protein_id="ACI58957.1"
FT                   /translation="MSDAILALDTVTKSFGHGSAAVHAARAISFSLHAGRALALVGESG
FT                   SGKTTCARMAMREYLPTSGRILYKGRPVEAANSAEIGRYRRSVQMIFQDPFASLNPAHT
FT                   IAHHLRRPLKLHRPEIKGAEIDVAVRELLQRVRLDPDLVAPKYPHELSGGQRQRVNIAR
FT                   ALAVQPEVIVADEPTSMLDVSVRLGVLNLLNEMKQEMNLGLLYITHDIATARYVAEDIA
FT                   VMYAGQIVEWGSTARVIDNPLHPYTKLLLSAVPDPDIRFEDPKARLRPDEVDDIRRRSA
FT                   APQDEIIEVEPQHFIRMI"
FT   gene            complement(196112..196549)
FT                   /locus_tag="Rleg2_5785"
FT   CDS_pept        complement(196112..196549)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5785"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; KEGG: ret:RHE_CH01330 probable
FT                   glyoxalase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5785"
FT                   /db_xref="EnsemblGenomes-Tr:ACI58958"
FT                   /db_xref="GOA:B6A3H5"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:B6A3H5"
FT                   /protein_id="ACI58958.1"
FT                   /translation="MALKRMDNVGIVVEDLAVAIDFFGELGLELEGRAMIEGEWAGRIT
FT                   GLGDQRVEIAMMRTPDGHSRLELSRFLMPDVVADHRNAPVNALGYLRVMFTVEDIDDTL
FT                   ERLRARGAQLVGEVVQYGDTYRLCYIRGPEGLLLGLAQELS"
FT   gene            196737..197417
FT                   /locus_tag="Rleg2_5786"
FT   CDS_pept        196737..197417
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5786"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rec:RHECIAT_PA0000257 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5786"
FT                   /db_xref="EnsemblGenomes-Tr:ACI58959"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B6A3H6"
FT                   /protein_id="ACI58959.1"
FT                   /translation="MLPWIQLDSATIPGEGGELRLKQRGSEFSIMLGANELMNSRLSGS
FT                   EEALATLSWERIKAHPKPRMLIGGLGMGFTLRAALAILPEDAGVTVAELVPAVVTWARG
FT                   PMAEVFKGCLDDPRVAIHQGDVGEAIRAGKGAYDAILLDVDNGPDGLTRKSNDRLYDFA
FT                   GLRFARDALRPGGVLAVWSSGPDPDFTRRLRDSGFSVDAVNTRANGKRGGARHVIWLAI
FT                   KPTR"
FT   gene            complement(197454..198248)
FT                   /locus_tag="Rleg2_5787"
FT   CDS_pept        complement(197454..198248)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5787"
FT                   /product="HpcH/HpaI aldolase"
FT                   /note="PFAM: HpcH/HpaI aldolase; KEGG:
FT                   rec:RHECIAT_PA0000256 probable hydroxyacid aldolase
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5787"
FT                   /db_xref="EnsemblGenomes-Tr:ACI58960"
FT                   /db_xref="GOA:B6A3H7"
FT                   /db_xref="InterPro:IPR005000"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:B6A3H7"
FT                   /protein_id="ACI58960.1"
FT                   /translation="MGAADIDGFANRIRGSRCGMISAWVGIPDAMLVNHLAQEAFDAVV
FT                   LDMQHGMWDMPSAANGIAQARLAGKPALARIPVGDFASASRLLDAGASGIIAPMINSAD
FT                   DARALARTTKYPPVGERSWGPSLALNHTGLSGDDYLKNANALTVAIAMIETRAALDAID
FT                   GILGVTGIDGIFIGPSDLSIALSNGDQVAPNAAEIDSAMQHAVARCRAHGKFACAFAAD
FT                   GERAGELLKFGFDLVVAGAETTQLRSGARRAINAARRIASAG"
FT   gene            complement(198302..198502)
FT                   /locus_tag="Rleg2_5788"
FT   CDS_pept        complement(198302..198502)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5788"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rec:RHECIAT_PA0000255 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5788"
FT                   /db_xref="EnsemblGenomes-Tr:ACI58961"
FT                   /db_xref="GOA:B6A3H8"
FT                   /db_xref="UniProtKB/TrEMBL:B6A3H8"
FT                   /protein_id="ACI58961.1"
FT                   /translation="MRTIGYIIGLLMVLFGLIWIGQGSGYFPYPASSFMIAQTIWVVWG
FT                   AILAAAGIAVMIIVSRLRRRV"
FT   gene            complement(198592..199497)
FT                   /locus_tag="Rleg2_5789"
FT   CDS_pept        complement(198592..199497)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5789"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="TIGRFAM: choline sulfate-utilization transcription
FT                   factor; PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: rec:RHECIAT_PA0000253 probable
FT                   transcriptional regulator protein, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5789"
FT                   /db_xref="EnsemblGenomes-Tr:ACI58962"
FT                   /db_xref="GOA:B6A3H9"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR017786"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B6A3H9"
FT                   /protein_id="ACI58962.1"
FT                   /translation="MPDHSLELGWMRIFVEVARLGSFSSAAALLGLTQPAVSYQIRRLE
FT                   EQFGVSLLRRQHRGVTLTAEGERLLDVTAKAVGDIDALARSFRAEAQRPVVRLRTDYAF
FT                   SSLWLIPRMDGFRLLHPETDIQIVATQRFAAGFRDEADVAVVFGTRAEFGAAGTLLLQE
FT                   KVVPVCTQGFLDRNGPFEDARQLAKAVLIHLDTPMPSPWFDWRSYLTEFSVVRDINAGR
FT                   GDISFNTYSLVIQAALSGQGVAIGWMGLVDTLLQAGMLVEAGPPLEAQDRGYWLVPPRS
FT                   PSPHSESLGAWLVGEVGGSG"
FT   gene            199592..201106
FT                   /locus_tag="Rleg2_5790"
FT   CDS_pept        199592..201106
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5790"
FT                   /product="choline-sulfatase"
FT                   /note="TIGRFAM: choline-sulfatase; PFAM: sulfatase; KEGG:
FT                   ret:RHE_PE00324 choline sulfatase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5790"
FT                   /db_xref="EnsemblGenomes-Tr:ACI58963"
FT                   /db_xref="GOA:B6A3I0"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR017785"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR024607"
FT                   /db_xref="InterPro:IPR025863"
FT                   /db_xref="UniProtKB/TrEMBL:B6A3I0"
FT                   /protein_id="ACI58963.1"
FT                   /translation="MARPNILILMVDQLNGTLFPDGPADFLHAPHLKSLAERSVRFANT
FT                   YTASPLCAPARASFMSGQLPSRTRVYDNAAEFASDIPTYAHHLRAAGYQTALSGKMHFV
FT                   GPDQLHGFEERLTTDIYPADFGWTPDYSKPGERIDWWYHNLGSVTGAGVAEITNQMEYD
FT                   DEVAYNATRKLFDLSRAHDGRPWCLTVSFTHPHDPYVARRKFWDLYEDCPALDPAVAPI
FT                   AFERQDPHSQRLMKACDHEAFAISPEGIRRARRGYFANISYVDEKIGDILGVLERTRMA
FT                   ENTIILFVSDHGDMLGDRGLWFKMNFFEGSARVPLMIAAPGWKPGRIDHPVSTLDVTPT
FT                   LAGLAGIDITALKPWTEGEDLAGLAEGTGSRGPVPMEYAAEGSEAPLVCLRDGRYKLSL
FT                   CDKDPPMLFDLEADPQELDNLAGNPAHAGTLARLADQAGRRWNLADFDAAVRESQARRW
FT                   VVYAALRNGAYYPWDYQPLQKASERYMRNHMDLNVLEENQRFPRQE"
FT   gene            complement(201125..201985)
FT                   /locus_tag="Rleg2_5791"
FT   CDS_pept        complement(201125..201985)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5791"
FT                   /product="Xylose isomerase domain protein TIM barrel"
FT                   /note="PFAM: Xylose isomerase domain protein TIM barrel;
FT                   KEGG: ret:RHE_PE00323 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5791"
FT                   /db_xref="EnsemblGenomes-Tr:ACI58964"
FT                   /db_xref="GOA:B6A3I1"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:B6A3I1"
FT                   /protein_id="ACI58964.1"
FT                   /translation="MQILQNGRFAVSTWSLHRLLGAVYAYSPDPDKSSAPKEPYGPGAA
FT                   ALIDMPAALAARGINRLEVCSFHLPSLEAGYLSELRDAMAASNVLFQTLLVEDGDPSHA
FT                   ETAERDVRWMAEWIDIAAALGAQRIRVIAGKQKPTEENLARAARHLGWLAEKAEGSGVR
FT                   IVVENWFDLLPSPVEMNWLLDRLDGKVGLNGDLGNWAAPAKYEGLADIMRRAEICHAKA
FT                   DYGVAGLDADDYRTCLEMCERAGYAGPFTLIYDSPFFPDEWDGILLQKQFIEDFLRDAP
FT                   ARRTA"
FT   gene            complement(202052..203422)
FT                   /locus_tag="Rleg2_5792"
FT   CDS_pept        complement(202052..203422)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5792"
FT                   /product="Amidase"
FT                   /note="PFAM: Amidase; KEGG: ret:RHE_PE00322 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5792"
FT                   /db_xref="EnsemblGenomes-Tr:ACI58965"
FT                   /db_xref="GOA:B6A3I2"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR020556"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/TrEMBL:B6A3I2"
FT                   /protein_id="ACI58965.1"
FT                   /translation="MSKSFGAMSVAQLSVLIQGGAADPVDVAAAVFGAIADYADKAVFT
FT                   TLTESRAMAEARASSKRLREGRSLGLLDGIPIAWKDLFDIEGLATTAGSVVLAADAPAK
FT                   RDAAVVGFLRQAGMVAIGRTNMSEFAFSGLGINPHYGTPVNPRGNDLPRIPGGSSSGAG
FT                   VAVAAGLVPVAMGTDTGGSVRIPAAFNGIVGYKATRGRHAMDGVYPLARSLDSLGPFCR
FT                   GVKDAVWIDAAMRGRIAPDVVERPLQALELLVPENIVFDGAEPGVIAAFEAGLERLQRA
FT                   GVHVARAVIPAFDAIFDLMTRYGPLVTAEAFALHHERLAGPDADRMDHRVVMRTRLGSR
FT                   TSLADYLAILEARKRMIADVERLVGDRLLAFPTVAHVAPPIGPLEGDDELFFATNNKTL
FT                   RNTALGNFLDWCGVSIPCGTGASGMPVGLLLSATARRDETLLGVALAAEPVVRGDFA"
FT   sig_peptide     complement(203354..203422)
FT                   /locus_tag="Rleg2_5792"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.748) with cleavage site probability 0.529 at
FT                   residue 23"
FT   gene            203661..203975
FT                   /locus_tag="Rleg2_5793"
FT   CDS_pept        203661..203975
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5793"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ret:RHE_PE00321 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5793"
FT                   /db_xref="EnsemblGenomes-Tr:ACI58966"
FT                   /db_xref="GOA:B6A3I3"
FT                   /db_xref="UniProtKB/TrEMBL:B6A3I3"
FT                   /protein_id="ACI58966.1"
FT                   /translation="MTDCETLTRRQDMVTLHVKEDETTGLGERDYVEHVSAQKLSGFER
FT                   IVVVAALALLSFVGFAAYSSSETDPVTTSAIAAPAGDSAPHHQPYGHCRESSPYAERVC
FT                   "
FT   gene            204066..204497
FT                   /locus_tag="Rleg2_5794"
FT   CDS_pept        204066..204497
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5794"
FT                   /product="Protein of unknown function DUF1810"
FT                   /note="PFAM: Protein of unknown function DUF1810; KEGG:
FT                   rec:RHECIAT_PA0000248 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5794"
FT                   /db_xref="EnsemblGenomes-Tr:ACI58967"
FT                   /db_xref="InterPro:IPR014937"
FT                   /db_xref="InterPro:IPR036287"
FT                   /db_xref="UniProtKB/TrEMBL:B6A3I4"
FT                   /protein_id="ACI58967.1"
FT                   /translation="MAGDIDYNLDRFVDAQNGVYEKALSELKAGRKSSHWMWFIFPQIS
FT                   GLGTSPMAEKYAIRSAEEATAYLADPILSSRLLRCVEAILSVKGRSAHEILGSPDDLKL
FT                   RSSMTLFAAISDHGSPFHRVIERFYQGKFDDRTMEILRT"
FT   gene            complement(204499..204693)
FT                   /locus_tag="Rleg2_5795"
FT   CDS_pept        complement(204499..204693)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5795"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rec:RHECIAT_PA0000247 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5795"
FT                   /db_xref="EnsemblGenomes-Tr:ACI58968"
FT                   /db_xref="UniProtKB/TrEMBL:B6A3I5"
FT                   /protein_id="ACI58968.1"
FT                   /translation="MNYVYLKRLYAKRAELEAKLELHDARYCFGEEEVDDGTDSDLRQR
FT                   LSEISDEIDALEAGRAARA"
FT   gene            complement(204765..205388)
FT                   /locus_tag="Rleg2_5796"
FT   CDS_pept        complement(204765..205388)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5796"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: ret:RHE_PE00303
FT                   putative transcriptional regulator protein, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5796"
FT                   /db_xref="EnsemblGenomes-Tr:ACI58969"
FT                   /db_xref="GOA:B6A3I6"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:B6A3I6"
FT                   /protein_id="ACI58969.1"
FT                   /translation="MSRTTSAKKSETSNEISAAVPEDRIPPRERIVSTASELFRERGIR
FT                   GIGVDAIADAALTNKMTLYRHFGSKDELVCETLRRASEKAGAIWRELEAAYPGNPRAQL
FT                   YAWVEMRAQCLNGEPAGCDLANAAIELKGEGHPAHEMIERHKAEQRDRLAALCSAADAR
FT                   EPELLADTLTLLLEGARVSRQAMGAASCCGHFAKACNAAIASFA"
FT   gene            205514..205729
FT                   /locus_tag="Rleg2_5797"
FT   CDS_pept        205514..205729
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5797"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rec:RHECIAT_PA0000245 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5797"
FT                   /db_xref="EnsemblGenomes-Tr:ACI58970"
FT                   /db_xref="UniProtKB/TrEMBL:B6A3I7"
FT                   /protein_id="ACI58970.1"
FT                   /translation="MRKTRDDLTISEALRDPLIAMVMRADGVKLEDFKQLLETAAGKRE
FT                   PRSTPVGNIIGAIASRANLPAMPCFG"
FT   gene            complement(205785..206315)
FT                   /locus_tag="Rleg2_5798"
FT   CDS_pept        complement(205785..206315)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5798"
FT                   /product="putative transcriptional regulator"
FT                   /note="KEGG: ret:RHE_PE00301 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5798"
FT                   /db_xref="EnsemblGenomes-Tr:ACI58971"
FT                   /db_xref="GOA:B6A3I8"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR014601"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B6A3I8"
FT                   /protein_id="ACI58971.1"
FT                   /translation="MADGRERQAEIGPIVSSAHLADGALPALSELEFGLILAGNAFDRW
FT                   MVRCMTAAGEPGCAPIDVLVLHSVAHRQRPKRLGDLCSVLGVEDTHLVIYAIKKLEKRG
FT                   LVKSTRAGKEKLIAATEKGLETCLKYRAVREALLVESVKGLGLDAAAASAVAATLRALS
FT                   GHYDQAARAAASF"
FT   gene            206401..210012
FT                   /locus_tag="Rleg2_5799"
FT   CDS_pept        206401..210012
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5799"
FT                   /product="5-oxoprolinase (ATP-hydrolyzing)"
FT                   /EC_number="3.5.2.9"
FT                   /note="PFAM: Hydantoinase/oxoprolinase; Hydantoinase
FT                   B/oxoprolinase; Hydantoinaseoxoprolinase domain protein;
FT                   KEGG: ret:RHE_PE00300 probable N-methylhydantoinase
FT                   (ATP-hydrolyzing)/5-oxoprolinase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5799"
FT                   /db_xref="EnsemblGenomes-Tr:ACI58972"
FT                   /db_xref="GOA:B6A3I9"
FT                   /db_xref="InterPro:IPR002821"
FT                   /db_xref="InterPro:IPR003692"
FT                   /db_xref="InterPro:IPR008040"
FT                   /db_xref="UniProtKB/TrEMBL:B6A3I9"
FT                   /protein_id="ACI58972.1"
FT                   /translation="MGGQWDFWIDRGGTFTDIVARRPDGALIAHKLLSENPEAYRDPAV
FT                   HGIRELLGLKAGDPVPSERIGAVKMGTTVATNALLERKGDPTLLVTTKGFRDALEIGYQ
FT                   ARADIFAKKIVKPELLYAGVIEADERVLADGTVERPLDEDRLRRALEAAYAEGLRAVAI
FT                   VFMHAYRYPEHEQRAAAIARAIGFTQISPSHVVSPLIKLVGRGDTAVVDAYLSPVLRRY
FT                   VDQVATELGAVEGQGPKLMFMQSSGGLTDAHLFQGKDAILSGPAGGVVGAVEVSRIAGF
FT                   GQMIGFDMGGTSTDVSHYDGELERAFETEVAGVRMRAPMMKIHTVAAGGGSILSFDGSR
FT                   FRVGPESAGATPGPKSYRRGGPLTVTDANIMTGKLLPEFFPAIFGPGQDQPLDAEAVHA
FT                   AFAEMAKTIGGGRTAEDAADGFLAIAVENMANAIKKISVQRGYDVSGYALTCFGGAGGQ
FT                   HACLVADSLGMKRVLIHPFSGILSAYGMGLADIRATRQRAVLTELATALVTIGEIRARL
FT                   EAEVREELTLQGVETADMEVVTRLHLQYKGTDTALPVAFGPQEEMVQAFAVAHKKQFGF
FT                   IFEDRPVVVDSIEVEGIGGGADIEETYREAKVFEPEALRTTRFYSGGTWQDAGIFKREA
FT                   LKPGAILKGPALIIEAHQTIVVEAGWQARLTGHDHIVLTREIPLARHAAIGTSADPVML
FT                   EVFNNLFMAIAEQMGVTLQNTAHSVNIKERLDFSCAVFDRTGALVANAPHMPVHLGSMD
FT                   RSVETIIRLNEDRIRRGDVFALNAPYNGGTHLPDITVVTPVFDDAGAVILFYVASRGHH
FT                   ADIGGKAPGSMTPRATKVDEEGVLIDNFLLVDKGRFREADFAAMLQDHPYPARNPAQNL
FT                   ADVKAQIAANEKGVQELRKMVSHFGLDVVEAYMGHVQDNAEESVRRVIARLSDSEFTYP
FT                   TDQGAVIKVKITVDRQAREVTVDFTGTSAQQPTNFNAPEPVTRAAVLYVFRVMVEQPIP
FT                   MNAGCLRPIRIIVPDGSMLRPAYPAAVVAGNVETSQHVTNALFGALGTLAAAQGSMNNL
FT                   TFGNAAYQYYETICAGGPAGLLNDGTGFSGADGVHTHMTNSRLTDPEVLEFRFPVVLED
FT                   FHIRRGSGGKGQYSSGGGTERTIRFLETMDCSILSSHRTIRPFGLLGGEDGQLGKTEIR
FT                   RADGKVERLEGADQAMLVAGDAVIVTTPTGGGYGKPV"
FT   gene            complement(210009..210866)
FT                   /locus_tag="Rleg2_5800"
FT   CDS_pept        complement(210009..210866)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5800"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR
FT                   domain protein; KEGG: rec:RHECIAT_PA0000243 putative
FT                   oxidoreductase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5800"
FT                   /db_xref="EnsemblGenomes-Tr:ACI58973"
FT                   /db_xref="GOA:B6A3J0"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B6A3J0"
FT                   /protein_id="ACI58973.1"
FT                   /translation="MTNYPTPPFPSQKQPMPGFTAQMDPVPDHGEKTYRGSERLKGKRA
FT                   IITGGDSGIGRAVAIAYAREGADIVISYLDEDEDADETKRLVEEAGRKAVLVSGDIQDP
FT                   ALCRQIVETAVEELGGIDILVNNAAHQASFKSIDEISEEEWELTFKVNIHAMFYLTKAA
FT                   VPHMKPGSSIINTASINSDSPNPTLLAYATTKGAIQNFTAGLAQLLAEKGIRANAVAPG
FT                   PIWTPLIPSTLPAESVSNFGKQVPMKRPGQPAELATTYVMLADPLSSYVSGATIAVTGG
FT                   KPIL"
FT   gene            210976..211224
FT                   /locus_tag="Rleg2_5801"
FT   CDS_pept        210976..211224
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5801"
FT                   /product="prevent-host-death family protein"
FT                   /note="TIGRFAM: prevent-host-death family protein; KEGG:
FT                   swi:Swit_1318 prevent-host-death family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5801"
FT                   /db_xref="EnsemblGenomes-Tr:ACI58974"
FT                   /db_xref="InterPro:IPR006442"
FT                   /db_xref="InterPro:IPR036165"
FT                   /db_xref="UniProtKB/TrEMBL:B6A3J1"
FT                   /protein_id="ACI58974.1"
FT                   /translation="MARVKLEEAEARLSELLDRVEAGEIFEILRHDKPVAQLVPMRTSA
FT                   KPIDVEQLKTFTASMEPPDELVDSATFIRGMRDTDRY"
FT   gene            211433..212266
FT                   /locus_tag="Rleg2_5802"
FT   CDS_pept        211433..212266
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5802"
FT                   /product="transcriptional regulator, IclR family"
FT                   /note="PFAM: regulatory protein IclR; Transcriptional
FT                   regulator IclR; KEGG: rec:RHECIAT_PA0000242 putative
FT                   transcriptional regulator protein, IclR family"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5802"
FT                   /db_xref="EnsemblGenomes-Tr:ACI58975"
FT                   /db_xref="GOA:B6A3J2"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B6A3J2"
FT                   /protein_id="ACI58975.1"
FT                   /translation="MDGKTSPAVYSEDEGHADEAAGKGARRARVSGIDRALQVIDHLYE
FT                   TGSPAGVYAIAKAVKAPLSTVYVIVDDLVEKNMLTRQADGSIWLGARLYHYGLAYARSL
FT                   DFMSIATHEMHDLCRQAGETVQVCGRDGDYMLVLAMADGPSHFQVASRVGTRVPLNWTA
FT                   SGRLLVGHLPEDERIELFKRCARSSPTGRAEIDPGTLSESAGKAFEDRLSIQAGESDYA
FT                   VACIASPICDRDGQCVATISIVLPEQKAFSDENHYTAHVRSSAERIEKLMGWRNR"
FT   gene            complement(212289..213503)
FT                   /locus_tag="Rleg2_5803"
FT   CDS_pept        complement(212289..213503)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5803"
FT                   /product="amidohydrolase"
FT                   /note="PFAM: amidohydrolase; KEGG: rec:RHECIAT_PA0000241
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5803"
FT                   /db_xref="EnsemblGenomes-Tr:ACI58976"
FT                   /db_xref="GOA:B6A3J3"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR020043"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:B6A3J3"
FT                   /protein_id="ACI58976.1"
FT                   /translation="MSMSGNQAKKPLLLTNVKPMAFGAGTPEGPVDILVDGDGRIARIG
FT                   PALAVSEDVTRIDGKGAFVSPGWIDLHVHIWHGGTDISIRPSECGLERGVTTLVDAGSA
FT                   GEANFHGFREYIIEPSRERIKAFLNLGSIGLVACNRVAELRDIRDIDLDRILEVYAENS
FT                   EHIVGIKVRASHVITGSWGVTPVKLGKKIAKILKVPMMVHVGEPPALYDEVLEILGPGD
FT                   VVTHCFNGKAGSSIMEDEDLFNLAERCASEGIRLDIGHGGASFSFKVAEAAIARGLLPF
FT                   SISTDLHGHSMNFPVWDLATTMSKLLSVGMPFDKVVEAVTHAPASVIKLSMENRLAVGA
FT                   QAEFTIFDLVDSDLEATDSNGDVSVLNKLFEPRYAVIGTDAVTASRYVPRARKLVRHSH
FT                   GYSYR"
FT   gene            complement(213669..214538)
FT                   /locus_tag="Rleg2_5804"
FT   CDS_pept        complement(213669..214538)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5804"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /note="TIGRFAM: RNA polymerase sigma factor, sigma-70
FT                   family; PFAM: sigma-70 region 2 domain protein; Sigma-70
FT                   region 4 type 2; KEGG: ret:RHE_PE00294 probable RNA
FT                   polymerase sigma factor protein, ECF subfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5804"
FT                   /db_xref="EnsemblGenomes-Tr:ACI58977"
FT                   /db_xref="GOA:B6A3J4"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:B6A3J4"
FT                   /protein_id="ACI58977.1"
FT                   /translation="MNEKKWLADQFEANRAHLRAAAYRMLGSRSEAEDAVQEAWLRLNR
FT                   ADTTDIGNLGGWLTTVVARICLDMLRARKTRREQPLEMPVHAAIADPAHDPERDAAFAE
FT                   SVGVALLVVLQTLAPAERVAFVLHDMFDLPFDEIAPIIGRTSAAARQLASRARRRVQGT
FT                   DEAPDVDFGRKRTIAEAFLTASRIGDLEALLAVLAPDVVFRPDATAARFGPFGGRRGAS
FT                   EVAELFKGRAQAAEAALVDGEVGFIVRIKGELRVVVTLTIVDGKVTVIEAFADPDYLEH
FT                   VDYSVLSS"
FT   gene            214666..215124
FT                   /locus_tag="Rleg2_5805"
FT   CDS_pept        214666..215124
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5805"
FT                   /product="alkylhydroperoxidase like protein, AhpD family"
FT                   /note="TIGRFAM: alkylhydroperoxidase like protein, AhpD
FT                   family; PFAM: Carboxymuconolactone decarboxylase; KEGG:
FT                   rec:RHECIAT_PA0000239 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5805"
FT                   /db_xref="EnsemblGenomes-Tr:ACI58978"
FT                   /db_xref="GOA:B6A3J5"
FT                   /db_xref="InterPro:IPR003779"
FT                   /db_xref="InterPro:IPR004675"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="UniProtKB/TrEMBL:B6A3J5"
FT                   /protein_id="ACI58978.1"
FT                   /translation="MRERMGNPALVLPAAMQALTALAKVPAEAGLSPKLLELVNLRASQ
FT                   INGCSVCIDGHPRIAKKLGETDERLFAVSAWRDTPYFSGAERAALALTEAVTRTSDRSD
FT                   PVPDEIWDEATRHYDGKSLAALVIAIANINVWNRLNIATRQIAGAWKP"
FT   sig_peptide     214666..214737
FT                   /locus_tag="Rleg2_5805"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.993) with cleavage site probability 0.986 at
FT                   residue 24"
FT   gene            complement(215173..216465)
FT                   /locus_tag="Rleg2_5806"
FT   CDS_pept        complement(215173..216465)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5806"
FT                   /product="L-rhamnose catabolism isomerase"
FT                   /note="TIGRFAM: L-rhamnose catabolism isomerase; PFAM:
FT                   Xylose isomerase domain protein TIM barrel; KEGG:
FT                   rec:RHECIAT_PA0000238 putative sugar isomerase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5806"
FT                   /db_xref="EnsemblGenomes-Tr:ACI58979"
FT                   /db_xref="GOA:B6A3J6"
FT                   /db_xref="InterPro:IPR013451"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:B6A3J6"
FT                   /protein_id="ACI58979.1"
FT                   /translation="MAEFRIAQDLVATENDKRATALKADYEALGANLDRRGVDIEAITR
FT                   KVAEFFVAVPSWGVGTGGTRFARFPGTGEPRGIFDKLDDCAVINQLTQATPNVSLHIPW
FT                   DKADTKELKARGDALGLGFDAMNSNTFSDAPGQAHSYKYGSLSHTDAATRAQAVEHNLE
FT                   CIEIGKALGSKALTVWIGDGSNFPGQSNFTKAFERYLASMADIYKALPDDWKLFSEHKM
FT                   YEPAFYSTIVQDWGTNYLIAQTLGPKAYCLVDLGHHAPNTNIEMIVARLIQFGKLGGFH
FT                   FNDSKYGDDDLDAGAIDPYRLFLVFNELVDAEQRGVNDFDPAHMIDQSHNVTDPIESLI
FT                   NSANEIRRAYAQALIVDRKALDGYQQDNDALMASETLKRAYRADVEPILAEARRRAGGA
FT                   IDPIAAYRASGYRKKIAAERPASTAGGGGII"
FT   gene            complement(216681..218777)
FT                   /locus_tag="Rleg2_5807"
FT   CDS_pept        complement(216681..218777)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5807"
FT                   /product="rhamnulose-1-phosphate aldolase/alcohol
FT                   dehydrogenase"
FT                   /note="TIGRFAM: rhamnulose-1-phosphate aldolase/alcohol
FT                   dehydrogenase; PFAM: short-chain dehydrogenase/reductase
FT                   SDR; KEGG: rec:RHECIAT_PA0000237 putative oxidoreductase
FT                   protein, short-chain dehydrogenases/reductases (SDR)
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5807"
FT                   /db_xref="EnsemblGenomes-Tr:ACI58980"
FT                   /db_xref="InterPro:IPR001303"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR013454"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036409"
FT                   /db_xref="UniProtKB/TrEMBL:B6A3J7"
FT                   /protein_id="ACI58980.1"
FT                   /translation="MAANVRLLDNRWDDAYAAGLDEPGKLLYRSNLLGADKRITNYGGG
FT                   NTSAKVMETDPLDGGTVKVLWVKGSGGDVGTIKLDGFATLYQDKLEALKGIYKGVEDED
FT                   RMVGFLPHCTFNLNARAASIDTPLHGFVPFTHVDHMHPDAIIAIAASKNSRELTQQIFG
FT                   AEIGWLPWRRPGFQLGLDLEAFVKANPNAKGVVLESHGLFTWADDAKACYELTLDIINK
FT                   AIVWFAEKTEGKTIFGGAVTESLPVAERRAIAARLMPEIRGRIGKQERKLGHFDDQDAV
FT                   LEFVNSKDLRPLGALGTSCPDHFLRTKIRPLIVDFDPAKPDVDAIVAGLDQALEDYRAD
FT                   YARYYNDCKHDNSPAMRDANPVIFLVPGVGMLSFARDKATARIASEFYVNAINVMRGAS
FT                   TVSEYQGLPEQEAFDIEYWLLEEAKLQRMPKPKSLAGRVAFVTGGAGGIGRATAARLVG
FT                   EGACVVLADIDQAALEGTEADFVKKFGADAVRSVRLDVTKEVAVVASFAEASVEFGGID
FT                   ILVSNAGIASSAPIEATELATWNRNIDILATGYFLVSREAFRLFRRQALGGNIVFVASK
FT                   NGLAASPNAAAYCTAKAAEIHLARCLALEGADAGIRVNTVNPDAVLRGSKIWSGEWREQ
FT                   RAASSKIEVDDLEEHYRKRSMLKLNVFPEDIAEAIYFLASDLSAKSTGNIINVDAGNVQ
FT                   SFTR"
FT   gene            218975..219787
FT                   /locus_tag="Rleg2_5808"
FT   CDS_pept        218975..219787
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5808"
FT                   /product="transcriptional regulator, DeoR family"
FT                   /note="PFAM: regulatory protein DeoR; Helix-turn-helix type
FT                   11 domain protein; KEGG: rec:RHECIAT_PA0000236 probable
FT                   transcriptional regulator protein, DeoR family"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5808"
FT                   /db_xref="EnsemblGenomes-Tr:ACI58981"
FT                   /db_xref="GOA:B6A3J8"
FT                   /db_xref="InterPro:IPR001034"
FT                   /db_xref="InterPro:IPR014036"
FT                   /db_xref="InterPro:IPR018356"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:B6A3J8"
FT                   /protein_id="ACI58981.1"
FT                   /translation="MHERERHRIILSAVQEKSVVTIQDIAELTEASEATIRRDIAALHV
FT                   QGKIRRVRGGAEAVHPPQLGNLAGRPFRVSESVNIDKKRAIARAAVDLCEAGDAIIING
FT                   GTTTFQMVHYMAGHRLQVMTNSFAIAEHLVKHSKNTVTVPGGAIYREQSLILSPFDNDA
FT                   IRNFYARRMFIGAQGVGPLGIMEADALIIQSEQKLMHQADELVVMVDSSKFNRRSSLIL
FT                   CALDRVSVVITDDGISDEAARMIENAGVRLVVASPVAQAVREDSSSVA"
FT   gene            219834..220829
FT                   /locus_tag="Rleg2_5809"
FT   CDS_pept        219834..220829
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5809"
FT                   /product="rhamnose ABC transporter, periplasmic
FT                   rhamnose-binding protein"
FT                   /note="TIGRFAM: rhamnose ABC transporter, periplasmic
FT                   rhamnose-binding protein; PFAM: periplasmic binding
FT                   protein/LacI transcriptional regulator; KEGG:
FT                   ret:RHE_PE00289 probable sugar ABC transporter,
FT                   substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5809"
FT                   /db_xref="EnsemblGenomes-Tr:ACI58982"
FT                   /db_xref="GOA:B6A3J9"
FT                   /db_xref="InterPro:IPR013459"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="InterPro:IPR030159"
FT                   /db_xref="UniProtKB/TrEMBL:B6A3J9"
FT                   /protein_id="ACI58982.1"
FT                   /translation="MKLAKTLALGVALAVAMMAGTASAKDIKIGLVVKSLGNGFFDAAN
FT                   KGAQEAAKELGGVEVIYTGPTSTTAEGQIEVINSLIAQGVDAIAVSANDPDALVPALKK
FT                   ATQRGIKVISWDSGVAPEGRILQLNPSSNELIGKMCLTLVKDHLDGGKGDFAILSATTT
FT                   STNQNIWIDQMKKQLKDFPGLNLVTTVYGDDLSDKSYREAEGLLKSNPNVKVIVAPTTV
FT                   GVLAASKVVEDKGLVGKVYVTGLGLPSEMAGAIKSGATKEFAIWNPIDLGYSATQIAYR
FT                   LVKGETDGKPGSEIAAGRMGKIKVGDNSEAAMADPFVYNASNIDEFSKVF"
FT   sig_peptide     219834..219908
FT                   /locus_tag="Rleg2_5809"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 25"
FT   gene            220902..222437
FT                   /locus_tag="Rleg2_5810"
FT   CDS_pept        220902..222437
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5810"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: ret:RHE_PE00288 probable sugar ABC transporter,
FT                   ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5810"
FT                   /db_xref="EnsemblGenomes-Tr:ACI58983"
FT                   /db_xref="GOA:B6A3K0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR015861"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B6A3K0"
FT                   /protein_id="ACI58983.1"
FT                   /translation="MNAAFQQTITDSKTGDAPAILEMRGISQIFPGVKALDNVSIALHP
FT                   GTVTALIGENGAGKSTLVKILTGIYRPNEGEILVDGRPTSFASAQAAIDAGVTAIHQET
FT                   VLFDELTVAENIFLGHAPRTRFRTIDWQAMNNRSKALLIALESNIDPTIRLKDLSIAQR
FT                   HLVAIARALSIEARIVIMDEPTAALSRKEIDDLFRIVRGLKEQGKAILFISHKFDEVYE
FT                   IADDFVVFRDGRAIGQGRLKDTPQDEIVRMMVGRDVENAFPKIDVAIGGPVLEIRNYSH
FT                   RTEFRDISFTLRKGEILGIYGLIGAGRSELSQSLFGITKPLSGTMMLEGREIAIHSPQD
FT                   AIRAGIVYVPEERGRHGLALPMPIFQNMTLPSLTRTSRRGFLRAAEEFALARKYAERLD
FT                   LRAAALSVPVGTLSGGNQQKVVIGKWLATSPKVIILDEPTKGIDIGSKAAVHGFISELA
FT                   AEGLSIIMVSSELPEIIGMSDRVLVMKEGLAAGMFERAELSPEALVRAATGNA"
FT   gene            222463..223464
FT                   /locus_tag="Rleg2_5811"
FT   CDS_pept        222463..223464
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5811"
FT                   /product="Monosaccharide-transporting ATPase"
FT                   /EC_number="3.6.3.17"
FT                   /note="PFAM: inner-membrane translocator; KEGG:
FT                   ret:RHE_PE00287 probable sugar ABC transporter, permease
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5811"
FT                   /db_xref="EnsemblGenomes-Tr:ACI58984"
FT                   /db_xref="GOA:B6A3K1"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:B6A3K1"
FT                   /protein_id="ACI58984.1"
FT                   /translation="MARLIRKRETLLFLIIVVMIAIFSTRAADFATPDNLAGIFNDTSI
FT                   LIILALAQMTVILTKSIDLSVAANLAFTGMAIAMMNAAYPDLPLVVLILMAIVIGACLG
FT                   AINGFLVWALEIPPIVVTLGTLTIYRGMAFVLSGGAWVNAHQMTPIFLSVPRTPILGLP
FT                   VLGWVGIIIVLLMYVLLRYTQFGRSAYATGGNPTAAVYAGIDTGWTKFLAFVLSGALAG
FT                   LSSYLWVSRYAVAYVDIANGFELDSVAACVIGGISIAGGVGSVAGTVLGALFLGVIKNA
FT                   LPVIGISPFTQMAISGTVIILAVAFNARRERNRGRIILRDRAAAEIRTEAAA"
FT   sig_peptide     222463..222546
FT                   /locus_tag="Rleg2_5811"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.974 at
FT                   residue 28"
FT   gene            223461..224468
FT                   /locus_tag="Rleg2_5812"
FT   CDS_pept        223461..224468
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5812"
FT                   /product="Monosaccharide-transporting ATPase"
FT                   /EC_number="3.6.3.17"
FT                   /note="PFAM: inner-membrane translocator; KEGG:
FT                   ret:RHE_PE00286 probable sugar ABC transporter, permease
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5812"
FT                   /db_xref="EnsemblGenomes-Tr:ACI58985"
FT                   /db_xref="GOA:B6A3K2"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:B6A3K2"
FT                   /protein_id="ACI58985.1"
FT                   /translation="MSTVSTPEKRVIPDRLGTPLRRIVASWEVLLFGVAVLIFIFNSLA
FT                   SPYFLDAWNLSDATFNFTEKAMIAFAMALLVISGEIDLSVAAIIALASTAMGAAAQFGI
FT                   GTPGLVLIGIGTGLVCGIFNGVLVSVLKLPSIVVTIGTMSLFRGISYIVLGDQAYGKYP
FT                   ADFAYFGQGYVVWVFSFEFVLFIVLAILFAILLHATNFGRQVYAIGNNDFAARFSGIPV
FT                   ERVKFILFLLTGIMSGIAAVCLTSRLGSTRPSIAQGWELEVVTMVVLGGISILGGSGTI
FT                   GGVVIAAFVMGLVTFGLGLLNVPGIVMSIFIGLLLIITIAIPIIARRIKLMSSR"
FT   gene            224465..224785
FT                   /locus_tag="Rleg2_5813"
FT   CDS_pept        224465..224785
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5813"
FT                   /product="L-rhamnose 1-epimerase"
FT                   /note="TIGRFAM: L-rhamnose 1-epimerase; PFAM: protein of
FT                   unknown function DUF718; KEGG: ret:RHE_PE00285 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5813"
FT                   /db_xref="EnsemblGenomes-Tr:ACI58986"
FT                   /db_xref="GOA:B6A3K3"
FT                   /db_xref="InterPro:IPR008000"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR013448"
FT                   /db_xref="UniProtKB/TrEMBL:B6A3K3"
FT                   /protein_id="ACI58986.1"
FT                   /translation="MTLEKHAFKMQLNPGMEAEYRKRHDEIWPELVDLLHKSGASDYSI
FT                   HLDRETNTLFGVLTRPADHTMASLPEHPVMKKWWAYMADIMAVNPDNSPVQSDLVTLFH
FT                   MP"
FT   gene            224782..226161
FT                   /locus_tag="Rleg2_5814"
FT   CDS_pept        224782..226161
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5814"
FT                   /product="carbohydrate kinase FGGY"
FT                   /note="PFAM: carbohydrate kinase FGGY; KEGG:
FT                   rec:RHECIAT_PA0000230 putative sugar kinase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5814"
FT                   /db_xref="EnsemblGenomes-Tr:ACI58987"
FT                   /db_xref="GOA:B6A3K4"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="UniProtKB/TrEMBL:B6A3K4"
FT                   /protein_id="ACI58987.1"
FT                   /translation="MTAPSYRRIAVLDIGKTNAKVVVLDSATGAEIAVLKRPNVAIKTG
FT                   LYPHYDIEALWSFALDALKSLAREPGFDAISITTHGAAAALLDRDGGLAMPVIDYEHEY
FT                   PEEIRDAYTALRPAFDETFSPRLTMGLNVGAQLHYQKSAFPEAFAEVATILTYAQYWTA
FT                   RLTGVAANELTSLGCHTDLWNPRTGDYSSLVDRLGVRALMAPIRSAFDALGPVLPGIAD
FT                   QLGLAAPVPVYCGIHDSNASLLPHLVHRAAPFAVVSTGTWVINFGVGGDLDHLDAKRDA
FT                   LANVDAYGRAVPSSRFMGGREFEILSAEIGPVDEKAAQAAIGPVIEKGMMLLPNIAPGS
FT                   GPFPGKASRWIGAEGASREERHAAACLYLALMTDACLGLIGAKGPVIVEGPFALNETYL
FT                   KLLAALAGRDVLALPGSTGTSQGAALLTGIRPVSGAETHVPPVEVAGLAAYRDRWYAAM
FT                   E"
FT   gene            226251..227009
FT                   /locus_tag="Rleg2_5815"
FT   CDS_pept        226251..227009
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5815"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ret:RHE_PE00283 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5815"
FT                   /db_xref="EnsemblGenomes-Tr:ACI58988"
FT                   /db_xref="GOA:B6A3K5"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/TrEMBL:B6A3K5"
FT                   /protein_id="ACI58988.1"
FT                   /translation="MAETFDPRGLAARLHSLRQAGRQEETGTFALPADLHQAMEAQNFL
FT                   TAADGISSNAWKVTVSPQGQAVTGPLHPYAEAASGASVPWYPGMKFETEIAVRLGRDLP
FT                   IRTGTPYSRADVVEAISAVHLGAELLVSAVSEGGSVSFLLFTSDRLGNSGYVLGPKLDK
FT                   SAVDTAGGTPLKVTHGGRTIYDGPAQHPKGDVLTWLVDYANDGLRPETSLKAGALITTG
FT                   TLSGAIELTEPGEIDILFGDSRLHFSVSKV"
FT   gene            227108..227887
FT                   /locus_tag="Rleg2_5816"
FT   CDS_pept        227108..227887
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5816"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: ret:RHE_PE00282 ferrichrome-iron transporter,
FT                   ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5816"
FT                   /db_xref="EnsemblGenomes-Tr:ACI58989"
FT                   /db_xref="GOA:B6A3K6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B6A3K6"
FT                   /protein_id="ACI58989.1"
FT                   /translation="MPSPFLALSGIEYAIGPKSILHGIDLMLEQGRIYGLVGPNGSGKS
FT                   TLLKIIARQVAAKSGAIAFGGKPAGDWGAREFARHVAYMPQFTPATDGMTVRELIALGR
FT                   FPWHGTLGRFTATDRNKVEEAIARTELANFADRLVANMSGGERQRAWIAMMLAQDARCL
FT                   LLDEPTSALDLAHQASVLSLVQELSHERGLTVIIVLHDINLAARYCDAIVALNRGRITA
FT                   EGTPTEIMQADKLQSIFGVGMGVFPHPVRNEPVSYLL"
FT   gene            complement(227895..228776)
FT                   /locus_tag="Rleg2_5817"
FT   CDS_pept        complement(227895..228776)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5817"
FT                   /product="3-hydroxyisobutyrate dehydrogenase"
FT                   /EC_number="1.1.1.31"
FT                   /note="KEGG: ret:RHE_PE00281 putative 3-hydroxyisobutyrate
FT                   dehydrogenase protein; TIGRFAM: 3-hydroxyisobutyrate
FT                   dehydrogenase; PFAM: NADP oxidoreductase coenzyme
FT                   F420-dependent; 6-phosphogluconate dehydrogenase
FT                   NAD-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5817"
FT                   /db_xref="EnsemblGenomes-Tr:ACI58990"
FT                   /db_xref="GOA:B6A3K7"
FT                   /db_xref="InterPro:IPR002204"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR011548"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR015815"
FT                   /db_xref="InterPro:IPR029154"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B6A3K7"
FT                   /protein_id="ACI58990.1"
FT                   /translation="MARIAFIGLGNMGGPMAANLVKSGHEVLGFDLAASVLKAAEESGV
FT                   KPASHASQAVKDAEIVITMLPQGRHVLTAWTDILQTAAQNTLVIDCSTIDVESSRKAHE
FT                   MAKAASCLSLDAPVSGGTGGATAGTLTFMAGGSDEAFARAKPILEAMGKKIVHCGEAGA
FT                   GQAAKICNNMILGISMVGVCEAFVLAEKLGLSHQALFDVASTSSGQCWSINTYCPVPGP
FT                   VPTSPANNDYKPGFAAALMLKDLRLSQEAALASGASTPMGAEAAQLFALFEKQGNGGRD
FT                   FSAIIEMFREKV"
FT   gene            complement(228786..230381)
FT                   /locus_tag="Rleg2_5818"
FT   CDS_pept        complement(228786..230381)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5818"
FT                   /product="glucose-methanol-choline oxidoreductase"
FT                   /note="PFAM: glucose-methanol-choline oxidoreductase; GMC
FT                   oxidoreductase; KEGG: rec:RHECIAT_PA0000226 probable
FT                   alcohol dehydrogenase protein, glucose-methanol-choline
FT                   (GMC) family"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5818"
FT                   /db_xref="EnsemblGenomes-Tr:ACI58991"
FT                   /db_xref="GOA:B6A3K8"
FT                   /db_xref="InterPro:IPR000172"
FT                   /db_xref="InterPro:IPR007867"
FT                   /db_xref="InterPro:IPR012132"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B6A3K8"
FT                   /protein_id="ACI58991.1"
FT                   /translation="MDRYDYIIIGAGSAGCVLANRLSADGRSRVLLLEAGGSDNYHWIH
FT                   IPVGYLYCINNPRTDWCFTTAPEAGLNGRALSYPRGKVLGGCSSINGMIYMRGQARDYD
FT                   LWRQMGCSGWGWDDVLPFFRKSEDFYRGADDMHGAGGEWRIERARVRWAVLDAFQQAAR
FT                   EAGIPETADFNRGSNEGSGYFDVNQRSGIRWNTSKAFLRPARKRSNLTVLIKAQVRRLL
FT                   VEEGAVAGVEYQHNGVAKRAYAGKETILSAGSIGSPHVLELSGIGRGEVLQRAGVDVIT
FT                   EVKGIGENLQDHLQLRLAYKVTGVPTLNEKATKLIGKAAIGLEYLVRRSGPMAMAPSQL
FT                   GIFTRSGPDRETPDLQYHVQPVSLEKFGDPVHPFPAITASVCNLRPESRGSVHLSSPDF
FT                   AAQPTISPKYLSTQRDRDIAVRSIRLTRKIVAQPSFARFKPEEFKPGPSYQTEADLERA
FT                   AGEIGTTIFHPVGTCRMGADRDSVVDPRLKLRALGKLRIADASVMPSITSGNTNSPTIM
FT                   IAEKAAAMILEDNR"
FT   gene            complement(230492..231481)
FT                   /locus_tag="Rleg2_5819"
FT   CDS_pept        complement(230492..231481)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5819"
FT                   /product="inner-membrane translocator"
FT                   /note="PFAM: inner-membrane translocator; KEGG:
FT                   rec:RHECIAT_PA0000225 probable branched-chain amino acid
FT                   ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5819"
FT                   /db_xref="EnsemblGenomes-Tr:ACI58992"
FT                   /db_xref="GOA:B6A3K9"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:B6A3K9"
FT                   /protein_id="ACI58992.1"
FT                   /translation="MADITDTIRTERSRTALSVQAGFLAIGLLLLLLAPFFFYPIFLMK
FT                   LLCFALFACAFNLLLGYTGLLSFGHATFFGGAAYFTAYTVKTWGLPPELGILIGVAGAA
FT                   FLGLVMGFFAIRRQGIYFAMITLALSQMFFFFCLQAKFTEGEDGIQSVPRGHLFGFIDL
FT                   NSSTNMYYFVLGVFIIGVLIIWRFINSPFGMILKSIRENENRAISLGYSVARYKLGAFV
FT                   MSAALAGLAGAVKSIVFQFATLTDVAWQMSGEVILMTLLGGIGTLIGPLFGAGLVVALE
FT                   NYLATSEFPVTIITGIVFMVCVLIFRRGIIGEFYASRLGRKLGFVYRR"
FT   gene            complement(231483..232370)
FT                   /locus_tag="Rleg2_5820"
FT   CDS_pept        complement(231483..232370)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5820"
FT                   /product="inner-membrane translocator"
FT                   /note="PFAM: inner-membrane translocator; KEGG:
FT                   ret:RHE_PE00278 probable branched-chain amino acid ABC
FT                   transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5820"
FT                   /db_xref="EnsemblGenomes-Tr:ACI58993"
FT                   /db_xref="GOA:B6A3L0"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:B6A3L0"
FT                   /protein_id="ACI58993.1"
FT                   /translation="MTMIFGIPLQALLGQLLIGLINGSFYALLSLGLAIIFGLLRVINF
FT                   AHGAQYMLGAFVAYLLLTYAGIGYWPSLILAPVIVGLGGAIIERLFLRRLYDLDPLYGL
FT                   LFTFGLALAVEGTFRYLYGSSGQPYATPAALAGGANLGFMFLPIYRGWVVVVSLVVCLG
FT                   TWLLIEKTKLGAYLRAATENAVLVQVFGVNVPVLLTLTYALGAGLAAFAGVLAAPIYQV
FT                   SPLMGSNMIIVVFAVVVVGGMGSIMGAIITGYVLGIAEGLTKVFYPEASNIVIFVIMAI
FT                   VLLIRPAGLFGRDA"
FT   gene            complement(232375..233076)
FT                   /locus_tag="Rleg2_5821"
FT   CDS_pept        complement(232375..233076)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5821"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: ret:RHE_PE00277 probable branched-chain amino acid
FT                   ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5821"
FT                   /db_xref="EnsemblGenomes-Tr:ACI58994"
FT                   /db_xref="GOA:B6A3L1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B6A3L1"
FT                   /protein_id="ACI58994.1"
FT                   /translation="MAALLEIQGLNAWYGESHVLHGVDMRVAEGETITILGRNGVGKTT
FT                   TLRTITGIVRARKGRISFAGSDMMQVPLHKTAHRGIGFVPEERGIFSTLTVSENLLLPP
FT                   VVAKGGMTLDEIYELFPNLYERRGSPGTKLSGGEQQMLAIARILRTGVRLLILDEPTEG
FT                   LAPVIVQRIGEVLQTLKGRGMTILLVEQNFRFASRIADRFYLMDHGQMVSEFPVGELPQ
FT                   RMDTLHKVLGV"
FT   gene            complement(233076..233858)
FT                   /locus_tag="Rleg2_5822"
FT   CDS_pept        complement(233076..233858)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5822"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: rec:RHECIAT_PA0000222 putative branched-chain amino
FT                   acid ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5822"
FT                   /db_xref="EnsemblGenomes-Tr:ACI58995"
FT                   /db_xref="GOA:B6A3L2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032823"
FT                   /db_xref="UniProtKB/TrEMBL:B6A3L2"
FT                   /protein_id="ACI58995.1"
FT                   /translation="MAVSAIETQEKPRVVLSARGLRRDFGGFTAVKNVDLDVHDASVHA
FT                   LIGPNGAGKTTVFNLLTKFLQPTSGTITLMGTDITGTPPDKVARMGLVRSFQISAVFPH
FT                   LSVLDNVRVALQRPNNLSTQFWRPLSALDRLNERAEQLLASVGLSKERDHIAADLSYGR
FT                   KRVLEIATTLALDPKVLLLDEPMAGMGLEDVGVVSAIIRDVARDRAVLMVEHNLSVVAN
FT                   ICQHVTVLQRGEILAEGDYATVSQDERVRVAYMGTEEH"
FT   gene            complement(233864..235069)
FT                   /locus_tag="Rleg2_5823"
FT   CDS_pept        complement(233864..235069)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5823"
FT                   /product="putative branched-chain amino acid ABC
FT                   transporter, substrate-binding protein"
FT                   /note="KEGG: rec:RHECIAT_PA0000221 probable branched-chain
FT                   amino acid ABC transporter, substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5823"
FT                   /db_xref="EnsemblGenomes-Tr:ACI58996"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:B6A3L3"
FT                   /protein_id="ACI58996.1"
FT                   /translation="MRKNLVASVAFLLASSTAVLAQSATDGKVKIGILNDQSGVYADFG
FT                   GKSSVEAAKMAVEDFGGKVLGVPVEIVDADHQNKPDIASNIARQWYDTEQVDAIMELTT
FT                   SSVALAVQAIAKEKKKIDIVTGAATTDLTGKACSPYGFHWAYDTHALAVGTGGALVKQG
FT                   GDSWFFLTADYAFGYSLEQQTTDYVKASGGTVVGAVRHPLSTQDFSSFLLQAQSSGAKV
FT                   IGLANAGLDTSNAIKQAAEFGITQGGQHLAALLFTLAEVHGLGLEAAQGLTLTEGFYWN
FT                   RDDDSRAFAKKFFARTGKMPNMIHTGTYSAVMQYLKAVQKAGTDETEAVAKQLHEMPVD
FT                   DVFGRGGTVGANGRMIHDMYLLQVKKPADSKEPWDYFNVLATIPGKEAYIDPAKSGCDL
FT                   VK"
FT   sig_peptide     complement(235004..235069)
FT                   /locus_tag="Rleg2_5823"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.962 at
FT                   residue 22"
FT   gene            235245..236198
FT                   /locus_tag="Rleg2_5824"
FT   CDS_pept        235245..236198
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5824"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: ret:RHE_PE00273 probable
FT                   transcriptional regulator protein, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5824"
FT                   /db_xref="EnsemblGenomes-Tr:ACI58997"
FT                   /db_xref="GOA:B6A3L4"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B6A3L4"
FT                   /protein_id="ACI58997.1"
FT                   /translation="MNNPPQFTWDDLQFFLAVARTGQLSTAARQLRSSHATVSRRIDRL
FT                   EFTLKVKLFERNPRGYVLTAMGTRFVETAERMEQETERLRADLADGSMAQRGLVRLSAP
FT                   EGFANFFFATVLPRFAAQHPHLSLELVTIQQIMSLSRKEADLSVVLDEPKGGPYFAERL
FT                   TDYHLQIYGSRDYLAKAPVITCRDDLLEHPFVSYIEEMIFAPGLDYLSDVHPRIKPQFQ
FT                   SSSIFAQLTATRNGLGLCILPYFFASRYPELVRVLPAEIDLKRHYWITCHRDLKQAPRV
FT                   RAVIDFLREAVRGEDARFVPPYVTPAGPARRAEADI"
FT   gene            complement(236208..237047)
FT                   /locus_tag="Rleg2_5825"
FT   CDS_pept        complement(236208..237047)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5825"
FT                   /product="putative membrane protein of unknown function"
FT                   /note="KEGG: bbt:BBta_3444 putative membrane protein of
FT                   unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5825"
FT                   /db_xref="EnsemblGenomes-Tr:ACI58998"
FT                   /db_xref="GOA:B6A3L5"
FT                   /db_xref="InterPro:IPR025201"
FT                   /db_xref="InterPro:IPR038318"
FT                   /db_xref="UniProtKB/TrEMBL:B6A3L5"
FT                   /protein_id="ACI58998.1"
FT                   /translation="MSRDKDFSAAQIETAIADYNVSGDLDFSEMPPLAQYCVCLIMTAM
FT                   ATAIAAGFDRYEAIPNLSLIYVVPVVIGSVLFGLGPALFSAVLGALAYNFFFTEPRFSL
FT                   AVADTANIWAITVLFVIACVISAITSWGRRKGIDLQRTRQAQVALRVYAEGMAASRSID
FT                   DAARLTVASLKGFFQAPAVVLLSANGICDPQFADGERLTAIEMEAAISSSTSNSVVSSG
FT                   VYPYDESRFDFWPVATISGRRAIIGVAFDPDRRPADPGAMVEIVALVFGAVIDRFRT"
FT   gene            237299..238069
FT                   /locus_tag="Rleg2_5826"
FT   CDS_pept        237299..238069
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5826"
FT                   /product="2-keto-4-pentenoate hydratase-like protein"
FT                   /note="KEGG: bpa:BPP2186 putative decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5826"
FT                   /db_xref="EnsemblGenomes-Tr:ACI58999"
FT                   /db_xref="GOA:B6A3L6"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/TrEMBL:B6A3L6"
FT                   /protein_id="ACI58999.1"
FT                   /translation="MYFELKDATATILAKSRRHDELCDLPLGLISSDCEAYDIQATAQD
FT                   ALGSTCRGYAIVGTSEMSRRTLGLSKPIYSEIPTSALLVGAKDFRLPPGTIGAQCEFVF
FT                   TMRRPFPDAGEAIDRDSAADAVLECRPAIGIIGRRTRRVFMGDQPAIADFGLHTATICG
FT                   DRPGKLSLADLADIEITTFLFKQTVFSAKAASVMDNPLNAVVWLANELSARGKQLKSDD
FT                   VVATGSCTTVLQVWAGQHLAADFGPLGQLECVFT"
FT   gene            238255..238494
FT                   /locus_tag="Rleg2_5827"
FT   CDS_pept        238255..238494
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5827"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5827"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59000"
FT                   /db_xref="UniProtKB/TrEMBL:B6A3L7"
FT                   /protein_id="ACI59000.1"
FT                   /translation="MVSRNIPHEYFLLNTARAEGPVVGRLHGKAISASVVDRNGRRYLF
FT                   VGVAARDRWGRLDVLSLRRGEWIVAPDLIYAEAT"
FT   gene            complement(238712..239050)
FT                   /locus_tag="Rleg2_5828"
FT   CDS_pept        complement(238712..239050)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5828"
FT                   /product="Cupin 2 conserved barrel domain protein"
FT                   /note="PFAM: Cupin 2 conserved barrel domain protein; KEGG:
FT                   rec:RHECIAT_PA0000218 putative pectin degradation protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5828"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59001"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR025499"
FT                   /db_xref="UniProtKB/TrEMBL:B6A3L8"
FT                   /protein_id="ACI59001.1"
FT                   /translation="MSSSDLFVSAEGAEWVNPEPGVTRRIMTYLPEMMMVEVAFESGAV
FT                   GAAHSHPHIQASYVAEGSFEVTIDGRTEVLRQGGSFIVPPNLVHGVKALEKGRLIDTFT
FT                   PHRAEFLR"
FT   gene            239225..240412
FT                   /locus_tag="Rleg2_5829"
FT   CDS_pept        239225..240412
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5829"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein;
FT                   Acyl-CoA dehydrogenase type 2 domain; KEGG:
FT                   rec:RHECIAT_PA0000217 glutaryl-CoA dehydrogenase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5829"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59002"
FT                   /db_xref="GOA:B6A3L9"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:B6A3L9"
FT                   /protein_id="ACI59002.1"
FT                   /translation="MQHTREVFDWADPFRLAEQLTDEERMVQNTAHAYAQEKLAPRVLD
FT                   AFRNEKTDPAIFREMGELGLLGPTISPDYGGAGLGYTAYGLIAREVERVDSGYRSMMSV
FT                   QSSLVMVPIDTFGSEAQKLKYLPKLATGEWIGCFGLTEPDHGSDPGSMATRAKKVDGGY
FT                   SLTGSKTWISNAPIADVFVVWAKTEDGLIRGFILEKGWKGLSAPAIHGKVGLRASITGE
FT                   VVMDGVFVPEENLLPGVTGLKGPFTCLNSARFGIAWGALGAAEDCYARARQYTLERKQF
FT                   GRPLAANQLIQKKLADMAAEISLGLQGCLRLGRMKEEGHPPVELTSILKRNSCGKALEI
FT                   ARAARDMLGGNGISDEFGIARHLVNLEVVNTYEGTHDIHALIIGRAITGIAAFAN"
FT   gene            240502..240963
FT                   /locus_tag="Rleg2_5830"
FT   CDS_pept        240502..240963
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5830"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rec:RHECIAT_PA0000216 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5830"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59003"
FT                   /db_xref="GOA:B6A3M0"
FT                   /db_xref="UniProtKB/TrEMBL:B6A3M0"
FT                   /protein_id="ACI59003.1"
FT                   /translation="MFLLLALLIGVISGLRTMTAPAAVAWGAALGWFDLSQTPLAFMGY
FT                   RWTPWIFTILAVTELVADQLPSTPSRKVPMQFGARIVSGALSGAAIGAASGLLFGGLIA
FT                   GVIGAVIGTFGGAAARSRLAVSFGKDLPAALIEDAVAVIGAVLIVGAVA"
FT   sig_peptide     240502..240579
FT                   /locus_tag="Rleg2_5830"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.997) with cleavage site probability 0.673 at
FT                   residue 26"
FT   gene            240960..242327
FT                   /locus_tag="Rleg2_5831"
FT   CDS_pept        240960..242327
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5831"
FT                   /product="pyridine nucleotide-disulphide oxidoreductase
FT                   dimerisation region"
FT                   /note="PFAM: FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; pyridine nucleotide-disulphide
FT                   oxidoreductase dimerisation region; KEGG: ret:RHE_PE00270
FT                   mercuric reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5831"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59004"
FT                   /db_xref="GOA:B6A3M1"
FT                   /db_xref="InterPro:IPR001100"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR012999"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B6A3M1"
FT                   /protein_id="ACI59004.1"
FT                   /translation="MKNFDAIVIGAGQAGPSLAARMVEKGMKVALIERKFLGGTCVNAG
FT                   CMPTKTLVASARAAHVARSGAAYGVNIPGEIAIDMKVVRARAETVTMNARNGLIGWLTG
FT                   MDGMSVIYGHARFEDPKTISVNGETLTAPRIFLNVGARPVIPDLPGIHDIDYLTSTSII
FT                   QLDTLPRHLAVIGGSYIGLEFAQMYRRFGAEVSVIEHGPKLASREDEDISDAIAEILRA
FT                   EDIGVHTDAGNIAFAGNGSGVSVTAGSATIDASHVLIATGRTPNTDDLGLDAAGVITDK
FT                   RGFITVDDRLATNVEGIFALGDCNGHGAFTHTSYNDFEIAAANLLDGDDRKVSSRIPAY
FT                   ALYIDPPLGRVGMTEKQARQSGRNIMVSTRPMSRVGRANERGETKGFMKVIADAETKKI
FT                   LGAAILGIEGDEVIHGLIDAMNAGTTYPALQWSVPIHPTVSELIPTLLGDLKPVQP"
FT   gene            242361..242930
FT                   /locus_tag="Rleg2_5832"
FT   CDS_pept        242361..242930
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5832"
FT                   /product="SNARE associated Golgi protein"
FT                   /note="PFAM: SNARE associated Golgi protein; KEGG:
FT                   rec:RHECIAT_PA0000214 hypothetical conserved membrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5832"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59005"
FT                   /db_xref="GOA:B6A3M2"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="UniProtKB/TrEMBL:B6A3M2"
FT                   /protein_id="ACI59005.1"
FT                   /translation="MSIELLIENYGLLAIFLGAAFEGETAAFLGGVVAHRGLLPYWSAS
FT                   LAAMAGSFAGDQFWFFAGRYAARWSLVRRLMEKPALARVTQLLEKYPTGFILAFRFLVG
FT                   LRTISPIVIGTTRISTGKFVVLNAIAALLWGQLFTALGYLFGHGIEQILGHLSLHRHLL
FT                   IAFGAAAVVAAAALAFRKRRPSAGHS"
FT   gene            complement(242946..243989)
FT                   /locus_tag="Rleg2_5833"
FT   CDS_pept        complement(242946..243989)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5833"
FT                   /product="Alcohol dehydrogenase GroES domain protein"
FT                   /note="PFAM: Alcohol dehydrogenase zinc-binding domain
FT                   protein; Alcohol dehydrogenase GroES domain protein; KEGG:
FT                   rec:RHECIAT_PA0000213 probable xylitol dehydrogenase
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5833"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59006"
FT                   /db_xref="GOA:B6A3M3"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B6A3M3"
FT                   /protein_id="ACI59006.1"
FT                   /translation="MTKVRALVLERQHELALRDIDLPLETGPGQVKIKIHTVGVCGSDV
FT                   HYYTHGKIGPFIVNAPLVLGHEAAGTVVEVGAGVTHLKVGDRVCMEPGIPDPNSKASRL
FT                   GMYNIDPAVTFWATPPIHGVLTPEVVHPANYTFKLPDNVSFAEGAMVEPFAVGMQAASK
FT                   AKITPGDTAVVLGAGPIGTMVAIAALAGGCARAIVADLAQPKLDISAQYQGVIPVNIRE
FT                   KSLSEEVVRLTDGWGADVVFECSGSPKAWETIMALPRPGGVIVAVGLPVNPIGFDVSTA
FT                   STKEIRIETVFRYAHQYERSIALLASGRVDLKPLISETFTFEESIKAFDRAVEARPSDV
FT                   KLQIVME"
FT   gene            244488..244850
FT                   /locus_tag="Rleg2_5834"
FT   CDS_pept        244488..244850
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5834"
FT                   /product="copper resistance protein CopC"
FT                   /note="PFAM: copper resistance protein CopC; KEGG:
FT                   rec:RHECIAT_PA0000212 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5834"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59007"
FT                   /db_xref="GOA:B6A3M4"
FT                   /db_xref="InterPro:IPR007348"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="UniProtKB/TrEMBL:B6A3M4"
FT                   /protein_id="ACI59007.1"
FT                   /translation="MKSIASFCLFVSLLFIASEASAALEQASLPPQEQEVRLAPANLEL
FT                   TFTGPVDLARSTAFLLDARGTAIPTGKPFLSGPEGSIFKVPLDPAMAPGDYTVDWRVLS
FT                   MDGRSAEGQYRFRVDP"
FT   sig_peptide     244488..244556
FT                   /locus_tag="Rleg2_5834"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.718 at
FT                   residue 23"
FT   gene            245310..247013
FT                   /locus_tag="Rleg2_5835"
FT   CDS_pept        245310..247013
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5835"
FT                   /product="potassium-transporting ATPase, A subunit"
FT                   /EC_number="3.6.3.12"
FT                   /note="KEGG: ret:RHE_PE00266 potassium-transporting ATPase
FT                   subunit A; TIGRFAM: potassium-transporting ATPase, A
FT                   subunit; PFAM: K transporting ATPase A subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5835"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59008"
FT                   /db_xref="GOA:B6A3M5"
FT                   /db_xref="InterPro:IPR004623"
FT                   /db_xref="UniProtKB/TrEMBL:B6A3M5"
FT                   /protein_id="ACI59008.1"
FT                   /translation="MTLNGWLQILLYCGIVLVLVKPLGGYMTRVFSGERTFLSPLLVPI
FT                   ERGLYRAAGTSEGEEQHWTSYAFAMLLFNLLGVIALYALQRFQAGLPYNPAGMAAIPPE
FT                   LAFNTAVSFVTNTNWQNYGGESTMSYLTQMAGFTVQNFVSAATGIAIALAFIRAFSRAS
FT                   GKAIGNFWVDMTRATLYVLLPISVVLTLAYVYLGVPQTLGAYVNATTLEGAQQTIAVGP
FT                   VASQLAIKMLGTNGGGFFNANSAHPFENPDAISNLIQMVSIFSIGAALTNVFGRMVGNQ
FT                   RQGWAILATMGVLFLAGVVVTYWAEAAGNPLMHAFGLGGGNMEGKEVRFGVALSSLFAV
FT                   ITTAASCGAVNAMHGSFTALGGLIPLINMQLGEIIVGGVGAGFYGILLFIIVAVFVAGL
FT                   MVGRTPEYLGKKIEAKEMKMAVLAILCLPLAMLVFTAIATVLPSAVASIGTAGPHGFSE
FT                   ILYAYTSAAANNGSAFGGLTGNTPWYNVTLGIGMLAGRFLVIIPALAIAGSLIAKKTVP
FT                   ASAGTFPTDGPLFVGLLVGTILIVGGLTFFPALALGPIVEHLVMIAGQTF"
FT   gene            247023..247178
FT                   /locus_tag="Rleg2_5836"
FT   CDS_pept        247023..247178
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5836"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5836"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59009"
FT                   /db_xref="GOA:B6A3M6"
FT                   /db_xref="UniProtKB/TrEMBL:B6A3M6"
FT                   /protein_id="ACI59009.1"
FT                   /translation="MILRHRLRHSSHLRPGAPGRRNRPGLQASDIILVMMAGLLVAAAI
FT                   FKILQG"
FT   gene            247219..249279
FT                   /locus_tag="Rleg2_5837"
FT   CDS_pept        247219..249279
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5837"
FT                   /product="K+-transporting ATPase, B subunit"
FT                   /note="TIGRFAM: ATPase, P-type (transporting), HAD
FT                   superfamily, subfamily IC; K+-transporting ATPase, B
FT                   subunit; PFAM: Haloacid dehalogenase domain protein
FT                   hydrolase; E1-E2 ATPase-associated domain protein; KEGG:
FT                   rec:RHECIAT_PA0000210 potassium-transporting ATPase
FT                   protein, B chain"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5837"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59010"
FT                   /db_xref="GOA:B6A3M7"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006391"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:B6A3M7"
FT                   /protein_id="ACI59010.1"
FT                   /translation="MSQAKSASIMDSRILIPAIAAAFKKLDPRALARNPVMFVVATVSV
FT                   LTTVLFLRDLVAGNGNLGFSFQINLWLWFTVLFANFAEAVAEGRGKAQADSLRKARTET
FT                   QAKLLTTNNGSDYRMVPGTSLKVGDVVLVEAGDIIPSDGEVIEGVASVNEAAITGESAP
FT                   VIRESGGDRSAVTGGTQVLSDWIRVRITAAAGSTFLDRMIALVEGAERQKTPNEIALNI
FT                   LLAGMTLIFVLATATIPSFAIYAGGSIPIIVLVALFVTLIPTTIGALLSAIGIAGMDRL
FT                   VRFNVLAMSGRAVEAAGDVDTLLLDKTGTITLGNRQATSFRPVRGVSEQDLADAAQLAS
FT                   LADETPEGRSIVVLAKEKYAIRGRDMASLKATFVPFTAQSRMSGVDLEGASIRKGAVDA
FT                   VLTYVNGDAPSKNGSEVVRELQSLADEVAKSGGTPLAVARDGRLLGVIQLKDIVKGGIR
FT                   ERFTELRRMGIRTVMITGDNPLTAAAIAAEAGVDDFLAQATPEMKLALMREEQAKGKLV
FT                   AMCGDGTNDAPALAQADVGVAMNTGTVAAREAGNMVDLDSDPTKLIEIVEIGKQLLMTR
FT                   GALTTFSIANDIAKYFAIIPAMFLTFYPQLGVLNIMGLSTPQSAILSAIIFNALVIVAL
FT                   IPLSLKGVRYRPIGAGALLSRNLLIYGLGGIIVPFIGIKAIDLAVAALGLA"
FT   gene            249294..249863
FT                   /locus_tag="Rleg2_5838"
FT   CDS_pept        249294..249863
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5838"
FT                   /product="potassium-transporting ATPase, C subunit"
FT                   /EC_number="3.6.3.12"
FT                   /note="KEGG: rec:RHECIAT_PA0000209 potassium-transporting
FT                   ATPase protein, C chain; TIGRFAM: potassium-transporting
FT                   ATPase, C subunit; PFAM: K transporting ATPase KdpC
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5838"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59011"
FT                   /db_xref="GOA:B6A3M8"
FT                   /db_xref="InterPro:IPR003820"
FT                   /db_xref="UniProtKB/TrEMBL:B6A3M8"
FT                   /protein_id="ACI59011.1"
FT                   /translation="MLKEFRPAVVMIVATTAITGLLYPLAMTGAAQALFPAQANGSLVE
FT                   KNGQVIGSTLIGQAFTSDRYFHGRPSAAGDGYNAAASSGSNLGPTSQKLIDRVKADYES
FT                   AKAANPSAEVPADLVTASGSGLDPDISPEAAYFQVARVAKARSMDEAKVKALVDGAVQA
FT                   RELGLLGEPTVNVLALNQSLDASMTE"
FT   sig_peptide     249294..249395
FT                   /locus_tag="Rleg2_5838"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.947) with cleavage site probability 0.625 at
FT                   residue 34"
FT   gene            250043..252751
FT                   /locus_tag="Rleg2_5839"
FT   CDS_pept        250043..252751
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5839"
FT                   /product="osmosensitive K+ channel signal transduction
FT                   histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase A domain protein; Osmosensitive K channel
FT                   His kinase sensor; UspA domain protein; KEGG:
FT                   ret:RHE_PE00263 two-component sensor histidine kinase
FT                   protein (probably regulates osmosensitive potassium
FT                   channel)"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5839"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59012"
FT                   /db_xref="GOA:B6A3M9"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR003852"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR025201"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR038318"
FT                   /db_xref="UniProtKB/TrEMBL:B6A3M9"
FT                   /protein_id="ACI59012.1"
FT                   /translation="MPDDNRDQAGRPSPDALLEKARAETRGRLKIFLGAAPGVGKTYEM
FT                   LLSGRAKIADGFDVVIGVVETHGRKETEALLAGFEIIPRVEIDYKGRLLEEMDLDGILA
FT                   RRPDLVLVDELAHTNAEGSRHPKRYLDVKELLDRGIDVYSTLNIQHVESLNDVVSQITR
FT                   IRVRETVPDSIIDLADDVEIIDLTPDDLIKRLHDGKVYMPRTAERALTNYFTPGNLTAL
FT                   RELALRKTAQRVDDQLLTHMQAHAISGPWAAGERVLVSVDHHPRSASLVRYASRMASRL
FT                   RAPWAAVYVETNRSINLSEAERDTIASTLRLAEQLGGEAITIPGREVADELVRHASANN
FT                   VTHIVIGAPKKPTWRDWWGRSITDELIRKTGEISVHVISGTEKDGTTARGVKAAATAPQ
FT                   LDLRAYLLATVYVAIALGVSIVLDQVLDVRNLALVFLMAVLTSAVLHGLRPALYSCILS
FT                   ALSFNFFFLPPRYTLTISDPESVLALFFFLGVAIIASNLTATVQRQAAAARQRARTTED
FT                   LYLFSKKLAGTGTLDDVLWATAFQLASMLKVRVVLLLPEEGSIAVKAGYPPDDTLDDAD
FT                   IAAARWAWEHNHAAGRGADTLPGAKRLYVPLRTGRTAVGVIGLDSDRRDGPLLTPEQQR
FT                   LLDALADQAALAIERVQLVADVDRARLAAEADRLRSALLTSISHDLKTPLAAILGAAGT
FT                   LRDYFASMPEEDRSDLLSTVVDESERLNRFIANLLDMTKIESGAMEPNSALHYAGDIVG
FT                   SALRRAAKMLERHRTEMSIPADLPMVRVDPVLFEQVIFNLLDNAAKYAPEGSIIHIGGW
FT                   ADADNVVLQVSDEGPGIPPADLTRVFDTFYRVRKGDQVRAGTGLGLSICRGFIEAMGGT
FT                   IAAGNRTGRSGAVFTIRLPKPNDIPKLDELK"
FT   gene            252748..253440
FT                   /locus_tag="Rleg2_5840"
FT   CDS_pept        252748..253440
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5840"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; KEGG: ret:RHE_PE00262
FT                   two-component response regulator protein (probably
FT                   regulates osmosensitive potassium channel)"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5840"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59013"
FT                   /db_xref="GOA:B6A3N0"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:B6A3N0"
FT                   /protein_id="ACI59013.1"
FT                   /translation="MTGSAVKILVVDDEPPIRKLLRVGLTAQGYEVQEAANAAGARQSV
FT                   ADSLPDLIVLDLGLPDISGHDLLQAWRDEGLSIPIVILSSRTDEAGIVTALESGADDYV
FT                   TKPFGVNELGARIRVALRHRLQQQGEKAIFQTGGLSIDLVKRIVKVDGQDIKLSPKEYD
FT                   ILRVLAQHAGKVLTHQFLLKQVWGPAADVQYLRVYIRQLRQKVEQIPDQPHYITTETGV
FT                   GYRLREPD"
FT   gene            253498..253953
FT                   /locus_tag="Rleg2_5841"
FT   CDS_pept        253498..253953
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5841"
FT                   /product="putative PTS IIA-like nitrogen-regulatory protein
FT                   PtsN"
FT                   /note="PFAM: phosphoenolpyruvate-dependent sugar
FT                   phosphotransferase system EIIA 2; KEGG:
FT                   rec:RHECIAT_PA0000206 putative PTS system, regulator
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5841"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59014"
FT                   /db_xref="GOA:B6A3N1"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="UniProtKB/TrEMBL:B6A3N1"
FT                   /protein_id="ACI59014.1"
FT                   /translation="MNLPNIIRPEHTFIGVPAPTKWRALQGIAEKAAKAFSVDGQTILK
FT                   ALEAREKLGSTGIGNGIAIPHAAIDGMTSPRGLLLRFAQPLDFEAIDDIPTDIAFVLLF
FT                   GENNRGEYLNVLSAIARRLQSDGVLAAMRKARTVDEFYSDFIADSRV"
FT   gene            complement(254003..255019)
FT                   /locus_tag="Rleg2_5842"
FT   CDS_pept        complement(254003..255019)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5842"
FT                   /product="porin"
FT                   /note="PFAM: porin; KEGG: rec:RHECIAT_PA0000205 porin outer
FT                   membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5842"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59015"
FT                   /db_xref="GOA:B6A3N2"
FT                   /db_xref="InterPro:IPR003684"
FT                   /db_xref="UniProtKB/TrEMBL:B6A3N2"
FT                   /protein_id="ACI59015.1"
FT                   /translation="MNIRTILFASVAALAAASGARAADAIVAAEPEPVEYVRVCDAYGT
FT                   GYFYIPGTETCLSVGGYIRTEVRFGDQISGDSDVNFWTRGQVTFQAKNDTEYGTLTGVI
FT                   TLRYNADNASDQEALLDEGYIDIAGFRVGKLYSWWDDDMSGETDTLASNETTHNSIRYQ
FT                   YESGAFAAGISVDELEEDYDTKPGEGPNNFGVAGQVSYKAGAISAYLLAGYDTDTSEVA
FT                   VRGIVYADIGPGTLGIAGVWASGANYYYEESEWTIAAEYALKINDKWSVTPGFQYFENI
FT                   ALEADGNGFTGGSAYTTGVTIDYRIVDDLRTKLSVQYHDEDEGDDEVFGFLRFQRDF"
FT   sig_peptide     complement(254951..255019)
FT                   /locus_tag="Rleg2_5842"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.982 at
FT                   residue 23"
FT   gene            255379..256404
FT                   /locus_tag="Rleg2_5843"
FT   CDS_pept        255379..256404
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5843"
FT                   /product="sulfate ABC transporter, periplasmic
FT                   sulfate-binding protein"
FT                   /note="TIGRFAM: sulfate ABC transporter, periplasmic
FT                   sulfate-binding protein; PFAM: extracellular solute-binding
FT                   protein family 1; KEGG: rec:RHECIAT_PA0000204 probable
FT                   sulfate uptake ABC transporter, substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5843"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59016"
FT                   /db_xref="GOA:B6A3N3"
FT                   /db_xref="InterPro:IPR005669"
FT                   /db_xref="InterPro:IPR034408"
FT                   /db_xref="UniProtKB/TrEMBL:B6A3N3"
FT                   /protein_id="ACI59016.1"
FT                   /translation="MQTQRLTRLLAAAVMAGSFAIGSIAPAFADQTLLNVSYDPTRELY
FT                   KDFNAAFAAKWKKDNGEAVTIQASHGGSGAQARSVIDGLDADVVTLALEGDIDAIAKAT
FT                   GKIPADWKTKFPNNSTPYTSTIVFLVRKGNPKGIKDWGDLVKDDVQVITPNPKTSGGAR
FT                   WNFLAAWAWAKQANGGDEAKAQDYVAKLLQHVPVLDTGARGATTTFVQRGLGDVLLAWE
FT                   NEAYLSLEELGPDQFEIVTPSFSIRADPPVAVVDGNVDKKGTRKVAEAYLNYLYSDEGQ
FT                   KIAAKHYYRPFKPEAADPADIARFPKLTLATIDDFGGWKEAQPKFFGDGGVFDQIYKPA
FT                   Q"
FT   sig_peptide     255379..255468
FT                   /locus_tag="Rleg2_5843"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 30"
FT   gene            256413..257270
FT                   /locus_tag="Rleg2_5844"
FT   CDS_pept        256413..257270
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5844"
FT                   /product="sulfate ABC transporter, inner membrane subunit
FT                   CysT"
FT                   /note="TIGRFAM: sulfate ABC transporter, inner membrane
FT                   subunit; sulfate ABC transporter, inner membrane subunit
FT                   CysT; PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: rec:RHECIAT_PA0000203
FT                   putative sulfate uptake ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5844"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59017"
FT                   /db_xref="GOA:B6A3N4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR005667"
FT                   /db_xref="InterPro:IPR011865"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B6A3N4"
FT                   /protein_id="ACI59017.1"
FT                   /translation="MKAHSPTRWRFRRPSVIPGFGMALGFTLTWLTLLILIPLSGLAVR
FT                   SSALGWEKFWSIALDPRTLNALRISFGSAFIAAIVNAVFGILLAWVLVRYRFPGKRIID
FT                   AMVDLPFALPTAVAGIALTTLYAPNGWIGQFLTPLGIKIAFTPAGIVIALIFVGLPFVV
FT                   RTVQPVMEEIDKEVEEAAATLGANRFQTIFRVLLPGLAPAVLTGFALAFARGVGEYGSV
FT                   IFIAGNLPFKSEIAPLLIIIKLEEYNYAAATGIAAIMLIISFAMLLVINLIQSWSRRRY
FT                   GYGA"
FT   sig_peptide     256413..256544
FT                   /locus_tag="Rleg2_5844"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.856) with cleavage site probability 0.479 at
FT                   residue 44"
FT   gene            257260..258132
FT                   /locus_tag="Rleg2_5845"
FT   CDS_pept        257260..258132
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5845"
FT                   /product="sulfate ABC transporter, inner membrane subunit
FT                   CysW"
FT                   /note="TIGRFAM: sulfate ABC transporter, inner membrane
FT                   subunit; sulfate ABC transporter, inner membrane subunit
FT                   CysW; PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: ret:RHE_PE00257 probable
FT                   sulfate uptake ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5845"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59018"
FT                   /db_xref="GOA:B6A3N5"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR005667"
FT                   /db_xref="InterPro:IPR011866"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B6A3N5"
FT                   /protein_id="ACI59018.1"
FT                   /translation="MALDTTAQPVKLRSVTTENRIARFTLIIVSLIFLLLILLLPLAAV
FT                   FVEAFRKGPGPFIEALGDAETFSAIRLTLIVAGVSVPLNLIFGVAAAWAIAKFEFKGKA
FT                   FLTTLIDLPFSVSPVISGLVFVLLFGANTWLGQWLSAHDIKILFAVPGLILATMFVTFP
FT                   FVARELIPLMQEQGTADEEAALSLGASGWQTFWHVTLPNIKWGLLYGVLLCNARAMGEF
FT                   GAVSVVSGHIRGQTNTMPLQVEILYNEYNFTGAFAVATLLALLALVTLVLKTLLEMRYS
FT                   AEISASRRH"
FT   gene            258143..259183
FT                   /locus_tag="Rleg2_5846"
FT   CDS_pept        258143..259183
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5846"
FT                   /product="sulfate ABC transporter, ATPase subunit"
FT                   /note="KEGG: rec:RHECIAT_PA0000201 probable sulfate uptake
FT                   ABC transporter, ATP-binding protein; TIGRFAM: sulfate ABC
FT                   transporter, ATPase subunit; PFAM: ABC transporter related;
FT                   SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5846"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59019"
FT                   /db_xref="GOA:B6A3N6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005666"
FT                   /db_xref="InterPro:IPR014769"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR024765"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B6A3N6"
FT                   /protein_id="ACI59019.1"
FT                   /translation="MEVRVQNIRKEFDRFPALHDVSLGIRSGELIALLGPSGSGKTTLL
FT                   RLIAGLESPTEGQIFFGDEDASKKSVQQRNIGFVFQHYALFRYMTVLDNVSFGLRVRNS
FT                   ARRPAKADIRKRALELLDLVQLSGLEKRYPAQLSGGQRQRVALARAMAVEPNVLLLDEP
FT                   FGALDAQVRKDLRKWLREIHDRTGHTTVFVTHDQDEALELADRVVVMSQGAIEQVGTPD
FT                   EVYDNPNSPFVFGFIGQSNCLQVEISDGDIRFEGRSLGLNAEGEPDGTAQLYFRPHDVR
FT                   LCESAENCIAGQPVSSRRVAGTRHIELDIGNDRPHIEIELPPSEADRLDRHRVAFKPTR
FT                   WKLFRS"
FT   gene            259342..260205
FT                   /locus_tag="Rleg2_5847"
FT   CDS_pept        259342..260205
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5847"
FT                   /product="cell wall hydrolase SleB"
FT                   /note="PFAM: cell wall hydrolase SleB; KEGG:
FT                   rec:RHECIAT_PA0000200 putative cell wall-associated
FT                   hydrolase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5847"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59020"
FT                   /db_xref="GOA:B6A3N7"
FT                   /db_xref="InterPro:IPR011105"
FT                   /db_xref="InterPro:IPR042047"
FT                   /db_xref="UniProtKB/TrEMBL:B6A3N7"
FT                   /protein_id="ACI59020.1"
FT                   /translation="MRAEISFGKSLIGILFVGLAAAGCTTTPKPAATAAKTKQPAKVTF
FT                   NYTNKDRDCLQRAMYFESQHSDEDGYMAVGTVVMNRLTSGAYPPSICGVVAQEKQFAPG
FT                   VMTREVKPQAETELATAADAILKGARHPAVKDAMFFHTDGLKFPYNNMHYVAVAGGNAF
FT                   YEKRGADGMLQTPPPLPAYEVAMNYVPGESMLPPQFDALIPSAVPVPLPAPDPIATAST
FT                   MSAINATPTARMAPIANPMPMQITAPVTAPETSIEPDPGMPIAIPIPRPAYDSVMLRGS
FT                   VAANGG"
FT   sig_peptide     259342..259443
FT                   /locus_tag="Rleg2_5847"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.749) with cleavage site probability 0.358 at
FT                   residue 34"
FT   gene            complement(260243..261475)
FT                   /locus_tag="Rleg2_5848"
FT   CDS_pept        complement(260243..261475)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5848"
FT                   /product="peptidase T"
FT                   /EC_number="3.4.11.4"
FT                   /note="KEGG: ret:RHE_PE00254 peptidase T; TIGRFAM:
FT                   peptidase T; PFAM: peptidase M20; peptidase dimerisation
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5848"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59021"
FT                   /db_xref="GOA:B6A3N8"
FT                   /db_xref="InterPro:IPR001261"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR010161"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:B6A3N8"
FT                   /protein_id="ACI59021.1"
FT                   /translation="MTDTVLDRFLRYVVIDTQSDPASSTQPTTEKQKDLGRVLVDELLK
FT                   IGLAGAHLDEHGYVYATIPGNSDKAVPVICFCSHMDTAPDFSGTGVTPQIIRNYAGGDI
FT                   GLAGDSSRVIRVSEHPELNNQIGNDIVTTDGTTLLGADDKAGLAEIMTAAQVLVDNPEI
FT                   RHGTIKILFTPDEEVGRGVNKVDLKKLGADFAYTMDGETSGHIEDETFSADGVEIAISG
FT                   VAIHPGFAKDRMENAIKIAGAIIDRLPKDLAPETTEGKQGFIHPVGVTGSMEKASLSFI
FT                   IRDFTDEGLVEKETMLEAIVTEVMAGYPGSTYHFQVKEQYRNMKAVLDRHPEIVDNAIE
FT                   AVRRAGMTPVRGSIRGGTDGSRLSFMGLPCPNIFAGGHAFHSPLEWVSRQDMEKAVKTI
FT                   VELAKVWEERA"
FT   gene            complement(261570..262628)
FT                   /locus_tag="Rleg2_5849"
FT   CDS_pept        complement(261570..262628)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5849"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; Transport-associated
FT                   OB domain protein; SMART: AAA ATPase; KEGG:
FT                   rec:RHECIAT_PA0000193 probable sugar ABC transporter,
FT                   ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5849"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59022"
FT                   /db_xref="GOA:B6A3N9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040582"
FT                   /db_xref="UniProtKB/TrEMBL:B6A3N9"
FT                   /protein_id="ACI59022.1"
FT                   /translation="MASIDIQNIRKAYGHVQVLHGVDLEIKDGEFVVLVGPSGCGKSTL
FT                   LRMIAGLEDVTSGEIRIAGSRVNERHPKDRDIAMVFQSYALYPHMNVAGNMSYSLKLRK
FT                   TAKEKIASAVSAAAAKLGLDPLLERRPKALSGGQRQRVAMGRAIVRQPKAFLFDEPLSN
FT                   LDARLREQMRAEIKKLHGDLKATSIYVTHDQIEAMTLADRIVAMHGGVVQQVGSPLELY
FT                   DHPANLFVAGFIGSPGMNFLAASYVEGGVKLQDGTIVPLAKPLPLEDGAKVTLGIRPEH
FT                   VLMTTDGAGLATDVELVEPTGFGIILHLALHGLPFKVFTLDREALKAGPKVNVAFPAQY
FT                   LHVFDGEGIRVD"
FT   gene            complement(262633..263463)
FT                   /locus_tag="Rleg2_5850"
FT   CDS_pept        complement(262633..263463)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5850"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: ret:RHE_PE00247 probable
FT                   sugar ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5850"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59023"
FT                   /db_xref="GOA:B6A3P0"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B6A3P0"
FT                   /protein_id="ACI59023.1"
FT                   /translation="MRRSAIPTIAHRLAILCYIAFALFPLFWLLKVSVTPNDLLYSEGV
FT                   RMWPSRTTWDHYAFVLQHSAFPTFFKNSLIVSASTAVTVTICASLSGYALSRFNFRAKY
FT                   WIVALMLLTQMFPLVMLVAPIFKILSPLHLTNSLTGLVIVYTAFNVPFATFLMQSFFDG
FT                   IPKDLEEAAMIDGATQFTAFRQIILPLTLPGIAATLGFVFTAAWSELLFALMLINGNDA
FT                   ATFPVGLLTFVSKFSVDFGQMMAAGVMALIPAGLFFLLIQRYLVQGLTAGAVKG"
FT   gene            complement(263468..264403)
FT                   /locus_tag="Rleg2_5851"
FT   CDS_pept        complement(263468..264403)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5851"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: rec:RHECIAT_PA0000191
FT                   probable sugar ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5851"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59024"
FT                   /db_xref="GOA:B6A3P1"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B6A3P1"
FT                   /protein_id="ACI59024.1"
FT                   /translation="MTISADTLDMRRDRRPWLRRLADASEPYLYSAPSLILIIAVMLVP
FT                   LTLGVSYAFRDIQLLNPFSGGFIGLDHFRELAGDPAFYGALRNTLWWTGASVVLQFVFG
FT                   LILALLLDKPFPGRAIAQALVFLPWAVPSFLAGLNWAWLFNPVIGPIPHWLFGLGLMHE
FT                   PGNILSDPNYAMWGPIVANVWWGIPFFAITLLAALQAIPRDLYEAASIDGAGWFQRFRS
FT                   ITLPFLAPTIAITVLLRTVWISNFADLIVVMTNGGPADRTQIVASYIFTTAFKRLDFGY
FT                   ASAIALVLLVLLLAYSMLIILLRQTLLNKD"
FT   gene            complement(264608..265867)
FT                   /locus_tag="Rleg2_5852"
FT   CDS_pept        complement(264608..265867)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5852"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   KEGG: rec:RHECIAT_PA0000190 putative sugar ABC transporter,
FT                   substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5852"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59025"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:B6A3P2"
FT                   /protein_id="ACI59025.1"
FT                   /translation="MKKLIISTLFASMMAGTAFADTTLKLVEVITSPERTETLKSIVGK
FT                   FEAANPGTKVDIISLPWNEAFQKFATMVSAGDVPDVMEMPDTWLSLYANNGMLESLEPY
FT                   LAKWEHTKELTPRALELGRDVKNTAYMLPYGFYLRAMFYNKKLLSEAGVAAPPKTLEEF
FT                   TAASEKISKLQGKYGYCMRGGAGGLNGWMIFAASMAGSNKYFNEDGTSTMNSPGWAKGI
FT                   EWMVDLYKKGYAPKDSVNWGFNEVVAGFYSGTCAFLDQDPDALIAIAERMKKEDFGVMP
FT                   LPKGPDGKSFPTIGYGGWSMFATSGNKDLSWKLIATLEGPEGNIEWNKRIGALPAYTAA
FT                   EKDPFYAGDQFKGWFEELADPNTVPTVMPTYLEEFAFFKDSLAIKTSQQALLGDISAKD
FT                   LADQWADYLTKAQQKFLSKK"
FT   sig_peptide     complement(265805..265867)
FT                   /locus_tag="Rleg2_5852"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 21"
FT   gene            complement(265898..267070)
FT                   /locus_tag="Rleg2_5853"
FT   CDS_pept        complement(265898..267070)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5853"
FT                   /product="Cystathionine beta-lyase"
FT                   /EC_number="4.4.1.8"
FT                   /note="PFAM: Cys/Met metabolism
FT                   pyridoxal-phosphate-dependent protein; aromatic amino acid
FT                   beta-eliminating lyase/threonine aldolase; KEGG:
FT                   rec:RHECIAT_PA0000189 cystathionine gamma-synthase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5853"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59026"
FT                   /db_xref="GOA:B6A3P3"
FT                   /db_xref="InterPro:IPR000277"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:B6A3P3"
FT                   /protein_id="ACI59026.1"
FT                   /translation="MSSGEDPFDLASIITAHDDGNFADAVVPPIFQTSLFTFSDYDEMI
FT                   TVYRGEKVRPTYTRGLNPTVRAFEEMLAKLEGAEDALGFASGMAAISSAVLSFVEPGDR
FT                   IVAVKHVYPDAFRLFGTILKRMKIEVTYVDGRDEEAVAKALPGAKLLYLESPTSWVMEA
FT                   HDVGALAALAKRHGVVSMIDNSWASPFFQRPLTLGVDLVIHSASKYLGGHSDVVAGVVA
FT                   GSKDMIARIKAEAYPYLGGKLSPFDAWLLIRGLRTLPLRMRAHEASALEIARRLQKLDV
FT                   VETVCHPGLANRLPAGLNGTSGLFSFIFRDGVDIRAFADHLKLFKLGVSWGGHESLIVP
FT                   GEVVLQQKAQPNSAQTFGIHARSVRLHVGLEGTEALWRDIEGALAAASQS"
FT   gene            complement(267067..267789)
FT                   /locus_tag="Rleg2_5854"
FT   CDS_pept        complement(267067..267789)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5854"
FT                   /product="GntR domain protein"
FT                   /note="PFAM: regulatory protein GntR HTH; GntR domain
FT                   protein; KEGG: rec:RHECIAT_PA0000188 probable
FT                   transcriptional regulator protein, GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5854"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59027"
FT                   /db_xref="GOA:B6A3P4"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B6A3P4"
FT                   /protein_id="ACI59027.1"
FT                   /translation="MKAKLSDRPVIRPLPVMDRARQVTDALADYVEDARLQAGDRLPAE
FT                   RELMAALAVGRSTIREAIRHFQALGVIETRKGSGTYLLKPVSRATIHMPLSFDAVHLRD
FT                   ALLQTLEVRRGIECEAGMVAARRRTAKDLVVIEEKLNEMERVHLEKGTSGPEDLAFHLA
FT                   VYDATHNPLFRQLLEQMRETFERFWEHPFDRQDFARRSFPFHRTLFNAIAAGDAEAARM
FT                   ETLKILDIVEEDIKEMSK"
FT   gene            268005..268502
FT                   /locus_tag="Rleg2_5855"
FT   CDS_pept        268005..268502
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5855"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: atc:AGR_L_3014 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5855"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59028"
FT                   /db_xref="InterPro:IPR009337"
FT                   /db_xref="UniProtKB/TrEMBL:B6A3P5"
FT                   /protein_id="ACI59028.1"
FT                   /translation="MNKLSVLAVISVTVFGPSTSFAKDEGKLPKGAVELSEQEVKDLYV
FT                   GNSVKYDVGDGMVYYTWSADGTLKGVKVGKKKGEYGYADGTWTVTGNMFCFKSDWKNKA
FT                   GDVVYVYQPCKAWWRVGKQKWTKNVSGDDQYNGDIYNNEIKKISKGDKVTAMFDTAKAS
FT                   AK"
FT   sig_peptide     268005..268073
FT                   /locus_tag="Rleg2_5855"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 23"
FT   gene            268835..269404
FT                   /locus_tag="Rleg2_5856"
FT   CDS_pept        268835..269404
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5856"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rec:RHECIAT_PA0000187 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5856"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59029"
FT                   /db_xref="UniProtKB/TrEMBL:B6A3P6"
FT                   /protein_id="ACI59029.1"
FT                   /translation="MRDYVKSAGFHRHMRLLLASRFQELGWESQTGKCSFISGKRVFWL
FT                   QISQSSNSLTGGKFTLNLSEGSAAAGDTRILRHLNEADRAIGKALEQNIIARLPRPDPD
FT                   PDIEVVGDGGPVLVKLGDLAKANPRQWDGPSDVWLPYFSKSDLDEWAAFLLPRLERLIR
FT                   PSTPEITDPMTWTKRFDRLTGLFRWR"
FT   gene            complement(269476..270015)
FT                   /locus_tag="Rleg2_5857"
FT   CDS_pept        complement(269476..270015)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5857"
FT                   /product="putative cytochrome c-like protein"
FT                   /note="KEGG: rec:RHECIAT_PA0000186 putative cytochrome
FT                   c-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5857"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59030"
FT                   /db_xref="GOA:B6A3P7"
FT                   /db_xref="InterPro:IPR002321"
FT                   /db_xref="InterPro:IPR010980"
FT                   /db_xref="UniProtKB/TrEMBL:B6A3P7"
FT                   /protein_id="ACI59030.1"
FT                   /translation="MISGVAPIFGAIIAVSSLVAPARADIISDRQADMKAMAAAAKTMA
FT                   EMFRNPDAYSSKQFAAAAGAIAERSGEILAGHFTDGVEDARSKAKPDIAEERDRFDRLA
FT                   EDLRAYARALDAQAQANPGAMTDRMRMRPGEPMGGGPLGTHVTNAASLSSLPAEHIFHL
FT                   MLQTCATCHARFRMER"
FT   sig_peptide     complement(269941..270015)
FT                   /locus_tag="Rleg2_5857"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.951) with cleavage site probability 0.903 at
FT                   residue 25"
FT   gene            270214..270717
FT                   /locus_tag="Rleg2_5858"
FT   CDS_pept        270214..270717
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5858"
FT                   /product="cytochrome B561"
FT                   /note="PFAM: cytochrome B561; KEGG: rec:RHECIAT_PA0000185
FT                   putative cytochrome b561 protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5858"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59031"
FT                   /db_xref="GOA:B6A3P8"
FT                   /db_xref="InterPro:IPR011577"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="UniProtKB/TrEMBL:B6A3P8"
FT                   /protein_id="ACI59031.1"
FT                   /translation="MKGSYSTAQIGLHWLIALLLPIQYLTGGSIERTHHAAHMGVTPSS
FT                   FDLFQHNVHNYAGMLIGALMGVRLLLRIMRPPAPQLPASWRQKAAAALHHALYVAILMQ
FT                   AGLGFVTSYLWFGTAAYHVALANIILAIVALHFAAAAWHTLVLRDETLDRMIFPRRNPT
FT                   SEKL"
FT   gene            270851..271240
FT                   /locus_tag="Rleg2_5859"
FT   CDS_pept        270851..271240
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5859"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rec:RHECIAT_PA0000184 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5859"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59032"
FT                   /db_xref="UniProtKB/TrEMBL:B6A3P9"
FT                   /protein_id="ACI59032.1"
FT                   /translation="MYRIALSGLLFVVRLAIVVSLAGYSISNVDAAMHGPPSQVEKSAS
FT                   SVAAHGGHDMAGVSSHKHAHGDATDKDGPSKIAKQECCKDFCGGFVLLCGGQSLGGPVV
FT                   ASIRQFSDDEHLLGELPLLDRPPNI"
FT   sig_peptide     270851..270919
FT                   /locus_tag="Rleg2_5859"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.788) with cleavage site probability 0.540 at
FT                   residue 23"
FT   gene            271334..271561
FT                   /locus_tag="Rleg2_5860"
FT   CDS_pept        271334..271561
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5860"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rec:RHECIAT_PA0000183 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5860"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59033"
FT                   /db_xref="UniProtKB/TrEMBL:B6A3Q0"
FT                   /protein_id="ACI59033.1"
FT                   /translation="MRPSLFVVGLPLVFGGCASTLPPDVVASSAAVEEPSARPVTYRSP
FT                   VSGYVTRQPVDPKPWRRQNDLQSPQKGDAS"
FT   sig_peptide     271334..271396
FT                   /locus_tag="Rleg2_5860"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.879) with cleavage site probability 0.370 at
FT                   residue 21"
FT   gene            271558..273024
FT                   /locus_tag="Rleg2_5861"
FT   CDS_pept        271558..273024
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5861"
FT                   /product="conserved hypothetical conserved membrane
FT                   protein"
FT                   /note="KEGG: ret:RHE_CH02518 hypothetical conserved
FT                   membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5861"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59034"
FT                   /db_xref="GOA:B6A3Q1"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="UniProtKB/TrEMBL:B6A3Q1"
FT                   /protein_id="ACI59034.1"
FT                   /translation="MIGLRRFATMLAFPLILSGCVTGAEYSSKQAGFASVADKTAIVTT
FT                   KQTVWIHNQNQARSVAAQVRSLLARKKTLDVETAVQIALLNNKGLQAAYADLGDSAADA
FT                   WQSTMLINPTVSIGTTGVGTPELEAFKTIEGMITTNILALATRNRDVAIADTRFRQAQL
FT                   TAAVKTLQLAADTRRAWIGAVAAWENVGQLQRAQAAADAASELAEKLGETGAMTKGAQA
FT                   REHVFVAELAGETAKARLAARLAKEELTRLMGLWGTDLDYQIPNSLAALPKTVARRDAI
FT                   EAEALRNRIDLQVARLELEATAKSYGLTEATRYVTDLEILTGFETEREIEDDEKQTRTT
FT                   AQVELEFAIPIFDTGKARMRKAELDYMRAANQLAEKAVNVRSEARSAYEAYRSNYDIAR
FT                   HYRNNVVPLRSKVEEESLLSYNGMITNTFELLTDTRDKINSILLSVNAKRDFWLAEANL
FT                   APAIYGGGATNASAGTEVAAASESSGGGGH"
FT   sig_peptide     271558..271629
FT                   /locus_tag="Rleg2_5861"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.996) with cleavage site probability 0.983 at
FT                   residue 24"
FT   gene            273039..274385
FT                   /locus_tag="Rleg2_5862"
FT   CDS_pept        273039..274385
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5862"
FT                   /product="multicopper oxidase type 3"
FT                   /note="PFAM: multicopper oxidase type 2; multicopper
FT                   oxidase type 3; KEGG: rec:RHECIAT_PA0000181 putative
FT                   multicopper oxidase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5862"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59035"
FT                   /db_xref="GOA:B6A3Q2"
FT                   /db_xref="InterPro:IPR002355"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR011706"
FT                   /db_xref="InterPro:IPR011707"
FT                   /db_xref="UniProtKB/TrEMBL:B6A3Q2"
FT                   /protein_id="ACI59035.1"
FT                   /translation="MFNRRQLFGASAALLAAGAWTKTSAMGLPDAPTMESADMQPPLHP
FT                   TSGPDYQPVVTLNGWTLPHRLNNGVKEFHLVAEPVEREMAEGMTAYLWGYNGQSPGPTI
FT                   EAVEGDRVRIFVTNKLPEHTTIHWHGMILPSGMDGVGGLTQPHIPVGKTYVYEFDLVKS
FT                   GTFMYHPHSDEMVQMAMGMMGFFVVHPKDPKFMRVDRDFVFLLNAYDIDPGSYVPRIME
FT                   MTDFNMWCWNSRVFPDISPLVVSKNDRVRVRVGNLTMTNHPIHMHGYDFEVTCTDGGWV
FT                   RPEARWPEVSIDIPVGAMRAYEFDAKYPGDWAIHCHKSHHTMNAMGHDIPTFIGADKSK
FT                   VAEKIRKLQPEYMPMGTKGMADMGEMEMPIPENTVPMMTGWGPHGPIEMGGMFSVVKVR
FT                   EGISADDYADPGWYENPPGTQAWEWTGELPDATKAKDAKTQITPQPTKG"
FT   sig_peptide     273039..273104
FT                   /locus_tag="Rleg2_5862"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.750 at
FT                   residue 22"
FT   gene            274420..274899
FT                   /locus_tag="Rleg2_5863"
FT   CDS_pept        274420..274899
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5863"
FT                   /product="blue (type 1) copper domain protein"
FT                   /note="PFAM: blue (type 1) copper domain protein; KEGG:
FT                   ret:RHE_CH02520 putative copper-containing oxidase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5863"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59036"
FT                   /db_xref="GOA:B6A3Q3"
FT                   /db_xref="InterPro:IPR000923"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR033138"
FT                   /db_xref="UniProtKB/TrEMBL:B6A3Q3"
FT                   /protein_id="ACI59036.1"
FT                   /translation="MKNFVLALAFAALASSAFASGNHAGGHGEKMAVGEPGDKAKATQT
FT                   IRVTMTETDDGKMLFTPAVFSVRKGQTVKIAIKNAGTVDHEFVLDQEDKILEHKKVMEK
FT                   FPEMEHADANSIRLPAGQSGEIVWKFTSDGAFKFACLIPGHYEAGMHGDVTVAGK"
FT   sig_peptide     274420..274479
FT                   /locus_tag="Rleg2_5863"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.983 at
FT                   residue 20"
FT   gene            274924..275211
FT                   /locus_tag="Rleg2_5864"
FT   CDS_pept        274924..275211
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5864"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rec:RHECIAT_PA0000179 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5864"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59037"
FT                   /db_xref="InterPro:IPR021647"
FT                   /db_xref="UniProtKB/TrEMBL:B6A3Q4"
FT                   /protein_id="ACI59037.1"
FT                   /translation="MKSAMMKIGLAALLSATAAFGAFAEEFTKGVVNKVDAKAQKVTIK
FT                   HEELKNLDMPAMTMVFRVEDPALLEKLKEGSSIEFVAERVNGKLTVTDVK"
FT   sig_peptide     274924..274998
FT                   /locus_tag="Rleg2_5864"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 25"
FT   gene            complement(275401..275769)
FT                   /locus_tag="Rleg2_5865"
FT   CDS_pept        complement(275401..275769)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5865"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ret:RHE_PE00237 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5865"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59038"
FT                   /db_xref="UniProtKB/TrEMBL:B6A3Q5"
FT                   /protein_id="ACI59038.1"
FT                   /translation="MRRVLLTLILCSQSASLSAASELSVFHTASFGSSRLVSLSLADGR
FT                   PARNPTFDFDVVITLSESDGGGTVLYRDRGRHEASVRCGSPAMVRINSADYAVDLSARL
FT                   GADWKHDLWAALCNAPVS"
FT   sig_peptide     complement(275710..275769)
FT                   /locus_tag="Rleg2_5865"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.799 at
FT                   residue 20"
FT   gene            complement(275865..276278)
FT                   /locus_tag="Rleg2_5866"
FT   CDS_pept        complement(275865..276278)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5866"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ret:RHE_PE00236 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5866"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59039"
FT                   /db_xref="GOA:B6A3Q6"
FT                   /db_xref="InterPro:IPR002048"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="UniProtKB/TrEMBL:B6A3Q6"
FT                   /protein_id="ACI59039.1"
FT                   /translation="MRVTIINAVLLAGAITVGGAGLAAAEDPHHPTDSQQAASPSEMDG
FT                   MIGSQGAMPGAEMMPGGMMGRTMMQSGMMGGMPMMGMCGPMMKIMLAIADTSGDGALSF
FT                   DEVTAVHKRIFDSVDANKDGKVTAEEIQAFMRP"
FT   sig_peptide     complement(276201..276278)
FT                   /locus_tag="Rleg2_5866"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.898 at
FT                   residue 26"
FT   gene            complement(276429..276734)
FT                   /locus_tag="Rleg2_5867"
FT   CDS_pept        complement(276429..276734)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5867"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rec:RHECIAT_PA0000175 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5867"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59040"
FT                   /db_xref="GOA:B6A3Q7"
FT                   /db_xref="UniProtKB/TrEMBL:B6A3Q7"
FT                   /protein_id="ACI59040.1"
FT                   /translation="MANTAFQSRSDASPVTPAQVSVPILGATVAVFAAVSFLLCMLLGF
FT                   VAPEWGLHKPWLQFFLGLTGFDLRSLALGIVQSVVFGGYAGALLGTIFNVISRRFG"
FT   gene            complement(276969..277784)
FT                   /locus_tag="Rleg2_5868"
FT   CDS_pept        complement(276969..277784)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5868"
FT                   /product="Endonuclease/exonuclease/phosphatase"
FT                   /note="PFAM: Endonuclease/exonuclease/phosphatase; KEGG:
FT                   ret:RHE_PE00234 putative
FT                   endonuclease/exonuclease/phosphatase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5868"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59041"
FT                   /db_xref="GOA:B6A3Q8"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:B6A3Q8"
FT                   /protein_id="ACI59041.1"
FT                   /translation="MHAKKDNLPSSILASIRSRKKRLDPAYTETRPRSVGTLIASYNVH
FT                   KCVGTDRRFDPERTSRVIHEIGADVIALQEADTRFGERTGILDLGRLERETGLIPVPVA
FT                   GMAKAHGWHGNVVLFKKGLVHDVHQVKLPGLEPRGALVAEIELEQGGVLRIIAAHFGLL
FT                   RHNRAQQARMLVELINDRREMSTILLGDLNEWRLGDRSSLNTFQSAFGPLPPAVPSFPA
FT                   GLPLLALDRIIANRKGIISEVEAHDTPLARVASDHLPIKALVDLKAVGG"
FT   gene            complement(277970..279433)
FT                   /locus_tag="Rleg2_5869"
FT   CDS_pept        complement(277970..279433)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5869"
FT                   /product="phospholipase D/Transphosphatidylase"
FT                   /note="PFAM: phospholipase D/Transphosphatidylase; KEGG:
FT                   rec:RHECIAT_PA0000173 transmembrane cardiolipin synthetase
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5869"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59042"
FT                   /db_xref="GOA:B6A3Q9"
FT                   /db_xref="InterPro:IPR001736"
FT                   /db_xref="InterPro:IPR025202"
FT                   /db_xref="InterPro:IPR027379"
FT                   /db_xref="UniProtKB/TrEMBL:B6A3Q9"
FT                   /protein_id="ACI59042.1"
FT                   /translation="MFYLLSTYWPHILFVVSIAMGAAAAIHAAMTKEEVRAAIGWVGVI
FT                   ILSPIIGAVLYAIAGINRIRRKSLSIRRDALLPAAEFDELETFDAEAETVISQFGRRFA
FT                   ALQTLGDRVTRNPLTSGNTIDVLETGDEAYAAMKSSIDEAARSILLETYIFDRDAIGLR
FT                   IADALIAAAKRGVAVRVLIDAVGARYSVPSILGHLRDGGVTVAVFNGNVIMGLRLPYAN
FT                   LRTHRKILIVDGKIALTGGMNIRAGFSEEATGESFAHDTHFSVTGPVVADLFDLAAEDW
FT                   RFSTQELLNGEAWRIEPPQRSPGDPILMRVVASGPDRSVETNHKMLMGAFSVARQSIRI
FT                   MSPYFLPDRELISALVTAARRGVEVDIVVPAVNNLVLVDRAMTAQFDQILKGYCRIWRS
FT                   TGSFSHSKLLTIDGTWAYVGSSNLDPRSLRLNFEVDLEVLNEGFAGEIDEHIEETLKSA
FT                   TPVTLDGLRARPFPVRLLEKVLWLGSPYL"
FT   sig_peptide     complement(279347..279433)
FT                   /locus_tag="Rleg2_5869"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.990) with cleavage site probability 0.591 at
FT                   residue 29"
FT   gene            279597..280238
FT                   /locus_tag="Rleg2_5870"
FT   CDS_pept        279597..280238
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5870"
FT                   /product="phage SPO1 DNA polymerase-related protein"
FT                   /note="TIGRFAM: phage SPO1 DNA polymerase-related protein;
FT                   PFAM: Uracil-DNA glycosylase superfamily; KEGG:
FT                   ret:RHE_PE00232 probable DNA-directed DNA polymerase
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5870"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59043"
FT                   /db_xref="InterPro:IPR005122"
FT                   /db_xref="InterPro:IPR005273"
FT                   /db_xref="InterPro:IPR036895"
FT                   /db_xref="UniProtKB/TrEMBL:B6A3R0"
FT                   /protein_id="ACI59043.1"
FT                   /translation="MNIVASAGPALALDVAEAESIAELRHQAEGCTRCDLYRNATQIVF
FT                   GEGPGKAEIVLVGEQPGDQEDLAGRPFVGPAGRLLDRCLEEAGLDRRRCYVTNAVKHFK
FT                   FTQRGKRRLHAKPNAGEIKRCAWWLGAEINILKPKLVVTLGASALYALLGPKVKLTPER
FT                   GHILQPANHPPVLVTIHPSYLLRIRDEAEQQRLRQDFVSDLHKAAAFRPR"
FT   gene            280381..280635
FT                   /locus_tag="Rleg2_5871"
FT   CDS_pept        280381..280635
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5871"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rec:RHECIAT_PA0000171 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5871"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59044"
FT                   /db_xref="InterPro:IPR021327"
FT                   /db_xref="UniProtKB/TrEMBL:B6A3R1"
FT                   /protein_id="ACI59044.1"
FT                   /translation="MAETRDEWIKKRAYALWEEEGYPTGRESIHWEQARHEREALEGSA
FT                   ASSDGKEVKPKAKRSVAGSKTNGVVKPALKRTASRKTAL"
FT   gene            280776..280958
FT                   /locus_tag="Rleg2_5872"
FT   CDS_pept        280776..280958
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5872"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rec:RHECIAT_PA0000170 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5872"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59045"
FT                   /db_xref="UniProtKB/TrEMBL:B6A3R2"
FT                   /protein_id="ACI59045.1"
FT                   /translation="MTLQALRPPEKVEPSPDNREQEFTPAVYGKTGEVAMNDGRSKILS
FT                   VLLVAAGSRASIAIV"
FT   gene            280969..281160
FT                   /locus_tag="Rleg2_5873"
FT   CDS_pept        280969..281160
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5873"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rec:RHECIAT_PA0000169 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5873"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59046"
FT                   /db_xref="UniProtKB/TrEMBL:B6A3R3"
FT                   /protein_id="ACI59046.1"
FT                   /translation="MSLLVIAALLYLGLALGFILVVDNLVGLVFRDPRAPVQPPFFNIG
FT                   RAFAASQKLNRKQAARHP"
FT   gene            281219..281944
FT                   /locus_tag="Rleg2_5874"
FT   CDS_pept        281219..281944
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5874"
FT                   /product="Glutathione S-transferase domain"
FT                   /note="PFAM: Glutathione S-transferase domain; KEGG:
FT                   ret:RHE_PE00210 glutathione S-transferase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5874"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59047"
FT                   /db_xref="GOA:B6A3R4"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="UniProtKB/TrEMBL:B6A3R4"
FT                   /protein_id="ACI59047.1"
FT                   /translation="MAYELYYWDSIQGRGEFVRLALEEAGADYVDVTREPGRGTDAMFA
FT                   LMKSDSEPHIPFAPPFLKDGDLIIPHVANILFYLGPKLGLAPEDERLRHVANGLQLTVT
FT                   DFIAEVHDTHHPIDTSLYYEDQKPEAKARSAAFIRDRIPKFLGYFERVLRQNPGGPDHS
FT                   VGNALTYVDLSLFQVIEGLTYAFPKAMAKRKADYPALLALHDRVTTRPNIARYLASPRR
FT                   LAFNEDGIFRHYPELDRTG"
FT   gene            complement(281957..282850)
FT                   /locus_tag="Rleg2_5875"
FT   CDS_pept        complement(281957..282850)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5875"
FT                   /product="DNA polymerase LigD, polymerase domain protein"
FT                   /note="TIGRFAM: DNA polymerase LigD, polymerase domain
FT                   protein; PFAM: DNA primase small subunit; KEGG:
FT                   rec:RHECIAT_PA0000163 putative DNA ligase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5875"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59048"
FT                   /db_xref="InterPro:IPR014145"
FT                   /db_xref="InterPro:IPR033651"
FT                   /db_xref="UniProtKB/TrEMBL:B6A3R5"
FT                   /protein_id="ACI59048.1"
FT                   /translation="MSPQNPPASHPPASDVVLTHPDRLYWPDEGVSKQALTDYYAAVWP
FT                   FMAPYLVNRPLALLRLPDGIKGHQRFFQKHAWKGMNPHIEEVADPEETDGEKLLRIVDF
FT                   NGLTALVQSAVLEIHPWGTTTENWERPDMITMDLDPGEDVAWSAVISAALDVKARLEAR
FT                   GLAAFVKTSGGKGLHVVAPLAPKAGWAAVKDFAHSLAESMSADAPEKYLSTATKAKRGG
FT                   HIYIDYLRNGRGNTAVAAYSTRARPGAPVSMPIDWSELNEISGPAAFTLANVPQRLETR
FT                   PSDPWRDFFDAAAPLE"
FT   gene            complement(282847..283851)
FT                   /locus_tag="Rleg2_5876"
FT   CDS_pept        complement(282847..283851)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5876"
FT                   /product="putative DNA topoisomerase I protein"
FT                   /note="KEGG: rec:RHECIAT_PA0000162 probable DNA
FT                   topoisomerase I protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5876"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59049"
FT                   /db_xref="GOA:B6A3R6"
FT                   /db_xref="InterPro:IPR001631"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013500"
FT                   /db_xref="InterPro:IPR014711"
FT                   /db_xref="InterPro:IPR035447"
FT                   /db_xref="UniProtKB/TrEMBL:B6A3R6"
FT                   /protein_id="ACI59049.1"
FT                   /translation="MNAEAITELGLVYVSDAEPGIRRRRKGKGFSYVMPDGTTLADELQ
FT                   RARIGALGLPPAYENVWICLYDNGHLQATGIDARGRKQYRYHKDWQSFRSAGKFHQLIE
FT                   FGRALPKIRRTVLRHLDTGTEDIDGVLAALTTLLDEAHLRVGNQAYVRENGTYGATTLL
FT                   KRHLKIVDGQIELKFRAKGGKRVQRSLKHPRLQKILEEIADLPGRQLFVWKDESGALKP
FT                   IDSGRLNAYLAEISGIPISAKTFRTWAGSLAAFGAARETIVGGGRPTVKQMSEAAAEAL
FT                   HNTPAISRSSYIHPAIIALAGNDHPLIESAEPLRGLRAEENRLLDFLTRETEE"
FT   gene            complement(283867..286023)
FT                   /locus_tag="Rleg2_5877"
FT   CDS_pept        complement(283867..286023)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5877"
FT                   /product="glycogen debranching enzyme GlgX"
FT                   /note="KEGG: rec:RHECIAT_PA0000161 glycosyl hydrolase
FT                   (glycogen debranching) protein; TIGRFAM: glycogen
FT                   debranching enzyme GlgX; PFAM: glycoside hydrolase family
FT                   13 domain protein; alpha amylase catalytic region; SMART:
FT                   alpha amylase catalytic sub domain"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5877"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59050"
FT                   /db_xref="GOA:B6A3R7"
FT                   /db_xref="InterPro:IPR004193"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR011837"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:B6A3R7"
FT                   /protein_id="ACI59050.1"
FT                   /translation="MSFSFSELDFLKPELGAEYTGSGTHFAIFSAHAEQIELCLFSPDG
FT                   KNEIARMPLPKREGDIWSGYIAGVGPGTVYGYRAHGPYDPGAGHRFNPNKLLLDPYAKQ
FT                   VTGDLKWDDALFGYQIGEDDLSFDERDSAPFMVKGVVQDPDFDWAGEEAIRRPWPDTII
FT                   YEAHVRGLTMTHPKVPDRLRGTFLGMCSDPIIDHLVKLGISAIELLPIQYFLDDRYLLE
FT                   QNLSNYWGYQTLGFFAPQSRYMSGDKITEIKTMVRKFHAAGIEVIMDVVYNHTAEGSEK
FT                   GPTLSFRGLDNASYYILSPDDPRHTFDTTGTGNTLNVAHPMVMRMVLDSLRYWVGVMHI
FT                   DGFRFDLASTLGRQDLEFDRQGGFFGAIRQDPILSGVKLIAEPWDIGEGGYQVGGFPYP
FT                   FREWNDKFRDDVRRFWKGDGGMVSEVAARVTGSAPQFNHSDRGATSSVNLLSAHDGFTL
FT                   MDTVSFDGKHNEANGEDNRDGHSDNHSDNMGAEGATDNADINTARARRRRNMIATLMLS
FT                   QGVPMILAGDELGNSQGGNNNAYCQDNDIGWTGWDGLDDPFLDFCRQAVAFRKAHPVLR
FT                   QERFLTGEVSEDGRIEIAWYKPDGSFMDDGAWNDDGLQVLGVYLSRSVHAPDTETMDDL
FT                   FLVFNAGGDCQIHLPEVNGLQQWSRILDTGTETDAFAVHEQDNPVIVYAQSVAVFAPTG
FT                   QTQPPEGATKAQRRRWFQFGRRSK"
FT   gene            complement(286126..286920)
FT                   /locus_tag="Rleg2_5878"
FT   CDS_pept        complement(286126..286920)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5878"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase;
FT                   short-chain dehydrogenase/reductase SDR; KR domain protein;
FT                   KEGG: rec:RHECIAT_PA0000160 probable
FT                   dehydrogenase/reductase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5878"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59051"
FT                   /db_xref="GOA:B6A3R8"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B6A3R8"
FT                   /protein_id="ACI59051.1"
FT                   /translation="MVELAQSLASIKLPDLAGKAVLITGASTGIGAALARAFAAQGAKV
FT                   GVHYNASREPAEALAEEIRAAGGTVHLIQGDVSREGETERVVEETAKTFGHLDGLINNA
FT                   GGMLGRKPTSEYTDAHYAAVMDLNARSVLAATRAAHPWLKKQGGFIINTTSIAARNGGG
FT                   NGAILYAASKGFVSTITRGHAKEFVADRIRVNAVAPGVIATPFHERYTNDEQMELQRKS
FT                   IPMGFVGTSEDCVGAYLFLASPTLSGYITGQIIEVNGGQLMP"
FT   gene            complement(287374..288633)
FT                   /locus_tag="Rleg2_5879"
FT   CDS_pept        complement(287374..288633)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5879"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fjo:Fjoh_4680 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5879"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59052"
FT                   /db_xref="UniProtKB/TrEMBL:B6A3R9"
FT                   /protein_id="ACI59052.1"
FT                   /translation="MLHCAWLHEGKHHVASVIAGVAALSLVMAASLPSSIWAQSQSAPA
FT                   GIEKPSPTSPPKIAVSRDGFDMKLLEPVNGIDYRTYGHITYAMFLDPDGDHEAIFKRFG
FT                   TDKAGYEAAGAAFTERMKQDQTFAMIEMFGAYFAEDAQGTYAALGRDVAQSVLNQAPLR
FT                   ETEPMPEEKFREIQVYYGRKVSVAGTALAQQDEILKPYHITFNDFNIIGAWFSRRLALE
FT                   TADASTPRESPPARAEGTPTERPEWGGLWRFTWKTLQRTDTEMKVVEASRDICIKSDMT
FT                   AETLPLMPKPSGVKCVLIDKIHFYDSGVQMSAQCDHGAIGTSWGLFSNRKMAEKASPAR
FT                   SPITRSTKATTTCRSRQPTFKSSGLANASEESENHDALCSCRRIRPDPGRGFRRGGRPA
FT                   HRTLAGQDLHAGSHARAEER"
FT   sig_peptide     complement(288517..288633)
FT                   /locus_tag="Rleg2_5879"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.975) with cleavage site probability 0.749 at
FT                   residue 39"
FT   gene            complement(288880..290004)
FT                   /locus_tag="Rleg2_5880"
FT   CDS_pept        complement(288880..290004)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5880"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rec:RHECIAT_CH0000569 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5880"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59053"
FT                   /db_xref="GOA:B6A3S0"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B6A3S0"
FT                   /protein_id="ACI59053.1"
FT                   /translation="MANTSAPSGNTDWTLADFLSTYRYWALFLSSLLLAIGGQGLSTVL
FT                   PLISQMTGSSAQTIGIFYSGSTLGWGVGAFLAFVVASRHARSALIYPLVICAVVAISFL
FT                   PAPALWGSPSFLFLFGLALGAVRAVFPLAIAIFLVSGRPGKIDFGCALTLMSTTILISA
FT                   IAPIGASWLSQFDPGGLPVVVGFLACLLLAVILLLPAEQLTFDEAPRPRHRPLTPRRRS
FT                   PLLVAFILSIPPILGFLMGLGIYLFQANGFDVISSPVTLLPTLLALGIVLAVFIYFAFW
FT                   VYRIHGELAGAAQSQRLVTPLAAMLIAILVPLGLAVLVMTLGDLLNDRARNAGQRPLVS
FT                   IGWLGIWSFVFPPIAIAMVQNAANDSYVVGSGTA"
FT   gene            complement(290229..291443)
FT                   /locus_tag="Rleg2_5881"
FT   CDS_pept        complement(290229..291443)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5881"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   ret:RHE_PE00206 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5881"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59054"
FT                   /db_xref="GOA:B6A3S1"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B6A3S1"
FT                   /protein_id="ACI59054.1"
FT                   /translation="MGVSYRWVIVAVGALMSCVAIGAMFSLAIFQEPIATATGWSHVGI
FT                   ASAMTLNFIVMGFGGFLWGAASDRFGPRIVVMIGSVLLGLALVLASRAEALLQFQLTYG
FT                   ILVGLAASAFFAPMIAATTAWFDENRGLAVSLVSAGMGVAPMTISPFARWLISAYDWRP
FT                   AMLIIGIATWVLLVPVALLVRRPPAETADAGTEFAAEGARPQLSKVFRSPQFIVLGLTF
FT                   FACCAAHSGPIFHMVNYATICGVAPMAAVSIYSVEGLAGLGGRLLYGTLADRIGVKPVL
FT                   VAGLLVQAGALATYLLVSELTQFYALAIVFGSAYGGVMPLYAVLAREYFGQRIIGTVLG
FT                   AATMLSSLGMAFGPLIGGWIFDTFANYSWLFIGSAMVGLGAAAIALAFPPLVRQKPQPA
FT                   LGVTS"
FT   sig_peptide     complement(291357..291443)
FT                   /locus_tag="Rleg2_5881"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.921) with cleavage site probability 0.379 at
FT                   residue 29"
FT   gene            complement(291573..292055)
FT                   /locus_tag="Rleg2_5882"
FT   CDS_pept        complement(291573..292055)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5882"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   rec:RHECIAT_PA0000157 putative acetyltransferase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5882"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59055"
FT                   /db_xref="GOA:B6A3S2"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:B6A3S2"
FT                   /protein_id="ACI59055.1"
FT                   /translation="MLIRPAENDDRDAIWRIIGPTIRAGETYALDRDLPEADALAYWMG
FT                   PDRETFVAEEDGVILGSYYIKANQAGGGRHVCNCGYMTDPAAAGRGIARRMHHHSLQHA
FT                   RARGFRAMQFNFVVSSNRRAVELWQSLGFEIVGRLPGVFLHPSEGYVDALVMFRTL"
FT   gene            complement(292105..293310)
FT                   /locus_tag="Rleg2_5883"
FT   CDS_pept        complement(292105..293310)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5883"
FT                   /product="beta-ketoadipyl CoA thiolase"
FT                   /EC_number="2.3.1.9"
FT                   /note="KEGG: ret:RHE_PE00203 beta-ketoadipyl CoA thiolase;
FT                   TIGRFAM: acetyl-CoA acetyltransferase; beta-ketoadipyl CoA
FT                   thiolase; PFAM: Thiolase"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5883"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59056"
FT                   /db_xref="GOA:B6A3S3"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR012793"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020613"
FT                   /db_xref="InterPro:IPR020615"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:B6A3S3"
FT                   /protein_id="ACI59056.1"
FT                   /translation="MTEAFICDYVRTPIGRFAGALSPVRADDLGAIPLKALMQRNGGVD
FT                   WEAVDDVIFGCANQAGEDNRNVARMSALLACLPIAVPGTTINRLCGSGMDAVITAARAI
FT                   RAGEAELMIAGGVESMSRAPFVMPKAETAFSRAAEIHDTTIGWRFVNPLMKKQYGVDSM
FT                   PETGENIAEDYKVSREDQDAFAVRSQAKAAAAQASGRLAKEIVAVTIPQRKGDPVIVDK
FT                   DEHPRATTIETLAKLATPFKKEGGTVTAGNASGVNDGAAALIVASEAAARKYGLTPIAR
FT                   ILGGAAAAVPPRVMGVGPIPASRKLMARLGMTQEQFDVIELNEAFASQGLAVLRALGIA
FT                   DDDQRVNRNGGAIALGHPLGMSGARITGTAALELLETGGKYSLSTMCIGVGQGIAIALE
FT                   RV"
FT   gene            complement(293320..294009)
FT                   /locus_tag="Rleg2_5884"
FT   CDS_pept        complement(293320..294009)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5884"
FT                   /product="3-oxoacid CoA-transferase, B subunit"
FT                   /EC_number="2.8.3.6"
FT                   /note="KEGG: ret:RHE_PE00202 3-oxoadipate CoA-transferase
FT                   subunit B protein; TIGRFAM: 3-oxoacid CoA-transferase, B
FT                   subunit; PFAM: coenzyme A transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5884"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59057"
FT                   /db_xref="GOA:B6A3S4"
FT                   /db_xref="InterPro:IPR004165"
FT                   /db_xref="InterPro:IPR012791"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:B6A3S4"
FT                   /protein_id="ACI59057.1"
FT                   /translation="MTVDIREDVKLSNAQIAWRAAQDIADGAYVNLGIGFPEMVARYQP
FT                   PGREAIFHTENGILNFGEPPAEGEEDWDLINAGKKAVTLKPGAAFFHHADSFAMVRGGH
FT                   LDVAILGAYQVAQSGDLANWRVGSKGVPAVGGAMDLVHGAKQVCVITEHVTKTGEPKLV
FT                   EKCTFPLTGVACITRVYTSHAVIDIVDGRFVLREKLAAMSQEELQAMTGAALHVDGPVA
FT                   ELVVPKL"
FT   gene            complement(294006..294713)
FT                   /locus_tag="Rleg2_5885"
FT   CDS_pept        complement(294006..294713)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5885"
FT                   /product="3-oxoacid CoA-transferase, A subunit"
FT                   /EC_number="2.8.3.5"
FT                   /note="KEGG: rec:RHECIAT_PA0000154 3-oxoadipate
FT                   CoA-transferase protein, A subunit; TIGRFAM: 3-oxoacid
FT                   CoA-transferase, A subunit; PFAM: coenzyme A transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5885"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59058"
FT                   /db_xref="GOA:B6A3S5"
FT                   /db_xref="InterPro:IPR004163"
FT                   /db_xref="InterPro:IPR004165"
FT                   /db_xref="InterPro:IPR012792"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:B6A3S5"
FT                   /protein_id="ACI59058.1"
FT                   /translation="MDKTIGSTAEAVSEIGDGATVMIGGFGGSGAPIELIHALIDRGPK
FT                   NLTVINNNAGNGRIGIAAMIDAGMVRKMICSFPRSSDPRAFTDKYLAGEIELELVPQGT
FT                   LAERIRAGGAGIPAFYTPTAYGTELADGKVIAEFDGRHYVQERWLKADFAIVKAEIGDI
FT                   NGNLTYNKAGRNFNPLMCMAAAKTIAQVSSIVPAGGIDPEHVVTPGIFVDRVVAVSHPQ
FT                   QEEELIRAGVAYV"
FT   gene            294867..295625
FT                   /locus_tag="Rleg2_5886"
FT   CDS_pept        294867..295625
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5886"
FT                   /product="transcriptional regulator, IclR family"
FT                   /note="TIGRFAM: beta-ketoadipate pathway transcriptional
FT                   regulators, PcaR/PcaU/PobR family; PFAM: regulatory protein
FT                   IclR; Transcriptional regulator IclR; KEGG: ret:RHE_PE00200
FT                   probable transcriptional regulator protein, IclR family"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5886"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59059"
FT                   /db_xref="GOA:B6A3S6"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR012794"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B6A3S6"
FT                   /protein_id="ACI59059.1"
FT                   /translation="MRETDFVSGFARGLKVIEAFGETRQRLSIAEASKLTELDRATVRR
FT                   SLLTLAELGYADYDGKFFTLTPKILRLGHAYLAATPLPALLQPHLDHLSERAGQSASAS
FT                   VLDGTEIVYIARASQRRVMSINLTPGSRLPAYCASMGRVLLAALTENEARAVLARSELR
FT                   QNTPKTRTDPEDLVAEFRRVRAEGYAIIDQELEIGLCSIAVPVENDRGETVAAINIGAP
FT                   AALVPAAEMKERYLPLLRETQAALRPLLRR"
FT   gene            complement(295683..297227)
FT                   /locus_tag="Rleg2_5887"
FT   CDS_pept        complement(295683..297227)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5887"
FT                   /product="acid phosphatase"
FT                   /note="TIGRFAM: acid phosphatase; PFAM: phosphoesterase;
FT                   KEGG: mlo:mlr8246 acid phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5887"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59060"
FT                   /db_xref="GOA:B6A3S7"
FT                   /db_xref="InterPro:IPR007312"
FT                   /db_xref="InterPro:IPR017768"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:B6A3S7"
FT                   /protein_id="ACI59060.1"
FT                   /translation="MKRLKFLNSICLAGSALMPFAMATAAHASPAGYDKIDNIVVIYAE
FT                   NRSFDNLYGSFPGADGLANVSAEQARQLDRNGQPLAELPPAWGGLTAKGVTPAVTEAQS
FT                   AHLANASFAIDDPKGFAQTPSVITRDLWHRFYQEQMQIDGGKNDKFVAWADSGSLVMGH
FT                   YDGSILPMWQVAKKYVIADNFFQGAFGGSFLNHFALVCACAPYYPDADKSPAKPVIAKV
FT                   DADGTSLTVAENAPKSALEGAPKFVSDGTLTPDFYAVNTMQPPYQPSANPPAKDGDKAL
FT                   ADPSAATTLPPQHAITIGDLLSLKGVSWAWYGGAWQAALDRKNATPVPNFQFHHQPFNY
FT                   FANFAPGTPARAEHLKDGGLAGEAFLGDIDAGKLPAVSFYKPQGNLNEHGGYADVSSGD
FT                   QHLADIVSHLEKSPQWGHMLVIVTYDENGGFWDHVAPPKADRWGPGNRIPAFIISPFAK
FT                   DGTVDHTQYDTTSIIRFITARYDLPVLPGIVARDKALGDNGQPPMGDLTAALDLTH"
FT   sig_peptide     complement(297141..297227)
FT                   /locus_tag="Rleg2_5887"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.992 at
FT                   residue 29"
FT   gene            297424..298713
FT                   /locus_tag="Rleg2_5888"
FT   CDS_pept        297424..298713
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5888"
FT                   /product="Di-haem cytochrome c peroxidase"
FT                   /note="PFAM: Di-haem cytochrome c peroxidase; KEGG:
FT                   mlo:mlr1826 methylamine utilization protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5888"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59061"
FT                   /db_xref="GOA:B6A3S8"
FT                   /db_xref="InterPro:IPR004852"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:B6A3S8"
FT                   /protein_id="ACI59061.1"
FT                   /translation="MTTKIIWLARTGLAVGIGAAALCLAILPLRQSSAAVAFGVHPGPM
FT                   SRAAAFARAETLTALGRKIFSDASLSASGLQACASCHDPAHAFGPTSAKPVEMGGKDMN
FT                   QPGLRAVPTLRYLQAVPSFSEHFYDSEDEGDESVDNGPTGGLTWDGRVDHGADQAKIPL
FT                   LSPFEMGNKNAADVAAKLRKAPYADAIKAAFGAAVFDNPEDTFNAAAEALATFEQSGPD
FT                   FYPYSSRYDAFLAGKATLTTQELHGRQLFEDPAKGNCSSCHLSELANDGEPPQFSDFGF
FT                   LGLAAPRNMAISANSDPNYHDLGLCGPKRTDLAGHAEYCGLFRTPTLRNVALKKSFFHN
FT                   GYFHTLRDVVSFYATRDSDPGRWYPKKADGTIHKYDDLPEAYWDNLNPDPPFGRKPGDA
FT                   PALTDPEIDDIVAFLDTLTDADLQPEMNGH"
FT   sig_peptide     297424..297528
FT                   /locus_tag="Rleg2_5888"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.627 at
FT                   residue 35"
FT   gene            298797..299720
FT                   /locus_tag="Rleg2_5889"
FT   CDS_pept        298797..299720
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5889"
FT                   /product="transcriptional regulator, ArsR family"
FT                   /note="PFAM: regulatory protein ArsR; KEGG: ret:RHE_PE00196
FT                   probable transcriptional regulator protein, ArsR family"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5889"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59062"
FT                   /db_xref="GOA:B6A3S9"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR016943"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B6A3S9"
FT                   /protein_id="ACI59062.1"
FT                   /translation="MERSFLTIAAGENNTAIRALSAPARVEMLKLLCAKGPTNINDIAQ
FT                   ALSLPQSTVATGIQILEEAGLVESRLAKARKGNQKICSAVYSEILISFEESAAQRANNI
FT                   IEVEMPVGLYTSCDVHAPCGLCSSESVIGPLDVPDYFLDPQRMQAGLVWFGRGYVEYKF
FT                   PNNAKVLNKDIRAIEFSLELSSEVPGTNADWPSDITLWVNGMAIGTWTSPGDYGDKRGA
FT                   FTPAWWKLEGSQYGTMKTWRISTRGTFIDGVAASNVTLGDLALGQHSSIRLRVGIAENA
FT                   GHTGGVNIFGRGFGNHGRDIIMRLHV"
FT   gene            299931..301439
FT                   /locus_tag="Rleg2_5890"
FT   CDS_pept        299931..301439
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5890"
FT                   /product="Alpha-N-arabinofuranosidase"
FT                   /EC_number="3.2.1.55"
FT                   /note="PFAM: alpha-L-arabinofuranosidase domain protein;
FT                   KEGG: ret:RHE_PE00195 probable alpha-L-arabinofuranosidase
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5890"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59063"
FT                   /db_xref="GOA:B6A3T0"
FT                   /db_xref="InterPro:IPR010720"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:B6A3T0"
FT                   /protein_id="ACI59063.1"
FT                   /translation="MKTNVVAHRDFRIATIDARLYSSFLEHLGRAIYGGIYEPGHPTAD
FT                   EDGFRRDVLDLVRELDTPYCRYPGGNFVSAYNWEDGVGPRSERPVRLDLAWRTREANQI
FT                   GINEFVDWCKKANTKPMLAVNLGSRGLDAARNFLEYCNHPGGTYYSDLRRKHGWANPHD
FT                   VKLWCLGNEMDGPWQVGHKSAYEYGRLADETAKAMRGFDKSLELVVCGSSNSDMKTYPD
FT                   WEAQVLEQCYDSADHISLHMYFANREKNTLNYLARATKLDRYITTIGGVIDYIKAKKRS
FT                   KKTIGISFDEWNVWYHSNQQDKEILARDEWPDAPHLLEDIYNFEDVLQVGGILNTFIRR
FT                   SDRVRIACIAQLVNVIAPIMTDDGGAAWRQTIYYPFYYASRYGRGAALQLVVDGPTYDS
FT                   DEENDVPYLDVSAVHSEDGRSLTFFAVNRHPQTALDLDVRLEGFGSARVIEQVEMTHGD
FT                   LQAVNTAQRQDTVAPVNVESATIEDGRLRAALKPLSYNVIRLSV"
FT   gene            301634..303538
FT                   /locus_tag="Rleg2_5891"
FT   CDS_pept        301634..303538
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5891"
FT                   /product="extracellular solute-binding protein family 5"
FT                   /note="PFAM: extracellular solute-binding protein family 5;
FT                   KEGG: ret:RHE_PE00194 probable oligopeptide ABC
FT                   transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5891"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59064"
FT                   /db_xref="GOA:B6A3T1"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:B6A3T1"
FT                   /protein_id="ACI59064.1"
FT                   /translation="MQQLKRLAFGVALAALGLTAAAKADDYTSLPRKETLIVENPEGTI
FT                   KNPGWFNIWVNAGAGVSTGLQQLTMDTLWYIDPEQGLGGATWDNSLAADKPQYNADFTE
FT                   MTVKLRKGLFWSDGVEFTADDVVYTVKTQMDHPGMVWSAAFSVQVASVEATDPQTVVFK
FT                   LKKPNSRFHALFTVRWNGAWIMPKHVFEKVADPLRYDFANPVSLGAYKLKAYDPQGKWY
FT                   TWEKRDDWQKTSLARFGEPAPKYVTYVDPGPPDKRTIAQLEHNLDIIHDNTPEGMFTLK
FT                   EKSKSVETWFPGFPFAHPDPTLPAVIFNTQDPTFNNPDVRWALALLIDIKAVDMASYRG
FT                   TATLSALGVPPTAIAMKDYQAPMQDWLKDFEIDTGKQKIKPYDPTIGQQVADLLRKQPK
FT                   FKDQIPTDPKAISTAFGYGWWKPNPQAAAELLQKAGFKKSGGKWMTPDGQPFRIRMTVE
FT                   GDTRSVFTRAGTLIAQQWAAFGIDAKAVPTTNLWQVALQPGDFQVAIAWSVETWGGDPD
FT                   LSFFLDSWHSQFVAKKGENQPPRNWQRWSNPELDKIIETIRGISADDPKGIELGKDYLK
FT                   LVAREMPTIPLMSYNVFTSMDTTYWTGYPTIKDPYTDPVPNWANSRLMMVKLKPAQPK"
FT   sig_peptide     301634..301708
FT                   /locus_tag="Rleg2_5891"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.951 at
FT                   residue 25"
FT   gene            303661..304665
FT                   /locus_tag="Rleg2_5892"
FT   CDS_pept        303661..304665
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5892"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: rec:RHECIAT_PA0000149
FT                   putative ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5892"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59065"
FT                   /db_xref="GOA:B6A3T2"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B6A3T2"
FT                   /protein_id="ACI59065.1"
FT                   /translation="MTPYLIFVLKRFGQFLLVVFLGVSITFFVTHLTPIDPVEESIGAI
FT                   TQMGQSDPNAIELMRQSLRELYGMEGSIWQQYLHFWLRLATGDLGPSLSAFPTPVSTII
FT                   LRSLPWTIGLMTVSTLITFVLGNALGALAGYYRKNMVLKAVSLVCIALLPIPYYILAFV
FT                   LLILFGYLWPVLPINGGYEMNANLDLSFALVLDILKHSILPALSLILVGAGSWLIGMRA
FT                   LVSNLITDDYVVFAELGGVPKRKILRSYIARNAMVPQFTGLAMSLGAIFNGTVITEIVF
FT                   GYPGIGNLLISAVHAGDYSLVLGLSALSIVGVAAAVFIIDILSPLIDPRIKVE"
FT   gene            304669..305526
FT                   /locus_tag="Rleg2_5893"
FT   CDS_pept        304669..305526
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5893"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: rec:RHECIAT_PA0000148
FT                   probable oligopeptide ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5893"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59066"
FT                   /db_xref="GOA:B6A3T3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B6A3T3"
FT                   /protein_id="ACI59066.1"
FT                   /translation="MFTIIRDLARQNLEFLCGLLLFAVIVGLIVVSYFSPYGPTDIYLL
FT                   PPDMPPDGDYWLGTTSRGQDVFWQLTTALRNTLYFGIGVAFLSRIISLVVGLVAGYAGG
FT                   AVDRVLMAINDSIMVIPQFPLLILFYFVLKDSMTWTVLIVIMASLGWSYDARLIRSVAI
FT                   GLKTRPFTTQSVYSGMSMRKILVEEHLPYVLPIVFATTMNNMIWSIGMEITLSVLGFTD
FT                   IETPTMGMMIYWANAHSALIAGIWWWVAAPVAVIVILFLALFLLSMSMNEYNDPRSRLN
FT                   RMGS"
FT   gene            305528..306517
FT                   /locus_tag="Rleg2_5894"
FT   CDS_pept        305528..306517
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5894"
FT                   /product="oligopeptide/dipeptide ABC transporter, ATPase
FT                   subunit"
FT                   /note="KEGG: ret:RHE_PE00191 probable oligopeptide ABC
FT                   transporter, ATP-binding protein; TIGRFAM:
FT                   oligopeptide/dipeptide ABC transporter, ATPase subunit;
FT                   PFAM: ABC transporter related; Oligopeptide/dipeptide ABC
FT                   transporter domain protein; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5894"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59067"
FT                   /db_xref="GOA:B6A3T4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B6A3T4"
FT                   /protein_id="ACI59067.1"
FT                   /translation="MDPLVEIENLKAYYRAFLFGVDREVRAVDDISLTIGRGEVYGVAG
FT                   ESSSGKTTLIKTIAGAIRPPLRVVSGNVKFHFAGGTQDIYAMKPEERMALRWRHLSYIM
FT                   QGSMNVLNPVRRIRHSFTDFAFRHMAVSKPVFFEKVATHLQRLKLDPHLLDAYPHELSG
FT                   GMRQRMTIALATILTPEFIIADEPTTALDVIVQRDVLSMIREIQREMGSSFLFVTHDMG
FT                   VHATVSDRIGIVYAGRLVEEAPTAKLFSKPLHPYTQHLVGSLPRIGDATTRPSLEGRPP
FT                   NLAMPPEGCRFHPRCPKRMDICSQKVPPLVTVEPGRRVACFAVTGDQV"
FT   gene            306514..307326
FT                   /locus_tag="Rleg2_5895"
FT   CDS_pept        306514..307326
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5895"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: rec:RHECIAT_PA0000146 probable ABC transporter,
FT                   ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5895"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59068"
FT                   /db_xref="GOA:B6A3T5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B6A3T5"
FT                   /protein_id="ACI59068.1"
FT                   /translation="MTALLHLSHVTKVYRQGGMLGRRLITAVKDVSFEVGAEPEILSIV
FT                   GESGSGKSTIAAMILGQTEPTEGRLEFSGKTVSIHSRSERKAFMKEVQPVLQNPFEAFN
FT                   PLKRVDRYLFETARNLSGPGKRIDRKEAERMADAALVHVGLTLEEVKGRFPHELSGGQL
FT                   QRVAIARALIPQPRLLVADEPVSMVDASLRMAIVNLFGRLKNELGLSIIYITHDLATAY
FT                   YISDNIIIMRKGEIVERGQARPVLDNPQHPYSRALKEAVLAADFSPAM"
FT   gene            complement(307522..309339)
FT                   /locus_tag="Rleg2_5896"
FT   CDS_pept        complement(307522..309339)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5896"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="PFAM: histidine kinase HAMP region domain protein;
FT                   chemotaxis sensory transducer; KEGG: rec:RHECIAT_PC0000478
FT                   putative methyl-accepting chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5896"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59069"
FT                   /db_xref="GOA:B6A3T6"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR024478"
FT                   /db_xref="UniProtKB/TrEMBL:B6A3T6"
FT                   /protein_id="ACI59069.1"
FT                   /translation="MRRPTVQTSLIVINLTFGFLFFAFALFSLGSVRQVNEDTGAIAKN
FT                   WLPSVSVSRNMQYELQKLKFAYANHIMSISDEAIAAAEKQIIGQKEELAKAIKAYRPLI
FT                   SSARESQLLDIISSRAADYAKAAEPMLVKSRKNDNDAAKVIFYNDMEPIIQEAEKNAGE
FT                   LLDINVAGSDASFDSSVATYATILWSTWSLIGLVLAIIAGAVAFVVIQISRPIKIITHS
FT                   MTRLASGDTDSPIPYADRTDEIGSMAGAVEVFRQTAVAKIHADHDAAANRVHAENERQR
FT                   REQIDRSRAASMAQATNGLADGLKMLAEGDLTAQIVEPFDTDFEALRNDFNSAVAQLCG
FT                   ALSRVSGSTVGIDGGSSEVANSANDLARRTEQQAAALEQTAAALDEITANVASSSKRAE
FT                   EARKVAAEANASATTSGEIVTHAVEAMSRIEQSSNQISSIIGVIDEIAFQTNLLALNAG
FT                   VEAARAGEAGKGFAVVAQEVRELAQRSAQAAKEIKALIQTSSGEVSTGVELVSKTGGSL
FT                   KQIGELVVAMNQHVDAIAVSSREQSVGLAEINTAVNSLDHATQQNAAMVEEASAAAASL
FT                   AKESATLRELVGRFNVGTTAERTALKKSA"
FT   sig_peptide     complement(309247..309339)
FT                   /locus_tag="Rleg2_5896"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.956) with cleavage site probability 0.467 at
FT                   residue 31"
FT   gene            309646..309916
FT                   /pseudo
FT                   /locus_tag="Rleg2_5897"
FT   gene            complement(309995..312112)
FT                   /locus_tag="Rleg2_5898"
FT   CDS_pept        complement(309995..312112)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5898"
FT                   /product="carboxyl-terminal protease"
FT                   /EC_number="3.4.21.102"
FT                   /note="KEGG: rec:RHECIAT_PA0000112 putative C-terminal
FT                   processing peptidase protein; TIGRFAM: carboxyl-terminal
FT                   protease; PFAM: PDZ/DHR/GLGF domain protein; peptidase S41"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5898"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59070"
FT                   /db_xref="GOA:B6A3T7"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR004447"
FT                   /db_xref="InterPro:IPR005151"
FT                   /db_xref="InterPro:IPR020992"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="InterPro:IPR040573"
FT                   /db_xref="UniProtKB/TrEMBL:B6A3T7"
FT                   /protein_id="ACI59070.1"
FT                   /translation="MRIAYVFLGAFLALVQSASAEVASPPVLAPLERQAEAAQLSAQFL
FT                   SRYSYKPVPLDDALSARVMDGFIKSLDPDRMLFLQADIDKFMAERSEIDDAIERKDLKI
FT                   PFAIFNAYEQRVVDRMTYARSLLKRDFDFSGQDNYSVLREKAPWPQSQAESDDLWRKRV
FT                   KSDWLRLKLGGKADAAIRETLDKRYENTLERAYKFKSDDVFQSFMDAYSNAIDPHTDYF
FT                   GAAASADFDVSMKLSLFGIGAVLQERDDYTTIRELVPGGPAELSGKLAVGDRITGVGQG
FT                   KNGPIKEVVGTRLDEVVQMIRGKKGSVVRLDILPADAGADATHRVVSLVRDKISLEKQA
FT                   ARKTVQTVKLGDTERKIGIITLPVFYEDFEAKGKGDKDYKSASRDVAKLLGELKDEKVD
FT                   SVLMDLRNNGGGSLDEAIDLTGLFIGKGPVVQQRRSDGKIEVKSSDLAEPVWSGPMGVL
FT                   INRGSASASEIFAAAIQDYGRGVIVGEGSFGKGTVQTVVDLDQMVHNSKPEYGELKVTI
FT                   AQFFRVNGGTTQLRGVTPDISLPGLSDPTSFGETSYDNALPWAEIKPAKYAPEGNVTAL
FT                   LPALQSRHDARVKGDPDFQRLVKDIADLKAQREKGIVSLNEAERRKEAAAREKRFKERA
FT                   QASDGDNPAGDDGLEAGERSLSADIALENARKNAKDVLLDEASAILADEVGLQDGDLNA
FT                   ATKPSGQADGK"
FT   sig_peptide     complement(312050..312112)
FT                   /locus_tag="Rleg2_5898"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.865 at
FT                   residue 21"
FT   gene            complement(312341..314302)
FT                   /locus_tag="Rleg2_5899"
FT   CDS_pept        complement(312341..314302)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5899"
FT                   /product="elongation factor G domain IV"
FT                   /note="PFAM: elongation factor G domain protein; elongation
FT                   factor G domain IV; KEGG: rec:RHECIAT_PA0000110 elongation
FT                   factor G protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5899"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59071"
FT                   /db_xref="GOA:B6A3T8"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR005517"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035649"
FT                   /db_xref="InterPro:IPR041095"
FT                   /db_xref="UniProtKB/TrEMBL:B6A3T8"
FT                   /protein_id="ACI59071.1"
FT                   /translation="MRCFTVLGPSQTGKSTVVEKLGSLEGTPRKSSSPYGLNLTEFTFG
FT                   NEAWCALDAPGANEALAHAQHALLASDACILCVSSAPEEAVLAAPYLRIVEASGTPCIL
FT                   FVNRMDEPRGRLRDVIAALQDYANHTLLLRQIPIREGDRIIGSCDLISERAWRYREGQP
FT                   SALIAIPESTAEREHEARTELLEHLSEFDDWLLEELIEDREPSSDALYAISSRVLSENR
FT                   IIPVLIGAASHGNGMMRLMKALRHEAPPVGILRQRLAQTGTVDEGKLVAVSFHAYHRQN
FT                   VGKTGLVRALGEGLRQGASLGGSSLGAVQNLANGRSNSAVLPAPGDVFATVKSDHLPVP
FT                   SLLTSGAVVAPPEWTEPPTPMLERILVPGSERDENKLSETLAKLSETDRGLKVLQEEGT
FT                   GAQLVRAQGPVHLRDLCRTLAEVFHISVTDRTPSPIYRETIAKPSEVHYRHRKQTGGAG
FT                   QFADVKLSIHPNERGQGFTFGETVKGGAVPRNYFSAVEAGAREAMEKGPLGFEVIDVGV
FT                   TLLDGQHHTVDSSEHAFRTASKMGVRQALSEGSTVLMQPVFRAEFHIPSVYSGSLIQIV
FT                   AALNGQVLGFDRDETAKGWDIFRALVPGGALEELARSLRSATQGIGYFSKTFDHFEELY
FT                   GKEADAIVRAKEKPGAAH"
FT   gene            complement(314633..317011)
FT                   /locus_tag="Rleg2_5900"
FT   CDS_pept        complement(314633..317011)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5900"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hmo:HM1_1017 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5900"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59072"
FT                   /db_xref="GOA:B6A3T9"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR034074"
FT                   /db_xref="InterPro:IPR036852"
FT                   /db_xref="UniProtKB/TrEMBL:B6A3T9"
FT                   /protein_id="ACI59072.1"
FT                   /translation="MSDLLATNTSTLQLRADPNALAPERLLVFELTGGVYKFEEAVRLV
FT                   PGLEFLGTEDLDPDDLDHNPSLYLMVPSEGALRNLVTLWRDWRRNGSVPSRFSSWKTLL
FT                   SQLRDIRPWGPQDRIAVEDALVLATEADHGHATMRVEIELVFRQNGEVAESVAREHIQA
FT                   KGGVVISRARVAGAGYHAILADVPTVAIREALAGNSESLAGSDAILQIRPQSVFHAVPY
FT                   EEEPGDVAGEAPDMPSGDPIASIFDAVPLSQHPRLANTLSLDDPFGLEQLAVGPRRHGT
FT                   AMASAVVHGDLNNPWPRALERPVYFVSMMFNAADGSNVERFPDRLPADLFEQALVHMRD
FT                   GPSPAAPHVLIVNASLGDANKPFSGRMSGWSRVVDYLASRYGVLFVISAGNHMGAYETE
FT                   NMSAMQFEDLPSDQKMRVALRASASQIALRRILAPAEAINAITVGALHADNYQHPYPLP
FT                   ASTFDVWAESGLCTVSSGLGPGYAGATKPDILAPGGRHHVRLMPDGANHRLQPLTVNAG
FT                   AFGGIGVAAPPTGTSLGPNVVARSVGTSVAAALATGVAARAHEALEAAYPDFVTLPSAQ
FT                   RAVLLKALLVHGARWTEARDLLIEILGPSDNRQHYRQKDNVRRYIGFGAYDPDRVIDCA
FT                   ADRATLWAVGRLGADQGKRFRIPWPAAMSGQARPHGVNATLAWFSPPKPGAVAYRGARM
FT                   KIIEPSKLGAAGIKAAGIQPDPKQAHKGTVVHRRWDGSRASAIAGDGFFEIDIQREADS
FT                   LPDDVQFALVVTLEMAGELAVYNQVLNRVALKPAVGIQT"
FT   gene            complement(317064..318122)
FT                   /locus_tag="Rleg2_5901"
FT   CDS_pept        complement(317064..318122)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5901"
FT                   /product="AAA ATPase central domain protein"
FT                   /note="PFAM: AAA ATPase central domain protein; ATPase
FT                   associated with various cellular activities AAA_5; SMART:
FT                   AAA ATPase; KEGG: hmo:HM1_1016 ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5901"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59073"
FT                   /db_xref="GOA:B6A3U0"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B6A3U0"
FT                   /protein_id="ACI59073.1"
FT                   /translation="MARSDLLVSLVKAGASGDRSTLTSTVEAIVAEERSKSHHVLADKL
FT                   HRALQSVPVTPASELRRSNGAGRDFILESEPRTTLESLLLTLPAEQLTRQLTEEQRRAD
FT                   LLRAQGMQPRHRVLLSGPPGNGKTSLAEAIAEGVAVPLLTVRYDALVGAYLGETNARLA
FT                   RLFDYVRTTPCVLFFDEFDAVGKERGDVHETGEIKRVVSFLLMQLDQLPSYVIVVAATN
FT                   HAELLDRAVWRRFQLRIDMPAPDAGSVAVLVNRFFEMWPENAGMSAETVALHLGPTSYA
FT                   EVREFCQNIRRRHILAQGAASLKSVLAEEIRLWKTRIRPESDGQHSGTPPSTPQQPRQR
FT                   RKTVGQSPPDPA"
FT   gene            318512..318808
FT                   /pseudo
FT                   /locus_tag="Rleg2_5902"
FT   gene            complement(318913..320283)
FT                   /locus_tag="Rleg2_5903"
FT   CDS_pept        complement(318913..320283)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5903"
FT                   /product="glycoside hydrolase family 4"
FT                   /note="PFAM: glycoside hydrolase family 4; KEGG:
FT                   rec:RHECIAT_PA0000101 alpha-galactosidase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5903"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59074"
FT                   /db_xref="GOA:B6A3U1"
FT                   /db_xref="InterPro:IPR001088"
FT                   /db_xref="InterPro:IPR015955"
FT                   /db_xref="InterPro:IPR022616"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B6A3U1"
FT                   /protein_id="ACI59074.1"
FT                   /translation="MAANPKITFIGAGSTVFMKNIIGDVLQRPALSGATIALMDLNPQR
FT                   LEESAIVVNKLISTLGVKAKAETYSDQRKALAGADFVVVAFQIGGYEPCTVTDFEVPKK
FT                   YGLRQTIADTLGVGGIMRGLRTVPHLWKVCEDMLAVCPEAIMLQYVNPMAINTWAISEK
FT                   YPTISQVGLCHSVQGTAMELAHDLDIPYEEIRYRAAGINHMAFYLKFEHRQADGSYRNL
FT                   YPDLVRGYREGRAPKPGWNPRCPNKVRYEMLTRLGYFVTESSEHFAEYTPYFIKEGRDD
FT                   LIEKFGIPLDEYPKRCIEQIERWKGQAEAYRSADKIEVTPSKEYASSIINSVWTGEPSV
FT                   IYGNVRNNGCITSLPANCAAEVPCLVDASGIQPTFIGDLPPQLTALIRTNINVQELTVQ
FT                   ALMTENREHIYHAAMMDPHTAAELDLDQIWSLVDDLLATHGNWLPEWARTSRKVQAA"
FT   gene            complement(320306..321973)
FT                   /locus_tag="Rleg2_5904"
FT   CDS_pept        complement(320306..321973)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5904"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: ret:RHE_PE00093 probable peptide ABC transporter,
FT                   ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5904"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59075"
FT                   /db_xref="GOA:B6A3U2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B6A3U2"
FT                   /protein_id="ACI59075.1"
FT                   /translation="MALALVNSFAPPVRHDHDGRQDTPVIDARNVAVNFKVEDGMVEAV
FT                   KDVSFQLYRGETIAIVGESGSGKSVTARTVMGLLSKRAVVSDKSTVAYDGSNILKFSER
FT                   ARRKLRGDRISMIFQEPMSSLNPIYTIGSQIVEAIRVHRKISKRDAQKRALELLEHVQI
FT                   PDPAARLMQYPHQLSGGQRQRVMIAMALANDPDVLIADEPTTALDVTVQAQILNLIRNL
FT                   QKEMGMAVILITHDLTVVRQFSDYVYVMQHGEVREHNTTEALFANPQHAYTRHLLASEP
FT                   RGEANPLPEGSDVILDAKGVRVAFMLRHGTFLKPAMRELVAVDSLSLTLRRHETLGLVG
FT                   ESGSGKTTFGQAILRLNTPDSGEIHFDHQPIHGLSRAEMRPLRARMQVVFQDPFSSLNP
FT                   RMTIGQIIEEGLVVNKLGATRAERQDRVREALISAGMPGNILSRFPHEFSGGQRQRIAI
FT                   ARAIALEPEFILLDEPTSALDLSVQAQIIELLRKLQDERGLSYLFISHDLKVVRALCHR
FT                   VIVMQHGKIVEEGPVNEVLSHPKTAYTERLVKAAFEVA"
FT   gene            complement(321984..323123)
FT                   /locus_tag="Rleg2_5905"
FT   CDS_pept        complement(321984..323123)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5905"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: ret:RHE_PE00092 probable
FT                   peptide ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5905"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59076"
FT                   /db_xref="GOA:B6A3U3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR025966"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B6A3U3"
FT                   /protein_id="ACI59076.1"
FT                   /translation="MLAFDSSPPPPTTTETSVSKPSRGHESYIALVWRRLRRSWTGMAG
FT                   LILVGLLLFMAIFADFVAPMDPKATDVGFAPPQMMSFHDKDGNFVFQPRVYGLADSDAL
FT                   DPVTFQPIVGVDYDNPRLLGFFVKGSEYRLFGLIPADRHFFGSTDGQPVHFLGTDKFGR
FT                   DVLSRAIIGSRISLMIALTVVFIVTVIGTTVGMVSGYFGGTFDVWLQRFVELVLAFPQL
FT                   PLYLALTSLIPVTAPTNVFLAFVIIVMSALGWAQMSREVRGKTLALARIDYVRAAMAVG
FT                   ATDKRIIMQHIFPNVMSHVIVAVTLAIPSVVLLESFLGFLGFAVKPPLISWGLMLQDTA
FT                   TYSVIGSYPWILSPVGFVLVTVFAFNALGDGLRDAVDPY"
FT   gene            complement(323125..324132)
FT                   /locus_tag="Rleg2_5906"
FT   CDS_pept        complement(323125..324132)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5906"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: rec:RHECIAT_PA0000098
FT                   probable peptide ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5906"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59077"
FT                   /db_xref="GOA:B6A3U4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B6A3U4"
FT                   /protein_id="ACI59077.1"
FT                   /translation="MLRFLLVRIASAIPVLFILSVVTFAIIQAPPGDYADYIRSQLINQ
FT                   GGASYAQAEAQAQAYRVEHGLDKPMVVQYVNWIGGIVTRGDFGYSMFYNKPVADVVAER
FT                   LPRTLLLALVCHIFASVLGIGFGIWAATRQYSWIDSTLSAVSFLGMTVPRFLMALIIVY
FT                   LLVFQFNVTEIGSFFSPQYGGAPWSWAKFVDLVHHVWPVVAIATFGGLAYNMRVMRGNL
FT                   LDTLNAQYVETAKAKGLSGGAVVMRHAVPNALHPLVMYQGVVLPYMLTGEIETAIIFAL
FT                   PTVGPAIVGSMAIGDVYVTATFMMVLSATLIVGNIIADMLLALLDPRVRQFEGA"
FT   sig_peptide     complement(324055..324132)
FT                   /locus_tag="Rleg2_5906"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.886) with cleavage site probability 0.776 at
FT                   residue 26"
FT   gene            complement(324247..326337)
FT                   /locus_tag="Rleg2_5907"
FT   CDS_pept        complement(324247..326337)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5907"
FT                   /product="extracellular solute-binding protein family 5"
FT                   /note="PFAM: extracellular solute-binding protein family 5;
FT                   KEGG: rec:RHECIAT_PA0000097 alpha-galactoside ABC
FT                   transporter, substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5907"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59078"
FT                   /db_xref="GOA:B6A3U5"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:B6A3U5"
FT                   /protein_id="ACI59078.1"
FT                   /translation="MMKFRKLGILAGLALGVSVLALNAYASEATVPPAPADFPAEGKIK
FT                   YVARDSILEFKALPEYHEPDWVTKNFVATGKLPAVKDRLPKEPMVFKTGNMPDGIGVYG
FT                   DTMRHVIGGRPEGWNYGAGQTQGWGGIDIGLSECLTRTAPLFQVEAKDTEPLPNLAKSW
FT                   DWSEDGHKLTMHLVEGAKWSDGAPFNADDIMFYWDDEVVDPNVSPLGGGASPEAFGVGT
FT                   TLKKIDDYTVEWTFKDAFPKQYLYTMAYPNFCPGPSHILKPQHPKYSKNTYDQFKNAFP
FT                   PEFMNMPVMGAWVPVEYRSDDIIVMRRNPYYWKVDEKGNQLPYLNELHYKLSTWADRDV
FT                   QAVAGSADISNLEQPENFVASLKRAAEKTAPARLAFGPRLIGYNLRMNFSANGWGNPDE
FT                   RGQAIRELNRNEDFRKAVTMALDRKAIGDSLVKGPFTAIYPGGLSSGTSFYDRNSTVYY
FT                   PFDLKGAKEELAKAGLKDTDGNGIVNFPAGTAGGKDVEIVMLINNQYTTDKSLAEGVVA
FT                   QMEKLGLKIVINALDGPKRDDAHYAGRFDWLIQRNTTELSSVVQNTEQLAPIGPRTSWH
FT                   HRAGKDDQLDLMPFEKELNDIVAKFTTSPDNDARVALMKQYQKISTEHVNTVGLTEYPG
FT                   ALIINKRFSNVPQGTPIFMFNWAEDSVIRERLWVAADKQGKYELFPEQLPGKPGDKGPV
FT                   NN"
FT   sig_peptide     complement(326257..326337)
FT                   /locus_tag="Rleg2_5907"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.988 at
FT                   residue 27"
FT   gene            complement(326462..327928)
FT                   /locus_tag="Rleg2_5908"
FT   CDS_pept        complement(326462..327928)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5908"
FT                   /product="glycoside hydrolase family 4"
FT                   /note="PFAM: glycoside hydrolase family 4; KEGG:
FT                   rec:RHECIAT_PA0000096 alpha-galactosidase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5908"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59079"
FT                   /db_xref="GOA:B6A3U6"
FT                   /db_xref="InterPro:IPR001088"
FT                   /db_xref="InterPro:IPR015955"
FT                   /db_xref="InterPro:IPR019802"
FT                   /db_xref="InterPro:IPR022616"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B6A3U6"
FT                   /protein_id="ACI59079.1"
FT                   /translation="MSFKIAIIGAGSVGFTKKLFTDILCVPEFRDVEFALTDLSEHNLE
FT                   MIKAILDRIVEANGLPTKVTATTDRRQALTGARYIISCVRVGGLEAYADDIRIPLKYGI
FT                   DQCVGDTICAGGILYGQRNIPVILDFCKDIREVAEPGAKFLNYANPMAMNTWAAIEYGK
FT                   VDTVGLCHGVQHGAEQIAEVLGAKSLGELDYVCSGINHQTWFIDLRLNGRRIGKDELIA
FT                   AFEAHPVYSQQEKLRIDVLKRFGVYSTESNGHLSEYLPWYRKRPEEITRWIDMSDWIHG
FT                   ETGGYLRHSTETRNWFETEFPQFLESAAKPIDPAKRSNEHASHILEALETNRVYRGHFN
FT                   VKNNGVITNLPSDAIIESPGFVDRFGINMVSGVTLPEACAATCIASINVQRMSVHAAIS
FT                   GDIDLLKLAVLHDPLVGAVATPEEVWQMVDEMVVAQARWLPQYADAVPAAKERLSKSKV
FT                   QTRDWAGAARRNVRSIEELRAEKAALKQAV"
FT   gene            328142..329017
FT                   /locus_tag="Rleg2_5909"
FT   CDS_pept        328142..329017
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5909"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: helix-turn-helix- domain containing protein
FT                   AraC type; AraC protein arabinose-binding/dimerisation;
FT                   KEGG: rec:RHECIAT_PA0000095 probable transcriptional
FT                   regulator protein, AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5909"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59080"
FT                   /db_xref="GOA:B6A3U7"
FT                   /db_xref="InterPro:IPR003313"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="InterPro:IPR037923"
FT                   /db_xref="UniProtKB/TrEMBL:B6A3U7"
FT                   /protein_id="ACI59080.1"
FT                   /translation="MLQNLIANGQSMRTVSLPRGRQPLHAMPTSSGYEVRENEPYDWDG
FT                   RRRGQTPFTVLQHTISGTGRLRYQNRNYRLQGGDTLLVLVPHNHRYWLEKGDRWEYFWI
FT                   SMNGEETLRIHQLVLSTAGPVLKLQPSTIDHLADCSLRLVTGATSPGAASAIAYEAAMA
FT                   LYDDVFGSPAFAAELSLMQPVIDHINANLEKPLPVSELAGIVGLSRAHFSRSFAESEGM
FT                   PPAEFVLQQRLQRAVKLLTKADFLPVKEVAIMCGFEDPNYFSKVFRRVYGTNPTEFRTT
FT                   GMYASIGKLR"
FT   gene            complement(329042..330103)
FT                   /locus_tag="Rleg2_5910"
FT   CDS_pept        complement(329042..330103)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5910"
FT                   /product="Methyltransferase type 12"
FT                   /note="PFAM: O-methyltransferase family 2;
FT                   Methyltransferase type 11; Methyltransferase type 12; KEGG:
FT                   mpt:Mpe_A0328 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5910"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59081"
FT                   /db_xref="GOA:B6A3U8"
FT                   /db_xref="InterPro:IPR025714"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B6A3U8"
FT                   /protein_id="ACI59081.1"
FT                   /translation="MREPDMQKLDALVGRLVGDVGAAMSGALVVLGDKVGIFKAMADGT
FT                   AMNVQQLSQKTGVKERYLREWLSAQAAADYITYDEKTDRFSLSAEQAMVFAEENSPAFF
FT                   VGAFEVVQSMWMDEPKVAEAFRTGKGLGWHEHSTCLFRGTERFFRPGYNSHLVAEWIPA
FT                   LAGVEEKLKAGASVADVGCGHGASTILMAQAYPASRFTGFDYHGPSIEKAKAAAEDAGV
FT                   ADRVTFEQSRAAEFPGRGYDMVAMFDCLHDMGDPVGAGQHVKETLGPNGTWLIVEPFAH
FT                   DHLKDNLNPVGRVYYGASTMICTPASLSQEVGLGLGAQAGEMKLRKVALDAGFTHFRRA
FT                   TETPFNMVFEVRA"
FT   gene            330373..330690
FT                   /locus_tag="Rleg2_5911"
FT   CDS_pept        330373..330690
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5911"
FT                   /product="putative transcriptional regulator, XRE family"
FT                   /note="KEGG: ret:RHE_PE00087 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5911"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59082"
FT                   /db_xref="GOA:B6A3U9"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:B6A3U9"
FT                   /protein_id="ACI59082.1"
FT                   /translation="MSLTSAQCRAARALLAWSQDDLSSAANVAKATIANFEAGKRSPYD
FT                   RTLQDMKHALEAGGVIFIPENGGGAGVRLAKRANSIDTNETETVQYEEYLENDAPPGAG
FT                   G"
FT   gene            330694..330954
FT                   /locus_tag="Rleg2_5912"
FT   CDS_pept        330694..330954
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5912"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rec:RHECIAT_PA0000093 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5912"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59083"
FT                   /db_xref="UniProtKB/TrEMBL:B6A3V0"
FT                   /protein_id="ACI59083.1"
FT                   /translation="MTKKQKLEHSELAGEFTDDGVTVLVDIFRTSGSNEDWTMEVVTQA
FT                   EDLIRWDEPFATDREAFDEFLAVVARDGLRSFLDDEEPSVH"
FT   gene            330964..331203
FT                   /locus_tag="Rleg2_5913"
FT   CDS_pept        330964..331203
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5913"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rec:RHECIAT_PA0000092 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5913"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59084"
FT                   /db_xref="UniProtKB/TrEMBL:B6A3V1"
FT                   /protein_id="ACI59084.1"
FT                   /translation="MKSINDLVASAKTVCDRYRAGRMERETVREWVLGLGAYPGPHGDR
FT                   VREAMEWFRLHNREPVSDDIVLVDIDRLKAISAP"
FT   gene            331360..333921
FT                   /locus_tag="Rleg2_5914"
FT   CDS_pept        331360..333921
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5914"
FT                   /product="FAD dependent oxidoreductase"
FT                   /note="PFAM: FAD dependent oxidoreductase; glycine cleavage
FT                   T protein (aminomethyl transferase); Glycine cleavage
FT                   T-protein barrel; KEGG: rec:RHECIAT_PA0000091 putative
FT                   sarcosine dehydrogenase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5914"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59085"
FT                   /db_xref="GOA:B6A3V2"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR006222"
FT                   /db_xref="InterPro:IPR013977"
FT                   /db_xref="InterPro:IPR027266"
FT                   /db_xref="InterPro:IPR029043"
FT                   /db_xref="InterPro:IPR032503"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B6A3V2"
FT                   /protein_id="ACI59085.1"
FT                   /translation="MAAFPEKAKVVIIGLGGIVGASIAHHLVERGWDDIVGIDKSGIPT
FT                   DIGSTAHASDFCYTTSHDYLSVWTTQYSIDFYEKMGHYARIGGLEVARTGDDAWMEEIK
FT                   RKLSSARAFGTRAHYVSPSEIKAKFPLIEEDQVMGGLYDPDAGLVIPRSQTVAGKLVDA
FT                   AEKAGKLQVFGNTPAKSLIVEGGRIKGVVTHRGTIMADHVIVCAGLWGRLIAEMVGEDL
FT                   PVMPVDHPLTFFGPYNEFEGTGKEIGFPLLRDQGNSAYMRDTGDPATTEGGQIEWGYYE
FT                   ANNPRMCHPRDILEKHEARLSPSQRDLEMEQIIEPLERAMELTPILGELGYNEGHSFNG
FT                   LLQVSASGGASCGESQKVRGLWYCVAIWVKDGPGYGKLIADWMTDGRTEIDHNSIDYAR
FT                   FYPHQLTEEFIEGRCYEAAQKIYFPAVHTREPYVSGRNAKRSPFYEREKELGGYFMELG
FT                   GWERAHGYAANEHLLEKYADRVPVRENEWDSRHFWRVSNAEHLAMSEDCGIVNLSHFHM
FT                   VDIEGPDHVELMEWLCAAKVGGDANIGKGVYTHFLDDEGMVRADFTVFRMADRCRLVNG
FT                   ADAGPRDLYYMKRVAEDRGLDVTITDVSEKFVTIGIWGPNARDTLKKAVADPAGLDQEN
FT                   FAFAAIKPIEIAGKPVTAFRISYVGEQGWELHMKYEDGLAVWDALRATGVMAFGVETYA
FT                   NSRRMEKSLRLQNADLLTQYNLIEADLARPKVKEADFRGKAKHLEYKAREHQPAMLCTL
FT                   VMTENTDKSGVKRYPLGNLPVVDPATGEVLVDELGRRSYTTSIAYGPTVGKNIALAYLP
FT                   WSHCQVGRKLNVEYFAETYPVEVVGVGYKPIYDPENLKPRT"
FT   gene            complement(333926..334675)
FT                   /locus_tag="Rleg2_5915"
FT   CDS_pept        complement(333926..334675)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5915"
FT                   /product="phosphoesterase PA-phosphatase related"
FT                   /note="PFAM: phosphoesterase PA-phosphatase related; KEGG:
FT                   ret:RHE_PE00083 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5915"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59086"
FT                   /db_xref="GOA:B6A3V3"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="InterPro:IPR036938"
FT                   /db_xref="UniProtKB/TrEMBL:B6A3V3"
FT                   /protein_id="ACI59086.1"
FT                   /translation="MSEVQRRGFLARLTAYEPLTLIMLASVAGGLFVLQRLTSEVLEGE
FT                   TFHFDETILLALRRPGELGVPIGPGWLTHAVGDITSLGGVTVLSLMTILVTVYLLLDRR
FT                   WPIAIFVLSSVLTGWLASTILKILVARPRPDIVPHLVEVSDLSFPSGHAMVSAVTYLTL
FT                   GALLARTQRYRSTRIFVMFAGVFLAVIIGLSRIYLGVHYPTDVLAGWCAGALWALGCWL
FT                   ISKRFIPSRAPDAAAEAENGDGGGISA"
FT   gene            334907..335440
FT                   /locus_tag="Rleg2_5916"
FT   CDS_pept        334907..335440
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5916"
FT                   /product="cytochrome c oxidase subunit II"
FT                   /note="PFAM: cytochrome c oxidase subunit II; KEGG:
FT                   mrd:Mrad2831_0033 cytochrome c oxidase, subunit II"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5916"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59087"
FT                   /db_xref="GOA:B6A3V4"
FT                   /db_xref="InterPro:IPR002429"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="UniProtKB/TrEMBL:B6A3V4"
FT                   /protein_id="ACI59087.1"
FT                   /translation="MLGLNRKKPAFIGFCILAGLAPCSGQAIGKNPNSPSPIDLVPDLV
FT                   QPVSDSSLADPGLSITIIGYRYGWRYRIEQRDNSRCFAGKVLVLPQGKIVQLKITSDDV
FT                   VHEWAVPALNLKTDAVPGLLSFVAVDTKVAGSFHGGATRMSGHRYKRMEFELRIIKADA
FT                   YQAWEKALPTSCEE"
FT   sig_peptide     334907..334996
FT                   /locus_tag="Rleg2_5916"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.725 at
FT                   residue 30"
FT   gene            335570..336112
FT                   /locus_tag="Rleg2_5917"
FT   CDS_pept        335570..336112
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5917"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rec:RHECIAT_PA0000089 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5917"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59088"
FT                   /db_xref="UniProtKB/TrEMBL:B6A3V5"
FT                   /protein_id="ACI59088.1"
FT                   /translation="MKILTAMVLMAAVLPPVSAFGETEWMGGARQWSVGFSSERPAYCR
FT                   LVWNSELGKTMEFRQSAKETFWLVTKDSWDIPAGTTTEVTLTDRSMTKVVAAEYFDKTT
FT                   LRLWPPASKGSGGLKKIIKNAFAGTPDVQLSFAGDEGDWTLPLSRVDQLYPTYRDCLKR
FT                   LEAGEKPKQDSATSKPF"
FT   sig_peptide     335570..335635
FT                   /locus_tag="Rleg2_5917"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.963 at
FT                   residue 22"
FT   gene            complement(336125..337618)
FT                   /locus_tag="Rleg2_5918"
FT   CDS_pept        complement(336125..337618)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5918"
FT                   /product="phenylalanine/histidine ammonia-lyase"
FT                   /note="PFAM: phenylalanine/histidine ammonia-lyase; KEGG:
FT                   rec:RHECIAT_PA0000088 histidine ammonia-lyase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5918"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59089"
FT                   /db_xref="GOA:B6A3V6"
FT                   /db_xref="InterPro:IPR001106"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="UniProtKB/TrEMBL:B6A3V6"
FT                   /protein_id="ACI59089.1"
FT                   /translation="MTINIETVLTWCDVARVGAGEALTLSPAAWARVEQASRIVASIVE
FT                   TGMRAYGVNTGVGALADTVVDRASQSLLSRSIVLSHACGVGPLLGSHEVRAIIAAQIAN
FT                   FAHGHSGVRREIVQHLTAMLEHDCIPDVPSKGSAGYLTHNAHTALVLIGEGSATLAGRR
FT                   LSGREALAAIGLEPLVLGAKEGLSLVNGTACATGLTATALLRAEKLLDWADAIAALTLE
FT                   AAGCQIAAFDEAVLALRPSAGIEKVGATLRARLRGSGLVAVASGRRTQDALSLRSVPHA
FT                   HGAARDVFDNSAHIADQELASVTDNPAVSGTPEQPIVSSEAHAVAPALGQAADSLAIAL
FT                   AQIGAISERRMDRLVNPLVSGLPSFLASDAGSHSGFMIAQYTAAALSNENRRLAAPAAM
FT                   DGGLTSGLQEDFLAHPTAAAGKLLAVIDNAEYILAIELMAGAQAHDFLAATAPRAPGTD
FT                   LVYQAVRERISHYGDERPLNGDIEAVRSLIRETLPPAIV"
FT   gene            complement(337615..338391)
FT                   /locus_tag="Rleg2_5919"
FT   CDS_pept        complement(337615..338391)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5919"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: ret:RHE_PE00080 octopine ABC transporter, ATP-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5919"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59090"
FT                   /db_xref="GOA:B6A3V7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030679"
FT                   /db_xref="UniProtKB/TrEMBL:B6A3V7"
FT                   /protein_id="ACI59090.1"
FT                   /translation="MPGVTRLSVRNIRKSFGTHEVLRGISLDAEDGDVISLLGASGSGK
FT                   STFLRCINMLETASDGEIWVDGEHIEMVHKNGRSKPASQKQVDHIRSELGMVFQSFNLW
FT                   SHMTILQNVIEGPIHVLKRPRADCIAEAEALLEKVGIADKRHAYPAHLSGGQQQRAAIA
FT                   RALAMKPKVMLFDEPTSALDPELVGEVLRVMRALAEEGMTMLVVTHEMSFARNVSNRVV
FT                   FMREGLVESSGKPDEMFTGGATPAFRQFIGHFGSGQ"
FT   gene            complement(338417..339121)
FT                   /locus_tag="Rleg2_5920"
FT   CDS_pept        complement(338417..339121)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5920"
FT                   /product="polar amino acid ABC transporter, inner membrane
FT                   subunit"
FT                   /note="TIGRFAM: polar amino acid ABC transporter, inner
FT                   membrane subunit; PFAM: binding-protein-dependent transport
FT                   systems inner membrane component; KEGG: ret:RHE_PE00079
FT                   octopine ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5920"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59091"
FT                   /db_xref="GOA:B6A3V8"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B6A3V8"
FT                   /protein_id="ACI59091.1"
FT                   /translation="MDFTFLASTMVTLLKAVPTTLILFSLSIFFGGLLALVIVSMRVSG
FT                   NRVLSGIAKGYIFVFRGSPLLIQMFLVFYGLGQFGVIRYSFLWPFLREPMVCAVLSLAL
FT                   CTAGYTAEIFRGGIRAVSPKEIEAARSIGMSGFLLVRRILAPIAFRHALPAYSTEIVLM
FT                   MKSTALASLVTVWEVTGVAQRLISQTYRTMEVFLCAAIIYLVLNFIILQGMALLEYSLS
FT                   RHRRAAPQPLKA"
FT   gene            complement(339132..339857)
FT                   /locus_tag="Rleg2_5921"
FT   CDS_pept        complement(339132..339857)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5921"
FT                   /product="polar amino acid ABC transporter, inner membrane
FT                   subunit"
FT                   /note="TIGRFAM: polar amino acid ABC transporter, inner
FT                   membrane subunit; PFAM: binding-protein-dependent transport
FT                   systems inner membrane component; KEGG: ret:RHE_PE00078
FT                   octopine ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5921"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59092"
FT                   /db_xref="GOA:B6A3V9"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B6A3V9"
FT                   /protein_id="ACI59092.1"
FT                   /translation="MASLELLGFGSTGWGALLILATLMTLAVTATALAIGAVLGAIVAG
FT                   AKLSGNPFLVALGNVYTTVFRGVPELLIIYLIYFGGSSAVTSIGKAMGYEGFLGLPSFA
FT                   AGALAVGIISGSYQAEVFRGAFLAISKGELEAASAIGMHRAMRFRRIIMPQVLRLAIPG
FT                   LGNVWQLSLKDSALISVTGLAELMRTSQVAAGSTRQYFLFFIAGGCLYLILTSLSDRIF
FT                   NGAERRANRSMPASAMGQA"
FT   sig_peptide     complement(339753..339857)
FT                   /locus_tag="Rleg2_5921"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.980) with cleavage site probability 0.353 at
FT                   residue 35"
FT   gene            complement(339962..340804)
FT                   /locus_tag="Rleg2_5922"
FT   CDS_pept        complement(339962..340804)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5922"
FT                   /product="extracellular solute-binding protein family 3"
FT                   /note="PFAM: extracellular solute-binding protein family 3;
FT                   KEGG: ret:RHE_PE00077 probable octopine ABC transporter,
FT                   substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5922"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59093"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:B6A3W0"
FT                   /protein_id="ACI59093.1"
FT                   /translation="MKFSTILFCGVAALSAFAAPAFAKDWTKATITLEGAYAPWNLTNA
FT                   DGTLGGFEPELAKVLCERAKIECTLVASDWDGMIPALNAGKFDVIMDALSITEERKQVI
FT                   DFTIPYAATPAAFATAKDSPLAKAAGTGATIKMTPGQTGVKEIDALKAAFKGKTIGIQA
FT                   ATVYAKFVYDNFGDIAEIREYKTGADRDLDLQNGRIDLGFDDAVYFANAFKSANGALDF
FT                   TGPEIVGSIWGEGEGLGVRKADTDLRDKFSEAIKSALADGTVKNLSMKWFQVDVSPQQ"
FT   sig_peptide     complement(340733..340804)
FT                   /locus_tag="Rleg2_5922"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.998 at
FT                   residue 24"
FT   gene            340999..341754
FT                   /locus_tag="Rleg2_5923"
FT   CDS_pept        340999..341754
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5923"
FT                   /product="transcriptional regulator, histidine utilization
FT                   repressor, GntR family"
FT                   /note="TIGRFAM: histidine utilization repressor; PFAM:
FT                   regulatory protein GntR HTH; UbiC transcription
FT                   regulator-associated domain protein; KEGG:
FT                   rec:RHECIAT_PA0000082 histidine utilization transcriptional
FT                   regulator (repressor) protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5923"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59094"
FT                   /db_xref="GOA:B6A3W1"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR010248"
FT                   /db_xref="InterPro:IPR011663"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B6A3W1"
FT                   /protein_id="ACI59094.1"
FT                   /translation="MKRSGEMKRELAENDSTPLYAGVKQVILDRIHSGEWPPKYRVPSE
FT                   NELVVELGVSKMTANRALRELANEGELVRIQGVGSFVAERKGYSALFEVRNIAEEIAER
FT                   GHVHEASVVVLAQETASPEIADALELAIGAAVFHSLIVHSENGVPVQIEDRFVHPEAAP
FT                   EYLEQDFTTLTPNAYLTAAAPLSGSEHVVEAAMPQAWECKLLTILKTEPCLTIRRRTWS
FT                   AKQVVSTARLVYPGYRYRLEARSGKMFEE"
FT   gene            complement(341787..342509)
FT                   /locus_tag="Rleg2_5924"
FT   CDS_pept        complement(341787..342509)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5924"
FT                   /product="transcriptional regulator, histidine utilization
FT                   repressor, GntR family"
FT                   /note="TIGRFAM: histidine utilization repressor; PFAM:
FT                   regulatory protein GntR HTH; UbiC transcription
FT                   regulator-associated domain protein; KEGG:
FT                   rec:RHECIAT_PA0000081 putative transcriptional regulator
FT                   protein, GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5924"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59095"
FT                   /db_xref="GOA:B6A3W2"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR010248"
FT                   /db_xref="InterPro:IPR011663"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B6A3W2"
FT                   /protein_id="ACI59095.1"
FT                   /translation="MNQSRDPTLHQRILGEIEGRIVSGEWPPGHRIPFEVDLATQYDVS
FT                   RMTVNKVLTQLAKAGLIERRKKSGSFVTQPQAQSAVLEIHDIKAEVQSLNLPYSYAVSK
FT                   TASRKAKAEDSRRLELPVASSVVEVVCIHNAGTRPFCLEERLISLATVPEAADADFLTV
FT                   APGPWLLNQVPWSTAEHRIHAVSANAEVAAALDIARNTACLVVERRTWSGAGPVTHVRF
FT                   TYPGDRHALVARFTPASQ"
FT   gene            complement(342570..343916)
FT                   /locus_tag="Rleg2_5925"
FT   CDS_pept        complement(342570..343916)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5925"
FT                   /product="formiminoglutamate deiminase"
FT                   /note="TIGRFAM: formiminoglutamate deiminase; PFAM:
FT                   amidohydrolase; KEGG: rec:RHECIAT_PA0000080 probable
FT                   cytosine deaminase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5925"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59096"
FT                   /db_xref="GOA:B6A3W3"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR010252"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:B6A3W3"
FT                   /protein_id="ACI59096.1"
FT                   /translation="MTILHASAALTPQGWQKDVRLTLESGRIARLEAGVSAAPSDERHA
FT                   LIVPAMGNLHSHAFQRAMAGLAEVRGPANDSFWSWRTVMYKFALAMTPEHVEAVAAKLY
FT                   AEMLEAGFSRVGEFHYLHHDRDGGAYANIAELAERIGAASQQAGIGLTLLPVFYAHSGF
FT                   GGAQPIDGQRRFINSLESFERLMEGCRGVTGRLDGAELGLAPHSLRAATPEELAKLVPM
FT                   AGDGPIHIHVAEQVKEVEDCVAWSGARPVEWLLDHMPVDQRWCLIHATHMTEDETRRMA
FT                   KSGAIAGLCPITEANLGDGAFAAPLFLQEGGSYGIGSDSNVLISVSEELRQLEYSQRLA
FT                   LRARNVVAAAGGSTALSLFTHALAGGGAALKAPAGLAEGHHADLVSLDTSAVPYLSGDQ
FT                   ILDHWLFAGGVSVDCVWARGRKQVAGGRHVGREAIDRRFLAAMGELLAA"
FT   gene            344038..345300
FT                   /locus_tag="Rleg2_5926"
FT   CDS_pept        344038..345300
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5926"
FT                   /product="imidazolonepropionase"
FT                   /EC_number="3.5.2.7"
FT                   /note="KEGG: rec:RHECIAT_PA0000079 imidazolonepropionase
FT                   protein; TIGRFAM: imidazolonepropionase; PFAM:
FT                   amidohydrolase; Amidohydrolase 3"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5926"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59097"
FT                   /db_xref="GOA:B6A3W4"
FT                   /db_xref="InterPro:IPR005920"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:B6A3W4"
FT                   /protein_id="ACI59097.1"
FT                   /translation="MTGNNFSEGTASAEVRPALWRNARLATLAPDKAGLGIVEKGAVLI
FT                   ENGRIAFAGAESELPASAIEHSEIVDLEGRWVTPGLVDCHTHIVHGGNRAREFEMRLEG
FT                   ATYEEIARAGGGIVSSVQATNALSVEELVATALPRLDTLLAEGVTTVEIKSGYGLNRSG
FT                   EVKMLQSAHLLGHVRPVRVATSYLGAHATPVEYKGRNGDYLDDVVLPGLDDMYNLGLAD
FT                   AVDGFCEGIAFSTAEIARVFDKAKALGLPVKLHAEQLSNLGGAKLAAAYGALSADHLEY
FT                   LDEEGVAAMATAGTVAVLLPGAFYAIHEKQKPPVEALRRAGVPIAIATDCNPGTSPLTS
FT                   MLLTMNMSATLFGLTVEECIAGATREGARALGLLGETGTLEAGKSADLAVWNIESLAEL
FT                   VYRIGFNPLHARVFKGERNGR"
FT   gene            345297..346832
FT                   /locus_tag="Rleg2_5927"
FT   CDS_pept        345297..346832
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5927"
FT                   /product="histidine ammonia-lyase"
FT                   /EC_number="4.3.1.3"
FT                   /note="KEGG: rec:RHECIAT_PA0000078 histidine ammonia-lyase
FT                   protein; TIGRFAM: histidine ammonia-lyase; PFAM:
FT                   phenylalanine/histidine ammonia-lyase"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5927"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59098"
FT                   /db_xref="GOA:B6A3W5"
FT                   /db_xref="InterPro:IPR001106"
FT                   /db_xref="InterPro:IPR005921"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR022313"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="UniProtKB/TrEMBL:B6A3W5"
FT                   /protein_id="ACI59098.1"
FT                   /translation="MTITLHPGSVSLKDLETIYWTGAPARLDPAFDAGIAKAAARIAEI
FT                   AAANAPVYGINTGFGKLASIKIDSADVATLQRNLILSHCCGIGAPLPENIVRLIMALKL
FT                   VSLGRGASGVRLELVRLIEGMLDKGVIPLIPEKGSVGASGDLAPLAHMAAVMMGEAEAF
FT                   FAGERLTGAEALERAGLKPVVLAAKEGLALINGTQTSTALALAGLFRAHRAAQAALITG
FT                   AMSTDAAMGSSAPFHPDIHTLRGHKGQIDTASALRALLEQSVIRQSHIEGDERVQDPYC
FT                   IRCQPQVDGACLDILRSVARTLEIEANAVTDNPLVLSDNSVVSGGNFHAEPVAFAADQI
FT                   ALAVCEIGAISQRRIALLVDPVLSYGLPAFLAKKPGLNSGLMIAEVTSAALMSENKQMS
FT                   HPASVDSTPTSANQEDHVSMACHGARRLLGMTENLFGIIGIEALTAAQGVELRAPLSTS
FT                   PELLKAIAAIRSKVPSLDSDRYMAGDLAAAAELVATGALNAAVSSGILPVLEG"
FT   gene            346838..347038
FT                   /locus_tag="Rleg2_5928"
FT   CDS_pept        346838..347038
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5928"
FT                   /product="diaminohydroxyphosphoribosylaminopyrimidine
FT                   deaminase / 5-amino-6-(5-phosphoribosylamino)uracil
FT                   reductase"
FT                   /note="KEGG: atc:AGR_C_2159
FT                   diaminohydroxyphosphoribosylaminopyrimidine deaminase /
FT                   5-amino-6-(5-phosphoribosylamino)uracil reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5928"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59099"
FT                   /db_xref="UniProtKB/TrEMBL:B6A3W6"
FT                   /protein_id="ACI59099.1"
FT                   /translation="MYVHLVPPSALPGISPTGGEIGWSDPLAPTSIVWGDTIRASISPL
FT                   VGEMSGRAEGGDTPNARGLCP"
FT   gene            347035..347838
FT                   /locus_tag="Rleg2_5929"
FT   CDS_pept        347035..347838
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5929"
FT                   /product="N-formylglutamate amidohydrolase"
FT                   /note="PFAM: N-formylglutamate amidohydrolase; KEGG:
FT                   ret:RHE_PE00071 formiminoglutamase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5929"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59100"
FT                   /db_xref="GOA:B6A3W7"
FT                   /db_xref="InterPro:IPR007709"
FT                   /db_xref="InterPro:IPR010247"
FT                   /db_xref="UniProtKB/TrEMBL:B6A3W7"
FT                   /protein_id="ACI59100.1"
FT                   /translation="MTAPYEIHRGTSPVILAFPHTGTDVPPGIADRLNDNGRILADTDW
FT                   YIHRLYDGLLDDVTTVRATFHRYVIDANRDPAGVSLYPGQNTTGLVPETDFDGKPIWKD
FT                   GQAPDEADIAARLRDFHAPYHAALAAEIERVRATHGVAILYDCHSIRSHIPFLFEGKLP
FT                   DFNIGTDMGKTCDGAIEQATLTVVEAAQGYDSMLNGRFKGGWTTRHYGRPATGVHAIQM
FT                   ELAQSTHLQTETPPFAYDAAKADRLRVHLRDILLRIEQIAPDLKR"
FT   gene            347855..349528
FT                   /locus_tag="Rleg2_5930"
FT   CDS_pept        347855..349528
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5930"
FT                   /product="urocanate hydratase"
FT                   /EC_number="4.2.1.49"
FT                   /note="KEGG: rec:RHECIAT_PA0000076 urocanate hydratase
FT                   protein; TIGRFAM: urocanate hydratase; PFAM: Urocanase"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5930"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59101"
FT                   /db_xref="GOA:B6A3W8"
FT                   /db_xref="InterPro:IPR023636"
FT                   /db_xref="InterPro:IPR023637"
FT                   /db_xref="InterPro:IPR035085"
FT                   /db_xref="InterPro:IPR035400"
FT                   /db_xref="InterPro:IPR035401"
FT                   /db_xref="InterPro:IPR036190"
FT                   /db_xref="InterPro:IPR038364"
FT                   /db_xref="UniProtKB/TrEMBL:B6A3W8"
FT                   /protein_id="ACI59101.1"
FT                   /translation="MNNPRHNIREIRAPRGNELNSKSWMTEAPLRMLMNNLDPDVAENP
FT                   NELVVYGGIGRAARTWEDFDRIVATLKTLTEEETLLVQSGKPVGVFRTHKDAPRVLIAN
FT                   SNLVPHWATWDHFNELDKKGLAMYGQMTAGSWIYIGTQGIVQGTYETFVEAGRQHYGGN
FT                   LKGKWILTGGLGGMGGAQPLAAVMAGACCLAVECNPDSIDFRLRTRYVDAKAETLDEAL
FT                   EMIDRWTKAGEAKSVGLLGNAAEILPEMVRRGIRPDMVTDQTSAHDPINGYLPKGWTMA
FT                   EWKAKRESDPKAVEKAARASMREHVEAMIAFWDAGIPTLDYGNNIRQVAKEEGLENAFA
FT                   FPGFVPAYIRPLFCRGIGPFRWAALSGDPEDIYKTDAKVRELTPGNTHLHNWLDMARER
FT                   IAFQGLPARICWVGLGDRHRLALAFNEMVRNGELSAPIVIGRDHLDSGSVASPNRETEA
FT                   MKDGSDAVSDWPLLNALLNTASGATWVSLHHGGGVGMGFSQHSGVVICADGSDDAAKRL
FT                   ERVLWNDPATGVMRHADAGYDIALDCARDKGLRLPGILGN"
FT   gene            349534..350109
FT                   /locus_tag="Rleg2_5931"
FT   CDS_pept        349534..350109
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5931"
FT                   /product="protein of unknown function DUF886"
FT                   /note="PFAM: protein of unknown function DUF886; KEGG:
FT                   rec:RHECIAT_PA0000075 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5931"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59102"
FT                   /db_xref="InterPro:IPR010282"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:B6A3W9"
FT                   /protein_id="ACI59102.1"
FT                   /translation="MKTLRAGDHKRMPWKNGGGETVEIAVSPEDAGLAGFNWRVSMATV
FT                   ATDGPFSIFPGVDRTLAILNGNGMTLDIEGRAPALLTTASDPLAFPADIPVAARLQDGA
FT                   ITDLNVMTRRASLVHTLVRLEIDGGRTLPLTVPTCLLLCHHGALSFRQGDETGSLASGD
FT                   ALLMTDAVGIELKIDGEATCYLASIDAG"
FT   gene            350283..350912
FT                   /locus_tag="Rleg2_5932"
FT   CDS_pept        350283..350912
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5932"
FT                   /product="heat shock protein DnaJ domain protein"
FT                   /note="PFAM: heat shock protein DnaJ domain protein; KEGG:
FT                   rec:RHECIAT_PA0000074 putative molecular chaperone, DnaJ
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5932"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59103"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:B6A3X0"
FT                   /protein_id="ACI59103.1"
FT                   /translation="MTDPYDILGVERDADEAQLKAAYRKHAKVAHPDSGGDSQAFDNLQ
FT                   KAYALLLDPVRRKVYDDTGYDVELADAAELQALVMIEKLVTDAVLDERLPGSFDPVAVM
FT                   QESLSEELRKARFSKSELERHASRIGLHLERLEKQSGRDVLAHMFRARIEAIGKAVVET
FT                   EAKIKAAERAADMLAGYIYDVDPTPLPEASVTSIEWAEPSRNRSTG"
FT   gene            complement(350927..351628)
FT                   /locus_tag="Rleg2_5933"
FT   CDS_pept        complement(350927..351628)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5933"
FT                   /product="protein of unknown function DUF899 thioredoxin
FT                   family protein"
FT                   /note="PFAM: protein of unknown function DUF899 thioredoxin
FT                   family protein; KEGG: ret:RHE_PE00067 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5933"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59104"
FT                   /db_xref="InterPro:IPR010296"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B6A3X1"
FT                   /protein_id="ACI59104.1"
FT                   /translation="MDHQHLVPAAVLAAKNGVRFPNESEAYRSARDALLAEEIELRRHI
FT                   ERVAVQRRALPPGGEVTKDYRFEGVDGPISFSELFADKETLVVYSYMFGPERERPCPMC
FT                   TSLLSAWDGEVPDMQQRVALAVVARSPLERLLAFKKERGWHHLPLYSDTTDEYSRDYHA
FT                   IGKDGSDDAAFNVFTRRDGTIRHFWGGEMGGVTADPGEDPRGAPDLMPLWTVLDSTPEG
FT                   RAPDWYPKLSY"
FT   gene            complement(352102..352284)
FT                   /locus_tag="Rleg2_5934"
FT   CDS_pept        complement(352102..352284)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5934"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rec:RHECIAT_PA0000068 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5934"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59105"
FT                   /db_xref="UniProtKB/TrEMBL:B6A3X2"
FT                   /protein_id="ACI59105.1"
FT                   /translation="MSTNDENVKPEQRRPKDVSAVPEKPEPADAESLAPPTVQPAGAGD
FT                   KSERPVVNPVTGVAF"
FT   gene            352355..352993
FT                   /locus_tag="Rleg2_5935"
FT   CDS_pept        352355..352993
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5935"
FT                   /product="putative hydrolase protein"
FT                   /note="KEGG: ret:RHE_PE00063 putative hydrolase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5935"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59106"
FT                   /db_xref="GOA:B6A3X3"
FT                   /db_xref="InterPro:IPR026555"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B6A3X3"
FT                   /protein_id="ACI59106.1"
FT                   /translation="MLDRFLLQGPQDARFTILLAHGAGAPMDSASMTAAAEALAGSGFR
FT                   VARFEFAYMAARRSGDRKPPPRAETLNPEYEAAIAELGVSGPLIIGGKSMGGRVASMIA
FT                   DDLHGRGKIAGLICLGYPFHPPGQPTKLRTAHLKGLTTPALICQGTRDEFGTRDEVPGY
FT                   DLSERIEILWLEDGDHDLKPRKKISGFSAADHLATMAKTAKAWAERLVI"
FT   gene            complement(352990..353661)
FT                   /locus_tag="Rleg2_5936"
FT   CDS_pept        complement(352990..353661)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5936"
FT                   /product="RES domain protein"
FT                   /note="PFAM: RES domain protein; KEGG:
FT                   rec:RHECIAT_PA0000066 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5936"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59107"
FT                   /db_xref="InterPro:IPR014914"
FT                   /db_xref="UniProtKB/TrEMBL:B6A3X4"
FT                   /protein_id="ACI59107.1"
FT                   /translation="MSARFAEAPRPSYRLIPSQFPPIGLFDTVTRAADLEAVMDLVGWT
FT                   NDRLVADRIQRLPEDEWVYGTPNASIVMAAFLHIAPGGMRFNGPDLGAWYAADALKTAA
FT                   AEVGHHLRREAVARGVATMARTYRSYAATLIGDYLDIRGEQTLRPDVYDGASYAASQLL
FT                   GEEVRSSGGAGILYDSVRLRGGVNIAAHRPRNIRDVLQADHFEITVFAADRRIDVRKLA
FT                   A"
FT   gene            complement(353658..354182)
FT                   /locus_tag="Rleg2_5937"
FT   CDS_pept        complement(353658..354182)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5937"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rec:RHECIAT_PA0000065 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5937"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59108"
FT                   /db_xref="InterPro:IPR024467"
FT                   /db_xref="UniProtKB/TrEMBL:B6A3X5"
FT                   /protein_id="ACI59108.1"
FT                   /translation="MQHARRREQRESLEPQRLETGRFAPANRKRLSAPALRTFLAIADL
FT                   WGLNEEQRLLVLGYPSRSTYHSWAKQAREHGAFTLDVDTLTRISAVLGIHQALGVLFAD
FT                   ERAGVAWLRMQHQAPVFGGHPPLDIVTNGTQDGLMTVRRFLDGARGGVYMQPNRLDEAF
FT                   TPYEDADIVFR"
FT   gene            complement(354254..355171)
FT                   /locus_tag="Rleg2_5938"
FT   CDS_pept        complement(354254..355171)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5938"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="TIGRFAM: pca operon transcription factor PcaQ; PFAM:
FT                   regulatory protein LysR; LysR substrate-binding; KEGG:
FT                   rec:RHECIAT_PA0000064 transcriptional regulator protein,
FT                   LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5938"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59109"
FT                   /db_xref="GOA:B6A3X6"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR012787"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B6A3X6"
FT                   /protein_id="ACI59109.1"
FT                   /translation="MIDSRVKFRHLQTFVEVARQKSVMKAAELLHVSQPAVTKTIRELE
FT                   QALGVDVFERDGRGIKITRYGEVFLRHAGAALTALRQGLDSVSQEQFADAPPIRIGALP
FT                   TVSSRIMPRAMELFLKERTWSRVKIVTGENAVLLEQLRVGDLDIVVGRLAGAEKMAGFS
FT                   FEHLYSEQVVFAVRAGHPLLSGGQSPFSGFGDYTVLMPTRGSIIRPVVENFLIANGVSS
FT                   LPNQIETVSDSFGRAFLRSSDAIWIISNGVVADDVADGRLALLPVDTGETRGPVGLTMR
FT                   ADAVPSAPQSILMQTIREAAGELS"
FT   gene            355730..356557
FT                   /locus_tag="Rleg2_5939"
FT   CDS_pept        355730..356557
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5939"
FT                   /product="3-oxoadipate enol-lactonase"
FT                   /note="TIGRFAM: 3-oxoadipate enol-lactonase; PFAM:
FT                   alpha/beta hydrolase fold; Ndr family protein; KEGG:
FT                   rec:RHECIAT_PA0000063 beta-ketoadipate enol-lactone
FT                   hydrolase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5939"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59110"
FT                   /db_xref="GOA:B6A3X7"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR026968"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B6A3X7"
FT                   /protein_id="ACI59110.1"
FT                   /translation="MTEEIDVQFARINDVTIHYQVIGAPADRPVIVFVNSLGTDFRIWR
FT                   DVVVRLAGDYAIVLYDKRGHGLSDVGQLPSSIEDHATDLAGLLDLLSVKDAVILGLSVG
FT                   GLIAQSLYQRRPDLVGALILCDTAHKIGTAESWNARIAAVERNGIGSIVDAIMERWFTP
FT                   AFRRPESTAYSGYCNMLTRQPVEGYIAACEAIRDADFTEAAKRITVPTICIVGDQDGST
FT                   PPDLVLSTAKLIPGARYEVIPDCAHIPCVEQPEALTVIIRAFLTTLAPGETNR"
FT   gene            356554..356958
FT                   /locus_tag="Rleg2_5940"
FT   CDS_pept        356554..356958
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5940"
FT                   /product="4-carboxymuconolactone decarboxylase"
FT                   /EC_number="4.1.1.44"
FT                   /note="KEGG: ret:RHE_PE00058 gamma-carboxymuconolactone
FT                   decarboxylase protein; TIGRFAM: 4-carboxymuconolactone
FT                   decarboxylase; PFAM: Carboxymuconolactone decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5940"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59111"
FT                   /db_xref="GOA:B6A3X8"
FT                   /db_xref="InterPro:IPR003779"
FT                   /db_xref="InterPro:IPR012788"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="UniProtKB/TrEMBL:B6A3X8"
FT                   /protein_id="ACI59111.1"
FT                   /translation="MNETASSSERYRQGMATRRAVLGDAHVDRAAAAATEFDQPFQELI
FT                   TEAAWGHVWSRPALSKRERSIVTIALLAALGQDDEVAMHVRATANTGATREDVCEALLH
FT                   VAIYAGVPAANHAIKIAKQTFAQMDAEKAV"
FT   gene            356968..357717
FT                   /locus_tag="Rleg2_5941"
FT   CDS_pept        356968..357717
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5941"
FT                   /product="protocatechuate 3,4-dioxygenase, beta subunit"
FT                   /note="TIGRFAM: protocatechuate 3,4-dioxygenase, beta
FT                   subunit; PFAM: intradiol ring-cleavage dioxygenase; KEGG:
FT                   ret:RHE_PE00057 protocatechuate 3,4-dioxygenase beta chain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5941"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59112"
FT                   /db_xref="GOA:B6A3X9"
FT                   /db_xref="InterPro:IPR000627"
FT                   /db_xref="InterPro:IPR012785"
FT                   /db_xref="InterPro:IPR015889"
FT                   /db_xref="InterPro:IPR024756"
FT                   /db_xref="UniProtKB/TrEMBL:B6A3X9"
FT                   /protein_id="ACI59112.1"
FT                   /translation="MSELPNRKPETGAFFARDRAWHAPALTPGYKTSVLRAPQRALLSL
FT                   DGTISETTGPVFGHSMLGELDNDLILNYARPGESAIGERIIVHGRVLDERAKPVAGALV
FT                   EFWQANAGGRYRHKKESYLAAIDPNFGGCGRAVTDEEGRYHFRTVRPGAYPWPNGINDW
FT                   RPAHIHFSVFGHGFAQRLITQMYFEGDPMIWKCPIVGTIPDKAAIEQLIAPLDWGNTIP
FT                   MDSRAYKFDIVLRGRRSTMFENRLEGN"
FT   gene            357720..358331
FT                   /locus_tag="Rleg2_5942"
FT   CDS_pept        357720..358331
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5942"
FT                   /product="protocatechuate 3,4-dioxygenase, alpha subunit"
FT                   /EC_number="1.13.11.3"
FT                   /note="KEGG: ret:RHE_PE00056 protocatechuate
FT                   3,4-dioxygenase alpha chain protein; TIGRFAM:
FT                   protocatechuate 3,4-dioxygenase, alpha subunit; PFAM:
FT                   intradiol ring-cleavage dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5942"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59113"
FT                   /db_xref="GOA:B6A3Y0"
FT                   /db_xref="InterPro:IPR000627"
FT                   /db_xref="InterPro:IPR012786"
FT                   /db_xref="InterPro:IPR015889"
FT                   /db_xref="UniProtKB/TrEMBL:B6A3Y0"
FT                   /protein_id="ACI59113.1"
FT                   /translation="MQQLGYLKETPSQTAGPYVHIGLTPNFCDITGVYDSDLGTAMVNE
FT                   KTLGERVTVTGRILDGAGALVRDAVVEIWQADSAGLYNSPSEMRGAADPNFTGWGRCPT
FT                   RSEDGVYSFETIKPGRVPFKDGRRQAPHITFWIVARGINIGLHTRMYFPEETEANAADP
FT                   LLLRIEHRERVATLIATRDGATCHFDIHLQGAKETVFLDI"
FT   gene            358530..359576
FT                   /locus_tag="Rleg2_5943"
FT   CDS_pept        358530..359576
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5943"
FT                   /product="3-carboxy-cis,cis-muconate cycloisomerase"
FT                   /note="TIGRFAM: 3-carboxy-cis,cis-muconate cycloisomerase;
FT                   PFAM: fumarate lyase; KEGG: ret:RHE_PE00055
FT                   3-carboxy-cis,cis-muconate cycloisomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5943"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59114"
FT                   /db_xref="GOA:B6A3Y1"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR012789"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="UniProtKB/TrEMBL:B6A3Y1"
FT                   /protein_id="ACI59114.1"
FT                   /translation="MTASPFDHPFLSGLLGDDEIAPYFSAEADIRAMLSFEAALARAEA
FT                   AHGLIPAEAARRIAEICAGFSADLHRLRAATARDGVVVPELIKQLRTEVGEEAAKSLHL
FT                   GATSQDVIDTGLMIRLKAIVFLFAGRLSAIVAGLDGLDRQFGRNRLMGHTRMQAAIPIS
FT                   VSDRLAAWRAPLETYRDRLTEQSFPVQFGGAAGTLDKLGPQGPAIRAALAQELGLTDCR
FT                   QWQSERLPIADIASLFASISGSLGKIGQDIALLAQAGQEIEIAGGGTSSAMAHKQNPVA
FT                   AETLVSLARFNATALSGIHQSLVHEQERSGAAWTLEWLLLPQMTMATAASLRLAGELTG
FT                   NIKRLGTA"
FT   gene            complement(359658..359753)
FT                   /pseudo
FT                   /locus_tag="Rleg2_5944"
FT   gene            complement(359821..360651)
FT                   /locus_tag="Rleg2_5945"
FT   CDS_pept        complement(359821..360651)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5945"
FT                   /product="Shikimate dehydrogenase substrate binding domain
FT                   protein"
FT                   /note="PFAM: UBA/THIF-type NAD/FAD binding protein;
FT                   Shikimate/quinate 5-dehydrogenase; Shikimate dehydrogenase
FT                   substrate binding domain protein; KEGG: azc:AZC_1453
FT                   shikimate dehydrogenase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5945"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59115"
FT                   /db_xref="GOA:B6A3Y2"
FT                   /db_xref="InterPro:IPR000594"
FT                   /db_xref="InterPro:IPR013708"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B6A3Y2"
FT                   /protein_id="ACI59115.1"
FT                   /translation="MITGTTKLIAHLGYPTESFKAPLIYNPYFEKNGIDAVVVPMGCRR
FT                   EDYPAFLKLVFRLSNIHGALITMPHKIATMALLDEASTNAKVAGSCNAVRLDPNGRLIG
FT                   DMFDGEGFVRGVLRKGKKVEGANALVVGAGGVGSAIAASLAKAGVAQLAIVDANKTTSA
FT                   ALLDRLKTYYPHLHVTIGSLDPTGFDIVVNATPLGMRRGDPLPIDVDRISPSTFVGEVV
FT                   LSKEITPFLEAARARGCTFQVGTDMLFEQIPAYLEFFEFPTTTADNLRAIAKLG"
FT   gene            complement(360656..361723)
FT                   /locus_tag="Rleg2_5946"
FT   CDS_pept        complement(360656..361723)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5946"
FT                   /product="oxidoreductase domain protein"
FT                   /note="PFAM: oxidoreductase domain protein; Oxidoreductase
FT                   domain; KEGG: bja:bll6385 putative oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5946"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59116"
FT                   /db_xref="GOA:B6A3Y3"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR004104"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B6A3Y3"
FT                   /protein_id="ACI59116.1"
FT                   /translation="MKPLKIAVMGAGLIGRRHAERVMSEPGTLLSAVIDPSPVGRDFAG
FT                   NAGIQWYASFQDIGAEDRPDGVIVATPNQLHVENAMEVIAAGIPVLIEKPIADDVDAAA
FT                   ALVAAGEKAGIPLLVGHHRRHNPMIQAAKQIVDGGRLGRIVTVHGTFWVAKPDDYFDIP
FT                   WRREAGAGPIFVNLIHDVDLFRFLFGEVEAVHAMESHAVRHHAVEDTAVVSLRFANGVL
FT                   ATLTGSDAVAAPWSWEATTGENPAFPRYAGHCYQIGGTKGSLGIPDLTLWTATAKPDWL
FT                   EPLAEERVAYEAADPLCRQLNHFCDVIRGEAVPLVSGREGLATLRVVEAIKRSARSGQM
FT                   IHLSDAGASADPEKV"
FT   gene            complement(361766..362530)
FT                   /locus_tag="Rleg2_5947"
FT   CDS_pept        complement(361766..362530)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5947"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: azc:AZC_1452 ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5947"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59117"
FT                   /db_xref="GOA:B6A3Y4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030679"
FT                   /db_xref="UniProtKB/TrEMBL:B6A3Y4"
FT                   /protein_id="ACI59117.1"
FT                   /translation="MTSPMPAQTAETMISMAQVEKWYGSFQALHDINMTVRSGERIVLC
FT                   GPSGSGKSTLIRCINHLETYQKGEIRVGGIVLSDQAKTIDAIRREVGMVFQQFNLFPHL
FT                   TVLQNCMLAPMKAIGVGRAEAEERARGLLERVKILEQADKYPVQLSGGQQQRVAIARAL
FT                   CMRPKVMLFDEPTSALDPEMVKEVLDTMIALADEGMTMICVTHEMGFARQVADRVIFMA
FT                   SGAIVEEAPPAEFFTNPQHERTRKFLGEILRK"
FT   gene            complement(362586..363227)
FT                   /locus_tag="Rleg2_5948"
FT   CDS_pept        complement(362586..363227)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5948"
FT                   /product="polar amino acid ABC transporter, inner membrane
FT                   subunit"
FT                   /note="TIGRFAM: polar amino acid ABC transporter, inner
FT                   membrane subunit; PFAM: binding-protein-dependent transport
FT                   systems inner membrane component; KEGG: azc:AZC_1450 ABC
FT                   transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5948"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59118"
FT                   /db_xref="GOA:B6A3Y5"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B6A3Y5"
FT                   /protein_id="ACI59118.1"
FT                   /translation="MGHDEFVFLLIGLKWTVVLSAVGFVCGCIAGLGVALARVSGNPLL
FT                   ERLTAGYIAVFQGTPLLMQLFVVYYGLALIGLMLDAWVAVAIGLTLHASAYLGEIWRGS
FT                   IEAVPRGQTEAAKALSLRYVSRMRDVILPQALRISLPATIGFLVQLIKGTSLASIVGFT
FT                   ELTRAGNIISNQIFQPLTVFGVVGILYFLMCCPLTILGARLERKFAASAR"
FT   gene            complement(363238..363906)
FT                   /locus_tag="Rleg2_5949"
FT   CDS_pept        complement(363238..363906)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5949"
FT                   /product="polar amino acid ABC transporter, inner membrane
FT                   subunit"
FT                   /note="TIGRFAM: polar amino acid ABC transporter, inner
FT                   membrane subunit; PFAM: binding-protein-dependent transport
FT                   systems inner membrane component; KEGG: azc:AZC_1449 ABC
FT                   transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5949"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59119"
FT                   /db_xref="GOA:B6A3Y6"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B6A3Y6"
FT                   /protein_id="ACI59119.1"
FT                   /translation="MNYKLDFTPVIDGLPSLLLGCLGTFLLAICGMLLAIVIGIGGVAL
FT                   RDSALKPLRWLVIAFVELIRNTPFLVQIFFIYFALPLTGIRLDPTPTAIIALGINGGAY
FT                   AIEIIRGGVQSIPKGQMEAGLALGLHKAQVFRLIILKPALRAIYPSLTSQFVLLTLTTS
FT                   IASAISAYELTSVSQRIESESFRSFEVYFTVTLFYFVISWVMMRLFAAFSARYFKYPVK
FT                   "
FT   gene            complement(363903..364352)
FT                   /locus_tag="Rleg2_5950"
FT   CDS_pept        complement(363903..364352)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5950"
FT                   /product="3-dehydroquinate dehydratase"
FT                   /EC_number="4.2.1.10"
FT                   /note="PFAM: dehydroquinase class II; KEGG: azc:AZC_1447
FT                   dehydroquinase"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5950"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59120"
FT                   /db_xref="GOA:B6A3Y7"
FT                   /db_xref="InterPro:IPR001874"
FT                   /db_xref="InterPro:IPR018509"
FT                   /db_xref="InterPro:IPR036441"
FT                   /db_xref="UniProtKB/TrEMBL:B6A3Y7"
FT                   /protein_id="ACI59120.1"
FT                   /translation="MTRTIFVLNGPNLNLLGEREPAIYGSTTLSDIRDRCLAKAESLGF
FT                   AIDFRQTNFEGELVESVHQARKQACGIIINPAGYTFTSIALLDALKMFDPPKIELHISN
FT                   VHARESIYHNSLISRVATAIMIGFGARGYELAVEAMADMAGAAKA"
FT   gene            complement(364626..365456)
FT                   /locus_tag="Rleg2_5951"
FT   CDS_pept        complement(364626..365456)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5951"
FT                   /product="extracellular solute-binding protein family 3"
FT                   /note="PFAM: extracellular solute-binding protein family 3;
FT                   KEGG: azc:AZC_1451 ABC transporter substrate binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5951"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59121"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="UniProtKB/TrEMBL:B6A3Y8"
FT                   /protein_id="ACI59121.1"
FT                   /translation="MFKSMLTRRNAMLGAAALVAAVTLAQPAAAITPDEIKARGKIIVG
FT                   IQGDNPPWGFVTSGGKQDGLDADIATLFAKELGVSVEFVPLEVNNRIPALTAGRVDVLF
FT                   ATMAMLPDRAKAVQFSKPYVANAIVLIGPKSAEIKTNADMAKFTVGVAKGAAQDTQVTK
FT                   NAPEGTTIRRYDGDAASVQALVSGQVDTLGGNIFYMDRVNKARPGEFENKLEFQKLYNG
FT                   ACTRLGEKEINAALNTFIDKIKTNGDLKAVYDKWMKVPVPEFPEKLEGIPFAAN"
FT   sig_peptide     complement(365364..365456)
FT                   /locus_tag="Rleg2_5951"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.653 at
FT                   residue 31"
FT   gene            365679..367574
FT                   /locus_tag="Rleg2_5952"
FT   CDS_pept        365679..367574
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5952"
FT                   /product="4-hydroxyphenylpyruvate dioxygenase"
FT                   /EC_number="1.13.11.27"
FT                   /note="PFAM: Xylose isomerase domain protein TIM barrel;
FT                   KEGG: oan:Oant_4428 4-hydroxyphenylpyruvate dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5952"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59122"
FT                   /db_xref="GOA:B6A3Y9"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:B6A3Y9"
FT                   /protein_id="ACI59122.1"
FT                   /translation="MKTSIATVTISGELPEKLEAIARAGFDGVEIFENDFLAFDGSPAD
FT                   VGKLVRDHGLEITLFQPFRDFEGMPEPLRSRTFDRAERKFDVMQQLGTDLVLVCSNISP
FT                   AAIGGIDRAAEDFRELGERAARRGLRVGYEALAWGRHISDHRDAWEIVRRADHPNVGLI
FT                   LDSFHTLSRKIDVNSIRSIPKEKIFIVQLADAPLIDMDLLYWSRHFRNMPGEGELPVTA
FT                   FTEAVAATGYDGYFSLEIFNDQFRGGLSRPIAADGHRSLIYLGDQVRRHLGTGSMTGAA
FT                   MPERAAVQGVGFVEFATDEQDEVELVALLRTLGFRQTAVHRTKKVSLFEQGEIRILVNV
FT                   DQAGFANAAYAVHGTFAYAMALVVDDAAKAYARALALDAEPFAQPVAEGELELPAIRGV
FT                   GGGIVYLIDDKSALGRFSEIDFRPVTDDTDTASAGLIRVDHVAQTVGYDEMLTWLLFYT
FT                   SIFETHKTPMVDIIDPAGVVRSQVVENQSGALRITMNGAENRRTLAGHFIAEKFGSGIQ
FT                   HLAFSTDDIFATAEKLRSCGFRSLHISPNYYDDVEARFGLDPVMTERLKAENILYDRDE
FT                   HGEYFQLYSGTYGEGFFFEIVERRGYRGYGAPNAIFRIAALKRQMRPEGIPKDVD"
FT   gene            complement(367606..368280)
FT                   /locus_tag="Rleg2_5953"
FT   CDS_pept        complement(367606..368280)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5953"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="PFAM: regulatory protein GntR HTH; GntR domain
FT                   protein; KEGG: smd:Smed_5700 transcriptional regulator,
FT                   GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5953"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59123"
FT                   /db_xref="GOA:B6A3Z0"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B6A3Z0"
FT                   /protein_id="ACI59123.1"
FT                   /translation="MLKQIHDPAETVSDVVFRQIREDIISGVLPPGAKIKLEQAKERYS
FT                   IGISSLREILSRLTTENLVLAEGQRGFEVSPASRRELLELADLRIVLETHAIGLAFAAG
FT                   NLEWEGRIVAAHHRLAAAERKLLAGDTSRTVDWVRYDWEFHQAIVSACNSETLMATLSS
FT                   VFDRFLRYHMLAESFRGKPVVDDHRLLFELSIQRDVAGATEVVKRHVHSGVEHVLKSGR
FT                   IL"
FT   gene            complement(368319..368987)
FT                   /locus_tag="Rleg2_5954"
FT   CDS_pept        complement(368319..368987)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5954"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="PFAM: regulatory protein GntR HTH; GntR domain
FT                   protein; KEGG: jan:Jann_4140 transcriptional regulator,
FT                   GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5954"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59124"
FT                   /db_xref="GOA:B6A3Z1"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B6A3Z1"
FT                   /protein_id="ACI59124.1"
FT                   /translation="MLQPVVNETIAESSYRRIRADIIFGRLAPAQKLKLENLKESYETS
FT                   ISTLREVLNRLSSEGLVVAEGQKGFEVSPVSVSDLKETAAMRLLLESHALEQSLARGDV
FT                   EWEAPLVAAHYKLARMEQVMSSGDTSRAEDWKRYDWEFHQALISACGSKLLMQTHSVIF
FT                   DKYLRYQMVALSYRGDVAADEHQQLLDAALRRDAETAKRVLAFHIQGGVEHALARGTLK
FT                   "
FT   gene            369490..370320
FT                   /locus_tag="Rleg2_5955"
FT   CDS_pept        369490..370320
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5955"
FT                   /product="beta-lactamase domain protein"
FT                   /note="PFAM: beta-lactamase domain protein; KEGG:
FT                   rec:RHECIAT_PA0000058 putative hydrolase protein,
FT                   beta-lactamase superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5955"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59125"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:B6A3Z2"
FT                   /protein_id="ACI59125.1"
FT                   /translation="MTTELFQVKFWGVRGSIPVSGPEFDRYGGNTSCIEIRCGEHRMIF
FT                   DAGSGLREAGLSLLADGVSDVDLFFSHCHYDHIIGLPFFKAIYYPSINVNIWSGHLDGK
FT                   MSTREMVEQFISPPWFPVKTDICQATMNFRDFHPGQALTPHEGIEIKTFMLNHPGGAIG
FT                   YRIEWQGRSVALIYDIEHIPGSYDPVSLEMMRDADLVVYDCTYNEDEMQRFKGFGHSTW
FT                   QHGTELAKIAGAKRFALFHHAPSRTDEQLAQMEAQAQAAFPESFAARDNQTVVI"
FT   gene            370437..370811
FT                   /locus_tag="Rleg2_5956"
FT   CDS_pept        370437..370811
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5956"
FT                   /product="glutathione-dependent formaldehyde-activating
FT                   GFA"
FT                   /note="PFAM: glutathione-dependent formaldehyde-activating
FT                   GFA; KEGG: ret:RHE_PE00053 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5956"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59126"
FT                   /db_xref="GOA:B6A3Z3"
FT                   /db_xref="InterPro:IPR006913"
FT                   /db_xref="InterPro:IPR011057"
FT                   /db_xref="UniProtKB/TrEMBL:B6A3Z3"
FT                   /protein_id="ACI59126.1"
FT                   /translation="MTVFSGQCLCGQVQIAVRGEPIRVGICHCMDCRKESGSAFTFYGI
FT                   WPAGRFEHSGQTGAFQGRHFCTGCGSRLFSVDDEEAEIKLGMLSEAPTPLVPRYELWIK
FT                   RREPWLRPVEGAEQFAEDRK"
FT   gene            370808..371698
FT                   /locus_tag="Rleg2_5957"
FT   CDS_pept        370808..371698
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5957"
FT                   /product="alpha/beta hydrolase fold"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG:
FT                   ret:RHE_PE00052 putative hydrolase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5957"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59127"
FT                   /db_xref="GOA:B6A3Z4"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR000639"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B6A3Z4"
FT                   /protein_id="ACI59127.1"
FT                   /translation="MSGDVESVAALVRHRRITVAGVETFYREAGRHDAPVLLLPHGYPC
FT                   SSYEFRNLMPRLADRWRLIAPDFPGAGYSGTPDDFDYSFDGYAAWLEAFIGAVDVDRFA
FT                   LYLHDFGSPIGARLAIKDPKRIVALIIQNGDIPYEDALGPKYADIEATWTLPRADMRKV
FT                   LAEAISEETFKEEFLNNLPPLLAATIPPDLWKLHWSLVTPRRKQIAIDLIAGLKENRAW
FT                   FPQHRKYLREYQPPTLIVWGPNDHYMPEKSARAYLRDLPDAELYLLGGGHWLLETHLDE
FT                   VAALMRDFLGRVHAA"
FT   gene            complement(371710..372462)
FT                   /locus_tag="Rleg2_5958"
FT   CDS_pept        complement(371710..372462)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5958"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rec:RHECIAT_PA0000055 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5958"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59128"
FT                   /db_xref="GOA:B6A3Z5"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:B6A3Z5"
FT                   /protein_id="ACI59128.1"
FT                   /translation="MIDRMSWEPLRRELDRWQAAGRVARFWLRDDDAIEPTPDLETMLA
FT                   STGDNAIPLTLAVIPGLTGEALAARLAEEAGVSVAVHGWSHTNHAGPERKKQELGGDRP
FT                   ADIVLGELSDGFRLLQRLHPARFLPVLVPPWNRIDAALIPALPDLGFAALSVYGRARQS
FT                   GAMPLLNTHVDIIDWHGTRGGRAEEELVAELLAELEDRFAGSDEPIGVLTHHLVHDAAA
FT                   WDFLSALFATTGRHPAVDWSAAAKLLKR"
FT   gene            complement(372459..373553)
FT                   /locus_tag="Rleg2_5959"
FT   CDS_pept        complement(372459..373553)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5959"
FT                   /product="glycosyl transferase group 1"
FT                   /note="PFAM: glycosyl transferase group 1; KEGG:
FT                   rec:RHECIAT_PA0000054 putative glycosyltransferase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5959"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59129"
FT                   /db_xref="GOA:B6A3Z6"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="UniProtKB/TrEMBL:B6A3Z6"
FT                   /protein_id="ACI59129.1"
FT                   /translation="MRVAFYAPMKSPNHPVPSGDRLMARLLIRALEMAGHEVEIVSEFR
FT                   THAATPEAAADLEPAIGAERQRLRQKWASTLRPELWFCYHPYYKSPDPFGPVISAEFAI
FT                   PYVTAEASYAAKRDSTGWAGVQKRVGEAILQAAVNISFTERDQAGLSAVFPQARLAGLE
FT                   PFIDTALFERVSPAPDPLRLMTVAMMRAGDKTASYAMLAKALRLIEDRPWTLAVIGEGP
FT                   MRHEVQALFAGFPAGRIEWLGERDAAEIAGLLGRGGLYVWPGCGEAYGLAYLEAQAAGL
FT                   PVVAQETAGVPAVVEAGVTGLLTPDGDVAAYAAAVAALLDDRERRDAMGQAARRFVLDE
FT                   RSLATAAERLDEILRDYAATGVMG"
FT   gene            373734..375452
FT                   /locus_tag="Rleg2_5960"
FT   CDS_pept        373734..375452
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5960"
FT                   /product="adenylate/guanylate cyclase"
FT                   /note="PFAM: ferredoxin; adenylyl cyclase
FT                   class-3/4/guanylyl cyclase; KEGG: ret:RHE_PE00049 adenylate
FT                   cyclase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5960"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59130"
FT                   /db_xref="GOA:B6A3Z7"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR001054"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR034804"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:B6A3Z7"
FT                   /protein_id="ACI59130.1"
FT                   /translation="MTTVSATGIFSERTIRRARLGSGLVIFIFVLLHLSNHAIGLISVS
FT                   AADKAARLFMAIWRNPVGTTIFYSSVLIHIALVLRAIYMRRSLVMPKGEMAQIVLGLLI
FT                   PLLLIDHVIGTRIAHELYGYIDDYETVVGSLWIRAPANGLRQAFGLLAVWIHGCIGLHF
FT                   WLRYRPWYPGLAPLLLALAILVPVLSLLGFVEMGRTLADPSYQQAIANSPYKATVNTRY
FT                   ASNPEVLRQVSTIRAGLYGAFSAALLIVVAARARRRLKEALDQVAVHYPGGEVIRVPRG
FT                   FSVLEASRLGGLPHYSVCGGKGQCSTCRVQILGDYENLPVPDKMEQTTLRRINAGPDVR
FT                   LACQLRPNRDVAVAPLLVPALEAALPANSQETSPGREREIAVLFVDIRHFTTLTETRLP
FT                   FDVVFLLNRYFAIIGKAVEQAGGRLDKFIGDGAMALFGLNTAPEEACRQALKAAAAIVA
FT                   EIEKLAAELAEELALPLRIAIGIHTGPAVVGTMGYGRVRSMTAIGDTVNVASRLESAAK
FT                   EFEAAIVISEPVASLSGADLSGIESREISVRGRALPLKVYVIPREKAAEPLEGKD"
FT   gene            375452..376330
FT                   /locus_tag="Rleg2_5961"
FT   CDS_pept        375452..376330
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5961"
FT                   /product="methyltransferase FkbM family"
FT                   /note="TIGRFAM: methyltransferase FkbM family; KEGG:
FT                   rec:RHECIAT_PA0000052 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5961"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59131"
FT                   /db_xref="GOA:B6A3Z8"
FT                   /db_xref="InterPro:IPR006342"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B6A3Z8"
FT                   /protein_id="ACI59131.1"
FT                   /translation="MPGKPWLTAKYWSRRLRKARNAVASRFFDTRFGRRLLVENIGPRV
FT                   VSMTVDAGDHLMTFSPADYIGRKVFRKGHFERDAVDRLIAILRERGLLRKDATLLEIGG
FT                   NIGTQTVYFALSGTYAHIVSIEPDPRNFPLLELNIRQNRLAEKVRLVNCAAGESQGEID
FT                   FFLNRNNHGKSSALRQSPTDRKISVPVKPVSEILADLSIDPGAIGLVWMDIEGYEPIAC
FT                   RSMQPLLARRVPLHMEFTPLFYGAEGTRAFISMLAGYYEDCLVLFEDREEEMKVRDLPG
FT                   EFDQYNVLFLP"
FT   gene            complement(376367..377338)
FT                   /locus_tag="Rleg2_5962"
FT   CDS_pept        complement(376367..377338)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5962"
FT                   /product="Alcohol dehydrogenase zinc-binding domain
FT                   protein"
FT                   /note="PFAM: Alcohol dehydrogenase zinc-binding domain
FT                   protein; Alcohol dehydrogenase GroES domain protein; KEGG:
FT                   ret:RHE_CH01124 probable quinone oxidoreductase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5962"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59132"
FT                   /db_xref="GOA:B6A3Z9"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B6A3Z9"
FT                   /protein_id="ACI59132.1"
FT                   /translation="MTDQIVMLNGPGDVTRFQVQDHRSAAPGRGEIRIRHEAIGTNFLD
FT                   IYHRKGIYPMPSYPAVVGAEAAGVVAAVGPDVTDLKEGDRVAYAGPPVGAYCSTRIIAA
FT                   ERVIRLPDAVSAKTAASSLLKGMTAYMLLKKTCDVRDGSRILIHAAAGGLGSILVRWAK
FT                   SLNATVIGTVSTPEKAVLAKSFGADHLIVGREADIVAEVQRLTNGNGVDVAIDGIGGDM
FT                   LVKSLRSVRAFGMAVTIGQAAGPVPPVPVEELRPGKSLSHPSIMAWCADVARYREAAQA
FT                   AVQAMEAGIVCQIAAEFSLADVARAHIEMESGRAAGSILLIP"
FT   gene            377408..378301
FT                   /locus_tag="Rleg2_5963"
FT   CDS_pept        377408..378301
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5963"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: ret:RHE_CH01125 probable
FT                   transcriptional regulator protein, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5963"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59133"
FT                   /db_xref="GOA:B6A400"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B6A400"
FT                   /protein_id="ACI59133.1"
FT                   /translation="MNGNKFTQLDWDDLRHFLALAQAGTFLGAAKQLGVEHATISRRVS
FT                   SLEATLERKLIDRRGRRIILTPEGEKVARHAAVIALQTAAVEQIGRSSATEVRGHVRIS
FT                   APPALSSVLLAKPIVAIRRDHPGVQITLVGEKRFTSLNRREADIAVRLSRPEDGDYSIT
FT                   KLHELTFNLFASKRYLETVAPSEWAFIGYDEAMNASPQQLRLKEVAAGRPIALRSSVLE
FT                   FQVAAARLDGGVVMLPDFAVPGDLQRIEGEHALVRELWLVVHSEIKDLPSIRVVLDALK
FT                   SAFKAKPRAGRPHLSE"
FT   gene            complement(378515..379408)
FT                   /locus_tag="Rleg2_5964"
FT   CDS_pept        complement(378515..379408)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5964"
FT                   /product="FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase"
FT                   /note="PFAM: HI0933 family protein; FAD-dependent pyridine
FT                   nucleotide-disulphide oxidoreductase; KEGG:
FT                   bur:Bcep18194_B2548 FAD dependent oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5964"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59134"
FT                   /db_xref="GOA:B6A401"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B6A401"
FT                   /protein_id="ACI59134.1"
FT                   /translation="MSFEAIVIGGNFAGLSAAMQLTRARRRVLLVDAGAPRNRFSQASH
FT                   GFLGQDGQTPAAIMREGKRQLSLYPNITIRTGKVVQAQCDGDEFVINVEGGGEEKAARL
FT                   VLATGVSDTLPEISGLRERWGRSALHCPYCHGYEVSGGKLGVLANHPHSAHSAMLIPDW
FT                   GATTFFTQAQFEPDEEQLVRLSARGVRIERSPIVELLGDNPGLDAVRLADGRVLPLDAV
FT                   FVAPKTAMASPLAEQLGCVFDDGPFGPVIRNGDNKETTVRGVFAAGDAASAMHNATLAS
FT                   ASGVLAGVHCHQSLVM"
FT   gene            379542..379997
FT                   /locus_tag="Rleg2_5965"
FT   CDS_pept        379542..379997
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5965"
FT                   /product="transcriptional regulator, BadM/Rrf2 family"
FT                   /note="PFAM: protein of unknown function UPF0074;
FT                   Helix-turn-helix type 11 domain protein; KEGG:
FT                   atc:AGR_C_402 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5965"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59135"
FT                   /db_xref="InterPro:IPR000944"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B6A402"
FT                   /protein_id="ACI59135.1"
FT                   /translation="MRNDSRLSRMLHVLIHMDRHQHSATSEMIAKMLNTNPVVVRRTMA
FT                   GLRERGYVRSEKGHGGGWTLVRPLWEITLLDVYNALGEPHLFAIGPADDQPKCLVEQAV
FT                   NSVLQDAMKEAEALLLRRLGGVTLEEIAADFEAKLTARWATSYPCAS"
FT   gene            complement(380015..380494)
FT                   /locus_tag="Rleg2_5966"
FT   CDS_pept        complement(380015..380494)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5966"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rec:RHECIAT_PA0000050 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5966"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59136"
FT                   /db_xref="InterPro:IPR025690"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B6A403"
FT                   /protein_id="ACI59136.1"
FT                   /translation="MSRLDSFIRRLTAQRDILNAIIDLVGEIEGPVLEFGLGNGRTYDH
FT                   LRENFPGRRIVAFDWEVRSYSASTPAAEDMVTGNIRESGQAFLGIGAALAHADIGTGHD
FT                   EIDAVTLTWLPQLMAGVLAPNGIAVSGLPLEHAELVALPLPEGIKEGRYFLYRRG"
FT   gene            380619..381794
FT                   /locus_tag="Rleg2_5967"
FT   CDS_pept        380619..381794
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5967"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rec:RHECIAT_PA0000049 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5967"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59137"
FT                   /db_xref="InterPro:IPR021445"
FT                   /db_xref="UniProtKB/TrEMBL:B6A404"
FT                   /protein_id="ACI59137.1"
FT                   /translation="MKTVTDEEFFAAVPLFSAFEGVTDAANYRPLPDGWVLALADIVGS
FT                   TQAIAGGRYKDVNMAGASVISAVLNAVGKGDYPFVFGGDGALIALPGSLEQAARDALSA
FT                   VQIWVEEDLGLMLRVAIVPVTETRAEGLDVRVARYSASPHVTYAMFWGGGTSWAERQMK
FT                   LGHYAVGRAAAGTRPDLTGLSCRWSPIDAQNGEIVSIIAVPGEGRPGEEFRDLVNGIVA
FT                   ITSEQNRGSHPVPADGPELAFSLHGINREAKATAPAGRRLRQKLIIFLQLAITVVCYRL
FT                   SIPLGRFDARRYKRDVAGNSDFRKFDDGLKMTVDVDAEHLRRIETLLEAARAKGIARYG
FT                   LHRQASALMTCFVPTPISRDHMHFIDGASGGYAVAASRMTGKALSNVAVTP"
FT   gene            complement(381784..383121)
FT                   /locus_tag="Rleg2_5968"
FT   CDS_pept        complement(381784..383121)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5968"
FT                   /product="nucleotide sugar dehydrogenase"
FT                   /EC_number="1.1.1.22"
FT                   /note="KEGG: rec:RHECIAT_PA0000046 probable UDP-glucose
FT                   6-dehydrogenase protein; TIGRFAM: nucleotide sugar
FT                   dehydrogenase; PFAM: UDP-glucose/GDP-mannose dehydrogenase;
FT                   6-phosphogluconate dehydrogenase NAD-binding;
FT                   3-hydroxyacyl-CoA dehydrogenase NAD-binding;
FT                   UDP-glucose/GDP-mannose dehydrogenase dimerisation;
FT                   UDP-glucose/GDP-mannose dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5968"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59138"
FT                   /db_xref="GOA:B6A405"
FT                   /db_xref="InterPro:IPR001732"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR014026"
FT                   /db_xref="InterPro:IPR014027"
FT                   /db_xref="InterPro:IPR017476"
FT                   /db_xref="InterPro:IPR028359"
FT                   /db_xref="InterPro:IPR036220"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B6A405"
FT                   /protein_id="ACI59138.1"
FT                   /translation="MAISTFDTLLQKIDTRNARAGVIGLGYVGLPLAMAVARSGFAVTG
FT                   FDIDPSKMVALDARRSYIDAVSNEALSAEIEAGRFQATTDFAGLAECDVIIICVPTPLT
FT                   KHRDPDLSFVEATSRSIAQHLRPGQLVVLESTTYPGTTDDIVKVILEGTGLKSGSDFFV
FT                   GFSPEREDPGNQNYHTATIPKVVAGDGTEALALMKAFYGAAVSTVVPVSSNATAEAVKL
FT                   TENIFRSVNIALVNELKTVYAAMGIDVWEVIDAAKTKPFGYMPFYPGPGLGGHCIPIDP
FT                   FYLTWKSREYELPTRFIELAGEINSAMPRYVVGKLAEALDIRAGKALSRSKVLVIGLAY
FT                   KKNVADIRESPSLRLIEIIEERGGRADYHDPFVAEIPPTREYQALKGRKSVALTPDAVA
FT                   DYDAVLVATDHDNVDYAALAKSAALIIDTRNVFNRLGLSADHVIKA"
FT   gene            383699..385042
FT                   /locus_tag="Rleg2_5969"
FT   CDS_pept        383699..385042
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5969"
FT                   /product="putative adenylate/guanylate cyclase"
FT                   /note="KEGG: rec:RHECIAT_PA0000045 adenylate cyclase
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5969"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59139"
FT                   /db_xref="GOA:B6A406"
FT                   /db_xref="InterPro:IPR001054"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:B6A406"
FT                   /protein_id="ACI59139.1"
FT                   /translation="MSTIESSVSSILLDRVAEWLTNSSLAGDELENIVRGFCERIAAAG
FT                   LPIARVHLTFSMLHPLYDALSFTWRRASGVTIEGFRMPAGQKPDRFLQSPYYYLLDNNL
FT                   QHIRRRLMQEGPAEFPIFEDLRKDAITDYLAFVQPFGDGSVQGMMGSWSTDHHNGFSDD
FT                   MIDALLRMQNHLAVAAKMAVLGKLANNMLTTYLGGDAGKRVLNGQIRRGDGETIRAALV
FT                   MGDMRESTMYAEKEGRQAYIDTLNQFFDAIAAPFNRNGGEILSFLGDGFLAVYPCGRHK
FT                   DPSKIACEAALSAVHQAQARVAELNKDREAKGLSKVGYGIGLHVGNVMFGNVGLKDRLT
FT                   FSAFGSAVNEVQRLQILTKKYGREVVASQAFAGYCGGEWTTLGEEKLRGIRQKVTVLQP
FT                   RAPAPEINVEEGFREAVQNGLSEAEQVILLHRDAKKHVERTTMEKFIQ"
FT   gene            385197..387092
FT                   /locus_tag="Rleg2_5970"
FT   CDS_pept        385197..387092
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5970"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related;
FT                   Oligopeptide/dipeptide ABC transporter domain protein;
FT                   SMART: AAA ATPase; KEGG: ret:RHE_PE00042 probable
FT                   oligopeptide ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5970"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59140"
FT                   /db_xref="GOA:B6A407"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B6A407"
FT                   /protein_id="ACI59140.1"
FT                   /translation="MASAADLLRIENLDVSFSVFGDRLRVVKEANLRILPGKVTALVGE
FT                   SGSGKSVISQSVMGILPNPARASGSILFTDPLDGSTTDILSFSRDSEEMRDLRGRRMAT
FT                   IFQEPMTSLSPLHTVGNQISEVLLIHTEIDKQEAREKTEEMLGLVGFTNPHRTYDMYPF
FT                   ELSGGMRQRAMIAMALICKPALLIADEPTTALDVTIQAQILELLRELQAKLGMAMLLIT
FT                   HDLGIVANMADEVVVIYHGEIMEAGPVEAIFRNPQHPYLKALMAAVPHFDMKPGERLKA
FT                   LRDVPVNLETLVGKKKPLQAEAPGTLLSVANLSKTYKTRKRSFLGKHEAAVVHAVDDVS
FT                   FDIRRGECLGLVGESGCGKTTLSKILMRAITPDSGAVVFNDGKDVIDVLSVRGEALQDM
FT                   RTKIQMVFQDPVSSLSPRMTVRNILSEPLEIHDRGDSDERKRKVEGLMAAIGLDKRYLS
FT                   RYPHSFSGGQRQRIGIARALALGPKLIILDEPVSALDVSVQAQILNLLKDLQKELGLTY
FT                   LFISHNLAVVDYVADRIAVMCKGRIVEIAPREIILRDPVHPYTKSLLAAVPFPDLDRPL
FT                   DFKALRENGAADKQNWGVTFTAEHDDAAELAYADLGDGHLVRARKGADAKELRGW"
FT   gene            387086..388993
FT                   /locus_tag="Rleg2_5971"
FT   CDS_pept        387086..388993
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5971"
FT                   /product="extracellular solute-binding protein family 5"
FT                   /note="PFAM: extracellular solute-binding protein family 5;
FT                   KEGG: rec:RHECIAT_PA0000043 probable oligopeptide ABC
FT                   transporter, substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5971"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59141"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:B6A408"
FT                   /protein_id="ACI59141.1"
FT                   /translation="MVTRRTFLGGLVGAAIAPAVLRAEPAGEPEFLKERLASGSLPPMA
FT                   ERIPARPRIVNLKEMGLAPGSYGGTVRTIIGSQRDIRFMTIYGYARLIGYNKHLQFQPD
FT                   ILADFQSEDDTIFTFTLREGHKWSDGEPFTADDFRYWWEDVILNDKLTPGGGALELRPH
FT                   GSLPRFEVLNPLTVRYTWEKPNPMFLPTLAGPIPLVIVGPAHYLKQFHKKFQPDQAKME
FT                   QMMQTNRVKKWQDLHIKMARSYRPENPNLPTLDPWRNTTALPAEQFVFERNPFFHRVDE
FT                   TGRQLPYLDRFILNVSSSSIIAAKAGAGEADLQATGIDFNDYTFLKEAEKRFPVKVNLW
FT                   KVARGSRITLLPNLNCADEVWRGLFRDVRLRRALSLAIDRHEINMVAFYGLGTPSADTV
FT                   LPDSPLFKQEYADAFVKFDADEANRLLDEIGLTKRGDDGIRLLPDGRRAEITVETAGES
FT                   NLDTDVLELVHDHWANIGLALYTRTSQRDVFRNRAMSGSIMMSIWYGLDNGVPTADMSP
FT                   SGLAPTLDDQLQWPLWGMHYLSAGQEGAAPDLPEAAELVDLLGQWGSTAKFEERQVIWH
FT                   KMLSLYTQQVFSIGLINSTLQPVLCAAKLQNLPEKALYGFDPTSYLGIYMPDAFWYKEA
FT                   "
FT   sig_peptide     387086..387157
FT                   /locus_tag="Rleg2_5971"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.994 at
FT                   residue 24"
FT   gene            388997..389995
FT                   /locus_tag="Rleg2_5972"
FT   CDS_pept        388997..389995
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5972"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: ret:RHE_PE00040 probable
FT                   oligopeptide ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5972"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59142"
FT                   /db_xref="GOA:B6A409"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B6A409"
FT                   /protein_id="ACI59142.1"
FT                   /translation="MLRYILWRIAAMVPTLFVISALVFTIIELPPGDFFESQIAELRAS
FT                   GETANLQEIEEMRQQYGFDKPEIVRYFYWVGGMLHGDFGYSFEYQMPVSDVVGERLWLT
FT                   ILVSFTTILLTWLIAFPIGIYSATHQYSWSDYGLTFLGLLGIAVPNFMLALILMYFANI
FT                   WFGISIGHLMDQQYISAPMSWEKARSILSHLWIPVIIVGTAGTAGMIRRLRANLLDEMQ
FT                   KQYVTTARAKGLHPVRALLKYPLRMALNFFVADIGSILPSIISGAEIVAIVLSLETTGP
FT                   MLIKALQSQDMYLAGSFLMFLAFLNVIGVLISDIALGFLDPRIRLQGRSTK"
FT   gene            389995..391167
FT                   /locus_tag="Rleg2_5973"
FT   CDS_pept        389995..391167
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5973"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: ret:RHE_PE00039 probable
FT                   oligopeptide ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5973"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59143"
FT                   /db_xref="GOA:B6A410"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR025966"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B6A410"
FT                   /protein_id="ACI59143.1"
FT                   /translation="MSPLPAPGAPLPHYVSTAPFDPLATETMTAAQSRIHLASQKQLMW
FT                   WKFKQHRLALTSGIFLAAVYLMILIVEFLAPYGLHTRNVDFIHAPPQRVHFFDKGNFVG
FT                   PFVYGRSMTLDLDTLHRVYNDKPNDVQPIRFFCRGDAYKFWGFAASNYHLVCPAIGGQM
FT                   FLLGTDRLGRDVLSRILYGARISLTIGLIGISISFVLGIVIGGLAGYWGGIFDLVVQRL
FT                   IEVLQSLPSLPLWMALAAIMPVTWSPIVIYFGITVILGIIDWTGLARAVRSKLLALREE
FT                   DYVQAAQLMGASTPRIIGRHLVPGFMSHLIASATISIPGMILGETALSFLGLGLRPPIT
FT                   SWGILLTEAKSVSVIAFYPWLLYPIIPVVLVILAFNFLGDGLRDAADPYK"
FT   gene            391265..392470
FT                   /locus_tag="Rleg2_5974"
FT   CDS_pept        391265..392470
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5974"
FT                   /product="membrane-anchored protein"
FT                   /note="KEGG: rec:RHECIAT_PA0000040 membrane-anchored
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5974"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59144"
FT                   /db_xref="GOA:B6A411"
FT                   /db_xref="InterPro:IPR007235"
FT                   /db_xref="InterPro:IPR016683"
FT                   /db_xref="UniProtKB/TrEMBL:B6A411"
FT                   /protein_id="ACI59144.1"
FT                   /translation="MARRLEDARILMYSHDTFGLGHLRRCRAIAHALVEDYRGLNILII
FT                   SGATIAGAFDYRARVDFVKIPSVIKLRNGEYTSLASHIDLHETLKMRESSIRHTAETFQ
FT                   PDIFIVDKEPMGLKGEVEDTLAYLKARGTVLVLGLREVMDAPHLLDAEWKRNGIMQKID
FT                   QYYDSVWVYGPPDFYDPLVGLDVPASLRRKMDFVGFLQRSVSKGKSSINARKDNYLLVT
FT                   TGGGGDGSDLVHDVMNAYEADPTLTQKALIVLGPYMPAAERAKLVQKGEAIPYIEVIEF
FT                   DNHMEELIDGATGVVAMGGYNTYCEILSFDKPALIVPRVKPREEQLLRAQRASALGLVD
FT                   MLLPEQSADPTIMSEALKRLPSRLPPSKSGSNMHLEGLDHISQTVGRWIDGRASHLSLV
FT                   AE"
FT   gene            392480..393727
FT                   /locus_tag="Rleg2_5975"
FT   CDS_pept        392480..393727
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5975"
FT                   /product="glycosyl transferase group 1"
FT                   /note="PFAM: glycosyl transferase group 1; KEGG:
FT                   rec:RHECIAT_PA0000039 glycosyltransferase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5975"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59145"
FT                   /db_xref="GOA:B6A412"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="UniProtKB/TrEMBL:B6A412"
FT                   /protein_id="ACI59145.1"
FT                   /translation="MPPRRKILVVLKGYPRLSETFIAQELLGLEKAGFDLTLISMRRPT
FT                   DKKRHPVHDEIRARVVYLPEYLHEEPIRVLKGLVAGFSKPGFKVLIKRFLADLPRDISR
FT                   NRFRRLGQALVLGREWPDGGEWLHAHFIHTPASVTEYASILTGIPWTCSAHAKDIWTSP
FT                   DWELQEKLGSARWAVTCTRTGYEHMRQLTSRKDAVHLSYHGLDLARFGHFAGERSERTG
FT                   SDPDDPAFILSVGRAVEKKGYDVLLRALALLPADLHWRMDHIGGGEELGKLKALASELG
FT                   LANRIVWKGAMAQEDVLDHYRRADLFALACRIAANGDRDGLPNVLVEASSQRLVCLSTA
FT                   VSGVPELLEDGENGLVVPPEDPARLAKALETAIRDPALRKRLGDAAERRVREDFDYHSS
FT                   IRQLTGLFEAEWQKAS"
FT   gene            393724..394872
FT                   /locus_tag="Rleg2_5976"
FT   CDS_pept        393724..394872
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5976"
FT                   /product="Glycosyltransferase 28 domain"
FT                   /note="PFAM: Glycosyltransferase 28 domain; KEGG:
FT                   rec:RHECIAT_PA0000038 putative glycosyltransferase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5976"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59146"
FT                   /db_xref="GOA:B6A413"
FT                   /db_xref="InterPro:IPR007235"
FT                   /db_xref="UniProtKB/TrEMBL:B6A413"
FT                   /protein_id="ACI59146.1"
FT                   /translation="MTAPRIFFYVQHLLGIGHIARASRIANALVQDGFDVTVVTGGLPV
FT                   PGFPGDGVKTVALPPVVASNAGFSGLADADGRPAGEDFLSARRDLLLEAFHAARPDVVI
FT                   IEAFPFGRRQMRFELLPLFAAIDKAEPRPKLVSSVRDILQENRKAGRDAETAALVKDHF
FT                   DAVLVHGDPDFIRLEDTFPLTAEIADRLRYTGLVAAPPAPEPTETFDIIASAGGGAVGA
FT                   ALIGAAKEAAALLPADLRWLLIAGPNLPEADFAALSQDAAPNVTLVRFRRDFPSLLRGA
FT                   KVSISQAGYNTVGDLLRTECRAILIPFVAGGETEQTVRAERLQALGLADILPETGLTPG
FT                   HVKEAVEKALAAPRSGLVSLDLDGAEKTAGIIRSIIAGDSKL"
FT   gene            394975..395670
FT                   /locus_tag="Rleg2_5977"
FT   CDS_pept        394975..395670
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5977"
FT                   /product="Helix-turn-helix type 11 domain protein"
FT                   /note="PFAM: Helix-turn-helix type 11 domain protein; KEGG:
FT                   bid:Bind_0532 helix-turn-helix type 11 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5977"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59147"
FT                   /db_xref="InterPro:IPR013196"
FT                   /db_xref="InterPro:IPR026881"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B6A414"
FT                   /protein_id="ACI59147.1"
FT                   /translation="MSRSERLLDLLQVLRRHRRPVSGGVLADEIGVSIRTLYRDIASLQ
FT                   AQGAAIEGEPGVGYILKPGFLLPPLMFPPEEIEALVLGSRWVADRGDDHLRDAARNALA
FT                   RIAAVLPPELRDALDASALLVGPGVKLPVDQVDPALLRKAIRTERKLLIFYSDGAGVAS
FT                   ERVVWPFALAFFDQVRLLLGWCELRQDFRSFRTDRIVHAQVLDARYPKRRQALLKQWRE
FT                   VQGISHRDV"
FT   gene            395737..396111
FT                   /locus_tag="Rleg2_5978"
FT   CDS_pept        395737..396111
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5978"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; KEGG: ret:RHE_CH00839 putative
FT                   glyoxalase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5978"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59148"
FT                   /db_xref="GOA:B6A415"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR026275"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:B6A415"
FT                   /protein_id="ACI59148.1"
FT                   /translation="MTASNSILLYVTDAPTSARFYTSLLGKEPVEASATFAMFILPSGL
FT                   GLGLWGKAGVEPAPAAAGGGCDIGFKVATSDMVDATHADWQAKGATIVMAPADLDFGRS
FT                   FVAADPDGHRLRVYTVAEEA"
FT   gene            396115..396567
FT                   /locus_tag="Rleg2_5979"
FT   CDS_pept        396115..396567
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5979"
FT                   /product="protein of unknown function DUF55"
FT                   /note="PFAM: protein of unknown function DUF55; KEGG:
FT                   rec:RHECIAT_CH0000926 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5979"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59149"
FT                   /db_xref="InterPro:IPR002740"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR022996"
FT                   /db_xref="UniProtKB/TrEMBL:B6A416"
FT                   /protein_id="ACI59149.1"
FT                   /translation="MARAWIAVASAEHVRIGRQAGFMQVCHGKASPLRRITPGDRVIYY
FT                   SPTVVFGGKDRLQAFTAIGAARDSAPYQVKMESGFRPWRRDVDWQAAEETPIRPLLDRL
FT                   SFRRVGPNWGYQLRFGLFGISNEDADMIAEAMSCSSANAMLRAVAA"
FT   gene            396942..399656
FT                   /locus_tag="Rleg2_5980"
FT   CDS_pept        396942..399656
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5980"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; KEGG:
FT                   rec:RHECIAT_PA0000037 putative multidrug ABC transporter,
FT                   ATP-binding and permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5980"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59150"
FT                   /db_xref="GOA:B6A417"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="UniProtKB/TrEMBL:B6A417"
FT                   /protein_id="ACI59150.1"
FT                   /translation="MEKSLARYIWKNTRLQQLWILAVVAASMVPYFLSFDLPKQIVNGP
FT                   IQGDGFEGPGARQTFMHIAYDIPLIGHVEFFQGLQLNRFQMLMALSLVFLALVVLNGLF
FT                   KFYINTYKGRLGERMLRRIRFELIDRVLRFPPIHFKRVKSAEIATMIKDEVEPMGGFTG
FT                   DAFVSPALLGGQAITALAFIIVQNFWLGMIAAGIVGVQAIVIPRMRKRLLDLGRQRQLT
FT                   ARELSGRVGEIVDGIGTIHGNDTSNLERADIASRLGRIFSIRYDLYQWKFLVKFINNFL
FT                   AQVTPFLFYAIGGYLALQGRLDIGQLVAVISAYKDLPGPLKELIDWDQMRQDVQVKYQQ
FT                   VYEQFNVEPLIDSRIQELATAPVGALTSALVVTNLSLSDDSGARLVDHVSVEIKPNETV
FT                   AIVGPNGSGAEAFAEALGRMVWPDSGRITIDGRDLLDLPESITGRRISYASADTFFFHG
FT                   TLASNLLYGLKHAPMTDPVYDEKEALEYKWHSIEAVKAGNPTLDLNSDWVDYQAAGASG
FT                   PEDLLKAIRPVLDAVLISQDILDLALRSTVNTDVHVAVSDHVVALRASLRDRLRDEGLD
FT                   GIVVPFDFDAYNAQATVGENLLFGTMKRPLMTNRRLAAHPYFQQLFRETGLSTDLYAMG
FT                   LEIAENAVELFHDLPPDHPFFQQLTFMTADDIPTYQALLQKLQSRRFEDATPEERSAII
FT                   RLSFAYIEPRHRFGLLTDELMDKIVSARKQFHEHIPADLGELIERYDAERFTPSASLMD
FT                   NVLFGRIAYQQADASDRIRAIMGELFDALDLYDDVLSIGLEFDVGSGGKRLTMVQRQKL
FT                   NLARALLKRSDYFIFNRPLSALDQRVQDQITRNIVQDLHEEGQRPSIIWVLSNARLAEM
FT                   FDRILLFDRGGLAEAGNYPELSEKNGMFKELLS"
FT   gene            399755..400222
FT                   /locus_tag="Rleg2_5981"
FT   CDS_pept        399755..400222
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5981"
FT                   /product="cyclic nucleotide-binding protein"
FT                   /note="PFAM: cyclic nucleotide-binding; KEGG:
FT                   rec:RHECIAT_PA0000036 putative transcriptional regulator
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5981"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59151"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018488"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="UniProtKB/TrEMBL:B6A418"
FT                   /protein_id="ACI59151.1"
FT                   /translation="MLLRDEVEMLRRVPIFSRIAPAKLKLLAFTSDRMTYKAGQNLFHQ
FT                   GDVGDAAYVILSGTADIIVSSPAGEIKVADVELNSIVGEIAILCDVSRTATVRATSPLE
FT                   VLRISKEHFLKLLSDFPEMAVEIMRVLADRLNHTTAELTAARAAKQPQMAQ"
FT   gene            complement(400230..400520)
FT                   /locus_tag="Rleg2_5982"
FT   CDS_pept        complement(400230..400520)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5982"
FT                   /product="addiction module toxin, RelE/StbE family"
FT                   /note="TIGRFAM: addiction module toxin, RelE/StbE family;
FT                   PFAM: plasmid stabilization system; KEGG: ret:RHE_PE00033
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5982"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59152"
FT                   /db_xref="InterPro:IPR007712"
FT                   /db_xref="InterPro:IPR035093"
FT                   /db_xref="UniProtKB/TrEMBL:B6A419"
FT                   /protein_id="ACI59152.1"
FT                   /translation="MIVKWLPQALLDRESQIRHIFAQNPKAAIALDDVIRHQAKMLADH
FT                   PEAGRRGRLGGTRELVIPRTAFLLIYRIDREAQTVEILRLLHGAQQWPPKR"
FT   gene            complement(400517..400978)
FT                   /locus_tag="Rleg2_5983"
FT   CDS_pept        complement(400517..400978)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5983"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ret:RHE_PE00032 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5983"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59153"
FT                   /db_xref="UniProtKB/TrEMBL:B6A420"
FT                   /protein_id="ACI59153.1"
FT                   /translation="MTAETIDHSTLSRLVEAGAVEAAHVVGKTGGWSVVIRYGKSERPL
FT                   AAQRSRQVRLFKRMDTLVSYLKDVGISQFDVDAADYVPEMASRPDRAEALRRTHEAAEY
FT                   DKWFREQVEAAIREADDPNTVWISAEAAEEQMDKLRAELLAQLESGDKA"
FT   gene            complement(401233..402564)
FT                   /locus_tag="Rleg2_5984"
FT   CDS_pept        complement(401233..402564)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5984"
FT                   /product="General substrate transporter"
FT                   /note="PFAM: General substrate transporter; KEGG:
FT                   rec:RHECIAT_PA0000031 putative ABC transporter, permease
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5984"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59154"
FT                   /db_xref="GOA:B6A421"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B6A421"
FT                   /protein_id="ACI59154.1"
FT                   /translation="MATTSHYGPSSSSLERDARRIHDDKPVSPGSIAIGVVIGRMSEFF
FT                   DFFVYGLASVLVFPQLVFPFAPDRLTGTLYSFAIFSLAFLARPVGSVVFMTIDRMYGRG
FT                   TKLTIALFLLGGSTASIAFLPGYEEIGVWSIALLALFRLGQGFALGGAWDGLASLLALN
FT                   APANHRGWYAMIPQLGAPIGFALASTLFGYFVANLSSEDFLSWGWRYPFFVAFAINVVA
FT                   LFARLRLVMTKEFGTLLEQHELEAAPILDVLRVHGRDILIGAFVPLASFAMFHLVTIFP
FT                   LGWMSLYGNQPIGAFMVVQVVGAMVGIVAIVASGLIADRIGRRAQLAICAVIIAVFSFV
FT                   GPILIASGNSGHDAFVIVGFGVLGLSFGQATGSISSRFGRGYRYTGAAFTSDLAWLIGA
FT                   GFAPLVALSLSSRFGLTFVGYYLLSGAICTLAALAFSRALEQRE"
FT   gene            402955..404127
FT                   /locus_tag="Rleg2_5985"
FT   CDS_pept        402955..404127
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5985"
FT                   /product="ubiquinol oxidase, subunit II"
FT                   /note="TIGRFAM: ubiquinol oxidase, subunit II; PFAM:
FT                   cytochrome c oxidase subunit II; COX aromatic rich domain
FT                   protein; KEGG: rec:RHECIAT_PA0000030 cytochrome o ubiquinol
FT                   oxidase protein, subunit II"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5985"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59155"
FT                   /db_xref="GOA:B6A422"
FT                   /db_xref="InterPro:IPR002429"
FT                   /db_xref="InterPro:IPR006333"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR010514"
FT                   /db_xref="InterPro:IPR011759"
FT                   /db_xref="InterPro:IPR034227"
FT                   /db_xref="InterPro:IPR036257"
FT                   /db_xref="UniProtKB/TrEMBL:B6A422"
FT                   /protein_id="ACI59155.1"
FT                   /translation="MKFSRLLSVLPLLFLAGCNMVVMAPSGDIAVQQRDLIVISTVLML
FT                   LIIIPVIFLTLLFAWRYRHSNTAATYAPEWHHSTRLEIVIWAAPLAIIIALGAVTWIST
FT                   HKLDPYRPLDRLDAARAIPADTKPLTVEVVALDWKWLFFYPELGIATVNELAAPVDMPI
FT                   NFKITASSVMNSFYIPALAGQIYAMPGMETKLHAVINKEGEYEGFSANYSGSGFSHMRF
FT                   KFHGLTREGFDAWVAKVKEQGTMLNRDAYLKLEKPSEKEPVRYYAGADADLYDAILNMC
FT                   ATPGKMCMNEMMHIDMTGGGGKESAENRDKLQYDNRHADEGIVAPAATVPATGAPARSE
FT                   PAKSSDGNSMQHDMPGMQGMPGMDMQHDGHSMPGMNNGADPAPAQLNNNN"
FT   sig_peptide     402955..403047
FT                   /locus_tag="Rleg2_5985"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.954) with cleavage site probability 0.477 at
FT                   residue 31"
FT   gene            404170..406173
FT                   /locus_tag="Rleg2_5986"
FT   CDS_pept        404170..406173
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5986"
FT                   /product="cytochrome o ubiquinol oxidase, subunit I"
FT                   /EC_number="1.9.3.1"
FT                   /note="KEGG: rec:RHECIAT_PA0000029 cytochrome o ubiquinol
FT                   oxidase protein, subunit I; TIGRFAM: cytochrome o ubiquinol
FT                   oxidase, subunit I; PFAM: cytochrome c oxidase subunit I"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5986"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59156"
FT                   /db_xref="GOA:B6A423"
FT                   /db_xref="InterPro:IPR000883"
FT                   /db_xref="InterPro:IPR014207"
FT                   /db_xref="InterPro:IPR023615"
FT                   /db_xref="InterPro:IPR023616"
FT                   /db_xref="InterPro:IPR036927"
FT                   /db_xref="UniProtKB/TrEMBL:B6A423"
FT                   /protein_id="ACI59156.1"
FT                   /translation="MFSNPDLLKFVFGRLTLDAIPYHEPILVVTFIGVVIGAIAVLGLI
FT                   TYFKFWGPLWNDWICSVDHKKIGIMYVILAVIMLLRGFSDAILMRIQQAIAFNGSEGYL
FT                   PPHHYDQVFTAHGVIMIFFVAMPFVTGLMNFVVPLQIGARDVSFPFLNNFSFWMTTAGA
FT                   IIIMLSLFIGEFAQTGWLAYPPLSGAAYSPGVGVDYYIWGLQVAGVGTTLSGINLIATI
FT                   VKMRAPGMTFMKMPVFTWTALCTNVLIVASFPILTATLALLSLDRYAGTNFFTNDLGGN
FT                   PMMYINLIWIWGHPEVYILVLPAFGIFSEVVATFSGKRLFGYASMVYATCVIMILSYIV
FT                   WLHHFFTMGSGASVNSFFGITTMIISIPTGAKIFNWLFTMYRGRIRYEVPMLWTVGFMV
FT                   TFVIGGMTGVMLAVPPADFVLHNSLFLIAHFHNVIIGGVLFGMFAGVNYWFPKAFGFKL
FT                   DPFWGKLSFWFWQIGFWFAFMPLYVLGLMGVTRRMNQFDDPSLQIWFIIAAFGVGLIAL
FT                   GIAAFLIQIVVSFMKREELRDDTGDPWDGRTLEWSTSSPPPDYNFALTPVVHDHDSWYD
FT                   MKNRGYARPLEGFRPIHMPKNTGTGAILSGISVALAFGLIWYMWWLVVVSFVGLLVVAI
FT                   GHTFNYRRDFHIPAEEVTETEGKRTALLAEQV"
FT   gene            406173..406799
FT                   /locus_tag="Rleg2_5987"
FT   CDS_pept        406173..406799
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5987"
FT                   /product="cytochrome o ubiquinol oxidase, subunit III"
FT                   /note="TIGRFAM: cytochrome o ubiquinol oxidase, subunit
FT                   III; PFAM: cytochrome c oxidase subunit III; KEGG:
FT                   ret:RHE_PE00028 cytochrome o ubiquinol oxidase, subunit III
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5987"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59157"
FT                   /db_xref="GOA:B6A424"
FT                   /db_xref="InterPro:IPR000298"
FT                   /db_xref="InterPro:IPR013833"
FT                   /db_xref="InterPro:IPR014206"
FT                   /db_xref="InterPro:IPR024791"
FT                   /db_xref="InterPro:IPR033946"
FT                   /db_xref="InterPro:IPR035973"
FT                   /db_xref="UniProtKB/TrEMBL:B6A424"
FT                   /protein_id="ACI59157.1"
FT                   /translation="MTMSDQTIDTSEKPEFYLTEDHHPENSTNLGFWLYLMSDCLIFAV
FT                   LFATHGVLGRNYAAGPSPADLFDLPIVALNTSMLLLSSITYGFAMLQMERNAKAETLFW
FT                   LAVTGLFGAAFIGLELYEFIHLIHEGAGPTRSAFLSSFFTLVGTHGLHVTFGIIWLITL
FT                   MVQVSMHGLAEANRRRLMCLSMFWHFLDVVWIGVFSFVYLLGVLG"
FT   gene            406796..407197
FT                   /locus_tag="Rleg2_5988"
FT   CDS_pept        406796..407197
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5988"
FT                   /product="cytochrome o ubiquinol oxidase subunit IV"
FT                   /note="TIGRFAM: cytochrome o ubiquinol oxidase subunit IV;
FT                   PFAM: cytochrome C oxidase subunit IV; KEGG:
FT                   ret:RHE_PE00027 cytochrome o ubiquinol oxidase, subunit IV
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5988"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59158"
FT                   /db_xref="GOA:B6A425"
FT                   /db_xref="InterPro:IPR005171"
FT                   /db_xref="InterPro:IPR014210"
FT                   /db_xref="UniProtKB/TrEMBL:B6A425"
FT                   /protein_id="ACI59158.1"
FT                   /translation="MSSQAPAHEDAHEAHHGHSHGHQAGHGTFRSYMTGFALSVVLTAI
FT                   PFWLVMAGVFASPLVTALLVMGIGAIQIVVHMVFFLHMNPRSEGGWTMMALIFTIIIVA
FT                   IALSGSLWVMHHLNSNMMPMSPEMMKNMP"
FT   gene            407238..407990
FT                   /locus_tag="Rleg2_5989"
FT   CDS_pept        407238..407990
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5989"
FT                   /product="Surfeit locus 1 family protein"
FT                   /note="PFAM: Surfeit locus 1 family protein; KEGG:
FT                   ret:RHE_PE00026 probable cytochrome oxidase complex
FT                   biogenesis factor protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5989"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59159"
FT                   /db_xref="GOA:B6A426"
FT                   /db_xref="InterPro:IPR002994"
FT                   /db_xref="UniProtKB/TrEMBL:B6A426"
FT                   /protein_id="ACI59159.1"
FT                   /translation="MAPSDTSERRPSRAKRAIFCVCLVLLAAALAALGTWQVQRLAWKR
FT                   DLIARVDQRVHAAPVPAPARADWSKVNAAADEYRRVSATGTLANDKETLVYASTVLGPG
FT                   YWVMTPLTLADGTAILVNRGFVPMERRDPATRRAGEVSGPVEITGLIRMTEPKGSLLQS
FT                   NDAAADRWYSRDVAAIAQKRSVGAVAPYFIDADAAANPGGLPVGGLTIIHFPNNHLVYA
FT                   ITWYGLAAMALALLVFIFRGEIGRGRRV"
FT   sig_peptide     407238..407342
FT                   /locus_tag="Rleg2_5989"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.494 at
FT                   residue 35"
FT   gene            408098..409291
FT                   /locus_tag="Rleg2_5990"
FT   CDS_pept        408098..409291
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5990"
FT                   /product="acyltransferase 3"
FT                   /note="PFAM: acyltransferase 3; KEGG: ret:RHE_PE00025
FT                   putative acyltransferase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5990"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59160"
FT                   /db_xref="GOA:B6A427"
FT                   /db_xref="InterPro:IPR002656"
FT                   /db_xref="UniProtKB/TrEMBL:B6A427"
FT                   /protein_id="ACI59160.1"
FT                   /translation="MTRPDYIPSLDGLRGIAALLVVLAHVGLIFPTASAHLTTMGSEAV
FT                   GLFFALSGFLMAHLYGSRPVTRENVLDFLVSRFARIYPVYLAAVLLVAMLSGMQTLDFV
FT                   QPITGGTDFVRHVFLLGSSGVFWSIPPEIQFYLFFPILWLCLARPHRYSGMIVGLTVVV
FT                   VVDGLLELPGPGIMLLSKLPYFVFGALAGKMHSYGDKWTPSALTGIFTLFLLAAFFTYR
FT                   HLVPSFSPEFWSLQSAFAAAIIVALVARQPPLAAHVLASAPMRFLGTISFSLYLFHVPI
FT                   MFLVHRSFETLMPEPALIGVALVVAVGGAWFLHETIEVPSRRLLVGLWQHHRWRVIARK
FT                   IPAGRIEQAILDLQETEKRLLSGAPSVTPVERQVPTPPEIREGTDRDGDNGDEKRRA"
FT   gene            complement(409309..411237)
FT                   /locus_tag="Rleg2_5991"
FT   CDS_pept        complement(409309..411237)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5991"
FT                   /product="PAS/PAC sensor hybrid histidine kinase"
FT                   /note="KEGG: ret:RHE_PE00024 probable two-component sensor
FT                   histidine kinase/response regulator hybrid protein;
FT                   TIGRFAM: PAS sensor protein; PFAM: response regulator
FT                   receiver; ATP-binding region ATPase domain protein;
FT                   histidine kinase A domain protein; PAS fold-3 domain
FT                   protein; PAS fold-4 domain protein; PAS fold domain
FT                   protein; SMART: PAS domain containing protein; PAC
FT                   repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5991"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59161"
FT                   /db_xref="GOA:B6A428"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B6A428"
FT                   /protein_id="ACI59161.1"
FT                   /translation="MESLNRQDPSLNDEGRFRLLVDAITDYAIYMLSPEGIITSWNTGA
FT                   QRFKGYKPSEILGEHFSRFYLEEDRAAGTPERALATAKEQGRFEGEGWRQRKDGSRFWA
FT                   HVIIDPIRHPSGELIGFAKITRDLTERRAAENAIRQSEEQFRRLVQGVSDYAIYMLDPS
FT                   GNVSSWNFGAERIKGYRPDEIIGRHFSTFYTLEDRAAGMPQTALGIARAEGRFEREGWR
FT                   VRKDGTRFWASVVIDAIRGDDGQVIGFAKITRDITEKMETQRALEQAREELFQSQKMEA
FT                   IGQLTGGIAHDFNNLLMAVLGSLEILKKRMPQDRSLTSLVDNAMQGAQRGAALTQRMLA
FT                   FSRRQELHMEPIDVSGLVRGMMDMLSRSLGPLTRIETSFPIRLPTILTDPNQLEMAILN
FT                   LVVNARDAMPSGGRILLRAAEESVPSGKGLLPPGRYIRIAVIDEGEGMDAKTMEQAITP
FT                   FFTTKGVGKGTGLGLSMVQGLASQSGGRLMLKSRLGEGTTAELWFPVVTLEQVAEVTAD
FT                   PPQRAENTPRGLRIVAVDDDGLVLMNTTLMLEDLGHTVFEAMAGPEALEIMRKQPVDLV
FT                   ICDHAMPRMTGAELAEVIREEWPEMPIILATGYAELPEGTQIANLPRLGKPFSQAQLAD
FT                   AISRVAS"
FT   gene            complement(411307..412713)
FT                   /locus_tag="Rleg2_5992"
FT   CDS_pept        complement(411307..412713)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5992"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ret:RHE_PE00023 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5992"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59162"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR038732"
FT                   /db_xref="UniProtKB/TrEMBL:B6A429"
FT                   /protein_id="ACI59162.1"
FT                   /translation="MTVQGLFSARANAAAQISAVPRIAIVGRGFSGMMAAIALMKTLRA
FT                   PFHLQLFDPNSSVSGGQALASARASTILNTRVRDLSVEIGDNDDFNDWLCSNAAFRAAV
FT                   PAAIPGFRQIFVPKEIFSDYVYQRFSEALAARRDITVQVCNDPVVAIRRSHGNRFLLES
FT                   ANPANPLFDTVILATGYGLSDPDAGERQASPVRAQRLVARPHAVLLGSGIRVVDQLLQL
FT                   RDSGYAGQVTIISRRGFLPQSHTPNSADPVFPAEALPESLPDIVRFIREACREAEEEGR
FT                   SWQSVMNGLRKHARSLWRSLPARDKHQFNRHLRAIYDSHRNRLPEAMHLRLKRELAEGR
FT                   TVLRRGRAGRRGLSGLFFTPAGSAAEEIIHAERIIDCRCQAPDLSAPLIQSLFSAGLAM
FT                   ADELSLGLAVNARGEPFLEDGSAVAGLFAIGPLGLGSLPDIDLVPEIVSQAYAAAERVG
FT                   ERFYPQVKAV"
FT   gene            complement(413012..413629)
FT                   /locus_tag="Rleg2_5993"
FT   CDS_pept        complement(413012..413629)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5993"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ret:RHE_PE00021 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5993"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59163"
FT                   /db_xref="GOA:B6A430"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:B6A430"
FT                   /protein_id="ACI59163.1"
FT                   /translation="MPLKALALNATLKSSDAKEPSSTDRMIGLIDKALSAYDVKTEVLR
FT                   LADFNVKPGVTSDEGKGDDWPDIRAKVLAADILIMATPIWLGQPSSVCKRALERMDAFL
FT                   DETDDQGRMVSYGRVAAVAVVGNEDGAHHVSAEIYQALNDVGFTIPANAVAYWVGEAMG
FT                   STNFVDLDKVPKVVTKAVDMLARNTAHLAGLLKAKQYPGEDG"
FT   gene            413951..415714
FT                   /locus_tag="Rleg2_5994"
FT   CDS_pept        413951..415714
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5994"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter transmembrane region; ABC
FT                   transporter related; SMART: AAA ATPase; KEGG:
FT                   rec:RHECIAT_PA0000021 putative ABC transporter, ATP-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5994"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59164"
FT                   /db_xref="GOA:B6A431"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:B6A431"
FT                   /protein_id="ACI59164.1"
FT                   /translation="MVRITMMAFRHPWQSGFAIGATLVASTFQLMIPRLLGQAVDHTQM
FT                   AMSGGAAGQAAQDALLTTALLLLGASVLRGLFTMVQNYYSEAVGHHIGYELRLACYEKI
FT                   QRLSFSFHDTVHSGDLITIGLLDLEGVRMYFSTALVRMILLSILIGIGAYMLLSTDIVL
FT                   GLLALSFVPFVGWRSSVTQLRLRATWLDLQERLSVLTRIMEENLGGIRVVRAFAAQDHE
FT                   MSKFEAASKNALALAHQRVGIRVTNTSAMTFSFFAAMGLVLFVGGGKVMSGEITVGTLA
FT                   SFLTFMTILQMPVRQLGLMVNAFARASTCGTRLFNLLDLDIAIKDAPDARELAVTGGVL
FT                   RFENVSFAYPGSEKRTVLHDVSFEARRGQTIGIVGPPGSGKSTIAHLIPRFYDVSGGKI
FT                   TIDGQDIRKAKLQSLRRAVAVVQQDSFLFTTTIENNIAYGDPWAKEGRIERASESAQLH
FT                   NYVLGLPTGYDTVVGERGVSLSGGQRQRLSIARALMLKPAVMVFDDSTAAIDAATEQRI
FT                   RSAMRRYAADRVTIIVAHRLSSLMHADQILFVEDGRIVERGTHAALLALGGRYKALYEL
FT                   QVRPGDEVLSA"
FT   gene            415934..417832
FT                   /locus_tag="Rleg2_5995"
FT   CDS_pept        415934..417832
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5995"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter transmembrane region; ABC
FT                   transporter related; SMART: AAA ATPase; KEGG:
FT                   rec:RHECIAT_PA0000020 putative multidrug ABC transporter,
FT                   ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5995"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59165"
FT                   /db_xref="GOA:B6A432"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:B6A432"
FT                   /protein_id="ACI59165.1"
FT                   /translation="MAEELETERPDVREDGRRPPRAVVGSHRVEEEMFGKAFDGNIVKR
FT                   IWAFVHPYRRQVAWSVVAVLTFTMMQLLIPLIIRYAIDHGMSPGGSSSALIWSIAAFAI
FT                   AISINYAASYAQETLVGGVAEDVLFDIRKAMFSHLQRVSLSFMDKTEVGRLMSRLQGDV
FT                   NSMQEFLETSVLSVGDIVLLFGIVFVMLYLDFKLGLLTLSVLPVLFIVRLFWLPLARKS
FT                   FMAAHETNSVANGALAEAIHGVRAVQSMDRQGVNFTLYDDKAHANLRTHLTAARYAQVM
FT                   VPIVDSLTGVAMALVIVVGGARVLNQALDVGVLVAFLFYIQRFFDPIRSLTLQYSVMQR
FT                   AMASGQRLTEVLDVPVDIKDAPDAKTLSRDMDGSVEFKDVVFGYNPKHPVLKHVSFKVN
FT                   PGETVALVGPTGSGKSSCMSLIHRFYDVQQGQVLVGGHDVRELTQDSLGAQIAMVLQEP
FT                   FLFTGTVFENIRYHKAEATREQVIEAAKAVGAHEFVMRLPDGYDSVLGERGGNLSLGQR
FT                   QLLSFARALVADAKILVLDEATANIDSYTEMLIQKALVKLLENRTGLVIAHRLATIREA
FT                   DRIIVLQNGEIIESGDHRQLMKNGKLYSKLYNLNYASFDDIPEDVLEETTATQSAT"
FT   gene            417944..418261
FT                   /locus_tag="Rleg2_5996"
FT   CDS_pept        417944..418261
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5996"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ret:RHE_PE00018 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5996"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59166"
FT                   /db_xref="GOA:B6A433"
FT                   /db_xref="UniProtKB/TrEMBL:B6A433"
FT                   /protein_id="ACI59166.1"
FT                   /translation="MKRIVSSLLIATALVGSAIQPAAARDHHHHNNTGRIIAGGVAAGV
FT                   VGGLIGGALANGSPRYVDEGPRYVESPRYVEPQPRCWYEDRDVRNRYDGGYHAETVRVC
FT                   E"
FT   sig_peptide     417944..418018
FT                   /locus_tag="Rleg2_5996"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.855 at
FT                   residue 25"
FT   gene            418445..419455
FT                   /locus_tag="Rleg2_5997"
FT   CDS_pept        418445..419455
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5997"
FT                   /product="transcriptional regulator, LacI family"
FT                   /note="PFAM: periplasmic binding protein/LacI
FT                   transcriptional regulator; SMART: regulatory protein LacI;
FT                   KEGG: rec:RHECIAT_PA0000018 putative transcriptional
FT                   regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5997"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59167"
FT                   /db_xref="GOA:B6A434"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:B6A434"
FT                   /protein_id="ACI59167.1"
FT                   /translation="MPKKERMRFVSAEQVAQRAGVSRSAVSRTFTPGASVAPATREKVL
FT                   RAAEELGYHVNDLARGVLANQSRLVGIVATRPEVGFRAHLAAALAKSLIRRGSIPILVN
FT                   TGQTEEELLAAQKMLIGHRAEAIIILSGSPPASFLELAQRNGQPLVVIGRSEPDADHVR
FT                   AGNSEASRKAATAFYESGRRRLAVIGSNSGTPAIVERESAFLSAAESLGASVVVARGDD
FT                   SDYQGGVTAGRALFSEKIKPDAVFCANDLIAFGLMDVARQEARLRIPEDLAIIGFDDVP
FT                   ESAWLSYQLTTFRQDPLVMAQRAVALMERRLENSDAPPASERVIPELVIRQSFRP"
FT   gene            419537..420574
FT                   /locus_tag="Rleg2_5998"
FT   CDS_pept        419537..420574
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5998"
FT                   /product="transcriptional regulator, LacI family"
FT                   /note="PFAM: periplasmic binding protein/LacI
FT                   transcriptional regulator; SMART: regulatory protein LacI;
FT                   KEGG: rec:RHECIAT_PA0000017 probable transcriptional
FT                   regulator protein, LacI family"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5998"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59168"
FT                   /db_xref="GOA:B6A435"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:B6A435"
FT                   /protein_id="ACI59168.1"
FT                   /translation="MKGIRQLAEHLDISIGTVSRALNGKPDVNDETRRRVLAAAEELGY
FT                   VANQSGRSLRQGMTNVIGLMLEVSRETVENSDDFFLGVTDGLQSVFSRHKLDLVMLPCP
FT                   DDEDPHEYLKRMVARRLVDALIISATRRTDRRIELLEKARIPFVALGRSASGGSYTWMD
FT                   LDFEGVAARGVDRLVAKGHRRIAVAAPSSDINLGYIFLDSYRQALKRHDIAFDPALVIR
FT                   VKSSEQGGYQAGHELLMIEDRPTAIILIHELMAIGLYRRLAEAGIVPGRDLAVVGFREE
FT                   PRTHFLQPSLTSFRMSLRDLGAQLGETLLASMPAYAEHYPQGARNRIWPLELVPGESDA
FT                   FTLTD"
FT   gene            complement(420585..421877)
FT                   /locus_tag="Rleg2_5999"
FT   CDS_pept        complement(420585..421877)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_5999"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   rec:RHECIAT_PA0000016 putative tartrate transporter
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_5999"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59169"
FT                   /db_xref="GOA:B6A436"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B6A436"
FT                   /protein_id="ACI59169.1"
FT                   /translation="MVDEKRLISKITWKLMPFLGILYLIAYIDRQNVSFAKLQMVDALG
FT                   MSEYAYGLGASLFFIGYFLFEVPSNLFLDRLGARVWFARILVSWGIVTVALAFTQNATM
FT                   FYILRFLLGVCEAGFFPGVLYLLTLWFPSVYRGRMVGLFMIFSAIANAVGAPLGGVLLD
FT                   LDGLYGFAGWEWVFLATGIPAIIAGIVTFFYLPGRPENASFLTGEEKDWLERRLAAENA
FT                   GMGEHAGNGFKALIDPRVLLMALCYVAFPLSAYGLSYWLPTIVKAFGVSNTVNGFLNII
FT                   PWLLVAVALYAVPAMADKAQSKTPYIVIPAFIGAACLLLSALIPNHTLQFAFLCVAAAG
FT                   IFAPQPVFWSLPSRFLKGAGAAAGLAAINSVGNLGGFVAQNVVPWIKDQSGSTIAPMFF
FT                   LAACLAAGALLVFFVTRQLSSREPPAAPSRV"
FT   gene            complement(422018..423217)
FT                   /locus_tag="Rleg2_6000"
FT   CDS_pept        complement(422018..423217)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_6000"
FT                   /product="drug resistance transporter, Bcr/CflA subfamily"
FT                   /note="TIGRFAM: drug resistance transporter, Bcr/CflA
FT                   subfamily; PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   rec:RHECIAT_PA0000015 putative multidrug transporter
FT                   protein, Bcr/CflA subfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_6000"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59170"
FT                   /db_xref="GOA:B6A437"
FT                   /db_xref="InterPro:IPR004812"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B6A437"
FT                   /protein_id="ACI59170.1"
FT                   /translation="MTASFFRMALILGLLSAIGPFAIDMYLPALPSIGQDLHADNNVTQ
FT                   LTLLAFFISFALAQLVYGPLSDMWGRKLPLYLGIGVFAVASIGCALSTNIETLIAFRFV
FT                   QGIGGAAGMVIPRAIVRDMHTGVQAARLMSLLMLVFSISPILAPLTGSAVIEFYGWRGV
FT                   FWAVTIAAFVGLVLLATQLEETRPAKERSGSGLKSAMAAYRLLLSDRNFLTLTFIGGLG
FT                   ISSFLVYLANSPFVLIQHYGLTPTEYSFAFSINAVSFFAVSQATGWLGERFGLVRVMRI
FT                   AVSAFALAMVVMAVVMASGFNQLPVMASFLFIGYGFLGLVIPTSAVLALEDHGAIAGTA
FT                   SSLMGTLHFVIAAVAMVISSLFFDGTAVPMAAGIALCAFAAFVLTQATIGRRAAVAAAE
FT                   "
FT   sig_peptide     complement(423149..423217)
FT                   /locus_tag="Rleg2_6000"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.913) with cleavage site probability 0.733 at
FT                   residue 23"
FT   gene            423455..424129
FT                   /locus_tag="Rleg2_6001"
FT   CDS_pept        423455..424129
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_6001"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: ret:RHE_PE00014
FT                   probable transcriptional regulator protein, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_6001"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59171"
FT                   /db_xref="GOA:B6A438"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR039536"
FT                   /db_xref="UniProtKB/TrEMBL:B6A438"
FT                   /protein_id="ACI59171.1"
FT                   /translation="MGGHTQRGQCAKRMSILDAAADVFCRQGFAGASIDEIAAVACVSR
FT                   QTIYNHYREKETLFVAVVEDVMNRANAMLFSVLSSFPEKSDDLEDGLTAFAVRLNKNCI
FT                   CNHDGKFLRKLVQTEGERYPHLFESWRQQGPGKLTNALSALLARLTHKGALVIDDFDIA
FT                   ARQFVALANADVQMMTLFGETPSDEELDKAARNAVRTFLKAYGRPAADIAGRPPELAAI
FT                   AG"
FT   gene            complement(424142..424552)
FT                   /locus_tag="Rleg2_6002"
FT   CDS_pept        complement(424142..424552)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_6002"
FT                   /product="response regulator receiver protein"
FT                   /note="PFAM: response regulator receiver; KEGG:
FT                   ret:RHE_PE00013 putative two-component response regulator
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_6002"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59172"
FT                   /db_xref="GOA:B6A439"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:B6A439"
FT                   /protein_id="ACI59172.1"
FT                   /translation="MKQRVLIVEDEFLIALDLGATVEGMGMQVAGLASDREQALRLAPL
FT                   ADIAFVDVNLADGPTGPEIGRRLAQEHGIAVVFMTGNPEVVADGVKGAVGVVQKPVMPS
FT                   VVQQLVNYLAARRVGMFAVVPSQMTVFAGSRG"
FT   gene            424871..425410
FT                   /locus_tag="Rleg2_6003"
FT   CDS_pept        424871..425410
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_6003"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rec:RHECIAT_PA0000012 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_6003"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59173"
FT                   /db_xref="GOA:B6A440"
FT                   /db_xref="InterPro:IPR005490"
FT                   /db_xref="InterPro:IPR038063"
FT                   /db_xref="UniProtKB/TrEMBL:B6A440"
FT                   /protein_id="ACI59173.1"
FT                   /translation="MRKKLIALAIVIVSLFTYTKLMARIGSGSPPPDAPLAQQADSIRV
FT                   YKSERRMVLLKGDVPISTYRISLGKAADAGPKQREGDEKTPEGHYEIDWRNPKSMAHLS
FT                   LHISYPSPDDQRNAAAGSFPPGGNIMIHGLPNGWGLFRQAHRLWDWTDGCIAVTNAEMR
FT                   DIWARVPDHTPIDIMP"
FT   sig_peptide     424871..424942
FT                   /locus_tag="Rleg2_6003"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.991) with cleavage site probability 0.792 at
FT                   residue 24"
FT   gene            complement(425417..426124)
FT                   /locus_tag="Rleg2_6004"
FT   CDS_pept        complement(425417..426124)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_6004"
FT                   /product="peptide methionine sulfoxide reductase"
FT                   /EC_number="1.8.4.11"
FT                   /note="TIGRFAM: peptide methionine sulfoxide reductase;
FT                   PFAM: Methionine sulfoxide reductase A; KEGG:
FT                   ret:RHE_PE00011 methionine sulfoxide reductase A"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_6004"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59174"
FT                   /db_xref="GOA:B6A441"
FT                   /db_xref="InterPro:IPR002569"
FT                   /db_xref="InterPro:IPR036509"
FT                   /db_xref="UniProtKB/TrEMBL:B6A441"
FT                   /protein_id="ACI59174.1"
FT                   /translation="MSMSHRRRSLAALLAAMIFSIAAGAASAAEDAVVIPPPDVDEAAG
FT                   PGTETAIFAGGCFWGVQGVFQHVKGVKSAVSGYAGGKAGTAQYETVSTGSTGHAESVQV
FT                   TFDPSKVSYGKLLQIFFSVAHNPTQLNFQGPDQGTQYRSALFVAGPEQRKVAEHYIGQL
FT                   DKAHVFAQPIVTKVSDTSGFYPAEAYHQDFLTLNPTYPYIVYNDLPKIENLKSLFPADY
FT                   RSEPVLVRKGSKG"
FT   sig_peptide     complement(426038..426124)
FT                   /locus_tag="Rleg2_6004"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.971 at
FT                   residue 29"
FT   gene            426333..431804
FT                   /locus_tag="Rleg2_6005"
FT   CDS_pept        426333..431804
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_6005"
FT                   /product="alpha-2-macroglobulin domain protein"
FT                   /note="PFAM: alpha-2-macroglobulin domain protein; N/apple
FT                   PAN domain protein; alpha-2-macroglobulin domain protein 2;
FT                   KEGG: ret:RHE_PE00010 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_6005"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59175"
FT                   /db_xref="GOA:B6A442"
FT                   /db_xref="InterPro:IPR000177"
FT                   /db_xref="InterPro:IPR001599"
FT                   /db_xref="InterPro:IPR002890"
FT                   /db_xref="InterPro:IPR003609"
FT                   /db_xref="InterPro:IPR008930"
FT                   /db_xref="InterPro:IPR011625"
FT                   /db_xref="InterPro:IPR011626"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR021868"
FT                   /db_xref="InterPro:IPR026284"
FT                   /db_xref="InterPro:IPR041203"
FT                   /db_xref="InterPro:IPR041246"
FT                   /db_xref="InterPro:IPR041462"
FT                   /db_xref="UniProtKB/TrEMBL:B6A442"
FT                   /protein_id="ACI59175.1"
FT                   /translation="MSVRSFFASATIAFFSTIAISFPAAAADTKRDIQTIKDADFFGFD
FT                   LRTEQNVSLDQCKTSCIGDKSCKAFTYNPKVKWCFLKSDFKTMNAFPGAIAGKIVETSG
FT                   KQEPDLGAAPRLTFLTNDLIQQARDFKDNLELTDDQQGQGADSLTANARLDLTANNLAD
FT                   ALKSFHGALSITPDDADLWLETARAAASLGTAESGTSGQAVLDALNGYELTRTKPKRAE
FT                   ALAVLADALDRNANYRPALDAYKASLALVASDNVQTAYLQLKSTQGFRITEHTVDADSA
FT                   TPRACVTFSEALIKTTDYTPFVTLNGAAPKALETKDKQICVEGLTHGETYKIAFRTGLP
FT                   SSVDEVLEAPVSIDVYIKDRSQMVRFTGDSFVLPSTARRGIPLVSVNLASANLKLYRIG
FT                   DRAIAPLLTNSQFLSQLDGYSAQNIEDQNGELVWQGSIDIANELNKDIVTSFPVDEALP
FT                   ERKPGIYVMTATGPNGPTQEWDSQATQWFLVSDIGISTYAGTDGLNVFTRSLASAKPIS
FT                   GVELQLLAKNNEVLGTATTDENGRATFTAGLIRGTAALTPAVITAKNGTSDYVFLDMTR
FT                   AGFDLSDRGVTGRAAPGAIDVLTFTERGIYRAGETVHAQALARDTDGNAIENLPLTFIF
FT                   SRPDGVEDRRIVSQTSNLGGYSIDFPTQENAMRGTWTMNIYTDPKGSAIASKSFLVDDF
FT                   VPDRTDMEITTEAKEIGPDTPAKINVSGKYLYGAPAAGLTLEGNVVVKPTRESAAYKGF
FT                   LFGLADEEASEDSRLPIDGLPELDENGEASTELTVGDLPATTQLLNATVYISMQEAGGR
FT                   AIERSLTLPVKNERASIGIKPEFSSDLPENSIANFTVIGVNAGGEKQEAKGLRWKFYSL
FT                   NREYQWYREGTAWKYEPVYTAEQIANGSVDATADRGKISVPVKWGRYRLEVESPDADGP
FT                   TSSVEFDAGWFVASTSTETPDGLEIALDKDSYKVGDTAKLKVTSRYGGELMVMAGTEKL
FT                   VAVQNATMGETGGEVDIPVTADWGAGAYVTATLFRPGDAQDSHMPMRSIGIKWLKVDPE
FT                   QRALQVKLDTPEKMLPRGPLNIGLQVAGAGANEDAYVTVAAVDVGILNLTRYEPPNPED
FT                   WYFGQRQLGLEIRDLYGRLIDGSLGATGKLRTGGDGGAIALQASPPTQKLVAFFSGPVK
FT                   LDAEGKANVSFDIPQFNGTARVMAVAWSKTGVGHGVKDVIIRDPVVVTASLPKFLAPGD
FT                   KANLRLDIANTDAPAGDYKLQLTGNDAVGIDQASAAQTIRLEAGAKSELTLSLIGKQPG
FT                   AGSVSINLSDASGLSLDQTVDMPVRPSSLPITERRVLALKPGAKLTVDKNLLADSVLPG
FT                   ASISVNVTRSAAFDIPALLMTLDRYPLGCAEQTTSRALPLLYLAEVAKQAGIENDDDVH
FT                   KRVQDAIYRVLSYQASAGSFGLWGPDSGDVWLDSYVTDFLTRAREMKYDVPEKAFVQAL
FT                   ENLQNTLSYTTDIKGQGDQIAYAIYVLARNKKAAISDLRYYADTMINDFPTPLAKAHIA
FT                   AALALYGDAQRSKNIFVDALQMSQQSMVSRVNLSRTDYGTILRDGAAILALAAESRPVP
FT                   PVIPDLAKAVAKEWGRSKYKSTQEETWMLLAARAIQGGDDGLKVDVNGAAHTGAYMARM
FT                   SGDALADHPLTLTNQTSDAVSAVVTTVAAPTVPLPADGDGFIVERSYYTLDGEEANVSE
FT                   AKQNERYVVVIHVRETNDWPSRIVVTDLLPAGFEIDNPNLVDSAQMTNFDWIGEIAAAH
FT                   TEFRYDRFVAAFNRAQGDEREFNVAYVVRAVTPGTYDHPAASVEDMYRPELSARTATGK
FT                   MEVVAAQQ"
FT   sig_peptide     426333..426413
FT                   /locus_tag="Rleg2_6005"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.995 at
FT                   residue 27"
FT   gene            431801..433882
FT                   /locus_tag="Rleg2_6006"
FT   CDS_pept        431801..433882
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_6006"
FT                   /product="penicillin-binding protein 1C"
FT                   /note="TIGRFAM: penicillin-binding protein 1C; PFAM:
FT                   glycosyl transferase family 51; penicillin-binding protein
FT                   transpeptidase; Penicillin-binding domain protein; KEGG:
FT                   ret:RHE_PE00009 probable penicillin-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_6006"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59176"
FT                   /db_xref="GOA:B6A443"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR009647"
FT                   /db_xref="InterPro:IPR011815"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/TrEMBL:B6A443"
FT                   /protein_id="ACI59176.1"
FT                   /translation="MRLWRKIAIGSAAGILLAGAALFALDAADKAFPPPLDKADLVSAE
FT                   VLDADGQLLRAFATSEGRWRLKTTVADVDPQFLRMLIAYEDQRFYDHGGVDAWALGRAS
FT                   LQFIRNGRIVSGASTLSMQVARLIEPRAGRSLSAKLLQLARAVQIERRLSKEQILDLYL
FT                   THAPYGGNLEGVRAASLAYFGKEPRRLTVAEAALLVALPQLPERRRPDRNLQAAQEARK
FT                   RVLERVAVAEAVGDGEAARAEVVAIPPRRMQLPALAAHVGEAALRKEPSVLKHQTTLKK
FT                   QVQQGLEAVARAAAMKLGPKLSLAMVMADAQTGAIVGEVGSADYFDASRSGWIDMTRVN
FT                   RSPGSTLKPFIYGLAFEQGLVSQETIIEDRPADFFGYRPRNFDMSYQGDVTVREALQLS
FT                   LNVPAVKLLDAVGPSRLLVRFRRAEVRPALPPNETPGLAIGLGGVGLTLKDLVQLYTAL
FT                   ANRGQPARLGDGITGTPDKLDGEPLLEPVAVWNIADILSGIIPPAGAPQRGIAYKTGTS
FT                   YGYRDAWSVGYDGRYVLGVWVGRPDNSAVPGLTGYGTAAPILFEGFAKSGIATTPLPRP
FT                   PAGAVRIAQSELPISQRRFALNASGLLVASGREPAPQIVYPPEGAHVDLGAGAGDLSPL
FT                   MLKLQGGRAPFRWLANGKPLPDLSRRRTQQWLPDGGGYSKLTVIDSAGRAASVGVFID"
FT   sig_peptide     431801..431875
FT                   /locus_tag="Rleg2_6006"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.623 at
FT                   residue 25"
FT   gene            433986..436595
FT                   /locus_tag="Rleg2_6007"
FT   CDS_pept        433986..436595
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_6007"
FT                   /product="malto-oligosyltrehalose synthase"
FT                   /note="KEGG: ret:RHE_PE00008 putative maltooligosyl
FT                   trehalose synthase protein; TIGRFAM:
FT                   malto-oligosyltrehalose synthase; PFAM: alpha amylase
FT                   catalytic region; SMART: alpha amylase catalytic sub
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_6007"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59177"
FT                   /db_xref="GOA:B6A444"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR012767"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:B6A444"
FT                   /protein_id="ACI59177.1"
FT                   /translation="MTLPTATYRIQFRNGMTFDRACGLIPYLKTLGISHLYASPIFTAV
FT                   NGSTHGYDVTDANDIDPALGGRAGFERLTESLAAAGMGLILDIVPNHMAASPENGWWRD
FT                   VLAFGRQSPYAGHFDIDWSEPLTLPQLGQDFEAALAAGELRIVLDETHGNFAFAYFETL
FT                   LPLNPSSYGAIANQLDDPVATGMAEAAAVISGEDFARTMRDILFEGGDRAVLRQKLEDI
FT                   SADRDFVKSLHEAQHWRLTHWKEAARHLSYRRFFEVTGLVGTRVENPSVFEDMHRLTIE
FT                   LVHHGKVQGLRIDHVDGLAEPKAYLDRLRDAVGPDTYIVVEKILGAGEALPESWPVSGT
FT                   TGYEFIAALSELFVDGGGLRRLDDAYRGLAGETGDLEEGRRLAKRLMVERNFAGETGRL
FT                   AAIAAGIFPEINRDEIATALTELLITFPVYRTYGDGGPLAWQDSAVLAATASQAMGRLD
FT                   DRRALDHVLRLLEGKVDGDAAHEFRIRFQQLSGPVMAKATEDTLFYRYNRLLAANEVGG
FT                   EPGKAPDGPEGFHRRMAERARLQPDGLSASATHDTKRGEDARARLYALSEGADVFAQAV
FT                   ARWREMNRPWLTELPDGAAPEPNVEWMLYQALAGIWPEDFDRGRTEELHERFTDYAVKA
FT                   VREAKLHTGWIEQDAAYEDAVRAYAAALVSPENDAFLEDFERVLQPFIAAGYLNSLSQT
FT                   LLKLTAPGIPDIYQGSEGFDFSLVDPDNRRPADHERLTAWLAEAGPIAKLQAAALKQRI
FT                   VAIGLQLRQRQSALFARGDYLPLKVTGSRREHVLAFARVHKDNFAIVAAPRLMFGWLDP
FT                   GVLFAGPEFWEDTAIAVPSPLHGLKADLVTGKTIEPGGSIAVAALLGSQPVGLISPI"
FT   gene            436717..439242
FT                   /locus_tag="Rleg2_6008"
FT   CDS_pept        436717..439242
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_6008"
FT                   /product="heavy metal translocating P-type ATPase"
FT                   /note="KEGG: ret:RHE_PE00007 copper-transporting ATPase
FT                   protein; TIGRFAM: ATPase, P-type (transporting), HAD
FT                   superfamily, subfamily IC; copper-translocating P-type
FT                   ATPase; heavy metal translocating P-type ATPase; PFAM:
FT                   Haloacid dehalogenase domain protein hydrolase; YHS domain
FT                   protein; E1-E2 ATPase-associated domain protein; SMART:
FT                   TRASH domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_6008"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59178"
FT                   /db_xref="GOA:B6A445"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR007029"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR011017"
FT                   /db_xref="InterPro:IPR012348"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:B6A445"
FT                   /protein_id="ACI59178.1"
FT                   /translation="MNTKHEHDHHHGHVHSADHGCCGHGREKAAGVITRDPVCGMTVDP
FT                   EAGKPSLDHDGRLYHFCSEGCRTKFAAAPQDYLTAKDPVCGMSVDRSTAKHFLKVEGEK
FT                   FYFCSAGCQTKFEADPSAYRDGNRPAAKPAPKGTLYTCPMHPEVVSDRPGDCPKCGMAL
FT                   EPMGIPPDDEGPNPELVDFTRRLWVSAILALPLLALGMGPMLGLPLREMIGEPQATYLE
FT                   LLLATPVVLWAALPFFRRAWASVVNRSPNMWTLIGLGVGTAYVYSLVATLAPGIFPMSF
FT                   RGHGAVVPVYFEAAAVIVALVFVGQVLELKARERTGSAIRALLDLAPKTARRIDADGGE
FT                   SDVPVDQIEAGDRLRVRPGERVPVDGSVLEGQSTVDESMITGEPLPVEKSKGDGLTGGT
FT                   INKNGSLVMSAEKVGADTVLSRIVDMVAKAQRSRAPIQGAVDRVSAFFVPAVVAAAILA
FT                   FIVWAAVGPEPSLANALLAAVAVLIIACPCALGLATPMSIMIATGRGAGEGVLIKDAEA
FT                   LERFSKVDTLIVDKTGTLTEGKPKLTDIVVFGGADENRLLSLAASLERGSEHPLAEAIV
FT                   SGAEERGAALVEVSGFEAKTGKGVQGLAGDTMVALGNAAMLADLGIDPSALAEKTEALR
FT                   GDGKTVMFVVVDSALAGLVAVADRIKPTTEAAIKALHDSGLKIIMATGDNDRTARAVAK
FT                   SLGIDEVRADMLPEGKSALIDELRAKGAVIAMAGDGVNDAPALAAADVGIAMGTGADVA
FT                   MESAGITLVKGDLTGIVRARRLAEATMRNIRQNLGFAFGYNALGVPVAAGVLYPIFGLL
FT                   LSPMIAAAAMSLSSVSVISNALRLRFAKL"
FT   gene            439252..439641
FT                   /locus_tag="Rleg2_6009"
FT   CDS_pept        439252..439641
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_6009"
FT                   /product="transcriptional regulator, MerR family"
FT                   /note="TIGRFAM: Cu(I)-responsive transcriptional regulator;
FT                   PFAM: regulatory protein MerR; Transcription regulator MerR
FT                   DNA binding; KEGG: ret:RHE_PE00006 copper eflux
FT                   transcriptional regulator protein, MerR family"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_6009"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59179"
FT                   /db_xref="GOA:B6A446"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR011789"
FT                   /db_xref="InterPro:IPR015358"
FT                   /db_xref="UniProtKB/TrEMBL:B6A446"
FT                   /protein_id="ACI59179.1"
FT                   /translation="MNIGEASERSGLPSKTIRYYEDIGLIRPERGGNGYRDYAATDVHK
FT                   LRFLQRSRGLGFSVEECRQLLALYEDKSRASADVKDIAETKLAEIDRKIRELSELRRTL
FT                   EHLVHACHGNDRPDCPILEGLSDGG"
FT   gene            complement(439670..439975)
FT                   /locus_tag="Rleg2_6010"
FT   CDS_pept        complement(439670..439975)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_6010"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_6010"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59180"
FT                   /db_xref="UniProtKB/TrEMBL:B6A447"
FT                   /protein_id="ACI59180.1"
FT                   /translation="MKDKKRVYEALVDGATEGLTDQALYDFVKARCPKATSKKIVRASL
FT                   LALTDPHLRDRNILDVIYALAIKHRLDDGVLDDGEDEPDERPPSALAANQNMPQLS"
FT   gene            440130..440669
FT                   /locus_tag="Rleg2_6011"
FT   CDS_pept        440130..440669
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_6011"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /note="TIGRFAM: RNA polymerase sigma factor, sigma-70
FT                   family; PFAM: sigma-70 region 2 domain protein; sigma-70
FT                   region 4 domain protein; Sigma-70 region 4 type 2; KEGG:
FT                   rec:RHECIAT_PA0000004 putative ECF sigma factor protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_6011"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59181"
FT                   /db_xref="GOA:B6A448"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:B6A448"
FT                   /protein_id="ACI59181.1"
FT                   /translation="MERKERPFDVIGQLAALRRYSRSLVRNSDEAEDLVHDALVRALEK
FT                   KKSFRSGGNLRTWLLSILHNAHIDRLRQNRSLTRRHDEAAVEAEQSLPAGQEHAVRLQQ
FT                   VRDAFFDLPEEQREALHLVAIEDLSYQEAANALGIPIGTLMSRISRARAQLRAFEEKTP
FT                   RKSHLRLIGGDGNESN"
FT   gene            440656..441423
FT                   /locus_tag="Rleg2_6012"
FT   CDS_pept        440656..441423
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_6012"
FT                   /product="putative transmembrane anti-sigma factor"
FT                   /note="KEGG: rec:RHECIAT_PA0000003 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_6012"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59182"
FT                   /db_xref="GOA:B6A449"
FT                   /db_xref="UniProtKB/TrEMBL:B6A449"
FT                   /protein_id="ACI59182.1"
FT                   /translation="MKAIDPILDADLDAYVDGELDVARRIQVESYLSDHPAIAAKVMAD
FT                   LSVKGELRLALAGESAFGRPETRDAARRLERGLSYGRIFHSMQRIAAVGILVTGGWVAH
FT                   NSFGAFSATEVSASVPAPAYVEDAVRAYQTAALRQSMPPQTPATYSADDIRAATAIVMP
FT                   DLPKDWKVADVQIFPSEFGPSVEMAIEQSDGKRLSLFAVRPGAFEVKPVSHLALEKAEA
FT                   AYWQIGEVAYALIADESGLNLDQAAERLARSLY"
FT   gene            441444..442154
FT                   /locus_tag="Rleg2_6013"
FT   CDS_pept        441444..442154
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_6013"
FT                   /product="protein of unknown function UPF0005"
FT                   /note="PFAM: protein of unknown function UPF0005; KEGG:
FT                   rec:RHECIAT_PA0000002 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_6013"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59183"
FT                   /db_xref="GOA:B6A450"
FT                   /db_xref="InterPro:IPR006214"
FT                   /db_xref="UniProtKB/TrEMBL:B6A450"
FT                   /protein_id="ACI59183.1"
FT                   /translation="MNPINSRYGAVAGTQAAFDEGLRQHMLRVYNYMALGLVITGLVAF
FT                   VVGSTPALYVPIFGSPLKWVVMLAPLAFVFFFSFRIQTMSASTAQITFWAFCAVMGLSL
FT                   ASVFLVFTGMSIARTFFITATMFGATSLYGYVTKRDLSRMGSFLMMGLIGVIIASIVNI
FT                   FLGSSALQFAISVIGIVVFVGLTAYDTQNIKEQYSENFDQESNQKLAVFGALSLYLNFV
FT                   NIFQLLLNFTGERE"
FT   gene            complement(442277..443410)
FT                   /locus_tag="Rleg2_6014"
FT   CDS_pept        complement(442277..443410)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_6014"
FT                   /product="protein of unknown function DUF1612"
FT                   /note="PFAM: protein of unknown function DUF1612; KEGG:
FT                   rec:RHECIAT_PA0000001 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_6014"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59184"
FT                   /db_xref="InterPro:IPR011670"
FT                   /db_xref="InterPro:IPR021068"
FT                   /db_xref="UniProtKB/TrEMBL:B6A451"
FT                   /protein_id="ACI59184.1"
FT                   /translation="MRYEIDAAMLQALLPSFAAAEDALARLDERVVRSPVGEGFAERSH
FT                   FFDAAGALWVAGELVHVEDLVLHDAHMDSRAPSHELTIAHSVLRARRRIWTGEPAWALG
FT                   ASGLATLTATLGEGEGTASEVKSPAVPAETDEEGGDEDGPLAAEMAEIDALLARSQKLL
FT                   DIHTGKLPASETAAVAPARRNDDPLGLLGDDEWDEEQRLAEWRGLLPLADSLPPVLGAI
FT                   ILFEAWERIEPLRRQHWLGGLLVAGHLRARGKVASHLFSFYGGLKLVRHERRRARDRAT
FT                   RLQAFLEAMHLGAAAGLKELDRLSLARTQMELRFRGRRSNSSLPDLADFILSRPMVSAA
FT                   MIARHLRITPRGALNLVNEIGIREITGRGRYRAWGII"
FT   sig_peptide     complement(443348..443410)
FT                   /locus_tag="Rleg2_6014"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.896) with cleavage site probability 0.861 at
FT                   residue 21"
FT   gene            complement(443591..444805)
FT                   /locus_tag="Rleg2_6015"
FT   CDS_pept        complement(443591..444805)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_6015"
FT                   /product="replication protein C"
FT                   /note="PFAM: replication protein C; KEGG:
FT                   rec:RHECIAT_PA0000383 plasmid replication protein RepCa"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_6015"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59185"
FT                   /db_xref="InterPro:IPR005090"
FT                   /db_xref="InterPro:IPR021760"
FT                   /db_xref="UniProtKB/TrEMBL:B6A452"
FT                   /protein_id="ACI59185.1"
FT                   /translation="MEPQYVSTPFGRRSMTLGMLASQESASKVESDASVDKWKIFRALC
FT                   EAKDMVGVSDRALAVLNALLTFYPKNEIAEANGFVVFPSNEQLSLRTHGMAGTTLRRNL
FT                   AMLVEAGLIIRRDSPNGKRFARRNGEGGLGEAYGFSLAPLLARAGEIEAQAAQVLAGKL
FT                   EWKRLRERLTLCRRDITKLIEIALEEEIAGEWIEMQRHFNLLSASLPRRPSAAEMESLL
FT                   ADLEAFRQLIVKTLELKTKTEKTGANDSQNGRHIHNSNPHPLSELEPSFEPKQGAKPEE
FT                   EPRPWREPPKSFPLAMVLQACPEIVAYGPGGGIGSWRDLMAAAVIVRSTLGVSPSAYQL
FT                   ACDVMGPENAATVIACILERGGHINSAGGYLRDLTRRAERGEFSLGPMLMALMRANGPA
FT                   ARKTG"
FT   gene            complement(444960..445955)
FT                   /locus_tag="Rleg2_6016"
FT   CDS_pept        complement(444960..445955)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_6016"
FT                   /product="plasmid partitioning protein RepB"
FT                   /note="TIGRFAM: parB-like partition protein; plasmid
FT                   partitioning protein RepB; PFAM: ParB domain protein
FT                   nuclease; RepB plasmid partition; KEGG:
FT                   rec:RHECIAT_PA0000382 plasmid partitioning protein RepBa"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_6016"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59186"
FT                   /db_xref="GOA:B6A453"
FT                   /db_xref="InterPro:IPR003115"
FT                   /db_xref="InterPro:IPR004437"
FT                   /db_xref="InterPro:IPR011111"
FT                   /db_xref="InterPro:IPR017819"
FT                   /db_xref="InterPro:IPR036086"
FT                   /db_xref="InterPro:IPR037972"
FT                   /db_xref="UniProtKB/TrEMBL:B6A453"
FT                   /protein_id="ACI59186.1"
FT                   /translation="MSRRDRLKGLFDDTAQELAAANYEEPSSRGSAGPVRTMALTLGRM
FT                   EEESRAMHEALLSGERIVELDPDLIDSSFVRDRLADQPLDIDDELVQSIAENGQEVPVL
FT                   VRRHPDDESRYQIAYGHRRLQAIKLLGRKVQAIVRSLDDTDVVIAQGIENSARRNLSYI
FT                   ERAVFALNLELKGFERPVIMKALSTDKTELSKLLSVARAVPAEIVRSVGAAPGIGRRRW
FT                   MALAQDWNGTTAVRLAKLIGSEKFMAEESDRRFELLVAELAKKEAKPEATEYDWKPKSG
FT                   GKIAGRIKSAGNSFTIALKTGDAPDFGAYISRRLDELYEAYRAGRLQAGE"
FT   gene            complement(445952..447148)
FT                   /locus_tag="Rleg2_6017"
FT   CDS_pept        complement(445952..447148)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_6017"
FT                   /product="plasmid partitioning protein RepA"
FT                   /note="TIGRFAM: plasmid partitioning protein RepA; PFAM:
FT                   regulatory protein MerR; Cobyrinic acid ac-diamide
FT                   synthase; KEGG: rec:RHECIAT_PA0000381 plasmid partitioning
FT                   protein RepAa"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_6017"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59187"
FT                   /db_xref="InterPro:IPR017818"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B6A454"
FT                   /protein_id="ACI59187.1"
FT                   /translation="MDNISVSTTDVRIERHANQLSRQLKLLRDKLFPPLSQKTLRTFSS
FT                   GEAAQMIGVSDGYLRQLSLDGKGPQPELSQNGRRSYTLGQINELRHYMAKLKPKDALNY
FT                   LPWRRPGEKLQTVAVTNFKGGSAKTTTTLYLAQYLALAGYRVLAIDLDPQASLSSMLGV
FT                   QPEFDLSDGDTLYGAIRYDAGRKPLKDIVRKTYFDGLDLVPGNLELMEFEHETPRALND
FT                   RQKPAELFFRRVGVAIAEVEAEYDVVVIDCPPQLGYLTLGAVCAATSLLITIHPQMVDV
FT                   ASMSQFLLMTSDLLSVVRKAGGDLQHDFIKYVVTRHEPFDAPQSQIVALLRSLFGDDVL
FT                   TATILKSTAIADAGLTKQTLFEIEKGQVRRSTYDRALESVNAANGEVLAGIHKAWGRT"
FT   gene            447350..448114
FT                   /locus_tag="Rleg2_6018"
FT   CDS_pept        447350..448114
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_6018"
FT                   /product="precorrin-6A synthase (deacetylating)"
FT                   /EC_number="2.1.1.152"
FT                   /note="KEGG: rec:RHECIAT_PA0000379 precorrin-6a synthase
FT                   protein; TIGRFAM: precorrin-6A synthase (deacetylating);
FT                   PFAM: Uroporphyrin-III C/tetrapyrrole (Corrin/Porphyrin)
FT                   methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_6018"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59188"
FT                   /db_xref="GOA:B6A455"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR012797"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:B6A455"
FT                   /protein_id="ACI59188.1"
FT                   /translation="MKHIHIIGIGAGNPEHVTIQAINAMNSADVIFLPLKGAAKEELAE
FT                   VRRDICERYVTRPGIRISEFEVPQRQTKDRSYTQSVDSWHAEIALIYKELISGLPDDGR
FT                   GAFLVWGDPSLYDSTIRIIERVRQDTSLEFDYSVVPGITSIQALAASHRIPVNLVGKPV
FT                   EITTGRRLARDGLQASATVVMLDGEQAFAKINDSDAEIFWGAYLGTKDEITRSGRLGGI
FT                   AAEILTLRAEARQRHGWIMDIYLLRKGRDFEE"
FT   gene            448187..449545
FT                   /locus_tag="Rleg2_6019"
FT   CDS_pept        448187..449545
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_6019"
FT                   /product="precorrin-3B synthase"
FT                   /note="TIGRFAM: precorrin-3B synthase; PFAM:
FT                   nitrite/sulfite reductase hemoprotein beta-component
FT                   ferrodoxin domain protein; KEGG: rec:RHECIAT_PA0000378
FT                   precorrin-3b synthase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_6019"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59189"
FT                   /db_xref="GOA:B6A456"
FT                   /db_xref="InterPro:IPR005117"
FT                   /db_xref="InterPro:IPR012798"
FT                   /db_xref="InterPro:IPR036136"
FT                   /db_xref="UniProtKB/TrEMBL:B6A456"
FT                   /protein_id="ACI59189.1"
FT                   /translation="MSIEAIRAIDRRAEAKTRARGACPALAAPMPTGDGMLVRLRPAGG
FT                   VLTLPQFAALARSAAAHGNGILEITARGNLQIRGLRAETVGRLAADIDAAEITVPDGPA
FT                   IEISPLHGIDPEEVSDPAAMELALRSMLQALLASPRLAPKLSIVIDGGGVFGLSALSAD
FT                   IRVVAQPDTGWLVAINGDGPTATPVAVGPVEAAISAVGEVLSLLAALGPGSRARDIDPA
FT                   LLQARFPAVNDLQSLPSRAAKMPLAGLHRLADGKTVLGVRPEFGQMRASDLTALLDLAT
FT                   TDGATAVRLAPERGFFFLGVPEDRVPAMQIAAARHGFSAQPGDNSEHIAACAGAGACGS
FT                   AFYETRTLARRILAVAPTLLDGSLTLHLSGCAKGCAHARSALTLTGSPEGYELILNGHA
FT                   ADRPDERIAGGRIDFAIERLARSIEDNRGAGESAAACLTRLGAIGVSKALRQE"
FT   gene            449548..450180
FT                   /locus_tag="Rleg2_6020"
FT   CDS_pept        449548..450180
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_6020"
FT                   /product="Precorrin-8X methylmutase"
FT                   /EC_number="5.4.1.2"
FT                   /note="PFAM: Precorrin-8X methylmutase CbiC/CobH; KEGG:
FT                   rec:RHECIAT_PA0000377 precorrin-2 c(20)-methyltransferase
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_6020"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59190"
FT                   /db_xref="GOA:B6A457"
FT                   /db_xref="InterPro:IPR003722"
FT                   /db_xref="InterPro:IPR036588"
FT                   /db_xref="UniProtKB/TrEMBL:B6A457"
FT                   /protein_id="ACI59190.1"
FT                   /translation="MPDYDYIRSGDAIYERSFAIIRAEADLSRFTEDQADIAVRMIHAC
FT                   GLVEAAEHFLFSADFVGAARAALKGGAPIFCDAEMVSQGVTRARLPALNEVICTLRDPA
FT                   TPELALKTGNTRSAAAMHLWLDRLGGSVVAIGNAPTALFHLLELLRDGAPKPAAILGMP
FT                   VGFVGAAESKDALAENSYGVPFAIVRGRLGGSAMTAAALNALARPGL"
FT   gene            450177..450908
FT                   /locus_tag="Rleg2_6021"
FT   CDS_pept        450177..450908
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_6021"
FT                   /product="precorrin-2 C20-methyltransferase"
FT                   /note="TIGRFAM: precorrin-2 C20-methyltransferase; PFAM:
FT                   Uroporphyrin-III C/tetrapyrrole (Corrin/Porphyrin)
FT                   methyltransferase; KEGG: rec:RHECIAT_PA0000376 precorrin-2
FT                   c(20)-methyltransferase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_6021"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59191"
FT                   /db_xref="GOA:B6A458"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR003043"
FT                   /db_xref="InterPro:IPR006364"
FT                   /db_xref="InterPro:IPR012382"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:B6A458"
FT                   /protein_id="ACI59191.1"
FT                   /translation="MTTSGRLIGVGTGPGDPELLTLKAVRAIEGADVIAYFAKQGRGGN
FT                   GKAIVEPLLKSGVTLLPLYYPVTTEIDKNDERYQSLITEFYDRSAETIAGHLDAGLTVA
FT                   VLSEGDPLFYGSYMHLHVRLSQRYPTEVIPGISAMSGCWSLAGMPIVQGDDVLSVLPGT
FT                   MAETELTRRLADTQAAVIMKVGRNLPKIRRALEAAGRLAEAVYVERGTMANSAMEKLAD
FT                   RADGEAPYFSLVLVPGWEGSR"
FT   gene            450905..451669
FT                   /locus_tag="Rleg2_6022"
FT   CDS_pept        450905..451669
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_6022"
FT                   /product="precorrin-3B C17-methyltransferase"
FT                   /note="TIGRFAM: precorrin-3B C17-methyltransferase; PFAM:
FT                   Uroporphyrin-III C/tetrapyrrole (Corrin/Porphyrin)
FT                   methyltransferase; KEGG: rec:RHECIAT_PA0000375 precorrin-3B
FT                   C17-methyltransferase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_6022"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59192"
FT                   /db_xref="GOA:B6A459"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR006363"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:B6A459"
FT                   /protein_id="ACI59192.1"
FT                   /translation="MSGALFVIGTGPGNPEQMTPEALAAVEAATDFFGYGPYLDRLQLR
FT                   DDQLRHASDNREELDRAGAALSMAADGAKVCVVSGGDPGVFAMAAAVCEAIENGPAAWR
FT                   AVDLTILPGITAMLAVAARAGAPLGHDFCAISLSDNLKPWNIIENRLELAAKAGFVIAL
FT                   YNPISRARPWQLGEAFKLLREHLPATTPVIFGRAAGRPDERIAVEQLSQADASMADMAT
FT                   CVIIGSAETRIVARPGRLDLVYTPRFMAGGTR"
FT   gene            complement(451633..452403)
FT                   /locus_tag="Rleg2_6023"
FT   CDS_pept        complement(451633..452403)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_6023"
FT                   /product="Precorrin-6A reductase"
FT                   /EC_number="1.3.1.54"
FT                   /note="PFAM: Precorrin-6x reductase CbiJ/CobK; KEGG:
FT                   rec:RHECIAT_PA0000374 precorrin 6x reductase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_6023"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59193"
FT                   /db_xref="GOA:B6A460"
FT                   /db_xref="InterPro:IPR003723"
FT                   /db_xref="UniProtKB/TrEMBL:B6A460"
FT                   /protein_id="ACI59193.1"
FT                   /translation="MGRPRILILGGTGEARLLAEALAARGDCDVLLSLAGRTEKPAAQP
FT                   VPARIGGFGGAVALADFLKVGGYDLLIDATHPFAERISANAAFAAEASGIAAIALCRPE
FT                   WQRLPGDRWHDVQSIPAAIEALGPSPRRVFLATGRQGAHFAEAAPQHFYLIRSVDPVAP
FT                   LLALANVDYVIDRGPFTLEGECALLKQHDIDAIIAKNSGGAATYAKIEAARLLGIEVMM
FT                   VARATASTVKTVETVEAALAAVDHLVPPAMKRGV"
FT   gene            452402..453634
FT                   /locus_tag="Rleg2_6024"
FT   CDS_pept        452402..453634
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_6024"
FT                   /product="precorrin-6y C5,15-methyltransferase
FT                   (decarboxylating), CbiE subunit"
FT                   /EC_number="2.1.1.132"
FT                   /note="KEGG: rec:RHECIAT_PA0000373 precorrin-6Y
FT                   C5,15-methyltransferase (decarboxylating) protein; TIGRFAM:
FT                   precorrin-6y C5,15-methyltransferase (decarboxylating),
FT                   CbiE subunit; precorrin-6Y C5,15-methyltransferase
FT                   (decarboxylating), CbiT subunit; PFAM: Uroporphyrin-III
FT                   C/tetrapyrrole (Corrin/Porphyrin) methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_6024"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59194"
FT                   /db_xref="GOA:B6A461"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR006365"
FT                   /db_xref="InterPro:IPR012818"
FT                   /db_xref="InterPro:IPR014008"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:B6A461"
FT                   /protein_id="ACI59194.1"
FT                   /translation="MSDVSPASGPRWLTIIGIGEDGPEGLGEEAKRLIATAPAVFGGAR
FT                   HHALAAPLISGERLSWQSPFEHSIDAVLQRRGTPVVVLASGDPFLYGVGATLSRHVAAE
FT                   EMRTIPAPSAFSLAASRLGWPLQDVTTISLHGRPVDLIRPHLHPVRRILALTSDEKGPG
FT                   ELATLLAATGFGQSQLTVLEALGGVRERQRNVVAADFDLADIDPLNVCAVEIAAGEGAR
FT                   ILPFAAGLEDELFEHDGQITKREIRAMTLSALAPCHGQLLWDIGAGSGSIGIEWMLADP
FT                   SLKTIAIEQSPERAARVARNASAFGVPHLAVIEGTAPGALTGLPEPDAIFLGGGGSEPG
FT                   VIDAAIAALKRGGRLVANAVTLEMEAMLLSEQAKHGGSLTRIEISRAGPVGSMSGWRPA
FT                   MPVTQWRWTKG"
FT   gene            453639..454397
FT                   /locus_tag="Rleg2_6025"
FT   CDS_pept        453639..454397
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_6025"
FT                   /product="precorrin-4 C11-methyltransferase"
FT                   /EC_number="2.1.1.133"
FT                   /note="KEGG: rec:RHECIAT_PA0000372 precorrin-4
FT                   c(11)-methyltransferase protein; TIGRFAM: precorrin-4
FT                   C11-methyltransferase; PFAM: Uroporphyrin-III
FT                   C/tetrapyrrole (Corrin/Porphyrin) methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_6025"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59195"
FT                   /db_xref="GOA:B6A462"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR003043"
FT                   /db_xref="InterPro:IPR006362"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:B6A462"
FT                   /protein_id="ACI59195.1"
FT                   /translation="MTVHFIGAGPGAADLITVRGRDLIGQCPVCLYAGSIVSPELLQYC
FT                   PADARIVDTAPMSLDEIEAEYLSAAAAGQDVARLHSGDLSVWSAVAEQVRRLEKHGIAY
FT                   TMTPGVPAFAAAASALGRELTIPAVAQSLVLTRVSGRASPMPNDETLARFGATGATLAI
FT                   HLAIHALKQVVEELTPLYGGDCPVAIVVKASWPDERVLRGTLSDIEAKVAAEPIERTAI
FT                   IFVGPSLAAEDFRESSLYDPAYQRRFRGRE"
FT   gene            complement(454445..455257)
FT                   /locus_tag="Rleg2_6026"
FT   CDS_pept        complement(454445..455257)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_6026"
FT                   /product="Xylose isomerase domain protein TIM barrel"
FT                   /note="PFAM: Xylose isomerase domain protein TIM barrel;
FT                   KEGG: ret:RHE_PE00448 putative sugar epimerase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_6026"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59196"
FT                   /db_xref="GOA:B6A463"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR014621"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:B6A463"
FT                   /protein_id="ACI59196.1"
FT                   /translation="MTSIRFALNHMAAPSLAIDDFFALAKSLGIDSVEIRNDLSGNAIL
FT                   DGTKPEAIREAAARHGLTIISINALQRFNEWNETRAGEAQALIDYASACGAKALVLVPK
FT                   NDGTGCADGERQANLRQSLTALQPMLEKAGIIGLVEPLGFEICSLRSKTEAAEAIKELG
FT                   AQSTFKLVHDTFHHHLAGEVATFAELSGLVHISGVSDASVSVADMRDSHRVLVDGDDRL
FT                   DNAGQIKALLQAGYNGPFSFEPFAAEVHAVKDPAAALRASMDYLTARV"
FT   gene            complement(455421..456449)
FT                   /locus_tag="Rleg2_6027"
FT   CDS_pept        complement(455421..456449)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_6027"
FT                   /product="transcriptional regulator, LacI family"
FT                   /note="PFAM: regulatory protein LacI; KEGG: ret:RHE_PE00447
FT                   probable transcriptional regulator protein, LacI family"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_6027"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59197"
FT                   /db_xref="GOA:B6A464"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:B6A464"
FT                   /protein_id="ACI59197.1"
FT                   /translation="MRRPTISDLARASGVSVATVDRVLNARHRVREETARRVYDAAQQI
FT                   GYHAVGLIRQRVFEDLPQYKLAFLLQKPTQSFYQSFVREIETAARAVTTARIQTQIDFP
FT                   SAATPAAIVEKIRTLAARNQAVALVGPDYPAVTTAVEELKERGIPVFSLLSDLATGVRD
FT                   AYVGVNNRKVGRTAAWTIARTARKPGKVACFVGSHRFHGHELREIGFRSYFRENAPEFD
FT                   VLDTLINLETAEITHEATLTLLQKHPDLVGLYVCGGGMEGAISAFREENVDGRIVLVVN
FT                   ELTPESKAGLADEIVTMVVATPLPALCKELLSLMVGAIEHGEAAVPGQSFLPFDIYISE
FT                   NI"
FT   gene            456581..457669
FT                   /locus_tag="Rleg2_6028"
FT   CDS_pept        456581..457669
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_6028"
FT                   /product="fatty acid desaturase"
FT                   /note="PFAM: fatty acid desaturase; KEGG:
FT                   rec:RHECIAT_PA0000369 hydrocarbon oxigenase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_6028"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59198"
FT                   /db_xref="GOA:B6A465"
FT                   /db_xref="InterPro:IPR005804"
FT                   /db_xref="InterPro:IPR039393"
FT                   /db_xref="UniProtKB/TrEMBL:B6A465"
FT                   /protein_id="ACI59198.1"
FT                   /translation="MAIEAQKRDYDLLGESGRTAVETGLAAAEWYHTDIPRKEMKALMQ
FT                   RSDAPGIRDTVIWLGSMLVLAGLGIYFWGSWIAVPFFLAYGVLYGSASDSRWHECGHGT
FT                   AFKTRWMNDAVYQIACFMIMRNPVTWRWSHARHHTDTVIVGRDPEIAVMRPPDLFRLVL
FT                   NFFGILDVWHAIVDMLRNAAGFIGAAEKTFIPEMEQPKAIRIARIWLAIYLATIAAAVA
FT                   MGTILPLMLIGLPRLYGAWHHVLTGLLQHGGLADNVIDHRLNSRTVYMNPISRFIYWNM
FT                   NYHVEHHMFPMVPYHALPRLHAMIKHDLPAPNPSILSGYREMIPAFLRQLRNEDYFLKR
FT                   ELPATARPYREEFHNELAPAAQ"
FT   gene            457691..458005
FT                   /locus_tag="Rleg2_6029"
FT   CDS_pept        457691..458005
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_6029"
FT                   /product="Rieske (2Fe-2S) domain protein, MocE subfamily"
FT                   /note="TIGRFAM: Rieske [2Fe-2S] domain protein, MocE
FT                   subfamily; PFAM: Rieske [2Fe-2S] domain protein; KEGG:
FT                   ret:RHE_PE00445 ferredoxin of the Rieseke type protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_6029"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59199"
FT                   /db_xref="GOA:B6A466"
FT                   /db_xref="InterPro:IPR012747"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:B6A466"
FT                   /protein_id="ACI59199.1"
FT                   /translation="MSGNWIEVCGKDEIDEEDVIRFDHGGRTFAVYRSPDDEFFATDGL
FT                   CTHEHIHLADGLVMDEIIECPKHNGRFNYKTGEAKGAPVCVNLKTYPVKIEGGAVFISL
FT                   "
FT   gene            458017..459243
FT                   /locus_tag="Rleg2_6030"
FT   CDS_pept        458017..459243
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_6030"
FT                   /product="FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase"
FT                   /note="PFAM: FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; KEGG: rec:RHECIAT_PA0000367
FT                   ferredoxin--NAD(+) reductase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_6030"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59200"
FT                   /db_xref="GOA:B6A467"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR028202"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B6A467"
FT                   /protein_id="ACI59200.1"
FT                   /translation="MAHFVILGAGECGARAAFALREKGFDGEITLVGAEPVHPYERPPL
FT                   SKAGSADAGDPKFIAALEKYADSGIRLLTGLEARDLDIASRTITLSDGTTLSYDKLLLA
FT                   TGAAARSFPGAPEGSAHIRSLRTHHDAAALREVMKPGKHIAIIGGGFIGLELAATARLL
FT                   GAEVTVIEGLERVLKRGVPEEIAHLLTERHRAEGVDIRCSVSIEALTEESGKALIRLSG
FT                   GKVIEADLALVGIGARPNVEIAEKAGLTIENGIAVDVNLKTSAPDVFAAGDCCSFPLSI
FT                   YGGRRVRLESWRNAQEQGTLAAANMLGLDEAVSSVPWFWSDQYDMTLQIAGLAEGAVTH
FT                   QRRDLGAGAFILFHLDAEGRLIAASGIGPGNAVARDIRLAEMLIAARAHPDPAALAAND
FT                   VKLKSLLAA"
FT   gene            459286..460098
FT                   /locus_tag="Rleg2_6031"
FT   CDS_pept        459286..460098
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_6031"
FT                   /product="Ketopantoate hydroxymethyltransferase"
FT                   /note="PFAM: Ketopantoate hydroxymethyltransferase; KEGG:
FT                   rec:RHECIAT_PA0000366 probable ketopantoate
FT                   hydroxymethyltransferase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_6031"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59201"
FT                   /db_xref="GOA:B6A468"
FT                   /db_xref="InterPro:IPR003700"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:B6A468"
FT                   /protein_id="ACI59201.1"
FT                   /translation="MKKHKRATVADLLSEKGKRQLTMLRVTSLEEAEAAEKAGIDIVSV
FT                   PPSLLGPVFREIAPTPFAIPGLEYGDHVSADDYLRAAFAALKAGGDAVYCAASLQTIRR
FT                   MRDEGIPVCGHLGLIPSKATWTGGFRAVGKTAASAAEIWRQTKALEEAGAFAAEIEVVP
FT                   GDVAAAISSNTAMLMISMGAGSGCDAQYLFADDVLGANRNHYPRHAKVYRDFAAEHDRL
FT                   QRERIAAFTEFAEDVRTGAYPEKRHLVGIDEAELKTFLHRLAGEIGNS"
FT   gene            460188..461117
FT                   /locus_tag="Rleg2_6032"
FT   CDS_pept        460188..461117
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_6032"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rec:RHECIAT_PA0000365 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_6032"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59202"
FT                   /db_xref="GOA:B6A469"
FT                   /db_xref="InterPro:IPR011213"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B6A469"
FT                   /protein_id="ACI59202.1"
FT                   /translation="MTLSERSIRSPVTIGFAHAELIAVLVAVTGDEPRVMTIRSGNALP
FT                   SGPFEMGHRTLQSGLREWVQEQTEHPVGYLEQLYTFADRDRNNDIPGGRTISISYLGLV
FT                   NEQSGAGRPGWHGWYEYFPWEDHRHGRPAVLDEVMARLRGWADADPARRDHRHRRADFT
FT                   FGLDGGGWNEDLALQRYELLYEAGLVAEAGCAGEANLGRAMFADHRRILATGIARLRAK
FT                   IKYRPVVFELMPESFTLLRLQRTIEALAGLTLHKQNFRRLIEQQELVEETGGTESETGG
FT                   RPAKLFRFRHTVLEERALAGTKLPLSRN"
FT   gene            461187..462158
FT                   /locus_tag="Rleg2_6033"
FT   CDS_pept        461187..462158
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_6033"
FT                   /product="quinolinate synthetase complex, A subunit"
FT                   /EC_number="2.1.1.63"
FT                   /note="KEGG: rec:RHECIAT_PA0000364 quinolinate synthetase A
FT                   protein; TIGRFAM: quinolinate synthetase complex, A
FT                   subunit; PFAM: Quinolinate synthetase A"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_6033"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59203"
FT                   /db_xref="GOA:B6A470"
FT                   /db_xref="InterPro:IPR003473"
FT                   /db_xref="InterPro:IPR023066"
FT                   /db_xref="InterPro:IPR036094"
FT                   /db_xref="UniProtKB/TrEMBL:B6A470"
FT                   /protein_id="ACI59203.1"
FT                   /translation="MNHSVSASSLYERVSRVIPKAEWMTFENDVDAILELKRRRNAVIL
FT                   AHNYQTPEIFHGVADIVGDSLALARKAIEVDADVIVLAGVHFMAETAKLLNPEKTVLIP
FT                   DLAAGCSLADSITPEDIALLREAHPGVPIITYVNTSAAVKAASDICCTSGNAKQVVESL
FT                   GVPKVLMIPDEYLARNVARETDVEIIAWHGHCEVHELFTAEDVRQLRENHPGVTVLAHP
FT                   ECPPEVVAEADFAGSTAVMSDYVGRQKPARVVLLTECSMSDNVAVHHPEVEFIRPCNLC
FT                   PHMKRITLANIRAALEENRHEVTVDPAIAVAARRAVERMLAI"
FT   gene            462155..463714
FT                   /locus_tag="Rleg2_6034"
FT   CDS_pept        462155..463714
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_6034"
FT                   /product="L-aspartate oxidase"
FT                   /EC_number="1.4.3.16"
FT                   /note="KEGG: ret:RHE_PE00440 L-aspartate oxidase; TIGRFAM:
FT                   L-aspartate oxidase; PFAM: fumarate reductase/succinate
FT                   dehydrogenase flavoprotein domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_6034"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59204"
FT                   /db_xref="GOA:B6A471"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR005288"
FT                   /db_xref="InterPro:IPR015939"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR037099"
FT                   /db_xref="UniProtKB/TrEMBL:B6A471"
FT                   /protein_id="ACI59204.1"
FT                   /translation="MTEILHNLAGQTVIVGSGLAGLMTALTLAPEPCVIVTRAALGTET
FT                   SSAWAQGGIAAAMGADDSAALHLADTLVAGDGLCDPTVAAGIIAEASAAISALERAGVR
FT                   FDRNAAGELSFGLEAAHSRRRIVHAEGDGSGAAIVAALVRAVKQTPSISVLEGFEARRI
FT                   MMDGERVAGLLCATANGAAILPSSKVVLATGGIGGLYDATTNPMGNFGQGIALAARAGA
FT                   DLTDMEFVQFHPTALDSRRRPLALVSEAVRGEGALLVNERGERFMARTPGAELAPRDVV
FT                   ARAISAEIARGGRVFLDARDALGSRFSTRFPVISALCGEAGIDPAKDLIPVRPAVHYHM
FT                   GGVATDANGRSSVPGLWVVGEAGSTGLHGANRLASNSLLEAAVMGMRAARDLSSMPASR
FT                   PGTRFAERLPAPADASLVRPIVSRHLGVLRNAGAVEGAIAALLPLAEGDGPAADPAIVA
FT                   LLIAVFASLRTESRGAHARTDFPLKLGAADRRQIHLSQALDIARATSPYALAPLYTLAR
FT                   SA"
FT   gene            463716..464612
FT                   /locus_tag="Rleg2_6035"
FT   CDS_pept        463716..464612
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_6035"
FT                   /product="nicotinate-nucleotide pyrophosphorylase"
FT                   /EC_number="2.4.2.19"
FT                   /note="KEGG: rec:RHECIAT_PA0000362 nicotinate-nucleotide
FT                   pyrophosphorylase (carboxylating) protein; TIGRFAM:
FT                   nicotinate-nucleotide pyrophosphorylase; PFAM: Quinolinate
FT                   phosphoribosyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_6035"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59205"
FT                   /db_xref="GOA:B6A472"
FT                   /db_xref="InterPro:IPR002638"
FT                   /db_xref="InterPro:IPR004393"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022412"
FT                   /db_xref="InterPro:IPR027277"
FT                   /db_xref="InterPro:IPR036068"
FT                   /db_xref="InterPro:IPR037128"
FT                   /db_xref="UniProtKB/TrEMBL:B6A472"
FT                   /protein_id="ACI59205.1"
FT                   /translation="MSLVPLPRLIVEPLVRAALLEDLGLAGDITSASVIPHDHRSTVVM
FT                   AARQPGVIAGLDAAELAFALVDPEITMRRHLQDGDAVKPGDVIATIEGPSRGLLTAERT
FT                   ALNFLGHLSGIATVTAEIAAAIRATKASVACTRKTTPGLRALEKYAVRAGGGMNHRFAL
FT                   YDAVLIKDNHVAIAGGVAEAIRRARAGVGHLVKIEVEVDTLDQLREAMETGVDAVLLDN
FT                   MTPDQLRQAVAIVAGRAITEASGRVTPATAGAIAASGVDLISIGWLTHSAPVLDIGLDF
FT                   IEAAATETSPKRVAQVL"
FT   gene            464859..466811
FT                   /locus_tag="Rleg2_6036"
FT   CDS_pept        464859..466811
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_6036"
FT                   /product="transcriptional regulator, SARP family"
FT                   /note="PFAM: TPR repeat-containing protein; transcriptional
FT                   activator domain; Tetratricopeptide TPR_2 repeat protein;
FT                   KEGG: rec:RHECIAT_PA0000361 putative trifolitoxin related
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_6036"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59206"
FT                   /db_xref="InterPro:IPR005158"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:B6A473"
FT                   /protein_id="ACI59206.1"
FT                   /translation="MQRTSGQMSKNRLCLLGRPRLLAAGRELPLPEKSYFLLAMLTAEA
FT                   NLELDRETVRRQLWQSELPEKRAGSLRQLLSRIEQSIPADLPPLLAATRTHIALADGWE
FT                   VDVHILKQKGPLAPEDSDMLNGELLEGAKSPTQGAEDWLTFERQRVDELRSAHLTRLIE
FT                   TSEDGSDDEQVAFARRLLELDPASETAYRALMRTYVRLNDAAAARQAYLKCKSQLKDDF
FT                   DTEPEESTTALARELGLIPAAQAAAPERPPASGMFANLLGQPRIIILPPESIFTDPLME
FT                   RVGRALLEDVTIGLSQQRGFKVIAAHTSLEILSRSIDPARAVPGPLDLSFDYAVYVTIQ
FT                   GRDEDVFATCRLTRTTTSEVIWALELPLVMQKISESFAHLTRRIVSSLADTIERHELAM
FT                   PIGDAPASAYRLYLEGKRLIAQTDLQHLRQARKWFKSSLNRYEHFSAAHAGVSRALGME
FT                   WLIRGMRDKELLDEANGAARQAQQSDPNSGRAYRELGFVALYRRRFDESLEYFQQAQDL
FT                   NPNDADILADFADALSHDGDFDRALELSRAAFKLNPLPPDYYYWNLGGIHFMREEYEKA
FT                   IDALEPVKTKQATARLLAASHAMAGETGKAQNYARTVLENFPDFRSEDIRHFVPDRDPA
FT                   FTEPLIKGLQLAGLP"
FT   gene            467073..468335
FT                   /locus_tag="Rleg2_6037"
FT   CDS_pept        467073..468335
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_6037"
FT                   /product="protein of unknown function DUF181"
FT                   /note="PFAM: protein of unknown function DUF181; KEGG:
FT                   rec:RHECIAT_PA0000360 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_6037"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59207"
FT                   /db_xref="InterPro:IPR003776"
FT                   /db_xref="UniProtKB/TrEMBL:B6A474"
FT                   /protein_id="ACI59207.1"
FT                   /translation="MSVFTDLETLAGDLKRSSAGVSDYHDRAVTPAQTLAAIRPHLREF
FT                   GITRVGLLTALDVLNIPVAFATRPNSHTLSVFQGKGIDNDAAMTSAAMEAIETRIAEIP
FT                   PADLTEATVAGMRAENAAMIDLDNVARCAPDEIGSGPIPWCSGLDILSGSSAFVPWWLV
FT                   GLDHRGERPPGFEQSSDGLASGNTPSEAVLHGLCELVERDAWALTQLKSPERLKESRID
FT                   PASFGDAVIDVMTDRIARAGMRLLLLDMTTDIGVPAFLAVIMPGNLSDRVDARWAHVCG
FT                   GCGCHPDPVRAALRAITEAAQSRLTAIAGSRDDFSPRVYQRLDQSAAMQQVVELCEGGG
FT                   RMRAFQPRQSRPATIQETIGHIADRLAATGIEQIVVVPFAHRALPVSVVRVIVPGLEVD
FT                   ISGQYIQLGMRAVNTMRGAQS"
FT   gene            468332..469075
FT                   /locus_tag="Rleg2_6038"
FT   CDS_pept        468332..469075
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_6038"
FT                   /product="TfuA domain protein core"
FT                   /note="PFAM: TfuA domain protein core; KEGG:
FT                   ret:RHE_PE00436 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_6038"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59208"
FT                   /db_xref="InterPro:IPR012924"
FT                   /db_xref="UniProtKB/TrEMBL:B6A475"
FT                   /protein_id="ACI59208.1"
FT                   /translation="MKVLFVGPSLGSDLAAVRATSPRIDFRPPAACGDILKAVHDGATA
FT                   IGLVDGYFGDLPSVWHKEILFALEHDVAVAGGASMGALRAAECAPFGMVGLGSIFEDYE
FT                   AGRLLDDEAVALVHAPQALGWLPLSVPWVDFEPTIEALLTSGEISSSERKKLLLAGRFL
FT                   HFSERTYAKVVDECHFRKPRRDQILAAVRQHRVERKRNDARLVLDWLRRDEFLPVNRDW
FT                   RFAATSHWELLHAEVTRNAVPVTLE"
FT   gene            469141..469407
FT                   /locus_tag="Rleg2_6039"
FT   CDS_pept        469141..469407
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_6039"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rec:RHECIAT_PA0000358 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_6039"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59209"
FT                   /db_xref="UniProtKB/TrEMBL:B6A476"
FT                   /protein_id="ACI59209.1"
FT                   /translation="MFEQRNEGTGSEYARIFRLLSAAKEEAEKLQLRNLMHLTNMALLQ
FT                   VVIDWDGIDPDRELDVNLEKLLGSKAKIAMKDASENLILIDRH"
FT   gene            complement(469439..469843)
FT                   /locus_tag="Rleg2_6040"
FT   CDS_pept        complement(469439..469843)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_6040"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="PFAM: helix-turn-helix domain protein; KEGG:
FT                   rec:RHECIAT_PA0000357 putative transcriptional regulator
FT                   protein, Cro/CI family"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_6040"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59210"
FT                   /db_xref="GOA:B6A477"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:B6A477"
FT                   /protein_id="ACI59210.1"
FT                   /translation="MKEEPHSVDVHVGKTIRIQRLLRKVSQTELGDRVGVTFQQIQKYE
FT                   KGSNRVSASMLVEIAGALKVDVRTFFDDLSAPDTANDNPAPSEEFIISREGVLLNAAFF
FT                   SIKNEALRKKILKLVQAIAHTEQLDGEAAE"
FT   gene            complement(470046..470882)
FT                   /locus_tag="Rleg2_6041"
FT   CDS_pept        complement(470046..470882)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_6041"
FT                   /product="amidohydrolase 2"
FT                   /note="PFAM: amidohydrolase 2; KEGG: rec:RHECIAT_PA0000354
FT                   putative amidohydrolase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_6041"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59211"
FT                   /db_xref="GOA:B6A478"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:B6A478"
FT                   /protein_id="ACI59211.1"
FT                   /translation="MLIDTHLHIIDRSALPYPWLSQVADLDHDFLYETYAAEARRCGIT
FT                   TVLHMEVDVDPAAMQAETDHIAGIAKRTGSLITGAIVSCRPEEEGFAAYLERQKADPFV
FT                   KGFRRVLHVVPDDVSEGALFRENIRRIGGSGLTFDLCTLPHQASRVTALVDLAPDVQFV
FT                   LDHCGVPDIRSDAYEPWKAGISEIARRPNVVCKVSGVVAYADAETWTAQTLRPYIEHVI
FT                   ASFGWDRVVWGSDWPVCTLGGGLSTWVAATHAVLSGSSEAERSRLLFANAQRLWSL"
FT   gene            complement(470959..471744)
FT                   /locus_tag="Rleg2_6042"
FT   CDS_pept        complement(470959..471744)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_6042"
FT                   /product="transcriptional regulator, IclR family"
FT                   /note="PFAM: regulatory protein IclR; Transcriptional
FT                   regulator IclR; KEGG: rec:RHECIAT_PA0000353 probable
FT                   transcriptional regulator protein, IclR family"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_6042"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59212"
FT                   /db_xref="GOA:B6A479"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B6A479"
FT                   /protein_id="ACI59212.1"
FT                   /translation="METEESDRYRAPALDKGLDILELLAGVDSGLTQADIAKRLDRSPN
FT                   EFYRMLDRLVRRGYVTRLDGDRYSLTLKLFGLAQLHTPVRRLASYATPLMRDLAQRTRQ
FT                   ANHLAVFDRGAAVVIAQQEAPDYWGFSIRIGAHISLFDTGSGHVLLAFRSAEEREMMIS
FT                   EHVRSRAEIELGPDFYDRLDQIRERGYEMMASAQTSGVYNLSAPVLGPDGRCIAALTCP
FT                   FIALVNAPTAPDISQATMLVQKAANQLSLLAGADVASPA"
FT   gene            472049..472783
FT                   /locus_tag="Rleg2_6043"
FT   CDS_pept        472049..472783
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_6043"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase;
FT                   short-chain dehydrogenase/reductase SDR; KEGG:
FT                   rec:RHECIAT_PA0000352 probable oxidoreductase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_6043"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59213"
FT                   /db_xref="GOA:B6A480"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B6A480"
FT                   /protein_id="ACI59213.1"
FT                   /translation="MTNRLSGKIVLITAAGQGIGRATATAFAAAGAKVHATDINTEALA
FT                   TLAAETGVSTHQLNVLEEDAVKALVAEIGAVDVLFNCAGFVHAGSILEMKDSDFEFALD
FT                   LNVKAMIRTIRAVLPGMLERKDGSIINMASVASSIKGVPNRFAYGVTKAAVIGLTKSVA
FT                   ADYVAEGIRCNAICPGTVESPSLQDRMRAQGDYDAARAAFIARQPMGRLGSPEEIADLA
FT                   VYLAGATYTSGQAIAIDGGWTI"
FT   sig_peptide     472049..472135
FT                   /locus_tag="Rleg2_6043"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.954) with cleavage site probability 0.801 at
FT                   residue 29"
FT   gene            472863..474140
FT                   /locus_tag="Rleg2_6044"
FT   CDS_pept        472863..474140
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_6044"
FT                   /product="Mandelate racemase/muconate lactonizing protein"
FT                   /note="PFAM: Mandelate racemase/muconate lactonizing
FT                   protein; KEGG: rec:RHECIAT_PA0000351 putative racemase
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_6044"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59214"
FT                   /db_xref="GOA:B6A481"
FT                   /db_xref="InterPro:IPR013342"
FT                   /db_xref="InterPro:IPR018110"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR029065"
FT                   /db_xref="InterPro:IPR034610"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/TrEMBL:B6A481"
FT                   /protein_id="ACI59214.1"
FT                   /translation="MTRITDLRVFDLRFPTSQSLDGSDAMNPDPDYSAAYVILDTDMPD
FT                   LAGHGLTFTIGRGNDICCMAIEAMRHLVVGAELAEVLAHPGKFWRHLTSDSQLRWIGPE
FT                   KGAIHLATGAVVNAVWDLLAKQAEKPVWRLVAEMSPEEIADIVDYRYLTDVLTREEAVE
FT                   ILKRAETGKAERIAILEKEGYACYTTSAGWLGYEDEKLRRLCREAIDAGFNHIKMKVGR
FT                   DLDDDIRRLRIAREVIGPDRYLMIDANQVWDVGQAIDWVKALAPAKPFFIEEPTSPDDV
FT                   AGHRKIRQAIAPVKVATGEMCQNRIMFKQFIAEGAIDIVQIDSCRMGGLNEVLSVLLIA
FT                   AKFGLPVWPHAGGVGLCEYVQHLSMIDYVAVSGTKEGRVIEYVDHLHEHFLEPCRIENA
FT                   AYMPPTQPGFSIEMKPASISNYTFRK"
FT   gene            474386..476968
FT                   /locus_tag="Rleg2_6045"
FT   CDS_pept        474386..476968
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_6045"
FT                   /product="peptidase C14 caspase catalytic subunit p20"
FT                   /note="PFAM: Sel1 domain protein repeat-containing protein;
FT                   peptidase C14 caspase catalytic subunit p20; KEGG:
FT                   ret:RHE_PE00124 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_6045"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59215"
FT                   /db_xref="GOA:B6A482"
FT                   /db_xref="InterPro:IPR001309"
FT                   /db_xref="InterPro:IPR006597"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR029030"
FT                   /db_xref="UniProtKB/TrEMBL:B6A482"
FT                   /protein_id="ACI59215.1"
FT                   /translation="MPKFHYVKRLCAYLLIAAAMLLSIGTARAAITEGENGRRVALVIG
FT                   NSVYKTLPSLPNPANDVEEVATTLRAAGFDVTIGVNVDRIGLEDTVRRFLRSTSNAEAG
FT                   LIYYSGHGIQVGGQNFLVPVDATLETPYDVETQTMPLDLILNHLKQNSRVQLIFLDACR
FT                   NNPFNAQKFWMAEKLEPVGATRGLARIDSDLGSLIAFSTEPGQVALDGTGALSPYSESF
FT                   IKRASEPNKEIRQVLTDVRRDVIAMTGGKQVPWENSSLMDSFYFIPAPPPPSVEPMQQV
FT                   SVPEGAAATKLPIAPPHDETGSALLVTLNQLPQTGKLSFDGKPVEQGAKMPAAALTALT
FT                   YDSSGVNAGTVGLIGYTVSDPYGQATQGVVAITVSADAGAKLAQLEQQKQVRLADADAY
FT                   LKTLPRDVDTPIGVGPVKTSLPVVPASAAEMTFKVAALPDKGTLRAGERVIGLGHVLEA
FT                   ADIPGLSYEPQIGTENQPFALTLQAANDNLPAATVTFKPVLDACDTSAAAPLDLQGVTA
FT                   GKLPNEIDPNVALPACMEAVKAYPEVARFVYQLGRAQLANRDTKTAFATIKKAMDAGHV
FT                   RAIQELSSLYEFGASVPRDAAKASEISKGGAAKGDPFALHSYGKALYYGRGTKANQQEG
FT                   LRMMLQAADLGHTYAMNELGYIFLNGVNVPADPERGIRFYEAGVERNDIYSLNNLALVY
FT                   RFGKGAPQDLTKALDLFTRAAEGGQPHAPTNLGRMYRDGVGVAADKTEAVKWLEMGAER
FT                   GDYWGALDRAVMAKEEGGDSDGLATAAHYFALATAINMPGSGDPKNQALAELKRLPNAA
FT                   KKNAEAAFVADLTAQEQKAIPKSKSIDDRLVKLAKATWVKRNPRYDLF"
FT   sig_peptide     474386..474475
FT                   /locus_tag="Rleg2_6045"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.997 at
FT                   residue 30"
FT   gene            476993..477301
FT                   /locus_tag="Rleg2_6046"
FT   CDS_pept        476993..477301
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_6046"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ret:RHE_PE00125 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_6046"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59216"
FT                   /db_xref="UniProtKB/TrEMBL:B6A483"
FT                   /protein_id="ACI59216.1"
FT                   /translation="MNSKLIIRVLLCSTFIAGSAAILQSCVFDPGAKTLFASEEPNRNT
FT                   PNAMPARKTTPTVKKVVAKSNETAFGRSGNDSGSNSGSNSGSSSGGMGGGSSGGQSW"
FT   sig_peptide     476993..477070
FT                   /locus_tag="Rleg2_6046"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.986) with cleavage site probability 0.593 at
FT                   residue 26"
FT   gene            477316..478533
FT                   /locus_tag="Rleg2_6047"
FT   CDS_pept        477316..478533
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_6047"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bpd:BURPS668_A2834 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_6047"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59217"
FT                   /db_xref="GOA:B6A484"
FT                   /db_xref="InterPro:IPR007269"
FT                   /db_xref="UniProtKB/TrEMBL:B6A484"
FT                   /protein_id="ACI59217.1"
FT                   /translation="MIQAATLIGGVAGIALSNYLLLEPGKAMAFALFCLLLVWIVFDGM
FT                   PAARGVWASRQRRNEASALFWRRIGTKLVGLAALLGAVVIACSVFPFFTQSLAVQWFIG
FT                   AGHTTIPISIVLAGATILYVAVTDLVAEEPDDYLHQVGRAVLMQDFREEDVLFALRLLT
FT                   IKCFFLVLMFSSGIAALSDLADKPAWLLPPFSAAWFEGLLRLVFLLDVILAAGGYIATF
FT                   KLFGWHVRATETTALGWLVCLICYEPFFPAISSAFVPYGAGPGWESVIQEGSVVYFVWS
FT                   VATLSCAIIYVWATIAFGPRFSNLTHRGIITSGPYRFIKHPAYVSKNISWWLFATPSFI
FT                   ASGLAEGLARAGMLAIVSLIYLLRARAEERMLSRDPAYRQYAETVAAHGLLAMAKRRLA
FT                   PTAPRV"
FT   gene            complement(478814..480418)
FT                   /locus_tag="Rleg2_6048"
FT   CDS_pept        complement(478814..480418)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_6048"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ret:RHE_PE00126 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_6048"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59218"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="UniProtKB/TrEMBL:B6A485"
FT                   /protein_id="ACI59218.1"
FT                   /translation="MRSFGSHILIAAALAVASPVFAKDTTIIELRSGDGGRSVGIISAS
FT                   EEVEASGPAAITVGDDGTIYILDQNNGRVLAIDAERSQAEPEILPLPENATPEDLAVVH
FT                   NELYLWSDGVVPLERSTEADGRSQTLRAVDGGDADDYTRSVFASMGSVPPGPLNSIVYE
FT                   IGRSTSRPAPRPPVIQYVPSRGLGDIVAEVSAANDKAEILLRRSSSEENFLSLPLTAEG
FT                   RIGTVELLDIDTTGRPYALVELVPADQPERTGMLVVRFTPNGVIDRVYDLPIDPGTVFS
FT                   RRFVAIGPRGDVLYLKSQESRAQVLRLDGRDPGRKLAVARPAKPLVAGKPGKTPKVAIV
FT                   PKSRSDVIERAIGFETLNWLVTSTAYGKDPGPGCINMNRLRRPIYLIGKRGQTVKGVPY
FT                   CWGCKTRLEDFMDGVEKGQTAGNVCTKSAPQTNILGVDCSGFVSDAWGLKMHVSTRAIP
FT                   GITKRVSDPWSMRPGDALNKPGSHVLLFMRFTDDRKVEVMEASPNACKGRVCRNTYSLG
FT                   SLLMRGYQPVRFKGLDG"
FT   sig_peptide     complement(480350..480418)
FT                   /locus_tag="Rleg2_6048"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 23"
FT   gene            480599..481189
FT                   /locus_tag="Rleg2_6049"
FT   CDS_pept        480599..481189
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_6049"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_6049"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59219"
FT                   /db_xref="UniProtKB/TrEMBL:B6A486"
FT                   /protein_id="ACI59219.1"
FT                   /translation="MLEWNGDELALDISLLEQVRAARIGFSDRVCAASQSTDDKHLAQL
FT                   RSEPTYLMAEFLYSMKVFGINTAEDIERFADLHNDYVVSLTRDPAKLQRLGLSQDRALA
FT                   SMFTADTKPRLIQNWAEKAGAIDQSNLGRFLVAVMSSETCRKTLIDFETAGFMQRKRSP
FT                   YGTMVVWSTGTIEEIFGEMLRDLRLSLQQLKIL"
FT   gene            481354..481731
FT                   /locus_tag="Rleg2_6050"
FT   CDS_pept        481354..481731
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_6050"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ret:RHE_PE00128 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_6050"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59220"
FT                   /db_xref="UniProtKB/TrEMBL:B6A487"
FT                   /protein_id="ACI59220.1"
FT                   /translation="MMKSRLIPLSIGLLLALQMPQLGHAGPAEDALAARNPALAALRQH
FT                   DEKAFAAATAIITEHESAKGLTPGAGKLPDATSPGRDMGSGAGKEFTVDNPDILWLYNS
FT                   SPEGMSDLISILKSAGQKPKN"
FT   sig_peptide     481354..481431
FT                   /locus_tag="Rleg2_6050"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.913 at
FT                   residue 26"
FT   gene            481943..483871
FT                   /locus_tag="Rleg2_6051"
FT   CDS_pept        481943..483871
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_6051"
FT                   /product="OmpA/MotB domain protein"
FT                   /note="PFAM: OmpA/MotB domain protein; Tetratricopeptide
FT                   TPR_2 repeat protein; KEGG: ret:RHE_PE00129 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_6051"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59221"
FT                   /db_xref="GOA:B6A488"
FT                   /db_xref="InterPro:IPR006664"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR025493"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="UniProtKB/TrEMBL:B6A488"
FT                   /protein_id="ACI59221.1"
FT                   /translation="MLNRKAILATATFLSLFSVVPAVLAQNERTLTEAPAQTGPVSITF
FT                   DRAEAKYAIGEVVGLFIQSTENSYVTVLNVSPNGSVVKLFPNKYQTDALVGPGKRVQVP
FT                   DPASGARLQVSGPVGQEQIKVFYSSKPLNIFADLGGSGSGMFRSVDGGMDAVSRSLEEA
FT                   RSLGTKISSKTLMLTTVDSPAALPPVAAPPVAAAPAVKPVEQAAKPPVAPKQKPVTKQE
FT                   VAKKPETVVEKPKPVAPKKVAPKPVEQAAQQPPKKYKIVTNLAPGQELAADELQLIGPA
FT                   DTTSSTRPTQYKQPAQSSQTKMPKLPMPQLKMPQFKLPGGFSIKMPQLNLGRSAEPDQA
FT                   GEEIEVANADTPACTALLDKLNTAVAAKDITAAAAEADTIAVSADCGQFQVNAQRRVAA
FT                   LRLAAAQEMMAANQPVTDYEPLLVAADSPQVLWQASATLGEIYFSARRFADAAADYQQA
FT                   IEIIKNETRTPKAPPADTISDLIQRAAQARILAANPTSDNPQGSFVPAEKDHRSGVLGG
FT                   IYSENVRGIVPVSIPVPITFDFNKSSFTSIGTEAAQELLEALKEQKPGRVILIGHTDRR
FT                   GGDDYNQKLSERRAQAVADFLKSNGIDASIDAEGRGASEPVDVTATANLTEDDVDALNR
FT                   RVEWRRE"
FT   sig_peptide     481943..482020
FT                   /locus_tag="Rleg2_6051"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.921 at
FT                   residue 26"
FT   gene            483894..485510
FT                   /locus_tag="Rleg2_6052"
FT   CDS_pept        483894..485510
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_6052"
FT                   /product="peptidase C14 caspase catalytic subunit p20"
FT                   /note="PFAM: peptidase C14 caspase catalytic subunit p20;
FT                   KEGG: ret:RHE_PE00130 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_6052"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59222"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="InterPro:IPR029030"
FT                   /db_xref="UniProtKB/TrEMBL:B6A489"
FT                   /protein_id="ACI59222.1"
FT                   /translation="MSASVSMAAAFALLSLAATDSLARTIEAPDRGAVRAVLIGIDLYR
FT                   NVPPLHGAVADAEDLSLSLRSVGVEDMTLLKNGEADREGIFHAIEAVTERAGAGDLVVL
FT                   GIAGHGSSEPERVKGSKPSGRDEVYVLAGFDTRLPGSRERIFGDEFKVLIHKLEAKGAD
FT                   VVFIADTCHAGGLTRDVDPRGAEITWRQAPSYTIEEDDLAPISTTADALSTGFDFKRLT
FT                   FLAAVDDNTKSPEISIPGIPQKRGALSYATARAFEGAADRNGDGAVSRRELFEYVRQSV
FT                   YQFTDQRQNIFTQSPPGTDLDRAVVYDYQGAGAQAAAEKSNAPPSAEPAPISVAALGTE
FT                   PVLQGIEPAVTPFKLTDGANAELVFDPEKHEAIAGGDVVASGIGAGDMPFVVDRMAALD
FT                   TLKRLSEVNPQTVRVTPSDTVHREGERVGVTISDLAGRKLVLFDVTGDGTVQFLYPGEK
FT                   DAEAEMPTNFDLDLSVVAPFGTDLLVAVTSETPMPELVEFLKQNDRRRTAGNIASRLGD
FT                   VLPEGARVGFTVLYTSAGAKL"
FT   sig_peptide     483894..483965
FT                   /locus_tag="Rleg2_6052"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.596 at
FT                   residue 24"
FT   gene            485507..488038
FT                   /locus_tag="Rleg2_6053"
FT   CDS_pept        485507..488038
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_6053"
FT                   /product="peptidase S1 and S6 chymotrypsin/Hap"
FT                   /note="PFAM: peptidase S1 and S6 chymotrypsin/Hap;
FT                   peptidase C14 caspase catalytic subunit p20; KEGG:
FT                   ret:RHE_PE00131 putative serine protease protein, trypsin
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_6053"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59223"
FT                   /db_xref="GOA:B6A490"
FT                   /db_xref="InterPro:IPR001254"
FT                   /db_xref="InterPro:IPR001314"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR018114"
FT                   /db_xref="InterPro:IPR025493"
FT                   /db_xref="InterPro:IPR033116"
FT                   /db_xref="UniProtKB/TrEMBL:B6A490"
FT                   /protein_id="ACI59223.1"
FT                   /translation="MSASISSILNVAAVMLLLASPVLAQQDTDFAGEDGGRVIGGQAAK
FT                   KGQWPWQVKILAPDPEQRGRFGGHCGGSLIAPRWILTAAHCVTSGRSGKQDLFARDLLI
FT                   VEGKSKIDKVISVDGPDKPGLAVEDVVIHEDFDRKVFANDIALIKLAEPAVSKPAVLAS
FT                   AGDDAVEAAGHKAVVTGWGYTKADHGWDDKYLPTELQEVELPIVPREDCRAAYRDSSMR
FT                   MNPIDERNVCAGYAEGGKDACQGDSGGPLVAQRPDKSWIQLGIVSWGAGCAEAEHYGVY
FT                   TRVAAFRGWIAAKTEGDVPDVEAPTSGDQVASTTTGTGTKPRQSGQKLANLAITTPPAG
FT                   DTAPAATTETPADNTAPAAKPAAEEPAVQPPVAETPALQTPGIQGSPGDRVLLIGIDDY
FT                   EMREAKLTGSASDVKAMQLFLVKTLAYRPEQIHTLTNRKATREAILAEIDDWLVRQSTP
FT                   GSRVFLYFSGQGSEEMGAEATTSPTLVAADAKLVREAGKVTVTNQIRETEIAARLNSLK
FT                   DRRVTLLIDACHVGPGSRSAVAAPSGSVRCLGPALAEFEPPNKSGKEAKFSFGGENAMV
FT                   WSAVNSGQWALVDREAKPPVGVFTRRFIEGVEDGVARAADKPNVSNAALLDYVRRKSDE
FT                   YCRTHAEDCRFTPVPQFYGQPDALGRDVITGEEAKTPVAAVENTLKTDNEAGVAVDVLP
FT                   GTSVGIGDKVAMRVSTKKSGYLILVDIDASGKLTQLYPNKRSMGLKPTAKSGDNRLDPT
FT                   RPVVVPDARNPYTGFEYVVEGPSGVGMVVAILSDKPIEVLDLPDVPTPLVGQRAAFNYV
FT                   YDLARTLRIVGDDETGAQGKWSFDSKFYRIR"
FT   sig_peptide     485507..485581
FT                   /locus_tag="Rleg2_6053"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.996 at
FT                   residue 25"
FT   gene            488053..489237
FT                   /locus_tag="Rleg2_6054"
FT   CDS_pept        488053..489237
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_6054"
FT                   /product="proteinase inhibitor I4 serpin"
FT                   /note="PFAM: proteinase inhibitor I4 serpin; KEGG:
FT                   ret:RHE_PE00132 putative serine proteinase inhibitor
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_6054"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59224"
FT                   /db_xref="GOA:B6A491"
FT                   /db_xref="InterPro:IPR000215"
FT                   /db_xref="InterPro:IPR023796"
FT                   /db_xref="InterPro:IPR036186"
FT                   /db_xref="InterPro:IPR042178"
FT                   /db_xref="InterPro:IPR042185"
FT                   /db_xref="UniProtKB/TrEMBL:B6A491"
FT                   /protein_id="ACI59224.1"
FT                   /translation="MPKSTLLAGLAASLMTLAPAHADNSGDGKAMLAAQAGLAAELIDR
FT                   TLAREGAANIMVSPASLAAALGLASLGASAEGKAAIAKGLGFGSEVKGPETVLAAMTPE
FT                   KPAAADAPLATAVAIVFDDKLVLSPDALSMLATHRIKPSIEDLDGPASVEHINGWVKET
FT                   TRGAIPVMLDAPPGGGFVSLGALSFKARWKTPFEKESPASPFQRPDGSTISVPMMHLTG
FT                   DGQKFRFDEKFTAVDLAYAGESYSMVVVAARSGKGVGGADLKALTSWLQGEKFEPAKGE
FT                   IFLPRFSLSDGRDLMPVLDQMGLAAGKANDAAFPGFTKENIRLSRVLQKTMIKLDENGT
FT                   EAAAATAAITERSIDPKLVRVVADARFAFALRDTKSGLLLAAGLIGDPLLEQDD"
FT   sig_peptide     488053..488121
FT                   /locus_tag="Rleg2_6054"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 23"
FT   gene            489371..491776
FT                   /locus_tag="Rleg2_6055"
FT   CDS_pept        489371..491776
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_6055"
FT                   /product="serine/threonine protein kinase"
FT                   /note="SMART: serine/threonine protein kinase; KEGG:
FT                   ret:RHE_PE00133 putative serine(threonine) kinase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_6055"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59225"
FT                   /db_xref="GOA:B6A492"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR016187"
FT                   /db_xref="UniProtKB/TrEMBL:B6A492"
FT                   /protein_id="ACI59225.1"
FT                   /translation="MRSDLIARYTIGEPVYENEFIVYPAQDKRMDHAVFIVAPDVALKL
FT                   DKARFERVWTSINEAKSLTARRFVEIEDLIPPSPEDDNFYIVEKRPSKTLHQYLDETEM
FT                   VAYERAAEIGRHILEGLATLHGAGYAHNALTDQCIYVSEDYSGLSVRIGNLHLISKIGE
FT                   HIIPPYVPEFGAPEIYASGTFSASSALDIYAMGMIAYKLFLPRQTYNSVFDSVMVWEDE
FT                   HQREQSWKNIHLDPSNIFPRLDVLIPGFPEGLASLIERMLSRDPAQRPRTGADALGEYT
FT                   RVTTGIQPMSWDPRGGMQQQQEAPKPKKWTPIKISMIAALLLICIGVGAITIPKLLRPD
FT                   PKLVADVGTWKKEAESRKQKAIAAKAPERPSGDQAKLAYDTGAAALTSADALLKDEDYD
FT                   KALPGFQSAAINLGNALIAISKENAEKAKAAASAAGGDKAPAFAEADAKMKTAADSAAA
FT                   KQMHGAIDNYDASKTAFDDLAKALTTLASAEKNATAKRETVNRIGAGDSPDVAKASGLM
FT                   ADAKAKAEQWQMPAATSGYGDAAKLFDALIADVMAAKDEATALKQKVADLNASITTRAG
FT                   AADPTLAALAPKIGEADGRYSAEAYKLALAAYKPILADLEALSARGFCPVSPTLAFEQV
FT                   PAGSYSLDNVRLMTASMKELGGMLGVANGAVKVEKSFCMQAKAVTRAEMAAYYTANSDP
FT                   ASAQAYSDNPQQPADDVPLAVAQNYTAWLSKQLNTPVHLPSATEWMAGATKIATEKLPD
FT                   NGDIILQWSATPCEAGGNVAFMAQEGSTFVVCSDASAGGIFRVTAELR"
FT   gene            492005..492316
FT                   /locus_tag="Rleg2_6056"
FT   CDS_pept        492005..492316
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_6056"
FT                   /product="protein of unknown function DUF982"
FT                   /note="PFAM: protein of unknown function DUF982; KEGG:
FT                   ret:RHE_PE00134 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_6056"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59226"
FT                   /db_xref="InterPro:IPR010385"
FT                   /db_xref="UniProtKB/TrEMBL:B6A493"
FT                   /protein_id="ACI59226.1"
FT                   /translation="MCWNTSAAFTPVGFALRGPASRKIVWTLGDAARLLMNDWPCDDGE
FT                   EYVAAVKACVDAISGKIAPEQFREALLRAAEEAGIAALCLVPQGVAARRPDLPSKAQR"
FT   gene            492388..492768
FT                   /locus_tag="Rleg2_6057"
FT   CDS_pept        492388..492768
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_6057"
FT                   /product="pentapeptide repeat protein"
FT                   /note="PFAM: pentapeptide repeat protein; KEGG:
FT                   mmw:Mmwyl1_2777 pentapeptide repeat protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_6057"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59227"
FT                   /db_xref="InterPro:IPR001646"
FT                   /db_xref="UniProtKB/TrEMBL:B6A494"
FT                   /protein_id="ACI59227.1"
FT                   /translation="MSDHQEHNPFDGPQMQGMHYERADMSGANFDGVNLADAQFYAVLT
FT                   KAKFTDSNLTEAVFDDINLADARFNNVNLSGAAITNANLSRLTICGVTLANSDIKDADL
FT                   TGMRINGVLVTDLLMAYEKAKT"
FT   gene            complement(492822..493298)
FT                   /locus_tag="Rleg2_6058"
FT   CDS_pept        complement(492822..493298)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_6058"
FT                   /product="transcriptional regulator, AsnC family"
FT                   /note="PFAM: regulatory protein AsnC/Lrp family; regulatory
FT                   protein MarR; regulatory protein ArsR; KEGG: mlo:mlr1825
FT                   probable transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_6058"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59228"
FT                   /db_xref="GOA:B6A495"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR019885"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B6A495"
FT                   /protein_id="ACI59228.1"
FT                   /translation="MAKQFDTDVAFDPTDISMIEILQDDGRISVSELGRRIGLSQPATS
FT                   ERLKRLEERGVISGYRALIDPAAVGLGMMAIVRLRTTHEYIKTCLKQFSEMPQVIEVLR
FT                   LTGEDCFHLKVIVPSPAELESIVDAVARYGSVTTAIVLRSEPTKRIGRELMMKG"
FT   gene            493403..493936
FT                   /locus_tag="Rleg2_6059"
FT   CDS_pept        493403..493936
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_6059"
FT                   /product="protein of unknown function DUF1234"
FT                   /note="PFAM: protein of unknown function DUF1234; KEGG:
FT                   mlo:mll1824 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_6059"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59229"
FT                   /db_xref="GOA:B6A496"
FT                   /db_xref="InterPro:IPR010662"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B6A496"
FT                   /protein_id="ACI59229.1"
FT                   /translation="MTEIIHLPGIGNSGDLHWHTRWEDADPSIRRFAPASWDEPDLSDW
FT                   IAALEQAVQSTQTPPVLVAHSLACLLVAHWHQMSDLPIKGAMLVAVPDPASQAFPAQAS
FT                   SFARPPEKKFRFPSLIVASTDDPYGSLPYAQMRAEQWGSEFKAIGAAGHINGQSKLGDW
FT                   SEGLAHLRDFTSRA"
FT   gene            complement(493976..494587)
FT                   /locus_tag="Rleg2_6060"
FT   CDS_pept        complement(493976..494587)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_6060"
FT                   /product="Endopeptidase Clp"
FT                   /EC_number="3.4.21.92"
FT                   /note="PFAM: peptidase S14 ClpP; KEGG:
FT                   rec:RHECIAT_CH0002954 endopeptidase Clp protein, subunit 1"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_6060"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59230"
FT                   /db_xref="GOA:B6A497"
FT                   /db_xref="InterPro:IPR001907"
FT                   /db_xref="InterPro:IPR023562"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR033135"
FT                   /db_xref="UniProtKB/TrEMBL:B6A497"
FT                   /protein_id="ACI59230.1"
FT                   /translation="MREAMQLVPMVVEQSSRGERSFDIYSRLLRERIVFLNGEVNDTVS
FT                   ALVCAQLLFLEAENPKKPIYLYINSPGGVVTSGLAMYDTMRYIRAPVHTLCMGTARSMG
FT                   SFLLMAGEPGERAALPNASILIHQPSGGFQGQATDMQIHAEEILKTKQRMTRLYAEHCG
FT                   RSYEDFERAMDRDRFMTSQEALEWGLIDKIMQLREVPADQ"
FT   gene            complement(494633..494992)
FT                   /locus_tag="Rleg2_6061"
FT   CDS_pept        complement(494633..494992)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_6061"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ret:RHE_CH01413 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_6061"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59231"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:B6A498"
FT                   /protein_id="ACI59231.1"
FT                   /translation="MNEQKIEEQDSGVELEFDLVDPPQKVWRAISMPEFRERWLPKEAL
FT                   ADPDAIAVTPGQELRYRLRDDSPPFLESTVTFTITPNATGGTCLRIVHELTDVRLDRMA
FT                   KAAANSNSPLLMLAA"
FT   gene            complement(494989..495303)
FT                   /locus_tag="Rleg2_6062"
FT   CDS_pept        complement(494989..495303)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_6062"
FT                   /product="transcriptional regulator, ArsR family"
FT                   /note="PFAM: regulatory protein ArsR; KEGG: ret:RHE_CH01412
FT                   probable transcriptional regulator protein, ArsR family"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_6062"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59232"
FT                   /db_xref="GOA:B6A499"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B6A499"
FT                   /protein_id="ACI59232.1"
FT                   /translation="MIENDFFRALADPTRRAIFEKLAAGSMNASALRNGMEISQPAMSQ
FT                   HLAVLRSAKLVREQRQGRFVNYEVDPEGLALIAQWLAKYRAYWPDRIAALKVLLKDMDQ
FT                   "
FT   gene            complement(495498..496259)
FT                   /locus_tag="Rleg2_6063"
FT   CDS_pept        complement(495498..496259)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_6063"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ret:RHE_PE00397 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_6063"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59233"
FT                   /db_xref="UniProtKB/TrEMBL:B6A4A0"
FT                   /protein_id="ACI59233.1"
FT                   /translation="MTHSSLQSGIQARSDEEKVRLCAANNADLYQAIFRAHGLPDQRTS
FT                   AFWSSDAGAPPYYSNMTTLDPDATEEQLIEIDRLTDRLGWRPGIKDGFSRLDLSNNGFR
FT                   LLFSASWIWAEPQKSSSNVPQGWVRVRDAAALDRWERSWKESGSPTDANVFTPALLSDP
FT                   DMHIYGRLAGGGFDAGCIANRSPAVVGISNIFSLSGTPQAFRDAISVAAIAFAADLPLV
FT                   GYDHGKALDEMIELGFKPVGQLRIWLANTAE"
FT   gene            complement(496276..496353)
FT                   /pseudo
FT                   /locus_tag="Rleg2_6064"
FT   gene            496423..496593
FT                   /pseudo
FT                   /locus_tag="Rleg2_6065"
FT   gene            complement(496880..497065)
FT                   /locus_tag="Rleg2_6066"
FT   CDS_pept        complement(496880..497065)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_6066"
FT                   /product="4-oxalocrotonate tautomerase family enzyme"
FT                   /note="TIGRFAM: 4-oxalocrotonate tautomerase family enzyme;
FT                   PFAM: 4-oxalocrotonate tautomerase; KEGG:
FT                   rec:RHECIAT_CH0001205 putative 4-oxalocrotonate tautomerase
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_6066"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59234"
FT                   /db_xref="GOA:B6A4A1"
FT                   /db_xref="InterPro:IPR004370"
FT                   /db_xref="InterPro:IPR014347"
FT                   /db_xref="InterPro:IPR018191"
FT                   /db_xref="UniProtKB/TrEMBL:B6A4A1"
FT                   /protein_id="ACI59234.1"
FT                   /translation="MPILHLQMHPGRTDDQKRAFAREATKAAVETLACPPESVEILITE
FT                   IAKDSWAVGGKLKSDG"
FT   gene            497191..498075
FT                   /locus_tag="Rleg2_6067"
FT   CDS_pept        497191..498075
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_6067"
FT                   /product="transcriptional regulator, LysR family"
FT                   /EC_number="4.2.1.1"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: ret:RHE_PE00136 probable
FT                   transcriptional regulator protein, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_6067"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59235"
FT                   /db_xref="GOA:B6A4A2"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B6A4A2"
FT                   /protein_id="ACI59235.1"
FT                   /translation="MDKLAGMAMFVRVIDNGSFAAAAGIAQVSPAMVAKHIKTIETRLG
FT                   AKLIHRTTRRHQLTEVGQLYYERCKRALSEVALAEASASELQSAPRGRLRLVAPVSFGT
FT                   QILVPALVDYQNAYPDVSIELSLDNNVHDLVGEGFELGIHIGPLSDDSLVARPLTPYRR
FT                   ILAASPDYLARHGRPASPEALTNHLCLGHSYWRMQDRWHLVGPGGEMRDVLISGKFSTN
FT                   QGAALRMAAISGAGIVLQPELLLAADIAEGRLEQVLPEWSYKPVPMSLVYAPNRRPTAM
FT                   LRTVIDFLVERFG"
FT   gene            498111..498218
FT                   /pseudo
FT                   /locus_tag="Rleg2_6068"
FT   gene            498727..499578
FT                   /locus_tag="Rleg2_6069"
FT   CDS_pept        498727..499578
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_6069"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: vvu:VV1_2447 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_6069"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59236"
FT                   /db_xref="InterPro:IPR041394"
FT                   /db_xref="UniProtKB/TrEMBL:B6A4A3"
FT                   /protein_id="ACI59236.1"
FT                   /translation="MDDSHDPALNKSTLPRPARTKPLVRHILPSDNHGFIGRVYDLSIV
FT                   SLNFDSYEEMAQYPDVKYALEVNYALKGLTRRVESLNLAGGLIWPERLPESFKDFAVSR
FT                   YEWLTIAADVFLMRYTSVVDCALIFASGVYECGLEAKKCSFDQLKKKGVASTALYVLEQ
FT                   MLADQGNLRAERNARFHHGEERGFTEDSQTFEMAARFEQWGSGLTGKNQVGRTINVTRS
FT                   FQEGLVELQREFNFSTKSLVKRLDEFYDILEVEFESRFGPRIQAATHGLNAGSQVRGRA
FT                   RP"
FT   gene            499575..500159
FT                   /locus_tag="Rleg2_6070"
FT   CDS_pept        499575..500159
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_6070"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_6070"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59237"
FT                   /db_xref="UniProtKB/TrEMBL:B6A4A4"
FT                   /protein_id="ACI59237.1"
FT                   /translation="MKHDFSPTTLRRQIAHLSDLDLVRTRYCYQIGSTFVACALVEDSV
FT                   ISSMLVCDRVKVNTVLREDISNWEKLLLKQKQLQDSTLGTLISLLSKQGIAPADLSYLR
FT                   WLKSKRDFFIHRFFHTGAWPGDMSERDVDSLCRTLGALEIIFLRGARRMIHILGRAGLM
FT                   RLEVLSEGVLAFNPDAFEGWDTEDHADSGLR"
FT   gene            500625..501071
FT                   /locus_tag="Rleg2_6071"
FT   CDS_pept        500625..501071
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_6071"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_6071"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59238"
FT                   /db_xref="GOA:B6A4A5"
FT                   /db_xref="UniProtKB/TrEMBL:B6A4A5"
FT                   /protein_id="ACI59238.1"
FT                   /translation="MRVRVICVLILSIAFAAFMPVVMEFGRALYVDDDFGAPASSDLVF
FT                   IAVSVIPGILAAAGLWLADVRQRKLPLLALPLGIIMSIGVGYGSTVFAFRYATARYDIL
FT                   TNDCYYTNALAFQGRTGVFISWGGRTAFHPLEKVRSMILVPAGA"
FT   sig_peptide     500625..500699
FT                   /locus_tag="Rleg2_6071"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.973) with cleavage site probability 0.548 at
FT                   residue 25"
FT   gene            complement(501144..501914)
FT                   /locus_tag="Rleg2_6072"
FT   CDS_pept        complement(501144..501914)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg2_6072"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR
FT                   domain protein; KEGG: rec:RHECIAT_CH0004013 putative
FT                   3-oxoacyl-[acyl-carrier-protein] reductase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg2_6072"
FT                   /db_xref="EnsemblGenomes-Tr:ACI59239"
FT                   /db_xref="GOA:B6A4A6"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B6A4A6"
FT                   /protein_id="ACI59239.1"
FT                   /translation="MQKNAPDFSLEGKVTLVTGASRGIGRACALACAAAGSDIVLGVRD
FT                   VAASAGLVAELEGTGRKVLTVELDIPNKAHIAQAVDAALTTFGRIDVLINNVGVAPGNL
FT                   AELVEEKDLDEILDVNIKGTFLMTQAVGRHMIQRKGGRIINISSQAGTVALRGEAIYCM
FT                   SKAAINHLTRCLAAEWAAYNITVNTVSPTFIHTDGTAPFLSDADNRKATLDHIPLGRIG
FT                   ETDDVVGAVVFLASPAASLITGANLLVDGGWSVA"
XX
SQ   Sequence 501946 BP; 96585 A; 157686 C; 153310 G; 94365 T; 0 other;
     gcagggtcgg tgggcggatg ccagatgtca ggtctgcttt gcttggggcc ggataacccc        60
     agaagcaacc atgccgtttg gcggtgcgct ggttgccgcg cttcgatgag cgtagactac       120
     ggacacgatg ccgaagctcg cgcaggcgcg aaaaccggtt caggaaaatt atcccgaggg       180
     ttccaggcgg cgatcgccgc gcagaagggt cagccaggcc tgcgacactt tctccgcgcc       240
     tgtacccccg atatggcaat cgtcgtagcg gtcgtctcca tcgagcaacg catcggaatt       300
     tacgccctct cgaataccgt ggccgctttt tgacagggcc agttgcgccc gcactatcgc       360
     attgtccgga atatgctcct tgaagccgcc gttgctcggt tcgaggcatt tcgatgcgat       420
     cgaaatgtaa acgggtgccc cgacgccgtg ctgacgcaac gtgtcaacca tcgacatgaa       480
     acgttgccca tatgcctccg cagtgttgcc gataacgagg tccttctctc cttgcaccca       540
     gaggacgctg gttatccgat aaccggaagc ctgaagctgt ttcattgtat caaccagcac       600
     aggattgagg tcaccgcctg ccgcccatcg ggcgacctca gatccggaaa aggcgagggg       660
     ggcgaggatg acgctgtcat tttgtcccga tgcgatcaat ttgttgccaa gaagcgtcca       720
     gtattctccc ttggtatcgg tcgatccaag aagcggcgac gcggcgatga agcactgttt       780
     gccaaaagcg tttataacgc gagcgccata atttgaccgg tgccgttgtc caccgtcgtt       840
     ggccgcattc gattggccaa gaatgagtaa gacggcagtt cgatcggttt gcgtcgggca       900
     ggttacaggc gtttttgttt catccccgat gagtcgttcc ttgtcgtcga aaatgtaacg       960
     gcttggaggc gccgccttct ctgcgccaac cgttttccgc agcacggaaa gttgtggcca      1020
     aggaaagatt tcatgtctcg cgctcgtgcc gccgagaacg tacatggcga tcaaggcgcc      1080
     caggccgact gatattgttt tgcgcatgtc gtttagctcg gaaacatcat ccggtgacat      1140
     ggagcctacg gaccgatcaa ggctgctcca gccatgaagg ttcctttcca ccagccacat      1200
     cggcttgctc gggcatgctc tttaagaaaa gagttcgtcg cgaagatcgg gcccaatcga      1260
     cgactcttca cgtggagtcg ccggaatctg ctctaaacta tagttcggac cagtgattac      1320
     aatcatccgg ttgggtgaga gatcgtgcct gctctgcagg atgcggcctc ggaggatgag      1380
     gcgggcgctc gggcgctggg cgctgataca cgcaagaagc agcattgcgg cgtgcttcga      1440
     ggcttcgccc ttccgggcta cgcacctcag catgagggag gttggaggat gccgcaccca      1500
     acaacaggcg cttgagatga ccatatgcaa atcacgaggt cggaggatgt agcgccgggg      1560
     tccaagagag cctcatccag aggtgccccg gaggggcctc gaagggcgag gcgggtgttc      1620
     aggcgttgat acatgcaaga agcagcgttg cggcgtgctt cgaggcttcg ccctttcggg      1680
     ctgcgcacct cagcatgagg gaggttggag gatgccgcac ccaacaacag gcgcttgaga      1740
     tgaccatatg caaatcgtcg gtcggagaat gtagcgccga gacccaagag agcctcatcc      1800
     tgaggtgccc cgtaggggcc tcgaagggcg aggcgggtgt gccgacatca ggtgcagcaa      1860
     aggcattgta ataacgtcgc gcctccaatg agaacgcacg gcacctcttt ttcatctccc      1920
     ttcgttgccg gcttcgcgcc acgaggagag attgatcagc tgcattgccg cagttcgggg      1980
     cagatttatt cggacatgct tgaagaagct tacctcctcc caatcattat cttattttcg      2040
     agtcgccgcc cccgcatgtt gagataaacc cgtccgttcg cgcccctgaa agccaggccg      2100
     tactgcaaaa cttcggcaca tgcatctgga ttatctccgt cacccataaa cttttcgacg      2160
     caatgcatca gaggttgaac ggcatagtag tcgttttccc agtcgctaag ctgcttgttc      2220
     aagatcgcgc ctatgcgttt tccctccggg gaaaagtcga ccgaatacct gctcgtcgct      2280
     cgggcgaggt tcagcatggt aagaagctcg ataaaccttg gcttctcctc ataattgatt      2340
     tgattgtccc aatagccacg cacagcatca acgtgttctt tcggaaaatt gtcgagtgaa      2400
     tccatgtacg gaaaacctgg tgcatcgcta gaacgcttca atgtggcagg aatggatttc      2460
     ggcaacaaga tgctgcggta gcgacaagtc tactgagggc cgtcagcggt cattggcggg      2520
     cgacgctgcg agcagggcta cagattgacg atcagcgccg cgctggcggc ttcaccgcag      2580
     cacggcgcgc tgcagcgcga accgcgccgc cgggcagttg atgcacctcg acgatcgggt      2640
     cggccgcccg cgaaagggcg gcataggttg catcaccatc gcggccgaca cagaagccga      2700
     cggcactgtt gaagcgcctg cgccgtctaa aaggcagttg ccggggttcg tttcccacgt      2760
     tgccagttcg ccttgatgtg ggatccatat tgcctggacg agcggaagga gtcgatttaa      2820
     accatacctt gcaattaaac gtgattgacc gcaattttct tagggcgctc gcaatgaata      2880
     tccccccgtt tgggaaacga aaatccactc cgttgattgg ctggtggtcc atgcttgagg      2940
     aggaggaacg ccttgttcga agcgatggag cgtccgtcca atttctcgga tttgtcaatc      3000
     aaggtgacga gccggggaag agggggttga atgatcgtcg ttggatgcgc ttcgaagcag      3060
     atgacaccat ccgttcaatg caattcctgg tgcaatggcg tgatgttttt agtccgcaat      3120
     cgccgcgcgc cctgatctgg cgcctcgatt atgctcgttc tttggagcag tccggtatcg      3180
     ttgcattgga ctatcaggaa tgggtcgcga tggatcggtt catttgcgat gctctggttt      3240
     gctggcccca gcgcgaggtg acgggtctcc gcccgacatt gattgcggtc agcggcggtt      3300
     ggcatcaagg gcaatggcgc gaagagtact accgcacctt cgacatggcc tatctcgggg      3360
     ggcgagtcga tgagacggtg tcaaagccgt cggttattcg ccaagagacg ccccgtcaat      3420
     ggcgcttcgt cccggcaact caagaggcca gtgccgaaga cattgtggcg atccatgaaa      3480
     ggttagctga tgcaaggccg gaggcgattg aggcgctggt tgtcggcctt ttgccaaaac      3540
     gaccgcactt gcaatcaggg gaacgctttt tggtcccgct gcggcagtac ggagggcaaa      3600
     cacaatggct ttacatagac gacgagatca tcaccgatcg cattgttgca cacacccata      3660
     agccaagctg gatgtttcgc atcgataacg cagcactgat cggaaccatt gaccgaaaac      3720
     ggaggactga gtttaaattc gaccacgctt ggcagccaaa aaaaattggt gcggtgaagc      3780
     gggagtatgg aacgttttcc cacgtctttc ggaaccgcct tcgggacctt tgcgagaacg      3840
     gcctatggca atgggaggag gtttgccttc aactccattc tcccgaatct gagggtaagg      3900
     gcagcgtaaa acagacctgc attcaacgtc cgaagcgggt taggctcgac gagatcgttt      3960
     ccgttgctgg acgtgttgct accgtcagac ttgtcattgc cgaatcgctc gacggcagcg      4020
     actacgccga taaaatattt tccgatgctt tcaacgacaa cccggcgccc ttgaacagct      4080
     cggagtggga gcaattcgaa tttcaggcgg atgcattttc gttgatggac ggaagcactc      4140
     agcaacagct tgagttgcgc gaaatcgttg cggggagtgg aagcgttaca gacggctgcg      4200
     agggtctctt ttgctatcga gacaatgaca gtgaatatct tcttgtggtt atacgggaag      4260
     gccggcgcgc caaccatcaa gccggcaagt gggtgctgga tcacaacgca tcacgatcta      4320
     aaaaccagca gtcaggcgtc ccgccgatat cggacgaacg ctggtatagg atggcaaggt      4380
     tttcgaggga cgctcttctc gcttggccgg ataccgatat atttggtccc ggcccctccg      4440
     gtctcgcgga attgggcggg tgctttcaag ggcgatggga gccggaatta cgccgttggc      4500
     aacgtaatca cctcaagact tcggagaatg atccgtccac cggcagatat aaccctgaag      4560
     ccagtttgct cctgccatgg aaagcattcg atcccggcgc agatgtcggc gccccaagtg      4620
     agaggattga ggcggcgctc cggagactgg cggatcgaag tgccggtgac gagaatatcg      4680
     gccaaacgag acgattgcgc tggctcagag ctgatggaag agcgatcttc tatctccacg      4740
     gttggcagac cttacgtgca ccgcccgacg gcgatcctta tcaggccccg gtcttcgagt      4800
     atctcgacga cgacataacg gtacatttat atcccaaaag gtttgatgag tacgacatgc      4860
     aatccctcgc gctgattgag gtcaatccgg cgtcaggcct ctatggcaaa gtagaaccca      4920
     cgcagagttt gtatcaacaa cggcgtccta ccgaggaaat ctggtaccgt gtggtaacag      4980
     cgatagagtc gcaaatcgac cggatttctg agcagttggc tatccatggg ctttatacag      5040
     tccacggcta cgacggctac gcaacacgga cactcgtgct caatcgatcc taaggcggct      5100
     ccccccaaac gcaccgctta tctgccaagc gtgtccttga tcaccgccgc gccggcggct      5160
     tcaccgctgc gcgccgttgc agcgcaaagc gcgccgccga gcagttgatg tcgggcacca      5220
     gatcgtaggt ctgctggtag aggctcagcg ccagcgtctt gttgccgcgg ttttccgagg      5280
     cgagtgctgc aagtgccgtg cgtttgtacg cctcgacgat cggctcggcg gccttcgcca      5340
     gcgcggcgtc gtccgatggc tcggcggcca gcgaaagcgc ggcataggtt gcatcgccat      5400
     cgcgaccgac gcggccgccg acggcgccgt tgaagcttgc ttcggagacc tggcgcatgc      5460
     gccgggcgtt cttgatgcag gtcgggatgc gggcggcttc ggcgttgatg cgctcggcgg      5520
     tcgggccacc ctcggtgctg ccgctatccg acaggatgac gtagccgata atgccgacga      5580
     tggcgagata ggcaagccct atgccggcga ggaaggccgg ctgcttcagc agcggcttct      5640
     tcggcttgtc gtctcccgtc ttggaagcct ccttcttcgg cgcctccttg gcggcggctt      5700
     tgacgacgaa ctggaattcg acatccttgc cgagacggaa gctgtcgccg gctttcagcg      5760
     aggctgtctg cagcagtgct tcgccgcgca gcatgatcgg gttcagcccc atgcggcgga      5820
     tgatgaagcc gccgtcgctc tgtttttcga tgcgcgcatg gatcggcgcc agaaagggat      5880
     cgtcgacgac gatatcggca ttcgccgccc ggccgatcga catctccggc cggtcgagca      5940
     catggctgcg gctctggccg ccgggaccgg tctgcagaag gcttggtttg tttccgcgaa      6000
     agaaggaaaa ggccatgatc agaacatccc actcgacatc atctcgacaa ttgccggcgc      6060
     cagtaccaga agcaggatcg acacgacgat catcatcgcc ggcatgacga tcttggcttt      6120
     cagcttttca ctggccctgt cggccttttc ccagcggcgg aagcgaaggt cgcgcgcatg      6180
     ttcgcgcaac agctcgacgc ggttgctgcc ctcgacctcg ccctggatca ccgcacggat      6240
     gacgcggatg acctcctcgg cggtcatgcg ccgctccaaa cgctgcagcg cctcgaccat      6300
     gccggtgccg agcgccacgt ccttcagcgt ctgatcgatc tcttcgctca tcaccgtgcc      6360
     gggtgcagcc tcggcataaa gcctcaggct ttccgggagc gttgcctgcg cctgctgggt      6420
     catgacgacg agatcgagga aatagggaaa ctcgcgcgaa atgcgttcct tgcggtcctg      6480
     catcttgtcg tcggcgacca cccagaaata gatggcgggg atcagaccga ggatcagacc      6540
     ggcgaccaag ccgccgatga tgctgccgct cgcaatgccg aacagcacgc cgagcaggat      6600
     gaagccgaag aggctgagga cgacgagaag cgcgatatat tcgcggcccg tgacgccgcc      6660
     gaagggccgg ccgccataga tcagcttctg ctcgagctgg gcgccgtaat cggcgagcca      6720
     cggctcgaaa tgcagcagca cgaattcgac cggcgtgcgc atgccgatgc tgtcgacgac      6780
     attcggcggc ggcccgtcgc cgccgcggga ccggcgcacc acctggatgc tgccgagcag      6840
     atcgccgatc caccagacga acagggcggc ggtgatgccg gcaaagacga cggcgatggg      6900
     tgcaaggggt atctgagaca tcagaccgac accttcatca tcgagcgcat ccagaagaaa      6960
     ccggtggcat agagaatggc gccgacgatc gcgatgacga tgccgatggc gttgccgaac      7020
     accttgtcga tcagctcggg ctggccgaag aagatcatta ggatcatgaa cagcgcgccg      7080
     ccgttgacga cgcgaaagtt catgcgcgcc tgcgacgacg aggtggtgat cttctggtcg      7140
     agcttccaga tttccttgaa ggatttcgac atttccgtca gcggctcgga aatatcgccg      7200
     ccctggcggg caaagagacc aagggccgca tcgaccatct tgaaatgcag gctcggcacg      7260
     gtgcggccgt ggcggtcgag cgcctcgacc aggccgatgc cgagcttctg ttcgcgggcg      7320
     atgcgctcga attcgcgcga ggccggcatc tggccggtat cggccaccgc attgacggcg      7380
     accgcgagcg gcttgccggt gcgcaccgcc gagacgatct ggtcgacggc atagggaagc      7440
     tgcgattcga tctgcagcca gcgccgctgc aggaaatagc ggatgaccgc cttgggcagg      7500
     aagaaagcga ccggaatggc gatgacgatg ccgaagatcg gcccgaagat cagcgagacc      7560
     accaggaaga cgacgattgc cgtgatgccg taggcaagga tcatcgtata gggcggcacg      7620
     gcatcgcggc cgaacacctg tgccgcttcg ctggcgagcg caatatcgcg ttcggtggcg      7680
     cgcagcagcg gcgccggcca gcgcaccggc gcaccccaca cgagcagccc cgccgtcacc      7740
     gcgccgaggg cgaccgtaaa aatctgcaga atgctgatat ccatggcttc ccccttaaaa      7800
     acaaaagtaa ttcttcgctt ccgcgaaacc tgaaccgcct aaacgaacat atcgagtttt      7860
     tcgatttcgc cgtcttcgcc gaactcgacg agctcggcga cgaagctcgg cagatagccg      7920
     gtgaaggcat gcaccgcctg gccgccggcg cgcccgacca gatggaagat cggctcgacg      7980
     atgacgaggc cggtatccgg atcgatgccg atcacctcgg atatttcggt caccgcgcgc      8040
     cgcccgcttt ccaggcggtt cagctgcacg acgagctcga cggcggcaac gatctgctgg      8100
     cggatcgcca tgaccggcag cgagctctgc ccctgcagca ccatcacctc caggcgggtc      8160
     atcatgtcct gcggcgtatt ggcatgcgcc gtcgtcatcg agccggcatg gccggtgttc      8220
     atcgcctgca gcatatcgat cgcctcggca ccgcggcact cgccgacgat gatgcggtcg      8280
     gggcgcatgc gcagcgcgtt gcgcacgaga tcgcggatgg tgacgctggt ttcggactcc      8340
     gccgtcttcg gccgcgattg cagatagacg acatgaatgc cgtcgagctg cagttccgac      8400
     gtgtcctcga cggcaacgac gcgctcgccg atcgggatga actgcgacag gctgttcaag      8460
     agcgtcgtct tgccggagcc ggtgccgccg gagacgacga tgttcttgcg ggcgcggacc      8520
     gccgcctcga ggaaggcgcg catcggctcg ctgagtgcgc cggccgtgac cagcttggag      8580
     atgtcgagcc gcgacttgcc gccgaacttg cggatggtga ggcaagcgcc cttgaccgcc      8640
     agcggcggaa tgacggcgtt gacgcgcgat ccatccggca tgcggaagtc ggccatcgcc      8700
     tcgctctcgt tgatcgagcg gttggaatcg acggcgatgc gctcgatcac cttcatcagc      8760
     tgccgctcat tagcgaaggc aaagggataa cgttccagca ggccgaattt ttcgacatag      8820
     atctcgtcat aacgcgtcac catgatttcc gagatgacat cgagatccat cagttccgag      8880
     atcgtgcccc agcggtacat cagctcttcg atattcgaac gtagatgcat atgggcgatc      8940
     tcgtagcggt cgccggcatt gaacagcgcc tggcgggact ggaaggcggc gctgaagcgg      9000
     gtgtcgagct gggcgaagtc ggcgcgggtg gattcgaaat tcagcttcag ctgcagcgcc      9060
     gagatcagcg ccttgccgac gtcgaacagc cggcgattgt cctgctcctc gcgcgacaag      9120
     ctggcggcag ttgacgaggc gtcgcgccgc ccggtgcggg cgatgcgttt tgccagccac      9180
     cgatagacgg cgttcttgat gacgaggatg acgagatcct gcggcgcgcc gtcgagcgct      9240
     tccttgatga acatgtcgag ccgttcgcgg atgcggtttc gcgtatcctc ccggccgaaa      9300
     tcagaggatt tcaccagccg gtcgtattgc gtgtccttca gcagtcgctc gtggatctcc      9360
     atctgcaagg cgagtacgcg ttcctgatcg ggaaactgcg tcaccgcttc ggcggccgcg      9420
     gccggttcga cgagttcgat cgtgacgttc ggcacccaga tcgacatgcc ggcggaaacc      9480
     gcaaccggcg tgccggctcg aagcggctga tcgtcgacgc gggtcgggtt gcggccgtga      9540
     tgctgcaccg accagccctg gccggatttg cgcagcacga attgcggcga ggagacgtgg      9600
     ctgccgcgca gccgcaccac gccggcgccg gccggcagcg tcagcgtgct gctttcgccg      9660
     acgaaatagg tctcgtttgc cgagagcggg atcacctccc ggccgctgcc gtcctcatag      9720
     gaaatcttca acagcatggc ttattccccc gcaacgctta catgcgcgtc cagttgatgc      9780
     tcggcagttc ctcgacggta ttgtcggccg gattgcgcag caccaggttc aggctgccgt      9840
     tcgactggcc catggcaaaa atcagcatct ccgcctccgc cggcgtcact tcgacggtga      9900
     cgttgttgta ggtgctgttc gccttggtga ccgcgccttc cgccgtcgtc gccgcgccga      9960
     ccgccagcac tttgacattc tgcaggaagg tgcgcgtgac gacgcgggtg cgcgagctga     10020
     tgccgagttt ataatcctgc gcctgtttgc ggtaggcgtt gacgtcattc tcgtcggcgc     10080
     ccggatattg ggtgagatag ttcttcagca tctgttcgac cggcgagggc ggctgggccg     10140
     gagcctgcgg ctgcccggct gcaactggcg cttgcccggg aacggccggc gcctggccgg     10200
     gcgttcccgg ctgggctgca gcggccggtg cgacgggctc gaccggctca tcgaccgtgc     10260
     cgagaatatc gacatagctg cccggctcga cgaagtgccc gacggccgag gccgcgttga     10320
     cgggaagggt gagcgcccgt tttcccggcg cgatcatcgt cgtcaggcgc ccgccgtcat     10380
     tgtcgtcgaa atactggaaa agcagcaccg agccggccgg aatgtcggca gcggccgtcc     10440
     tgtccttcag ccattcctgg taggcgctgg cagccggaac cgcgagcttg gcaagcgccc     10500
     cgaagctttc cggcagcatg accggttcgg cgagcatatc gggggtgatc gcctgaccgc     10560
     gcgtcacctt ccggtcgggc tggagccgca tgaaggcata ggctacctgc tcgttcttga     10620
     cgctctcggt ccagaagtag agcagaacgc cggtgatgag cccgacgatg acggccgcaa     10680
     taagcttcca gttcatggtg ttattccccc tacgaagggt tgcctgattt gaatgacctc     10740
     gacggtccgg ccgtcgctct tgctgctggt gtagagaaca ttggcctcga cgctgccgcg     10800
     acggccgtaa agggcagtga ccccgccgcg ctgagccggc ggcgcctcga tggtgaagcc     10860
     gtcacgggtg agaagctcgg cgcgcgcatc cgaccagcgc accgccgaca gcgagccttt     10920
     cgagacgacc gtgcgcgagg tatggccctt gtcgcggtcg ccgatatcgc tcagcacttc     10980
     gacaccggcc ggcggacgca gcgacggcgg cagcttgccg gcatcggcgg gtgctgcaaa     11040
     ggccggcagc gacgacgcca cgtcctcgaa gcgggtcatc agcacctcgg tcaccggcgc     11100
     accggcgggc ctgcggatca tgatcgagac gccggggatc ggcgcccttg ccgagggatt     11160
     tgccgggtcc tgccgtctca tataatcgag cgctgcctcg ccgtcgccat cgaagaagcg     11220
     gaccaccacg gcaagatcgt cgcggatgcg gctggtcttc ggaacgatca gcatgttggc     11280
     ggcgatgacg gcagtcagtt cttccctgtc gttgcttttc ggcagggcag ggcgggtatt     11340
     gacggccagc acccgcagcc attcgtcggt gatatcggaa atgctgcgat cgctctgata     11400
     gggggtgaat tcgagcggct ggccgttgat gaccagatcg cgcggcgccc gctccggcgc     11460
     gccgagaatg ccggccagca tcgaattcag cgtcgcccgg aaatccttgt agacctcggc     11520
     gcggcccggc gtggccgcga ccatggcgac aagcccgata ccgaacgcgg tggccagcag     11580
     atgaacggag atgcgcgcgc cctgtctcat cttatttcgc tcccggaaag acgccgtcga     11640
     acagatcgcc ggaatcgtcg gccacatcgc ggatttcgcg gcgcagcgtc gggtcgtagc     11700
     cgcggcgcgt cgtatcgttg ttgtgcgagg caaacagcgt tgcatcgtcg accgtgaagg     11760
     catccttcca gcggatgctc ctgatggtat cgaggtcgtc ggaatccctg aacttgtaga     11820
     cgcggtcggc cgtcgcggtg accagttgcg gcttttcatt ggcgaggtcg ccgaccatgt     11880
     cgccgaagtc gcggccgtcg cttttcagcg tgttttgcac gtcgtcccag acgaaggtgc     11940
     gctgggggtc gccgtcgccc tcatgcgagg gcgtgcgcga gcagctcatg gcgtcgcgtc     12000
     cgggcagcgc cggcagagag gggagtggaa agacgttcga gaaatccgac gtgcagtcca     12060
     gtccattcgc ctcggcgaag gcggcgttgc gcatcgccag catggtgccc accttcttgg     12120
     tggagatcct gttggcatgg atcatgaaga tcacgatcag caggatgacg ggtgcggcga     12180
     gcacgaattc gatcgaggcg agaccccgcc tgtcgcggtg cagccgcatc atcaggccgc     12240
     cggccggcgc gccggcagga tcagtgtgtg ttgacggcag cccaggcatt ggctcctccc     12300
     ttgtcgaaga cgcgggtcag gccggtgaaa ctatcggcgg ccgggctctg cttgatggtg     12360
     ttcgaaacct cgccggtatc gtcggcgagc gtggccggcg caagcgatgc cagccagtcc     12420
     tgcgtgtaga gatcgaaggc cgtgtaatta tggacccagc tctgcgcgag cgcataggcg     12480
     gatggcgtct tgtccttgaa gatgcggatc tgcagccggg cccgcggcgc acgcgaaacg     12540
     atcgccagcg tctgatagtc gtcgagctgc tcgccgccga agggcgtgaa gttgaagggg     12600
     acacgtccct tcagccagta aggcttgggg aaggagatga ccggcagggc agcacccgcg     12660
     acagagatcg ccgcaccggc cggcccgcag acctggttcc agatcatgtc gaacttacgg     12720
     gtgaaatcgt tctcgtcctt tgtctgtgag tccgaatagc gcggcggcac gtcgatcggc     12780
     agctggaagg ggttcacgac gccgaactcg atgccgaaga actcctcggc tacgaagaag     12840
     ctggcatcga gcgtcagttc ctcccaccag ctcagatcgg catattgctc gataatcgcc     12900
     ttgaacggga tcttgctcaa gtaagccggg ccgaaggctt cataaaagat gtagaaattc     12960
     accagcgtac tgtcgatgcc gctcttgtgg ttgacaaaat cgcggatatg gctgccgtcg     13020
     acgccgcctg cggtcagcgg acccttgccg ttggggaagc cgcgattggc gaattcaccg     13080
     cgcatcagga acgggtcctg cccctcggtg cccctgctca tcgcaaggca catttctgca     13140
     taggccgcag cgggattaac gccgtcgcga tcgaccggca ggttgccgcc ggcaccttct     13200
     ccggcgtcgt tgcaggattc gcacggcgga tggaagacga catgatccgc cttgttcagg     13260
     cgcaccagat gcagggcttc gttgccgacg cgctggggaa agctctcgac gaggtagtcg     13320
     ttgagatcgt tcatgccgtc gatgatgtcg ctggacttgt tgatcaggcc ccagggatca     13380
     taatcgatct gtgctttcac cgtgtatgcg atggcaatgg ttgcttccgt cgcccggaac     13440
     ccctgaaacg ccaggcaagc gccgtaaatg atgccgccga cgatcgggac tttctgccag     13500
     cccgggcaat agggcatcgg cggcatcggc ggcagaaggg acgccgggcc gaagccctcg     13560
     gtgaaggaat attcggcaag tttcgccaga atggcggtcg agcgcagggc cagttccgcc     13620
     gtggtgagct ggaaggcaac cgaggtcgcc atgacaacgg ttgcctgcga ggaggcgacg     13680
     ttgttcatcg ccatgatgtt gagataacgc gcttcccagt cggcatggac gagcgcggcg     13740
     gcgtcggccg tgtcctgcgt gcgctgcttg tcgtagatca tctgtcccgt gttcaggatc     13800
     cagacgatca tcagcgcaag cgcgatggtc atgtagagaa tgatcggcga caggaagccg     13860
     cgttcgtcgc ggtgcaggcg cttgatgagg gtcggtgtca tagcaggttc acctccgcct     13920
     tcgagatcgt gtaatagcgg ccgtctttcc tctggccgcg ggcaaagacc cagccggcat     13980
     attcgagcag caggaagcgc gcttcgacct tggcggtcac cggcacatgc ggcgagcggt     14040
     tgatggcggc atagagcgcc atcggcgcgc ggtcgacggt cacggtgacg ttctgcgggt     14100
     cgaacatgta gcgggcctgg ttgcgcatcg cccgccagtt cttcgaaagg ccggaggcat     14160
     cggcaaggct cttcagcgct tcttccggcg gctggcaggc gccgacacat ttcagctggt     14220
     cgtagggggc agccgggatc agcgccaggc gggcggcaag atcggctttc ccaggagcgg     14280
     catcgtcatc gcaggtcttg acgtcaatga agctccggat ggtgatcggc aaagccgggc     14340
     agaaatagac gcgggcgctg cgggccgccg cataggcggc ataatgggtg aagaggtggt     14400
     ttttcgccag gatcgcgaac tggaacacca cgaacatgaa gaagacgaag accggcgtga     14460
     cgagcacgaa atccatcatc gtcgtgctgc cggagctatc accgtgcagc tccgagatcc     14520
     ggcgccggcg ggcggaaagc cgcggcagca gcagcatcga agcaagcagg atcatcgcga     14580
     tcgcaaaggt gccgaagagc gcgccgtgat cctcagggat ccagaaggtc cgtgagtgca     14640
     ggatcgaact ccagaaggca ccgtcgaaga gggggcgttc gagttcagcg cgcattgccg     14700
     ttacctcacg agtgaaagag gggtggaatc aggcataaat aggcaccaga aaagcccgag     14760
     agcggcggca acgccgaagc ggacggtatg atgtgtctcg cgcggcttca gcaccgaagc     14820
     ggcgtcgcgg aaaccggcgg gcagaagcag ggcgaacagt ccgacgttcc tggccagcac     14880
     gctccactga acacgccgcg ccatcgagaa tagggcgatc acgccgccga ccatcagcga     14940
     tgcgagcgtc acgtcgatgg cgggccagag gccgagaatg gcgccgagcg ccgccatcag     15000
     cttgacatcg ccgccgccgc agcttccggc tgcgaaggcg atgatgaaga tcatgccggc     15060
     cgcaatcagg ccggcaaagg caaggccgat ccctgcgaga cctccgccgg ctgccgccag     15120
     catgaagccg gcaagcaggc agggataggt cacggcgttc gggatgtgac cctggcggtg     15180
     atcgagcacc gccgcggtcg tggcgcaggc gacggcaaga gccgccgccg caggcatcag     15240
     ggtcagatcg taggtcatat ccatgacacg ggatccgctt attgacccgg ctcgggaatt     15300
     ctctcagcgt cggagagagc cgtgttcttt tcgttgaacc attcgccaat ctgtttgccg     15360
     aatgcgagca gaagcagcat cagcggaatg acgatcaggg cgacggcgag gacgatctgg     15420
     gccatgtcgc cgcgttcgtc ctggtgaagt gcaattgcga gagtcttgag ttttccaaac     15480
     atctgcgtat tcctcgttcc taggtttgtt tcggatcgaa gacctgagag aagattacca     15540
     agcatacggt atcgatccga accagcacgt tgctcgttcc aatgatatgt tctgcttcag     15600
     cttttcttcc ccggcggcca acgcttgttg agcaacacca ttaagaccca agagtgcgcc     15660
     caaggccagc cctccgtcaa gcaaacggaa cgaagggttc caattgtctt ggaggcgtct     15720
     cttgatgaaa cggagttgac ggcggtaatt ttcaactaac cgcctgaaga cgctatagtt     15780
     ttacccgaag aagcaacttt gtgacggctt tgccaactgt cgccgactgc cccataattg     15840
     gtcaattctt tcaaggcgat agaatagaca ccacagcaca ggccctatcg gccgctcgcg     15900
     cgggacgcgg ccatggcgtt gcttggcgat ctggattaag cttctccgac attatgggcc     15960
     tcgcccttca gtcgttccgg agaaacgaac catggaaacg atgagcagca tcctgatact     16020
     tgcattggtc ctcattccat tgatgatgtt ctttccaacc gcagttcaaa tgatggcgac     16080
     actgttcggc atgagcacgg ttctggtagg gatgccgctc tgatgaaggc cgtttccgac     16140
     gacgccgccg aacaggcgac ctttcaggtc ctgacccggg cgctggacaa gctcttgggc     16200
     ccgatccgct ttctcctcga ggatccgagc gtgtcggaaa tcctgatcaa cggaacatcc     16260
     gacatcttcg tcgaaaggcg cggcaagctc gagcgcgccg atacgcgttt tgccagccgt     16320
     gaggacctgg aatcggccgc gcgcagcatc gcgcagttct ccggcaaacg gctgacgccg     16380
     gaggagccga gcgtcgaggc ccgcctgccg gatggttcgc gcgtgcagat gatccagccg     16440
     cccgccgccc gcaccgggct ctgcatctcc atccgccgct ttctgaaaga acatcgcagc     16500
     atccgcgatc tcgtcaccca gggcagcctg accgaagcgt cgctgtcgct actgcaggcg     16560
     gccgtcgggc tacagaagaa cgtcatcatt tcaggcggca ccggcaccgg caagacgacg     16620
     atgctgaacg cgctgtcgga agcctttgcc gatcacgagc gcatcatcgt catcgaggac     16680
     acctcggaac tgcagatccg caaggagcac gtcgtctatc tcgaagtgac caagcccgac     16740
     cgcttcggcc ggggcggcgc cagcatccgc gacctgttcc gctcgtcgct gcgcatgcgg     16800
     ccagaccgca tcatcgtcgg cgaatgccgc ggcggcgagg cgctcgatat gatccaggcg     16860
     atgacctcgg gccatagcgg cagcctttcg acggtgcatg ccaacacacc ctacgatgcc     16920
     cttcatcggc tggaaacgct ggcgctgatg tcggatatcg acatgccgct ccggccgctg     16980
     cgcgcacaga tcgcctcggc agtcgacgtc gtcgtgcaga tcgcccgctt caagcgcacc     17040
     ggacgacgcc gggtgatcga gatttccgag atcaagggcc tcaacgagga cggccaatat     17100
     atcgtcgaga gcatctataa gctcgaaggc gacggtcatt ccaattccga tggcgcattg     17160
     ctctggaccg gggtcgtgcc gagtttcgcc gccgatgcgg tggaagaact gcaaggcgca     17220
     gagcgcgcgg aatggatgga gcccgccgcg cgggaaacgg cttgaagcct attggcagac     17280
     gttgggaatc tggtgccttc gagggaaggg aacttcgtcg accacttcga cgagactgta     17340
     gtgctcgatg tgcgcccgca cgtgaaggcc tcggctgaga ggttcctgaa aggcaagcgt     17400
     gtttgccttc cccggttgtt taccggcgct ttttacgcca gagcgcattc tgctgccagt     17460
     cgccggccat gatgctcccg tatgggatct ttcgcagcgc tcttgtaggc actcggcagt     17520
     tccgacacat cggcgaaacc atccaatcct tcattcacgc cagagctact gtaagctgca     17580
     aatctacgat gttgcctcat caatcacacg ccccatggca tatgacggct ggtaacctgg     17640
     caacacgttg ccagtgggtc tgatggaacg catcaacgcg tctcgggact tacctgcgat     17700
     tgcacctgct tttcgcaagc caaaaacgta aggacccacg tcagcaggca gtgaattgag     17760
     cgacaatccc aactctttat cggaaagatg ggcgacagat gctgccagtg cagcgacctt     17820
     cctttccatc gccgcgtatt ccttcgtcag gaggcgtacg atgttgtcaa aatcgctcca     17880
     aaactcttcc ggcaaatcac gacgaatcgc ggccatgtcg tccccagcgg ccattgcttc     17940
     ccacattgcc aatggcgtgc agcgtgagat caacgcatgg atacgacggt actcggagcc     18000
     tttgagtttg aggcgcaagc catttgtgaa tctaacgaca aacccctcgt tgtcgcgtgg     18060
     gagcgttgca gtatggagca tcatgtccgc catattcccg aactcatggc gttcggccgc     18120
     acgccatccc aacgcttggc tggtcgttcg aacctcgtcg taggttactt caagacctga     18180
     agcgtggtag gccgccaaca tcaccatggc aggctccgca tatcgcacga caattctgtt     18240
     ttccggatat accgcctcga acagatatgt cgtatccggc gacagaccgg agagatcgtg     18300
     ggcatccaag cgtgcttgag cccatagggc ctgttcggag tcgaacgcgc ctttggtggc     18360
     tgcgtgccaa cggccagcat cattgaacac gattatcaga ctaccatcga gcttttcgaa     18420
     cgcctcaaac ggcagatcgg gcacttcgcc atgccgctcg ccgacattga aaaacttcgg     18480
     aaacggcgtg gcaacgaccc gaccagcgcc ctcgtccaca atgagaccgc gagcgatcag     18540
     cgaaaactga tcccaaccat cctcatatac gcaccggggg gtatagatgt agagctgcaa     18600
     agtaccggtt gcgttctgac ggcgatggac atggccaagc ccttgggctc gcttcaagcc     18660
     agcgataagg tcgggaaacg ggatttcgcg tgcagggtgt atgcggtcgt tcatctgttc     18720
     acagcaccct gttttatcgc cttcagaatt aattttggct gaatttatca attgttcagc     18780
     cgctctacgc cgtcaaacgc gatttgctaa taggtttgat tgaccgctct gatggatgca     18840
     acgcctattg ggttcggacc caacacagcc tttgccaatg atttcgctac tggcgttcgc     18900
     gatccccgcg tcgaagcgtg aatccgattc gagagaacgg ttcgatcaat catgctcaaa     18960
     gaatttatct cgcggcatta tctaggctgc cacaaggtgt gattggggca ccgcttacct     19020
     tctgctccat cgtcagtccc taaaaaattt cgccgccatc ctctccgctg tagcgaattc     19080
     tcgtggctcg acggtcaacg gctgcgtgcc accggccgga aagttgaacc ttccagctat     19140
     ttcgctcaat cgccgatctt tatgccggca cgaccctcac gcgccttcct tttcagcgct     19200
     cgccgccata tgcctgagtt cgtcccagag gctttcggcg aagctgcgca gaacggtgag     19260
     ttcgaagctg tcatcgccgg tgcggacgat ctgtacggag atgtgaccca tcatggtcat     19320
     cgccgaatgg ccttccggga agacggaagg atcgaggtcg acggcggtgc cttttgaaag     19380
     aagcagccgc gaatatcggc cggacacgcc gatgcgcacg cgcccgtggc tttggtccat     19440
     gacgaaggct tttccggcga gcgccgtcgt cagcgcatcg agaccggcgg gggaaagcgg     19500
     ctcgttgccg gcgacgaacc attggcggaa gccggctttg cggatcgaac tattggtaaa     19560
     gccggctttg gccaattccg cggcgagagc cgccggctcg atcgtgccga gcacgtgcag     19620
     gagatggcct tccggcaggg cctccagccg gatgcctgct ccagaaatgc cactatatgc     19680
     cgtcccggca agaaccggtc tgtgctgggg aagatcaggc atggagcttc tcgttttcgg     19740
     gatcgatgaa gacgggatgg cagagcaccg catcggtgaa ttcattgcgc aggccgttcc     19800
     agaccgtcac cttttcgccg atgcgctccg gcccgcgcct gaccagcgct aggccgatcg     19860
     tatggccgag cgtcggcgaa aaggcgcttg aggagatgta gccctggtcg ttttcgagcg     19920
     tcgccgcggc gccctcggcg agaatatgcg agccggtgcg gaagccgctt gccggattga     19980
     gcggcttgac gccgacgagg cgtgggcgct cgggatcctg cagaccttcg cgggcgagca     20040
     tcgccttgcc gatgaaatcc ggcttggtcg atgaaaccat gcggccgaaa ccgagatcgc     20100
     ccggggtgac cgtgccgttg atctcggcat gggtgacgtg gcccttttcg atgcgcagga     20160
     cgccgagcgc ttcggcgcca taggcgcaga tgccgtgttt ttcgcctgat gccatgacgg     20220
     cgtcggcaac gctctcaccg tagccagccg gcacggccag ctcgtaggcg agttcgccgg     20280
     agaaggagat ccggaagagc cggccttcga gacggccgcc gaagagcgaa accttgcggg     20340
     cgctcatgaa ggggaaggcc gcatcggaca aatcctcgtc gacgatctcg gcgaggatgg     20400
     cgcgggactt cggcccggca atggccatct gcgcccattg atcggtcgag gaggcgaagc     20460
     agacgtcgag ctccggccag agcgtctggg cgcagaattc gagatgggtc agcacaccgg     20520
     cggcaagcgc cgtcgtcgtc gtcatgaaga aatgctcgtc gccgaagcgg ctggtggtgc     20580
     cgtcgtcata gatgaagccg tcttcgcgca gcatgatgcc ataacgcgcc ttgcccagag     20640
     caagcttggc gaagccgttg caatagatcc ggtcgaggaa ggtcgcggca tcgcggccga     20700
     agatttcgat cttaccgagg gtcgagacgt cgcagaggcc ggcgtttttg cggatgttca     20760
     gcacttcgcg gtcgacgctg tcgcgccatg tcgcctcacc tgcgcgcggg aaccaggagg     20820
     aacggtacca gaggccggtt tcaacgaaga ccgcgccgtt cttcttagcc cagccgtgca     20880
     gcggcgattt gcgcgccggc tggaaatcct tgccgcgtga tgccccggtc aaagcaccaa     20940
     aggagaccgg cgtatagaaa ggccggaagg tcgtcgttcc cacctcggcg ggcgacacgc     21000
     cgcgcgcctc agcgagaatg ccgatggcgt tgatgttgga aagcttgccc tggtcggtcg     21060
     ccatgcctga tgttgtataa cgcttggcaa gctcgacatg accgtagcct tcgcgcacgg     21120
     caaggccgag gtccttgaga tgcacgtcgt tctgatagtc gacgaaagcc ttgcccttcg     21180
     agcccttgac ggaccagagc ggctttgagc cttgggccgc ttccggggca accgcaaagg     21240
     ccggttccgc cgctgcaaag ccgatcgcct tcagggcggc cgcagccttt gcggcgccat     21300
     cgccaaggca ggccgtggtt tgcgcaagcc cggcagccga accggcaacg gcaagaccgt     21360
     cctgtgcggc cggcgccaga aacgccgccg cctcgtccga ccattgcggc ttgccgccgc     21420
     gatggcaggc aagatggatg atcgggctcc agccgcccga catggcaagc gcatcggctt     21480
     cgatgcggcg gataccgccg gtggtttcaa cgctgacgcc gcgcaggcgc tggccgccga     21540
     acgcatcgat cacccgggca cccttcaaca cttcggcgcg gccctgccag cctttgccgg     21600
     catcggcgcg gctgtcgacg atcgccgcga cggcgaggcc ggcggcttcc aaatcggcgg     21660
     cagtgcggta accggcatcg ttggtggtga agatgacagt gcttttgccg ggcgccacag     21720
     cctgtcggtt gagatagctg cgcatggcgc ccgccatcat tacgcctggt atatcgttgc     21780
     cgccgaagac gagcggccgt tcctcggccc ctgtcgccag gatcgcctgg cgggcgacga     21840
     tgcgccacaa gcgttcgacc gggcgctccg ggtcgggcag cgccacatgt ttctgcacgc     21900
     gttcgacggc gccgaagaca ttgtcgtcgt accagccgaa gactgtcatg cgcggcaggc     21960
     ggcgcacatt ttccagctct tcgagttctg ccagcagctc gttgagaagc gcgtccgccg     22020
     gcttgtcctc gacagtgccg cgggaaagca ggctgccgcc gagttccggg ccttcgtcgg     22080
     cgaggatgac gcgcgcgccg gcgcggccgg cggtcagtgc cgcggcaagg ccggcagggc     22140
     cggcgccgat caccagcaga tcgcaatgcg cccagcattt ctcataaata tcgggatccg     22200
     cctcgtagga ggctctgccg aggcccgccg ccttgcggat caccggctca tagagctttt     22260
     cccagagggg cgccggccac atgaaggtct tgtagtagaa accggcgctg aggaaaggcg     22320
     agagaaagcc gttgacggcg ccgacatcga aaccgagcga cggccagcgg ttctggctct     22380
     tagccgccag cccctcgtaa agctcgatca tcgtcgcgcg cgtattcggc tcggtgcgcc     22440
     cgccgctgcc tgtcgtcacc aacgcgttcg gttcggcggc acctgccgtc aggatgccgc     22500
     gcgggcggtg atatttgaaa ctgcggccga caagctggac gccgttggca agcagcgccg     22560
     aggcgagcgt atcgcccgga tggcctgcga gcgccttgcc gtcgaaagtg aagccgagtg     22620
     tcgtggcgcg gtcgatgcga ccgccggagg aaagacggaa gctcgtcatg ctaggtcccc     22680
     gccaagcttc gcaagggcgg catccctgac gccatgaacc acatgggtga cggtatcacg     22740
     ttcgacgatc agccagcggc ggcagccgga ggaatggtgc cagtattcgc tgtggctgcc     22800
     acgcggattg tcgcgcagat agacatagtc gaaccaggca tccgcaccgg catccggcgc     22860
     cggtcgagcc aggcccgcat cgccgcggat cgagaattcc tccttgggcc gggcgccgca     22920
     atggggacat gaaatcaggc ttgccatcgt tagatgtcct cagtgcagat tgggctgggc     22980
     gccgacgccc ttttcgtcga tcggatagcc gcgggcgaac cggtcgagcc ggaaggcgcg     23040
     ggccgtctga tgcggcgtgt tgcgggcgat cagatgggcg tagcagaagc cggaggccgg     23100
     cgtcgccttg aagccgccgt aacaccagcc ggcattgaga tagagattgt ctatatgggt     23160
     gcggtcgatg atcggtgagc cgtccatgct catgtccatc accccgcccc aggagcgcag     23220
     gtaacgcacc cgcgacaggg atgggatcat cgccagcccg gcttcggcga catgctcgac     23280
     cgaggccaga ttgccgcgct gggcatagga attataacca tcgatatcgc cgccgaagac     23340
     gagcccgccc ttgtccgact gggagacgta gaaatggccg gcgccgaagg tgacgacgtt     23400
     gtcgatgaag ggttttagtc cttcggagac gaaggcctgc agcacatggc tttcgatcgg     23460
     caggcgaagg ccggccatgt cggcaacgac agtggaattg ccggccgctg ccagcgccag     23520
     cttgccgcag ccgatgaaac cccggctggt ctcgacgccg gtcaccttac cgttttcgct     23580
     gcggatgccg gtcacttcgc actgggtgat gatgtcgacg ccgcggctgt cggcgccgcg     23640
     cgcataaccc caggcgaccg catcgtggcg caccgtgccg ccgcgcggtt ggtacaaagc     23700
     acccatcacc gggaaacggg cattgtcgaa atcgaggaag ggcagttttt tgcgcaccgc     23760
     ctgccggtcg agaagctcgg cgtcgacgcc gtgcagccgc atggcgttgc cgcggcgcgt     23820
     ataggcgtca cgctgcgcat cggaatggaa gagattgaga acgccgcgct gcgagaccat     23880
     ggcgttgaaa ttgaagtcct gctccaagcc ttcccaaagc ttcatcgaca gttcgtagaa     23940
     gggattgttg ccgggcagca ggtagttcga gcgaatgatc gtcgtgttcc tgccgatgtt     24000
     gccggagccg agataaccct tttcgaggac agcgacattg gtgatgccga attccttggc     24060
     gagataatag gcggtggcaa ggccgtgacc gccgccacca acgatgacga cgtcgtaatg     24120
     cggcttcggc gccgggtcgc gccaggcggg cgcccagcct ttgttgccgc gaaggccgtt     24180
     gagaaaaatc gaaagagcgg aatagcgcat gggtcaatcc gaatggaacg accgtatgat     24240
     gccagaaagg agacgttcga cttgcgctat aaggacatga atggttagaa aagagacatg     24300
     tcctcgcccg atagtaaaaa tgtccaggaa atcggcttca tcctgatccc gggattcgcg     24360
     ctgatgtcct atgcctcggc gaccgagccg ctcagggcgg caaaccttct ggccggacga     24420
     gaaatctatc ggctgtcgat cttttcgccg gacggagggc cggcgcgctc ctcttcaggc     24480
     gtcagcgtgc ccgccgaacc ccttccggcc agaggttccg gcctcggcac ggccttcgtc     24540
     tgcgccggcg gcttgccgcg cgactggcgt tatcccggcg tgcttgcctg cctcaggcaa     24600
     ctgtcgcgcg agggtgtgag gatcggcggc atttcgggcg gcccctatct gatggctgcc     24660
     gccggactgc tggccggccg cgattttacc atccactggg aacatgcggc cgccctgctc     24720
     gaggcctttc cggagcttac gccgcgccag gcgcgcttca tgatcgacgg caaccggatc     24780
     acctgcggcg gcggcatcgc cccgctcgat atgatgcatg tgctgatcgc cgagcgcatg     24840
     ggaccggatt ttgcccgccg cgtcagcgac tggtatcttc acaccgaggt caatgagccc     24900
     gccgcccccc agcgcgcctc gctcgccgag cgctatggcg tccaccatcc agggctgctc     24960
     agcgttctcg aacggatgga ggagacgatc gaaatgccgc tcgaccgcgc cgccatggcg     25020
     cgcatcgccg gcgtcaccgt ccgccatctc gaccggctct tttccgccca tcttaagacc     25080
     agcttcctcg atcagtacca caggatcagg ctgcagcacg cccatcgcct gctgaagcag     25140
     agcccgcttt ccgtctcgga gatcgccgtt gccaccggct tttccagtct tagccacttt     25200
     tcccggatgt tccgcgccgt ctacggcatc gctccgcgtg aggcgcgccg ggaataggtt     25260
     ttcttcacgg ttgagaaaat ttcactaggg cgatagggtt gcctctgaac aacgcgaagg     25320
     cggcagcatg aaatccaagc ttgaagcggc gaagcaaccg gaacaggcgc atagcgaacg     25380
     cgctcccttt tcccaggatc cgcacgctgt tcgcgagccg aaggaaaaca acctcgaaat     25440
     ggcgatcggc catgaggtgc gcgcctaccg caagaaactc ggcatcacgg tgaccgatct     25500
     ggcggccgcg accggcattt cgctcggcat gctgtcgaag atcgagaacg gcaacatctc     25560
     gccgtcgctg acgacgcttc aatcgctgtc gcgggcgctc ggcgtgccga tgaccgcttt     25620
     tttccgccgc tttgaggaac cgcgcaatgc cgtcttcgtt aaggcggggc agggcatcga     25680
     actcgaacgg cgcggcacgc gcgccggcca tcaatataat ctgctcggcc atatcgacaa     25740
     taataccagc ggcgtcatcg tcgaaccgta tctcatcacc ctgacggccg attccgacac     25800
     cttcccgacc ttccagcacg agggcatgga atttctctat atgctcgaag gcgaggtcat     25860
     ctaccgccat ggcgatcagc ttttccagat gcagccgggc gacagcctgt tcttcgatgc     25920
     cgatgcgccg catggcccgg aacagctggt ggaactgccg agcaaatacc tctcgatcat     25980
     cagctatccc cagcagaatt caagaagctg acttgcctta aaagaaaaat ttattcttcc     26040
     tagttgaagt cctgaaatag tcctgctagt cctttctcac catgaacgga ggcacacgct     26100
     atgtgcggca ttgttggatt gttcctcaag gacaagagcc ttgaacctca gctgggaaat     26160
     ctgctctcgg atatgctgat caccatgacg gatcgcggac cggactcagc cggaatcgca     26220
     atctatggcg gctccaccga gggaaaagcg aagattacca tccagtccgc caaccccggc     26280
     gtggacttcg aaggcctcgc cgctgacctt gcgaaggctg gcatcagagc cgaggtgtcg     26340
     atcaagagca cgcatgcggt catcgagctg gatgcctcca agcttggaac cgtgcgcaag     26400
     gcgctcgaag agatccgccc gacggtccgc ctgatgggat cgggcgaaag cgtcgaaatc     26460
     tacaaggaaa tcggtcttcc gaaagacgtc gtgaagcggt tcgatgtccg cgccatgggc     26520
     ggcacccacg gcatcggcca tacccgcatg gcgacggaat ccgcggtcac cacactcggc     26580
     gcccatccgt tctcgaccgg cgccgaccag tgcctggtgc acaacggctc gctgtccaac     26640
     cacaacaacc tgcgccgcga actggttcgc gaaggcatga ccttcgagac gcagaacgat     26700
     tccgaagtcg ccgccgccta tctgacggcc gaaatggcca agggcaagga tctcggtgag     26760
     gccctgaccg gcgcgctcga cgatctcgac ggtttcttca ccttcgtcgt cggcaccaag     26820
     tccggcttcg gggtggtgcg cgacccgatc gcctgcaagc ccgccgtcat ggccgagacc     26880
     gaccaatatg tcgccttcgg ctcggaatac cgcgcgctgg tcaatcttcc aggcatcgag     26940
     aacgcccgtg tctgggagcc ggagccggcc accgtttact tctgggatca cgacaaggcc     27000
     gcctgagggg cgcctgaatg caggagcggg tcagaccgtc tcccggacca acgaggatgc     27060
     aatgccgaca ttcgatcttt ccaacacccc tcttcgcgaa ctgaacagcg cgctgcacgc     27120
     cctttccaaa ggtgccaacg acaccgaatt cgaggtcatc aacccgcgcg gcagtcattc     27180
     cgttgccgtc ggtatcgaca gccccgtcac ggtcgccgtc aaaggatcgg tcggttatta     27240
     ctgcgccggc atgaatgacg gcggcagggt cacggtccac ggttcggccg gtccgggcgt     27300
     tgccgaaaac atgatgtcgg gcactgtcgt catcgagggc gacgccagcc agtatgccgg     27360
     cgccaccggc cgcggcggcc tgctcgtcat caagggcaat gcggcgtcgc gctgcggcat     27420
     ttcgatgaag ggcatcgaca tcgtcgttca tggcagcatc ggccacatgt cggccttcat     27480
     gggccagtcc ggccatctcg tcgtactcgg cgacgccggc gaagcgctgg gggattcgct     27540
     ctacgaagcc aagctttttg tccgcggcga agtcaagagc ctgggatccg actgcatcga     27600
     gaaagagatg cggccggagc atctggaaaa gcttgccgag ctgctcgaca aagcaggcgt     27660
     gacggacgtc aggcccgaag agttcaagcg ctacggctcg gctcgcaagc tctacaattt     27720
     caacatcgac aacgccgacg cgtactgagg cgagggaccc ccatgagcta tcacaatcct     27780
     tataccccgc cacgcaagtc cgcgaccttc gatgattata cgcttgccga aatccgccgc     27840
     gcggcggcga ccggtatcta tgacatccgc ggcgccggca ccaagcgcaa ggttccgcat     27900
     ttcgacgatc tgctgtttct cggcgcctcg atctcgcgct acccgctcga aggttatcgc     27960
     gagaagtgcg acacgacagt cgtgctcggc tcacgttttg ccaagaagcc gatcacgctc     28020
     aagacgccga tcaccattgc cggcatgagc ttcggcgcgc tgtccggcaa cgccaaggaa     28080
     gcgctcggcc gcggtgcgac catcgccggc acctcgacca cgacaggcga cggcggcatg     28140
     accgatgagg aacgcggcca ttcgcaaacg ctggtctacc aatatctgcc ctcccgctac     28200
     ggcatgaatc cgaaggacct gcgccgcgcc gatgccatcg aagtcgtggt tggccaaggc     28260
     gccaagcccg gcggcggcgg catgctgctc ggccagaaga tctccgaccg cgttgccaat     28320
     atgcgcaacc tgccaaaggg catcgaccag cgctcggcct gccgccatcc ggattggacc     28380
     ggccccgatg atctggaaat caagatcatg gagctgcgcg aaatcaccga ttgggaaaag     28440
     ccgatctacg tcaaggtcgg tggcgcgcgt ccctattacg acaccgctct tgccgtgaag     28500
     gccggcgccg acgtcgtcgt gctcgacggc atgcagggcg gcaccgcggc cacgcaggac     28560
     gtcttcatcg agaatgtcgg catgccgaca ctcgcctgca ttcgtccggc ggtccaagcg     28620
     ttgcaggatc tcggcatgca tcgcaaggtg caattgatcg tttcgggcgg catccgctcg     28680
     ggcgccgacg tcgccaaggc gctggcgctc ggcgccgacg cggtcgcgat cggcacggcg     28740
     gcacttgttg ccatcggcga taacgatccg cactgggaag aggaatatca aaagctcggc     28800
     acgacggccg gcgcctatga cgactggcat gaaggcaagg atccggccgg catcaccacc     28860
     caggatccgg agctcgcaaa gcgccttgat ccggttgcgg ccggccgccg ccttgccaac     28920
     tacctcaagg tcatgacgct cgaggcgcag acgatcgcgc gtgcctgcgg caagaaccac     28980
     ctccataacc tcgagccgga agacctcgtt gcattgacga tcgaggcatc ggccatggcg     29040
     caagtgccgc tcgccggcac caactggatc cccggcaaga ccggttttta aaaaaacatc     29100
     agccgggcgc gtttgggagg atgcggccgg cttcatcatc aagtgtctga gatcaataca     29160
     aggggacaaa cgtgacactg gatctctcgc aatacgcctc cgaaaaaggc atcaaatatt     29220
     tcatgatcag ctacacggac ctgttcggcg cccaacgcgc caagctggtc ccggcgcaag     29280
     ccattgccga tatgcagaaa gacggcgcgg gctttgcggg ttttgcaacc tggctcgatc     29340
     tgacgccggc ccatcccgac ctgttcgcgg ttcccgatgc gtcctcggtc atccagctcc     29400
     catggaagaa agacgtcgca tgggtcgcag ccgactgcgt catggacgat cagcccgtcg     29460
     aacaggcgcc acgtgtgctg ctgaaaaagc tggttgctga ggctgcaaaa gaagggctgc     29520
     gggtaaaaac cggtgtggag cccgagttct ttctgatctc tgcggatggt tcggtgattt     29580
     cggaccagtt cgataccgcc gaaaaaccct gctacgatca gcaggccgtg atgcgtcgct     29640
     atgatgtcat cgccgagatc tgcgactaca tgctcgagct cggctggaag ccctatcaga     29700
     acgaccacga ggatgcgaac ggccagttcg agatgaactg ggaatatgac gacgtgcttc     29760
     agaccgcaga caaacactcc ttcttcaagt tcatggtcaa gtcggtcgcc gaaaagcatg     29820
     gccttcgcgc caccttcatg ccgaagccct tcatgggcct gaccggaaac ggctgccacg     29880
     cccacatctc ggtttgggac atcgatggca aggtcaacgc cttcgccgac aaggaaatgg     29940
     cctttgggct ctcggctcag ggcaagacct tcctcggcgg cattatgaaa catgcctcgg     30000
     cgcttgccgc ggtcaccaat ccgacggtca attcctacaa gcgcatcaac gcgccgcgca     30060
     ccacctcagg cgccacctgg tcgccgaaca ccgtgacctg gacgggcaac aaccgcaccc     30120
     acatggtgcg cgtgccggga ccgggacgtt tcgaactgcg cctgccggat ggagcggtca     30180
     atccctatct gctgcaggcg atcatcattg ccgccggcct taacggcatc cgcagccagg     30240
     cagaccccgg ccggcactac gatatcgaca tgtatgccga ggggcatctg gtgaaggacg     30300
     cgccgcgcct gccgctcaac ctcctcgatg cgctgcgtgc ctacgatgcc gacgagggcc     30360
     tgaagcaggc gatgggggcg gaattttccg ccgcctatct caagctcaag catcgggaat     30420
     ggaatgccta ctgctcgcat ttcacccagt gggaacgcga cagcacgctc gacatctgag     30480
     cggccgacgg atgtcttcga gaccgccgac acgccgggct gacaagctcg gcgtgatcgc     30540
     atcctcggca cttgatctcg tgaaggaaaa gacagcatga aaaacgtcgt actcaccgta     30600
     tcttgcaagt cgacgcgcgg catcgtggcg gcgatttcga gttatctggc cgacaagggc     30660
     tgcaacatca tcgacagctc gcagttcgac gatctcgata ccggcaagtt cttcatgcgt     30720
     gtctcgttca tttccgagga aggtctttcc ggctcggaga tcggcgccga tttttcaccg     30780
     gtcgccgccc ccttttcgat ggattacgaa ttccacgaca gcgagaagcg catgaaggtg     30840
     ctgctgatgg tgtcgcgctt cggccattgt ctcaacgacc tgctctatcg ctggaagatc     30900
     ggcgcgctgc cgatcgacat cgtcggcgtc gtttccaacc atttcgacta ccagaaggtc     30960
     gtggtcaacc acgacattcc cttccaccat attccggtca ccaaggccaa caaggttcag     31020
     gccgaagccc gtatcatgga ggtggccgag cagaccggca ccgagctgat cgtgctcgcc     31080
     cgctacatgc agatcctgtc ggacgagatg tgccagaaga tgtcgggcaa gatcatcaac     31140
     atccaccatt ccttcctgcc gagcttcaag ggcgccaacc cctacaagca ggcctatggc     31200
     cgcggcgtca agctgatcgg ggcaaccgcg cattacgtca ccgccgatct cgacgaaggc     31260
     ccgatcatcg agcaggacac ggcgcgcatc acccatgcgc agtcgcccga cgactatgtc     31320
     tcgatcggcc gcgatgtgga aagccaggtg ctggcccggg ccatccacgc ccatattcac     31380
     caccgcacct tcatcaacgg caaccgcacc gtggtcttcc cggcaagccc cggcagctac     31440
     gcctccgaac gcatgggctg agagatggtt gaggtcatcg acggcaagaa cgtagctgca     31500
     tcggtcattc agacggtcaa gagtgcgacg gcagcgctgg aaaagagcag cggcgtcacc     31560
     gccggccttg cagtcgtcat cgtcggtgac gatccggcaa gccacgccta tgtcggctcg     31620
     aagggccgca tggccaagga atgcggcttc aaatccgtcc agcacacgtt gccggccgag     31680
     accagccagg aggagctggc agccctcgtc gccaccctca acgccgatcc gtcgatccac     31740
     ggcatcctgg tgcaattgcc cctgccgaag ccgctcgaca gcgagccgat catccagtcg     31800
     atcctgccgg aaaaggatgt cgatggcctc agcatcgcca atgctggcaa gcttgccatc     31860
     ggcgacctga gaaccggact ggtttcctgc acgccggccg gtgccatggt cttcgtccgc     31920
     cgcacccacg gcgaggacct ctccggcctc aacgccgtcg tcatcggccg ctccaacctg     31980
     ttcggcaagc cgatggcgca attgctgctc aacgccaatg cgacggtgac gatcgctcat     32040
     tcgagaacca agaacctcgc cgaggtctgc cgcaatgccg atatcctggt ggccgccgtc     32100
     ggccggccgg agatggtcag ggccgattgg gtcaggccgg gtgcgacggt catcgacgtc     32160
     ggcatcaacc gcgtgccagc tcccgaaaga ggcgagggca agacccggct ggtcggcgac     32220
     gtcgccttcg ctgaggtctc cgaagtcgcc agcaccatca ctcccgttcc cggcggcgtc     32280
     gggccgatga ccatcgccat gctgatggcc aataccgtca tcgccgccca tcgcactgcc     32340
     gggcagacgc cgccgaagtt ttgattggaa tgccgccggg cgggcttgcc atggcgcgaa     32400
     aggcttatat actcaggaaa taaatattcc gtagaagaaa taagagggaa cggaaatggc     32460
     tctatcatgg cgtttctccg tgttagcgga tcggcatcgc gctctgggat cgaagcttga     32520
     ggactggagc ggcatgggaa ccgcctggac ctacgacaag gacatgtcgg aagagcatgt     32580
     cgcggtccgc accaaggccg gcatcatgga tgtatcgggc ctgaagaagg tgcatctggt     32640
     cggcccgcac gccatcgccg ttctcgacgc catgaccacc cgcgacctga ccaagatcta     32700
     ccccggccgc tcggtctatg cgaccatgct gaacgagcgc ggccatttca ccgacgattg     32760
     catcgtctat cgcaccggcc cgaacgcctg gatgctggta cacggctccg gttccggcca     32820
     cgaggagatc gtcaggcagg cggcaggccg aaactgcgcc gtgctcttcg atgacgacct     32880
     gcatgacctg tcgctgcagg gtccgctcgc ggtcgactat ctcgccaaat acgtgccggg     32940
     catccgcgat ctcaaatatt tccaccacat gcagacgaca ctgttcggcg cgcctgtgat     33000
     gatctcgcgc accggctata ccggcgaacg cggctacgag atcttcgtgc gcggccagga     33060
     cgccgtcatg gtctgggacc ggatcgtcga ggaaggcaag gaaatgggca tcatcccttg     33120
     ctgcttctcc gtactcgaca tgctgcgcgt cgaaagctac ctgctgttct acccctacga     33180
     caattcgcag atgtatccct tcgccgatca gccgcccggc gacagcctgt gggaactcgg     33240
     cctcgacttc accgtcagcc ccggcaagac gggcttccgc ggtgcggagg aacatgcccg     33300
     cctcaagggc aaggaacgct tcaagatctt cggcatgctg atcgatgccg atggacccgc     33360
     cgatctcggc gacgaggttt ttgccgacgg caagaaggtt ggcgtcatta cctgcccgag     33420
     ctattcgtcg ctgacgaaga aatccatggc gattgcccgt ctcgacgttg acaaggcggt     33480
     gcatgggacg aaactcgaag tccgcggcaa gaccgtgaag gcaagcgcca ctgcccacac     33540
     gctccccttc gacgacccgg agaagaagaa gaggactgcc gtaggttaag gagcacgcga     33600
     atgctcgttg caggcatcaa gagccgacca gtctatacgg gcctgaccat ccagccgaac     33660
     gcccggcggc acattttcgc gctcgaaggg gagggtgcca aggctctcct cgaccagcgg     33720
     gcagcactcg acgaaaccgc cctctcccgc agcgaaatcc tctatgtcgc ccgcggctcg     33780
     caaggctccg gcctggacga ggcactgcgc cacctcggcg ccgacatgtt cttcacggcc     33840
     ccgacgatcg caacactgct cttccgattg aagggctcgc ttgccacagc ccatatgggc     33900
     acccggcttt atatagcggg cacggaaggc ttcatcggcc aggcgatgct ggtggcgctc     33960
     gattacggca tggactacgc ctccgtcatc accgaacacc gcggatcgct cgccaggcgc     34020
     gtgcaatgcg tccattgcaa gggcatcacc gacgacgtca ccgccagtcc ctttacctgc     34080
     agccattgcg gattgacgct tctggtgcgc gatcattatt cgcgccggct cgccgccttc     34140
     cagggcgtca atatcgatgc ggaagaaccg ggcagcgcgc ccgaccccga ggagttgttt     34200
     ctttgagcgg cggcacagaa attcccgtcc gcgtggcgcg gatcaccccg atcgccgaac     34260
     gcgtcaagcg cttccgcttc gagcgcctcg acggcaagcc gatgccttat ttttccggcg     34320
     gcgcgcatat catcgtctcg atgaacgatg gcggccatat gcgccgcaac gcctattcgc     34380
     tgatgtcgcc gccgcatgat tgcgcagcct atgagatcag cgtgctgcat gtcgaggatt     34440
     cacgcggcgg ctccaccttc atgcatgaga aggtgagcga aggcgacgaa ttgagggtca     34500
     gctaccccgt caacctcttc cagccggatt ggcgcgggcg caagcatctt ctgatcgccg     34560
     gcggcatcgg cattaccccc ttcatcgcga tgatggagca gttctcccgc gagggcgcca     34620
     atttcgagct gcattatgcc atccgcacgc gcgaccgcgg cgcctattgg cgggaactgc     34680
     tggagcgcta cggttcccat cgcatcaaga tccattgcga cgccgaaggt gcggccatcc     34740
     ccctgacgcg cctactcgac agccagccgc tcggcacgca tctttatgtc tgcggcccca     34800
     cagggatgat cgatggcgtg ttgaaaaccg gcgtcaacgc cggatggccg gaacagaacc     34860
     tgcattcgga acggttcctg tcgtcgctgc ccggcaagcc tttcacgatg gagctgatcc     34920
     gctccggcaa gaccgtgaag gtcggccatc acgaaagcat gctggaggcg atcgaagcgg     34980
     cgggcgtcga cgcacccttc ctctgtcgcg gcggcgcctg cggtcaatgc gagacggggg     35040
     tcgttacctg cgacggcaag ctgctgcaca atgacgtcta tctgacgagc gaagaaaagg     35100
     catccggccg caaggtgatg atctgtgttt cccgcttcga gggaaacagg ctgcatctcg     35160
     atctttgacg gcatcggatc aagcggaaca aggagaccga acatggcaat cgccttcaag     35220
     caggaaacct tccggaatga tttcagctac ggcaacagcc ccgaaaacat ccggcgcttc     35280
     ccgtttccct tcgagcgcga cgaatacatg tattccgtca acatggagcc gcatgtgcgc     35340
     ggccgggcgg gcaccgtctt cgaaaacctg atcgacgtcg acgaacatta tgtcgccgag     35400
     atgcacgacc gggcactggt tttgaaagag gatccgctcc gctatcaggc gctgccgcac     35460
     atgatgagcg cgcaatggga tacgctggaa ctgctgatgg aagagcaggc ggcgggcaat     35520
     ccagaccatt tcacgctgat ccgcaatggc gaccagtggc gctggatcaa ccgcccgctc     35580
     ggcatcgacg acagcttcac cttcggcgac gcctcgacgc tgccctatga gcccttcgaa     35640
     tacatcaccc gccaggccca gggcgacttc tgcatcgtcg accagcgcga cggcaatctg     35700
     tggatggatg ccggcatggt aacgacgcag gccgactggt cgctcgattt cgatatcggc     35760
     atgaatttca tggaatggca tgggccggtg ccgctcgccc atcagatcgg cgtcttcgac     35820
     cgggcgctga aattcctgtt gaacctgcag caaggcaagc cgacacggcg gttcaactgg     35880
     acgatgacga tcaatccgcg gctcgacacc agccccgaga attatcacaa atggggcccg     35940
     gaccgcacca cggtgacatc gggcaatgtc ggcgagaagg tgtatctgcg cgtcgagctg     36000
     cagagcctct ggcgcctgcc gcgctccaac gccatccttt tcgtcatccg ttgctacctg     36060
     atgaatatgg acgagctcgt caccgtgccg aagtgggcgc gacgcttccc gcgcgtgctg     36120
     aagacactgc cgcccgagct catcgattat aagggcctca cccgtttccg cgagacgacg     36180
     atcgactggc tatccaaata tgacgatggc gctccgacca gccccggcat ttttcccgac     36240
     tgacgcgccg cgatgcacac ctttcagacg cgaaaaacac cgtaacactt tgaaatttag     36300
     tccgtaaatc gataccgcat aatcaagagg ggaatgcttc atgacaagag tagccgtcat     36360
     cggtgccggt ccttccggtc tggcgcagct gcgcgccttt caatcggctg cccagaaggg     36420
     cgccgagatc ccggagatcg tctgcttcga aaagcagtcg gactggggcg ggctctggaa     36480
     ctatacctgg cgcaccggcc tcgacgaata tggcgagccg gtccatggca gcatgtatcg     36540
     ttacctctgg tcgaacggtc cgaaggaatg ccttgaattc gccgactatt ccttcgagga     36600
     gcatttcggc aagccgatcg cttcctatcc gccgcgcgcc gtgctctggg attatatcaa     36660
     gggccgcgtc gagaaggcga atgtccgcca ttgggtgcgc ttcagcacgc cggtgcgcat     36720
     ggttcgcttc gacgaagcga cgaagaaatt cacggtgacg gcgcataacc gcgtcgagga     36780
     ccggatgtat gacgaggaat tcgactatgt cgtcgtcgca tcaggtcact tctcgacgcc     36840
     gaacgtgccc tatttcgagg gtgtgaagac cttcaacggc cgcgtcctgc atgctcacga     36900
     tttccgcgac gcgctggagt tcaagggcaa ggatattctg ctcgtcggcc gcagctattc     36960
     ggccgaagac atcggctcgc aatgctggaa atacggcgcg aaatcggtga cgacgagcta     37020
     ccgctcgaag ccgatgggct tcaaatggcc ggagaatttc gaagaacggc cgctgctgac     37080
     gaagctcgaa aaccgcacgg cgcatttcct cgacggctcg accaaggacg tcgatgcggt     37140
     catcctctgc accggctacc agcaccattt ccccttcctt ccggatgatc tccggctgaa     37200
     gacctccaac cgcctctggg cggacagcct ctacaagggg gtgatcttcg ataagaaccc     37260
     gcagcttttc tatatcggca tgcaggacca gttctatacg ttcaacatgt tcgacgtgca     37320
     ggcctggtgg gcccgtgacg tgatgatggg ccgcatcgcc ctgccgccgg aagaagagct     37380
     gcaagccaat ttcgatatgt ggcgggcccg cgaggagacg ctcgaggatg ccgaacagat     37440
     gatctggtat cagggagatt atgtgaagga actgcttgcc gagaccgatt atccctcctt     37500
     cgacatcgag ggcaccaacc ggaccttcat ggagtgggaa catcataagg cccacaatat     37560
     catgggcttc cgcgaccatg cctatcgatc gctgatgacc ggcaccatgt cgccgaaaca     37620
     ccacacgccc tgggtcgagg cgctcgacga ttccaaggag gaatatctgc gcaactgacc     37680
     ggacggcgag cgctttgccg ggcgaaggta ttcgtacact ttcgtccggc atagtatgac     37740
     cggcgccttt tgaaacgagc cgatatgaat ccatccgcaa ctcttctctt cggacatggc     37800
     cttcatggat tttcaaacga gcattctcgg acgcatgaac ggctttctct atcgctgccg     37860
     tgccgatgaa aactacacga tgcttgagat gaccgacggc atcgagcgca tcttcggtta     37920
     tccccccgac gaaatcgtcg gcaaccgcac gcgaaccttc acctcgatca tgtacgaaga     37980
     agacgtgcct ttgatggacg aaatcgttgg ccgggcgctg gacaagcgcg tggactggac     38040
     gatggaatac cgcatccgcc atgcgatggg ccatctcatc tgggtgacag agaccggcgg     38100
     cggcatctgg gaccagaagg gcgagcttct ctacctcgaa ggcagcatca tcaacatcga     38160
     atcgctttat cagcgaatcg acgaacgaac cgccgacatg cgcgtcaccg cctcgaagac     38220
     caacgagatc ctgcaatcgc tgcgctatct gaagctgctt gccgtcaatg ccggcattga     38280
     ggccgcccgc gccggcaccg ccggatcggg ctttgccgtg cttgccgccg agatgcgcac     38340
     gctcgccaac tcctccgagg aggccgcgcg cgccatttcc gaggcgcaac gcaaggcgga     38400
     aggctgagcg ttttcccggg cgacgaaata tttacggctc aggtcaaaaa cgcggttgtt     38460
     aaccgtgcga ccacatcaga tattaccatt tattttcaat aatttgcttt aatttcgccg     38520
     ctgaaaaaac gcttgtcatt gccgctaata ttaaggccgc gttaactttt tgttaaccat     38580
     agcagcgcta gatatggtca acgatttctt cacatagatg accaaagtgc taacagacgc     38640
     tcgctctatc cgcatcaagg gccgctcctt cctggccgtc atgttgtctc cggaccttcc     38700
     tttcgatgat tggttggcga ggctcgacga tctggccgca cgttcggccg gcttcttcct     38760
     cggacggccc gtcgtgctcg atctgacgga cctgcaaatc gaccggccgc agctgaaaga     38820
     gctgattgcc gaactggcca aacgcaatgt cagcatcatg ggcatcgagg gcgcacggcc     38880
     ttccattctc ggctcgggca tgccgccggc gctcaaaggc ggccgctccg cttcagacat     38940
     cgaggttcag gccaatgagc ctgccggttc gccggtgaaa cctgaagtcg ccgcgatccg     39000
     cccggcaacg acgcaatcga tcgtcatcag ggagccggtg cgctccgggc aatcggtgat     39060
     cttcccggaa ggcgacgtca ctatcgtggg gtctgtcgcc tcgggcgccg aggtcatcgc     39120
     cggcgggtcg gtccatatct atggggcgtt gcgtggccgc gccatggcgg ggtccatcgg     39180
     caacgcatcg gcgcggatct tttgccgcaa gctggaagcc gagctggtgg caatcgacgg     39240
     cgtttacaaa atggcggaag acatggccgc caatcttcgc gggcaggctg ttcagctctg     39300
     gctcgaagac gatgcgatca tggcggaaaa aatgacctga cgacagcgcc gcgcggcttt     39360
     gagaaacgcg tgaggacgct gagacacttc gaattactgc ggcaaaggag agagacatgg     39420
     ggaaagtgat cgtcgtcacg tcaggcaagg gtggggtcgg aaagacgacc tcgaccgccg     39480
     cattgggagc ggcgctggcg caacgcaatg aaaaagtcgt cgtcgtcgat ttcgacgtcg     39540
     gcttgcgcaa tctcgacctg gtcatgggcg ccgaacgccg ggtcgtctac gacctgatca     39600
     acgtcatcca gggcgatgca aagctcaccc aggcgctgat ccgcgacaag cggctggaga     39660
     cgctgttcct gctgccggcc tcgcagacgc gcgacaagga caatctgacg gccgagggcg     39720
     tggaacgggt catcaacgac ctgaagcggt atttcgactg gatcatctgc gacagccccg     39780
     ccgggatcga gcgcggcgca acgcttgcca tgcgccatgc cgatgttgcc gttgtcgtca     39840
     ccaaccccga agtctcgtcg gtgcgcgatt ccgatcgcat catcggcctg ctcgatgcca     39900
     agacagccaa ggccgaacgc ggcgaacgga tggaaaagca cctgctgctg acccgctacg     39960
     acgccaaccg cgccgagcgc ggcgacatgc tcaaggtcga tgacgtgctg gaaatcctgt     40020
     ccatcccgct gctcggcatc gtgcccgaaa gcatggacgt cctgcgcgcc tccaatatcg     40080
     gtgcgccggt cacgctggca gaaagccgca gcccggctgc gatggcctat ttcgatgccg     40140
     cccgccggct cgccggcgaa ttggtgccga tggcgatccc tgaggaaaag cgcaacattt     40200
     tcggcaaaat cttcggacgg agggcggcat gaatattttc cgtcttttca acaagcagag     40260
     aaccgcaccg gccgctcgcg aacgcctgca ggtgcttctt gcccacgaac gttcctcggc     40320
     cgggtcggac ctagtcacgt tgctgcgcga agaaatcctt gcggtgatcg ccaagcatgt     40380
     cgaactcgac catgacaagg tgcaggtgac gatcgatcgc aacgaattcg tctcgacgct     40440
     cgagatcgat gtcgaaatcc cgctgaacgc agccgtgcag gccgcttgaa agagggcgct     40500
     gcctgttgtg acgacaggca gcgctgacag tcacgacttt ctggcttttc gattggcgta     40560
     acgcaggtcg cgtgcggcct tccgggcggc ttcgtcggca atgacgcgag cgatccggtc     40620
     tttgtcagcc gcttcgcgcg catcggcgtc ggcgcgtgct gcagcctcgg cggcagcctg     40680
     gcgttctgct tccgcggctt tcgcctgctc cagttcctca cgctttaccc gttcgcgctc     40740
     ggcgcggcgt tcttccctgg cggcagcgac ggcctgacgc tccgcctgtt ttgcctgcct     40800
     ggtcggttca gccttatcct tggcgtcacg atacgcattg aggagagcgg cctttgcttc     40860
     ggcagcggcg ctgcgacgat cggaaagctc attgtttctg gcgtttttca attctgttac     40920
     ctgactgttt ggctgcgacg ttagagcatg attgccgaaa actgtgcggc tttcgcatga     40980
     ccctatgctc tatgtattcg attgggatcc ggatgctatt atgccaatcc ggtttgaaat     41040
     catctagatg ttgaatcact ttttcttatt tcgcttcaca gggccggcgg ccgccatcaa     41100
     gcgatcctgc aattccttgg cctcgcgggc ttcgcgcaat ctcaaggtct tttcctcgcg     41160
     ggcgcgcacg gtctgatcga tttcttcgac cgcgcggcta cgcgccagga attgcgactg     41220
     tacgtttccg aaggcgatct ccgcccgctg gcgcgatttg ctgtgtgtgt ctgtcatatc     41280
     agtcctggat tttcgtgaca gcgccgcgcg tctcaagacg ggcaaaggac gctggaacac     41340
     gttgacttgc tgcataattc cttaaagcgc gtcgcgatct ttcagattcg cttcttgcgc     41400
     tttaggtctt tgttttacgc atatcgttgc ggcaaaagcg cttcgcgctt tgccggggaa     41460
     aaccgctgcg cacttttgcg cgacatgctt tagatcgatt ccgatttaag gaatggtgca     41520
     gcggcccgct cgagcgcagc aaaaaggcca ggcaatttgc ctgacctcgc tggtatcccg     41580
     ctttcaacaa tgccagtaca tccgtggtca aaggaaagca gatatcaatt ttaggcagct     41640
     tgaagattgc aagcggacat tttgcccgac ttgttatcgc gctcaagctc gtagccgatc     41700
     ttctggcctt cgacgatttc acgcatgccg gcgcgctcga cggcagagat gtggacgaag     41760
     gcgtcagcgc cgccgtcatc aggctgaatg aagccgaagc ccttggtgga attgaaccat     41820
     ttaactgtgc cagtggtcat aacaaaccct ttcatagcaa ttgacaggcc gcacgtgcga     41880
     gatgcacgac ggatgataat ctcgattttg aagagggaag ttcgtccagg gcacgttgtc     41940
     ggcgtgcgat aacaaaagtc aaacaagcaa tatcgacaat gccgatataa tcactcaacc     42000
     caaatttgtc aacttttagt ttttcgaagc cccgcattct ctaaatggtt gtatcgcagt     42060
     cactttacac attcgccggt gcgtgatgcg tcatcggcga ggcccggaac ggaggcccgg     42120
     tctccaatgc ctgcgttaag agcgcggccg cgtcttctgc gggtcgtaat gcgaaagcgg     42180
     cacgattgtc gccggcaggc gtttctggtg gccgtcgagc ttgccgattt cgacctcggt     42240
     gccgggactt gcatgcatga cgtcgatgcg ggcgagcgcg atcgtcttgc cgaggatcgg     42300
     cgagcgggtg gcactggtga cgacgccgac ctgggcccgg ccgatatgga cgcaatcgcc     42360
     gtggccgacc gcctcattgg ctttgacgtc gaggccgacg agcagatggc gcgggtgttc     42420
     cttgcgccgg atcagcgcgt cgcggccgat gaaatcgtcc tgcttggatt tcaacggcac     42480
     ggtgaagccg atcccggcct cgaacgggtc cgtctggtcg gtgaattcgt gatgggcaaa     42540
     gatcaggcct gcctcgatgc ggaccatgtc gagcgcctcc agccccatcg gcttcaagcc     42600
     atgcggctgc cctgcctccc agacgccgtc gaacaccgtc agcgcatcct tcggatggca     42660
     gaagatttcg tagccgagct cgccggtata acccgtgcgc gagacgacga ccggggcgcc     42720
     ttcgaaaccg ccgatgcggc cgacggtgaa gcggaaccat tcgagctcgc cgatcgtcgg     42780
     ctggcgcggc gccgtccaga tgatctcctt caggatatcg cggctcttcg gcccctgcag     42840
     ggcgatattg tgcatctgat ctgtggacga gcggacccag gccttgaagc ccttcttctc     42900
     ggcctgctga cgcagccata cgccgctgaa atcatcgccg ccgatccagc ggaaattctt     42960
     gtcgccgagc cggaaaagcg tgccgtcatc gatcatgccg ccgttttcgt agcacatggc     43020
     ggaatagacg acctggccgg tcgacagttt gcgcacgtcg cgtgtcaggc aatattgcag     43080
     gagctcctcg gcatccggcc ccgtcacctc gaactttcgc aagggcgaga gatcgatgac     43140
     agcggcgcgc tcgcggcagg cccagtattc cttgaccggt ccttcggcgg aaaagcggtt     43200
     cggcagccag tagccgcgat attcggtgta atcgcgcgtc aaggcggaaa gacggggatg     43260
     gaaggcggtt tcgcgcgtca gttcggcgtc ggcatctggg gtcatgcgat aggccaccgc     43320
     tcgtgagaat ttctcttttc cggaaaaggt gcggacgtgg atatccgtcg gatcccagcc     43380
     attcgccgcg tcgatatcgt cggggcagga cgaggagacg cagacgagat cggtcagcgc     43440
     ccgcatcagc acgtagtcgc cggggcgcga ccagggctcg tcgagataaa gctggttgtt     43500
     gtggtcgata ttggtgttgt agaaataatt cagcgcttcc cagcccttgc ggccggcaat     43560
     accgtaaggc gccagcgccg cgttgaaatt gtccgtgcag ttgacgtggc cgggatatcc     43620
     catgtcatcg taatagcgcg aattgcaggc ggtcgcgaag gcatcgtggc gccctaccgt     43680
     atcctggacg atctcgacca gcggctcaaa gtcgcggtcg aaggcctttg agggcaggcc     43740
     cggcatcgga tagctgcggc tgagcagcgt gcgggtcacc gtggaatcca gtgcgagatc     43800
     gaggcccttg tcgaccttgc gggcggcgaa agcctggaaa tcggtgcatt ggcgtccata     43860
     aacatcgatg atctggatga attcgccggc acgcacgaaa taggctgcgg cagtcgccgc     43920
     ccggatgcgg atatcctcga tggggtcggc ggccggttcc ggcagggcgg aggcataatc     43980
     gcggatcacc aggctgcggt tgatcctgat ctcgatcggc gtcgccgtat cctgcgcctc     44040
     cggcgacatg gcgccagccg gtgccgcgac gatcagcagg cccttcatag aaatcgcgaa     44100
     atccgcccgg ctgcccgggc tcgatcccgc tccgaagatg ctgagcgctc cggccgccga     44160
     aagatcggcg ctgcgccgct caagcgctgc acgcgtgcgg gcagcactct catcctcgcc     44220
     ttgaagaatg gccttcaaac cctcggctga attgctgaat gccgtcccga agcccgctgc     44280
     caggaagcgg cctttttcgt cgaggaaaga gatttcgcaa acctgtccgc cctcggtgtc     44340
     gataacgctg atgcgatctc ccggcccgac acgcacgacg accgatccgc cgccctttgc     44400
     cctgtagcgc tccgtcccct caggcagggc agggatgccg ggatagtgca ccaggctcgg     44460
     aaccgcgggc cgcaggcctg tcatagctgg atgaagttct cgcattctgc cctcattggg     44520
     aggatcggca tgccctcagg cacgcaccca tacaggttac aaaatggttg gggaaagtaa     44580
     agtcgagttg actaaaaaga aaaaatcttc actatgcata aagggtcgag actcgggaat     44640
     ccgtcgggaa cacggatcgc caaaatcatc cgggcgggct tgagactgtc agggagacac     44700
     gttcagggag acgtacaaag atacgtccgg gaacaaatcg aatggggaat tttaccgatg     44760
     acagacgtta tggaggccgg gatttcatcc ggcaccgaag gtaagcttgt acgcgcgctc     44820
     gactggaagg gcgcattctg ggtggctgcg ggcgtgccgc cgctcgttct tttctccatc     44880
     ggcggcattg cgggcacgac gggcaagctc gccttcctcg tctggattat ttcgatggtg     44940
     atgggtttcc tgcaatcctt cacctatgcc gaaatcgccg ggatgttcgc caacaaatcc     45000
     ggcggcgcct cggtctatgg cgccaccgca tggctgcgct attcgaaatt catcgcgccg     45060
     ctgtccgtct ggtgcaactg gtttgcctgg tcgcccgtgc tgtcgctcgg gtgcgccatc     45120
     gccgccggct atatcctcaa tgccttcttc ccgatcccgg cggcggattc gcagatggtc     45180
     ctggactgga tctccgcgca tgccgcgtcc atcacggccg atagcccccg cgtcgccgaa     45240
     tatatcgcgg cccacgccgg caccacgccg gatgacgccg tcagggcgct gctgagcacc     45300
     gacggtgtcg ccgcgctgac accgtggatc cgcagctggt cgctcttcag cttcagcatt     45360
     ccttttcttg ccaccgccaa tgtcaacgcc accttcttca tcggcggcat cctgatgctg     45420
     atcatctttg cgatccagca tcgcggcatc tccgagacgg caagcgtgca gaagtggctg     45480
     gcaatcatcg tgctggtgcc gctgctgatt atcggccttt acccgatcgt cagcggccat     45540
     atccttgccg ccaacgttac cggcctcgta ccgccgacgg ccgcctattc cggcgccgac     45600
     ggcagctgga gcaacggcgg ctggacgctc ttcctcggcg gcctctatat cgccgcctgg     45660
     tcgacctacg gcttcgagac cgccgtctgc tacacccgtg aactcaagaa cccgaagacc     45720
     gacactttca aggcgatctt ctattccggc cttgcctgct gcctgttctt cttcctggtg     45780
     cccctcgcct tccagggcgt tctcgggcat gcgggcatgc tcgcccccgg catcgtcgac     45840
     ggcaccggcg ttgccgaagc gctcggcggc ctgatcggag ccggccgcgt cgtcacccag     45900
     ttgctcgtcg tgctgatgat catggcgctt ttcctcgcca tcatgacggc gatggccggg     45960
     tcgtcgcgca cgctctatca aggctcgaag gacggctggc tgccgaaata tctcgaccac     46020
     gtcaacgaaa acggcgcccc gacgcgggcg atgtggaccg atttcgcctt caacctcttc     46080
     cttttggcca tcgcctcgga taccggcggt tacttcttcg tgctcgccgt ctcgaatgtc     46140
     ggctacatca tcttcaactt cctgaacctc aattccggct ggatccatcg gatggactcc     46200
     ggccatatcg aacgtccctg gaaggcgccg acctggctga tcggcctcaa caccgtgctc     46260
     gccttcgtca acgctctgtt cctcggcgcc ggcgccaagg tctggggtta ttccaacgcg     46320
     ctctgggtcg gcttcatctt cgccgccctg atcctgccgg tcttcgccta tcgccattat     46380
     gtgcgtgacg gcggcaagtt cccggcaggc gcgatggaag atctcggcct cgtcggccag     46440
     gatctcggcg tcaagaaggc cggcttgctg ccctatctgg cactcgccgg cggcctggcc     46500
     atcgtcctga tcgccaacgt gatcttccag cttccggcct aaatcgcctc ccaagcagaa     46560
     aagccgccat gataaaacat ggcggctttt tgcgttggcg gctgcggatc cgagacagcc     46620
     cgttgatttt ggatgaagct cagcggccgc cttcgatctt gcggtggcgc tggttgatgc     46680
     cgcccttgcc gtagggatag tcgaagggct gaggggcgct gacctcattc agtcgcgtca     46740
     tgtcttcgtc ggagagcttg agcttcatgg cgccgagatt gtcggccagt tgctccggcg     46800
     tgcgggcgcc gaggatgacc gaggtgattg ccggctgcgc cgccgtccag gcgagcgcca     46860
     cctgcgccat gctgacgccg tgcgccttgg cgatttcctc gacagcagcg atgatcgccc     46920
     aggttcgttc catcgcattg cgcggcgcat aggattcgcc gccgcgattg ggattttcgc     46980
     cgaggcgggt ggcgccggtc ggcatctcgt cgcgcttgta tttgccggtc agccagccgc     47040
     ccccgagcgg cgaccagggc aacagcccca tgccggcatc ctggcaggcc gcgacgatct     47100
     cgagctcgat gtcgcgcacc agcaggttat attgcggctg cagcgtcacc gggcgggtat     47160
     aaccgcgcgc cttggcaatc tcggaggcct tggcgatatg ccagccgaca tagttggaga     47220
     agccgtaata gccgatcttg cctgatgaaa ccgcatcgtc gaggaagcgc agcgtttcct     47280
     cgatcggagt cagcgcgtcc caggcatgca tctggtagag gtcgatctgc tcaaggccga     47340
     ggcggcgcag agaatcgtcg agcgcctggc cgagatggcg gcgcgacagg ccgatgtcgt     47400
     tgggaccgtt gcccatcgga aaacggccct tggtggcgac gatcgcctgg cgggcttcgg     47460
     tcgggcgcgc cttcagccag cgtccgatga tctcttccga cttgccggcg ctgtagacat     47520
     cggcggtatc gatgaaattg ccgccccagg cgaaataatc gtcgagcagc ttgtgcgagg     47580
     ccgcttcgtc ggcctccgcg ccgaaggtca tggtgcccag gcaataggcg gtgacgacgg     47640
     tcccgctggg accgagcttg cgataatcca tatcttcctc ctcatgcgga cgcccgcagc     47700
     cgacgcacaa aatcgccggg gtagaagccg gggcttccgc aatcaatgac aatatcgagc     47760
     ttgaggcggc cgcttgccgc cggatgacgt ctggcgccct gggctcatct ggcgcagggg     47820
     ctgaagcagc ataaccaatc ccgccggtgt cacaagtggg aaaaatattc gcgcaggcca     47880
     tgcgacccgc gacttacact tttgacgaca acgagccggc gatcagatcg gcggcagcga     47940
     caccggtctc gtaggcgccg tgcgccgtcg aataacgcgc gcgcgaacag gcttcgccgg     48000
     caaagaagat ccgctggtca tgcggtgcgg cgaggaccgc gcgcagatcc gaggcgccgg     48060
     gttcggcata ggaataggag ccgccgatat ggggtgcagc ggcccaggcc gagatcgccg     48120
     caaccgacaa ttccttgcgg atatcggcgc cgaattctgc cgccagctca tcggcggcga     48180
     aggaaaaggc ggcctcgctg ccctcacgct ccagatcatg ggcgaggtcg ccggcaaaat     48240
     aggcctcgac gacaggagcg ccgagcggcc ggagctgata ggtgccggtt gcgccgcggc     48300
     tgacggagcc gagcatatgc gtatcggccg gcagcacctc ctgattatcg agcctgagaa     48360
     acagcttgtc ggcgagcccg agcggcaggc gcgccgccgc ctcgatcttc tcgggcaagg     48420
     gagggtcgaa ggcgatcttt tcggcggcaa gcacattcgt cgaaacggtc accagcaccg     48480
     cgcgagccct gagcccaccc tggttcgtct caatgtcgat gcggccggca tggcggtggt     48540
     cgatgcgcgt gacctcgacg ccaagccttg ccggaaccgg cctgccgtaa cgggagatca     48600
     agtttccata gccctcacgc acccgccaat ccgggccagg gccaggatca tatctggtgt     48660
     agtcgacgac cgaagagcac tccagttcgg caccggtgat ataggtgccg atcgcccgga     48720
     tctggccatt ccaggcattg cccggttcga gcatttcggc cagatcggtg tcatcacctt     48780
     catggctctc caggcgttcg aaataggcgc cgatcgcctc ttgcgcggcg tggatctgcg     48840
     catcgtcccg ctgcagctgc cgtccaccat tccagggcgc cggcgtgcgg tcgaccgtca     48900
     atccgacctc gtcggcaata ccagtccagg ggttgctccg cgccccgtgc agccagccgc     48960
     agccgaggtc gagcgcgatg tcggctgctc ccggcagccc gaccgtccag gctctgccgc     49020
     caaggcggtc gccggcttcc agcagcagga tcgaaatatc cggacggatc gcctgcaggc     49080
     gacgggcagc ggcaatgccg gcggcgccgg cgccgatgat gacgacgtcc tgttcgacac     49140
     tcgtgccgtt gtcaccgggc atggcttttc ctttggctgc tcgcgctcag ctaagcttgc     49200
     atgtccatga aaggcaaggg gctggggata gcgccgcgcg cgatggatta aaccgcgtca     49260
     gcgtgacata caggtccgat gagcgtgcag agagattcgc aactcgatat gtttgccaag     49320
     ccgtcaccgg cgacggccag ggcgcgcgct ccatcgcgcc ggccgccatc gcagccggcc     49380
     ggccattccg atgaagagat ggcgcgcacg cttgaagaga gcggcaacta ccgcatcctc     49440
     cggaaactga ccgcccggcc gattgcaacg gccagacggc cggggttttc gcggcttggc     49500
     gtcattctcg ataccgaaac gacaggtctc aatcaccgca gcgatgagat catcgaaatc     49560
     ggcgccgtcg ccttcacgtt cgacgatgac ggcgggatcg gtgatatcgt cggcatctat     49620
     ggcggcctgc agcagccgtc gcggccgata ccggccgaga ttacccgatt gaccggcatt     49680
     accgatgcga tggtcgaagg ccaggtcatc gatatgtggt cgctgagcgc cctgatcgaa     49740
     ccggccgatc tgatcatcgc ccacaatgcc ggtttcgacc ggccgttctg cgaagccttc     49800
     tcgacgatct tcgccggcaa ggcctgggcc tgttcggttt cggaaatcga ctggagcgcc     49860
     cgcggcttcg aaggcaccaa gctcggctat ctcgtcggcc aggccggtta tttccatgac     49920
     ggccatcgcg cggtggacga ctgccacgca ttgctggaaa tcctcgatcg ggagcagggc     49980
     gacggtgaaa gcccattcgc cgagctctac cgcgccagcc agcgctcgcg catccgcatc     50040
     tttgccgaac acagcccgtt cgagatgaag gaccatctga aggcgagggg ttatcgctgg     50100
     tcggatggaa gcgacggacg cctgaagtcc tggtggatcg aagtcggaga agacgatctc     50160
     ggtgacgagc tttcctatct gcgctcggac atctaccggt ggcgagacgc ggatccgccg     50220
     accgtgcggc tgacggcctt cgatcgcttc aaactctgac cgcgaagcgg ttcggatcct     50280
     gaccggaaca gctccgatcc gacgacccat gcaagcatcg cataggtgca gtgatgcatt     50340
     ggcgctgcaa caatcgatcg gctcatacta tataccactc atcgaagcga acgaagcgcc     50400
     aaggactggc agctaggctt cgaaagccca cggaaagggg atcatcatga acgtagcacg     50460
     ctctttcaat aactggcgca agtaccgtca gacggtcgct gaactgggcc gtatgtctgc     50520
     gcgcgaactg gacgacctcg gcatcggccg cggcgatatc cgcaacgtcg ctcgcgctgc     50580
     catcgcccgt taacggcctg cacagtaagc acttttaaag acttggccag cgcctgcttt     50640
     ctccgaagcg ggcgctttgc ttttgtgctt ccggcgtaac cggatcatgg tgattggagc     50700
     cacctgcttt tcgcataacg catagctgcc ctgcaaagaa atgcctacca actgagcaag     50760
     aaataagtat gattatttct atcgaagcga tgcacctcct cccgcatccc ttcgatatgc     50820
     aggcgcccca tcctcctccc agggtcgtct gcgggaacgg cagcactcct cctcccagct     50880
     gtcgttcggt ttttttcgaa agcctgccgc acctcctccc gcggcaggct ttttcgtttt     50940
     tggccgatcg cgccgaaaac cgcggcgtgc gatccgccgc ccggcgctga agacttttcc     51000
     cgcttaccgc tgattttact cccgattcct gcggtggccg cccgctgcgg gctagtgctg     51060
     cagaaacata ttgacttcga atttgtcgta caactatgta accattcggt tcattgccga     51120
     gcgaaatgga ccgtcgaacc gatccggctt cgctggagca acgacgcgtg acgacaacga     51180
     aactgaagga attttgacat gcagatcgac gtgaggcacg cctcccatcc cgaggccgtg     51240
     cgcgaatacg acacggagac gctgcggcgt cactttctgg tggaaaccgt ttttgcgggc     51300
     ggcgagatcc ggctgactta ttcccattac gaccgcatgg tcatcggcgg cgcgacgccg     51360
     ctggccgacg ggctcgcgct gacggcgccg acggcgatcg gccaggaaac cttccttgcc     51420
     gagcgtgagc tcggcgcgct caacatcggt ggcgccggcc gcatcgtcgt cgacggcacc     51480
     agctatgatc ttgccaagta tgattgcctc tatgccggca agggcgccaa ggacgtgcgg     51540
     ttcgaaagcg tggatgccgc caatccggca aagttctatc tggtttcgac gccggcgcat     51600
     caggcacacc cgaccgtgct gctcacccgc gagaaagccc gccacctgac gcccggcgac     51660
     gcggcaacgg ccaacaagcg gtcgatctac cagttcatcc accctgaggt ctgccagtcc     51720
     tgccagctca ccctcggctt caccatgatc gagccgggca gcgtctggaa caccatgccg     51780
     gcccatacgc atgatcgccg catggaagcc tatctctatt tcgatctcga agccgaacag     51840
     cgcgtcttcc atttcatggg cgaaccgcag cagacccggc atatgcttgt cgccaacgaa     51900
     caggcggtca tctcgccgcc ctggtcgatc cattccggcg ccggcaccaa gaattacagc     51960
     ttcatctggg cgatggccgg cgacaataag agcttcaccg acatggatca catcgccatt     52020
     gcggatctga ggtgagcgcc gtggcaaatc ccttcgacct cacaggcagg accgccgtcg     52080
     tcaccggcgc caataccggg atcggccagg ccatcgcggc ggcgctggcc gaggccggcg     52140
     cctcgatcgt cgccgtcggg cgatcctcga tggaggaaac cgaggcgctg gtgaagcagg     52200
     cgggaagccg ctttcatgtc gtcaaggccg atctcggcac catcgagccg gtcaagggca     52260
     tcgtcgctga agccatccag accttcggcg gcctcgacat cctcgtcaac aatgccggca     52320
     tcatccgccg ggccgatgcg ctcgacttca ccgaagaaga ctgggacgcg gtgatcgacg     52380
     tcaacctgaa gacggccttt ttcctgtcgc aggcggccgg ccgccacatg gtcgacaagg     52440
     gcaggggcaa gatcatcaac atcgcctcgc tgctctcctt ccaaggcggc atccgcatcc     52500
     cgtcctatac cgcctcgaaa agcggccttg caggcctgac caagctgctt gcctgcgaat     52560
     gggccggcaa gggcgtcaac gtcaacgcca tcgcgcccgg ttacttcgtc accaacaata     52620
     ccacggcgct gcgcgaggat gccgaccgca acgccgccat ccttgcccgc attccggccg     52680
     ggcgctgggg aacaccagcc gaacttggag gggccgccgt gttcctggca tcgtccgcct     52740
     ccgattatgt gcatggaacg gtgctgcccg tcgatggcgg ctggctggcg cggtgatcag     52800
     tcccggaacg atgactgcat attcaaagta ctaagcgccg tgcgtctgaa gagacgcgcg     52860
     gcgctgtcac atagagctgc cgtgatcgag gtccttttgc ctttcctgcc ggcatgcgtt     52920
     agcaaaagga catcagaccg gcagagccgc atcgggggca ggatcgacac aggatgacgg     52980
     acagagacaa cgcggtcttc aacactattc gccagccgcc gaacctgcgc agcggccttg     53040
     ccgatacgct gatggcgcag atcgagtccg gcgatctgaa gcccggccag cgcctgccga     53100
     ccgaacaggc aatcatgagg acgaccggcg tcagccggac gattgtccgc gaggcgctcg     53160
     ccacgctgcg cgccaagggc ctgatcacca cccggcaggg gcttggagct tttgtttcga     53220
     acgatcccaa cccgcgatcc ttctcgatca ttcccaacga cctgcagtcg atcgacgaga     53280
     tcctgcgcgt gctggaactg cgcatggggg tcgaatacga agccgccggt cttgccgcgc     53340
     tgcggcgcac gcctgaggat ctcgaccgca tgcaggatcg gctcgatgcg ctcgacaagg     53400
     cgctggagga gggcggatac ggggcgcagg aggactacgc cttccaccgg tcgatcctgg     53460
     tcgcgacgca gaactcctat tacggccgcc tcttcgatac gttcggcgac ctcatggtgc     53520
     cgcggcaatg ggcccgcctg gacaagatga cggcggccga gcgcaagcgc catgcggcgc     53580
     gcatgcgccg ggaacaccat gccatattcg cggcgatccg cgacggcgaa gaggccgccg     53640
     cccgccgcgc cattcgaact cacctgtcga agagtgccgc ccgcttcgaa gaactgcgcg     53700
     acgccagcac ctcgtcgtga atattacgcg tcgggcttcg gtttcatcag ccgccgccag     53760
     gcggcgtgat ccgtctgcag ctcgacggaa gcgtgaaccg cgggaagaag cggcttgcgt     53820
     ctgcgccggc cgaagcgtcg tttgaggccg aggatatttt cgacgaagct cctggcatag     53880
     agtccgggcc cgctcgaata gatgcgccag ccgccgtcga ccgcgacctt tccggccttg     53940
     acgcgcgccc attgcgccgc cgcctgatag cgatcatgga aggccgcgtc gctgctgctg     54000
     aaataggtat tgcgctggcg caacgacgcc tgcggcaggg ccgtggtgac ggcgatggga     54060
     ttgacgagcg aaatcgcctt ccagagttcg ttcgcctcgc cgtccaaagc gagcgtctcg     54120
     caataacgca gatgcgcatg cacatacatc agcccgatct cgcggccgac gaaggaggag     54180
     gattcggccc ggcgaaacag cgtctccggt cctccggcat aggtcgccgg cttctccatc     54240
     agccgcacgc cgtctgggaa gagcagatgc tcttcgatca gcttcatatg atcgcgtcgc     54300
     tgatccggcg tgaacagccc gccgagcatc gcctgcgtca tcgcgatcag cgagtaggag     54360
     aggccggtgc gactgtcgct cgggtgcagc agcaattcga cgccgtcatg ggcgggatcg     54420
     aagataccgt agccggccac gatgccgtcc cgcacgagat ggcggttgaa atcccgccgc     54480
     atcgccgttg cgattttcct cagcaatttt gccttgttat ttctggcctt tttcccgtgg     54540
     ccgagacggc gcaggatcgc ggaatagcgg acgatctgct cgtaaagcag ggcgacggtc     54600
     cagctgctga ccatccagtc gcgcagatgc ggatcggccg gctgcaggga atcgttccag     54660
     tccccctcgc cataacggat cagatgtgtt cccgggatga actggccgcg aacggtatcg     54720
     agcagcttgt cgacatggac cgcaatgctg tcggccttcg gcgccttttg catggtcttt     54780
     tcatcgcgcc aggagacctt ctcgtcgaga atggcaagat cgccggtcgc ttcgatatag     54840
     tcgcagagcg ccttcaatgg ccagacgata acgtcgccat ggctgtcgcc tgctcttatg     54900
     ttggcatagg gctccagcat gaaccattgc ggccagtcgc ctttctcaag gtactgctcg     54960
     ctgaagaccg tttttaccac ctctttggct tctcggtcat gctcgtaggc gagcaggaat     55020
     tcgatcggcc cctggcaggc gtcgcgtgtg ccccaggccg caccggtata ttgctcgagg     55080
     ccgtgcggaa cgctcagatg cacgatggcg tcgtgcgcga gccagggcag cagggtcgtc     55140
     tgcgcggcaa ggtccggcga agggttatcg atcgtcaaac cacgaacggc gttccgccag     55200
     aatttcgatg ccggcgccag catggctgcc tcggtgacgc cagcctcgta gcgttgcgcc     55260
     agccgctcgg cttcttcagc attggtcatc gagccgacca cggcgaatga gagggcctgc     55320
     gtcggccggg agcgcagggc gacgaaggcg ccgttgcgcg caacgccatc ggtatagagc     55380
     agttcgtcgc cgccgatttc ctcgatggcg tcgggtgtcg aactcaccag ccaatagccg     55440
     gcatcgggat aacgctcgcc ccagagccag gccggatccg gccggaaggc gatgcgtttg     55500
     cgcgcggcat cgaccgcgat ctgcccgccc gcgtcatatt cgcgctcgcc aagcacgaca     55560
     tgcccgaaca ccaggaagcg gcacggcttt ccctccgcgg agacggtcca ttgcatggcc     55620
     gcgtcctcgc cggaggcgac cgccgcaacg gtgatcgtgc gttcggaaca ttggtagatc     55680
     cagcggcagt cgttaagccc catttcgaac gccgacggca ccgccagcag ctgccagccg     55740
     gcacccagat ccgccaggat gcgcagcccg ctggcgcgcg tcaggttgta ggggtcgcgg     55800
     gagacggaaa agagcttgtg gaacgaggta ttgccgatcg tcagctgcgc ggcgaaaatg     55860
     ccctgcatcc agcaggtggc ggcaagagta gaatcgtcga gcagcatatt cgcaccgctt     55920
     ctaacgatcg cgccgtggcg gcgcgccacc aaaagctctt tctcgcgcag gacgacgtgg     55980
     cggttcaggg cgccgtccgg cgtgaagaac gacagcagct tcccgccggc gcgttcttcg     56040
     aggctccgct cgggatagag ccggccgatc gcctttttgt cgagcggctc gacctccaac     56100
     agcgacgcgt cctgcagcag gctgcggacc ggcgtcacgc cttcgaggcc ggcggcaacg     56160
     cttcccgtgg ccgcaagccc gtcgagccgc gcaagatcgg catcgctcga cgcctcggga     56220
     tgatcggcgg caaatactgc aaagaaagtc gcaccagcac cgcttgcgga aatggcgagc     56280
     ggtttcgacc ggatggccgg gcaggccgtt tcctgctgcc gccgttcact cggcaggctg     56340
     gcgccgaagg ggccgaccag ccgatcgccg agacggtctt ttgcctgcac cagctgcatc     56400
     gcatccgtgg cataggcggc agtcccgtcg aggcagccct gggcgagcca gggactgcgg     56460
     gcgccaccct gtttgagatt ttgccggttc atcaccacgg ggccgaatgc cggatgatcg     56520
     gcgatatggt gatcgacata ttgcgaggca taggcttcgc tgttcatcag gaagccgcga     56580
     tcgccaaggc cgacatcctg gatcagcacc agatccgccg gcagggtttt ctccttcgga     56640
     tgccggagcg agacgcgcca gaaccatgcc gtttccgagg gatggagttc gagccgaacg     56700
     tcataggcga tatcgcctgt cttgccgctc cagcagaagc tcgtcgcatc gtatccgaag     56760
     ctgccgttgg cacgcggccc gacaatctcg acgacatcag gccgagcgcc gccgatgcgc     56820
     agatacaggc ggccgatgcc gccgatgagc ggcgaaccct ggatctgatt gatctgcacc     56880
     gcccccttgt cgtcggcata ctcgatggca aacagcgtgc cgttcggcag cgccgatatc     56940
     gtcaggccgg agccgttgct gatcgtgaag aggccgagat cgtcgcgtcg gggcatttga     57000
     aagctgcggt caaggttcgg ggccattgag atctcgtcga ttgatcagag gggaatcgaa     57060
     ggatgacgca aaaagattga gagaaatctt accggcggcc gaccgaacgg caacatatcg     57120
     ccatgtgtca cgttgacgcc ggccgcctgg cgaagggcac gcagagcagg gcgcagccgg     57180
     tgaggatggc gacaaccatc caggcttcgt tgatcgcctg gacgctggcc gcggtctgga     57240
     caagcggatc gagcagcgcc gtcgtatccg catcgaattc cccatggtgg cccaatatgg     57300
     cctgaagtgg tgcgccgaca aatgtggcgg catcgatgtc gccggcctgc agacgcgccc     57360
     agagaccttg gcccagcggt tcggagcgcg tgtagatgat ggtgtcgatc agcgcgatgc     57420
     cgatggcgcc gccgagattg cgcatcaggt tgaaaagccc gctcgcatcg ggaatgcgat     57480
     cggccggaag cgtgccgagc gctagccgcg tcggcggcag caggcagaac atgatggcga     57540
     cgccgcgcac gatctgcggc cagaacatcg catcgtaatc cgaacgcgga tcctgaaacg     57600
     cgctcatgcc gacgccgatc gcaaacagtg cgaaaccggc ggccgacagc agccgcgcat     57660
     ccaaacgctt ctccagcgcg accgcgatcg gcgccgtcac caattgcgcg atgccagtga     57720
     ccagcatcgt catgccgatt tcgagcgcgt cgtgacctct gacgaaagcg agaaacaccg     57780
     gcatcagata gacagagccg aacaggccga tgccaagcac gaagcttaag gtcgagccga     57840
     cgagaaaatt gcgatcgacg aaattgccga gatcgacaat cggccggtcc cgacgcagcg     57900
     tgcgagcgat gaatacaccg cccgagacaa gacagatcgc cagcaggctc agcacatagg     57960
     tcgaggtcca gccgctggtc ggcgcctcct tcaggctgag ttccagcgtc gtcagcgcag     58020
     ttgccattag aagaagcgac aggccgtcga gatgcctgag ttcggacggg tcggccggct     58080
     gccgcggcag gaagaatgcc gccaggattg ccgaggctat ccccggaacg atgttgatca     58140
     ggaacagcca gtgccaggaa taggtttcgg tcagccatcc gccgacgatc ggcccgactg     58200
     tcggcgccag caccgccagc acgccggcaa ccgtcgtcgc cagcgcctgc cgctcgttcg     58260
     ggaacaggat gaagacggcc gaaaacaccg aggggatcag ggttccgccg gaaaaaccct     58320
     gcagcacccg ccaggcgacc agctcgccga agctgccgct ggccgcgcag ccggcggaag     58380
     ccgtcacgaa caggccaatg gcgacaacga acagccaccg catggtcaaa agccgcgtca     58440
     gcaggccggt gagcgggatc gccaccactt cggcgatgag ataggccgtc tgtatccagc     58500
     tcatctgatc cggatcgatg cccagtgccg actggatggt cggcagcgac gtcgccacca     58560
     cctgaacgtc gaggatcgcc atgaacatgc cgatgcacat ggcgatgaag ccgagccaga     58620
     cgatggcagg ccttgcatcg ggatgggcag gctcaactcg ttccatgcga tgatcctgcg     58680
     cgcgcggcat ttctgccgcg gttgagaaga tcgatcatgt ttgcggtgga gacgatcgac     58740
     atgtcaaccg gcatgtcagg gcaagaggtg tccgaaatgc aatcgagccc gaccggggaa     58800
     ggcgaagctc gatcgttgat cggcggaggg gagccgggtg ttttaagcgc ccggctccct     58860
     ttgcgtcttt gattgcgatt agccgcggaa gagcgacagg atattctgcg acgacgaatt     58920
     ggcgattgac agcgactgga tcgccagctg ctgttgtgtc tgcaaggcgg acagtttgct     58980
     cgattcctcc tccatgtcgg cgtcgaccag ccggccgaca cccgagtcga tcgaatccga     59040
     cagcgcaccg acgaaatcct cctgcagatc gatgcgcgtc gagatcgaac ccagttgcgc     59100
     accggccgaa gtcatcgccg agagcgcgga ttcgatggtc gacagcgccg actggatctg     59160
     accggtggtg aagttggtaa tgtcgagcga atagacggaa tcgccgcttg catccgccgt     59220
     tccgaggatg ccggtggagg tttcgatcga gccgccgctc atgccgaaca gcacgttgcc     59280
     ggcggagctg gtatccagaa cgtaatccgt catcttgacg gaaacggcgc cggagccgtc     59340
     gcgaacgaag gacgatacga cgctcttcgt gccgtcggcg ccggcgaccc agttctcgcc     59400
     cgagaacgat gccgactggg caatgctcat cagctgttcc tgcagctggc tgatttcttc     59460
     ctggaccttc gacttgtcga caccgtcttc ggtcgctgcc accagcttgg atttgatctc     59520
     gtcgacgacg tcgatcgcgc tgtccattgc cgtataggcg gtatcgacct ttgcggcgcc     59580
     gaggccgagc gcatcggaga cggcagacag cgccttgttg tcggagcgca tcgtggtggc     59640
     gatcgaccag taggcggcat tgtcggatgc agtatcaacc cggtagccgg tggagacact     59700
     gttctgtgtc gtttcgagat tggaattgat gctgcgcagc gtctgaaggg cagccatcgc     59760
     ggaattgttg gtattgatgc tcgtcatcgg agttcgcctg gttcggaggt tgaatctgtt     59820
     gaaacccggg gaaacatccc ggccgtggcg agcagcctca tgcttattga cctggagttt     59880
     ccgatcaatt cgccatcgtt ggattaatta tcgtacttaa aagtacctta atggttaacg     59940
     cggcgaggcc cgcccttatt ttttattcac catgatattg cgcgcctcga tctctgccga     60000
     aaacggctcg ggatgccgcc cggaaaaatt tgagatcggc aattgacgca tcagcgggaa     60060
     actgactatc aatattaaat caatttgatt gactccaaaa atagataaca agggaacgtt     60120
     ggaatgagat cgagcaaacg catgtttcac aacatttccg tgcacgccgg cttagcagcg     60180
     gcaaccgcgc tgacggcgct cgtcgctttc ggggcgggca gtgcggcggc tgaatcggtg     60240
     ctgacgatgc acatcgaaga gcagaccagt tgggttcaga acttcaatcc gttcgatctt     60300
     gccggccgtc ggcagagcac gatggatttc atctacgagc cgctggtcat cttcaatgcc     60360
     gaggatggcg gcaagccggt tttccgcctg gcgaccgctt acaaattctc cgaggatatg     60420
     aaatcggtca cctatacgct gcgacccggt gtgaaatggt ccgacggcca gccgctgacc     60480
     tcggccgatg tgaaatatac gatcgacctg atgctgaaga acgcagccct cgacacggtc     60540
     ggcgtcggtc aaacggttgc ctcggtcgag acgccgtcgg cgaccgaggt gaaggtcgat     60600
     ctcaaggccg tcaactccga tttcccggaa acgctggcgg acctcgccat cgttcccgag     60660
     catatctgga aggacgtgtc cgatcccgtt gccttcaaga acgagaagcc ggtcggttcc     60720
     ggcccgatga ccgagctgcg ccgcttcacg ccgcaggtct acgagcagtg ccgcaacccg     60780
     aactactggg atgccgcctc gctgcatgtc gattgcctga gactgccgca gatctccggc     60840
     aacgaccaga tgcttgccat cctgcctgag ggcaatatgg actggatcgg ctccttcatt     60900
     ccccagatcg acaagacttt cgtcgggctc gatgccgacc ataacggcta ctggcagccg     60960
     ccggccgaaa ccgtcgcttt ccagatgaat ttcaagagcg gcaatgacgg caacctcgag     61020
     gcctataagg accttaactt ccgccatgcc ttcagcctcg cgatggatcg caagtccatg     61080
     gtcgatattg ccggcttcgg ctatcccgtc gtcaacgaac atgcgaccgg cctgccgccg     61140
     cgtttcgaaa gctggcgcaa caaggatgcc gagggcggca aggacgcctt catgggcttc     61200
     gacaccgaaa aggccagcaa gattctcgac gatgccggct acaagaaggg cgccgacggc     61260
     ttccgcacga cgccgagcgg caaaccgatc gccttcccga tcatcgttcc gaacggctgg     61320
     acggactgga tcgatgcggt ccagatcgcg gtcgaaggcc tgcgcgccgc cggcatcaat     61380
     gcgtcggtcg ccacgcccga atatgaacaa tggcgcaaag agatcatcga cggcagcttc     61440
     gaggtcgtca tgaactcccg cgccgacggc gcaacgccgt tccgcggcta ttaccagagc     61500
     ctttccacag cctatggcgg gcgcatcacc ggcgcgccct cgcgttattc gaacccgaaa     61560
     ctggacgcgc ttttcgatca atatctgcag gcaacgtcgg acgacgatca caagaagatc     61620
     ttcaacgaca ttcaaatgct gatcgccgac gacttccccg tcgttcccgt cttcaacggg     61680
     ccgacctggt atcagttctc cagcaagcgc ttcaccggct gggtcaccga caaggatccg     61740
     gtgatgaatc ccgaggatca cgacaacaac cgcatgcgcc tgatgcatct cttgcgtctc     61800
     aagccggtca gctaaaccca gcgggggagc aaaatgcgca tttcgagccg gcgcctcggc     61860
     gtctacgcgg tcgcgctggc ctttgccatc gtggtgaact tcatccttcc ccggctgatg     61920
     ccggggagcc cggtcgatgc catggttgcc cagctcggtc cgcgggcaac gcctgccgcc     61980
     gtcgaggcga tcaaggcgcg cttcggcgcg gtcgaccaac cgatgctttg gcaattcgcc     62040
     gattatctga aggggctcgt gaccctcgat ctcggcgtct ccgtcaaata ttacccgcag     62100
     accgtcgtcc aggtgctcgg tcgctcgacg ctctggacca tcttcctggt caccacagcg     62160
     attatctttt ccctctgtgt cggtgtcgtg ctgggcgcag tgtcggcctg gcgccgcggc     62220
     gggcgtttcg acacgatcgt ttcgccgctc tcggtgatca tgatttcggt gccgcccgtc     62280
     atcgtggcgc tgacgacgct tttcgtcttc gcggtctcgc tgcgctggtt tccggtgggt     62340
     tatgcctatg atcccaatct tgatcccgcc ttcaatttca cctttgtcgg cagcgtcttt     62400
     gcccatgcga tcctcccggt gctgacgctt tcgccgtttc tgatcggcga attccagacg     62460
     acgatgcgct cgtcgatgat ctcggtgctc ggcgaggact atgtgaccat ggggcgcgcc     62520
     aaggggctca gccacctgac cgtgatgttc ggctatggcg cccgcaatgc catgcttccc     62580
     gtgctgacca atctggcgct gatgctcggc gccgtcttcg gcggctcgat cgtcaccgag     62640
     atcgtcttca actatcccgg cctggggctg acgctctata ccgcgagcat cgcccgcgat     62700
     tacccggtca tccagggaca gctgttgctg atgacgctcg ccacccttgg cgccaacttc     62760
     ctcgtcgaca tcatttacgg ctttgtcgat ccgagactgc gggaggccgc gtgatgagct     62820
     ttacgctgtg gcccatcttc aagcagaaga aagcgttggc cggcctgatc atcatcgcca     62880
     tcctctggct gatggcgctg tttgcgccgc tcgtcgcccc cggagagccc ggagcgcgtg     62940
     tcgggcgctc gcatcagccg ccgtcgatcg aacatgttct cggcaccacg aaaatggggc     63000
     gggatgtcta tcgccagttc gtctggggcg cccgcagctc tctttccgtc ggctttgcca     63060
     ccggcattgc catcaccgtt ctcggcacgg cgatcggcct cgttgccggt tatgccggag     63120
     gcaggacgga tgcctgtctc gatcttgcga cgaatgctgt gctcgtcatc ccgaacatgc     63180
     cgcttctgat cctgctcgcc tcctttgccg gcacggtagg gccgatgacg atcatgacga     63240
     tcatcgcgtt gacctcctgg ccgtggggcg cccggatgac gcggtcgcag acgatggcgc     63300
     tgcgcaatcg cgatttcgtc acggcgtcga agatgatcgg cgagccggcc tggcgcatca     63360
     tcttcgtgga gatcctgccg aacctgacga cgctgatcgg catcaacctc gtcggcagca     63420
     tcatctacgc catcgttgcc cagacgacgc tcgaatatct cggcttcggc gatccgctga     63480
     aagtctcctg gggcacgatg ctttacaacg cccagaattc ctcggcgatc atggtcggtg     63540
     cgtggtggga catcggggtg cccgcactcg gcatcgccct gaccggcctt ggccttgcgc     63600
     ttttgaattt caccttcgac gagatcgcca atccgcagct ccgctccggc ccggcgctga     63660
     cccgctggtt ccgcctcaac cgcgcccgca acagggaact ggagcttggc cgatgagcga     63720
     caatcttctc gaaatcgaaa agctcaatgt cgactacctc gtcgacaagg gagaattccg     63780
     cgccgtgaag gacgtctcct tcacgatcgg ccgcggcgaa atcttcgggc ttgccgggga     63840
     atccggctgc ggcaagagca cgatcgccta tgcgatcacc cgtctttcca aggcgcccgc     63900
     ctggatcagc agcggcagca tccggctgga cgggcaggat cttttgaagc tgccggaacg     63960
     tgagctgcag acaatccgct ggaagcgcat cggcatggtc ttccagagcg cgatgaattc     64020
     gctcaatccg ctgatgcggg tcgaggcaca gttccacgac gttctgcgcc ggcacaccgg     64080
     ttgctcgcag gcggaatccc gggcgcgggc cgaggaaatg ttccgcctcg tgggcattcc     64140
     cacgcatcgc atcggcgatt acccgcacca gttctccggt ggcatgcgcc agcgcatcgt     64200
     catcgcgatc tgcctggcgc tgagaccgga actgatcatc atggacgagc cgacgacggc     64260
     gctcgacgtg gtcgtgcagc gggaaatcct cgaacaggtc gtcgacctgc agcggagcta     64320
     cggcttctcc gtgctcttca tcacccatga cctgcatctt atggcgcagc tctgccggcg     64380
     catcggtgtc atgctgaagg gcgagctcgt ggaagttggc gacgtcagcc aagtcgcgca     64440
     tgcgccgcgg cacgaatata cgcggaagct ctggaatgcc attccgcagc ttcccgacaa     64500
     tcggcatcta tcgggagtgg tggcatgaaa gcggaggcaa atcccgttgt cgctgaagcg     64560
     gtgatccggc tcgaagggat agagcgtaat ttcggcgcgg tccgcgcgct gaaaggcgtg     64620
     tccttctcgc tgtttcccgg ccgggcattg gcgctcgtcg gcgaatccgg ctgcggcaag     64680
     acgacctgcg cccgcatcat cgcaaggctc gacaaagcgt ccggcggcag gctgtttttc     64740
     cgtgggcagg agctgactgc ccggggcgac gctggggccg agcatcgcta ccgccgggag     64800
     gtgcagatgg tcttccagga tccgttctcg tcgctcaacc cggcctttac cgtcagccat     64860
     catctggcgc ggccgctgca actgcatcgg cagagcggcg taaaggctga tctcgccgag     64920
     gagattaccc ggctgcttgc aagcgtcggg ctggaacccg atgtgaccag gcagaaattc     64980
     ccgcatgaac tgtcgggcgg gcagcggcag cgcgtcaaca tcgcccgggc gctcgccgtc     65040
     gcgccgagcg tgctggtcgc cgacgagccg acctcgatgc tcgatgtttc catccgcaag     65100
     gatattctcg atctactcgc cagggtgaaa cgggaaaacg atctcgccat gctctatatc     65160
     acccacgata tcgcaacggc ggcgcatgtg gccgaggaga tcgtcgtgat gtttgcgggc     65220
     cagatggtcg aatggggcga caccgaaagg gttctttccg acccgcgcca tccctacacc     65280
     aggctgctgc tttccgccgt tccggacggc agcaggccgt tcgtgacggg cggaagcgcg     65340
     cgcttcctcg aacaggcgga aaaggtgcgc gcgctgagcc gccctgaatc ggctgacatc     65400
     gagcaggtcg gccccaacca tttcatccgc gcgctcggcg tttccaacgc cggaatgccc     65460
     aagagctgat tttcaaaagc ccgcttctca agaggccaat gttcaaaagg aaagagtgac     65520
     catgtccata ccgcgaccga aaaccctgcg gctcgaaacc ctttggaatc cgcctgccga     65580
     cggcaaggag ttctcctatg tcctgcgcct caagaacctc ggcaacgagc cgatttcggg     65640
     cttctcgctt tgcatcagcg gtccgggccg ggtcgatccg gccggacggg tcgaaggcgc     65700
     cacggtctcg aagcggctct ccaatttcac cgaattccag ccgccggccg atttcgttct     65760
     cgccgccggc gagacctgga cgatctcggt ctacgcgctg agctggcagt tccgccattg     65820
     gacggatggt gcgacgagcg cctatctcgc gctttccgat ggcggcacca tcgtgctcgg     65880
     catcgagccg acgcgctcct cggtcagcaa tgcggcccta aagcggggcg ccgagatcta     65940
     tccggttccc gccaatgcgc ccgttcaggt gtcgatcatt ccctggccga accatgtggc     66000
     ggtcgcctcc cgccgtccgt tgccggccgg ttttgcaccg cgggcgcaga gtgccgaagg     66060
     ggaggcggca gcgcagagct tcgcggcgct ggtcgaccat ctcttcgccg tcgaaggcat     66120
     cgtgcgcacc gaggcggaag gggcggtgcc ggtcgccctg aaggatgccg ccggcttcgg     66180
     cgccgaagcc tatcggctga gttttgacga ggagaggctg acggtggagg cgagcagccg     66240
     gaccggcttt ctctacggcc tggtcaccct cggccagatc tggcgcggcg caaggctgca     66300
     tcccggcgtc ttccagtttc cggcatccgg cgagatcgtc gacgagccgg cgatgggctg     66360
     gcgcggactg catctcgatg tcgcccgcca gttctacggc gcagccgaag tcaagaagct     66420
     gatcgcggtg cttgcctgga acaagctcaa ccgcttccac tggcatcttt ccgacgacga     66480
     ggcctggcgc gtcgagatcg acgcctatcc ggcactgacc gcggtcggcg cctggcgcgg     66540
     ccacggtctt gcggtgccgc cgctcctcgg gtccagcccg gcccgcacgg gtggctatta     66600
     taccaaacca gtcatccgcg acatcgtcgc cgaggcaaag agcttcggcg tcgagatcgt     66660
     gccggagatc gacatgcccg gccattgcta cgccatgcag caggcgatac cggaactgcg     66720
     cgatccggcc gaggttggca gctattattc ggttcagggt tttcccgaca attgcatcaa     66780
     ccccgccctc gagaagacct acgagatcgt cgagaccatc ctgaccgaac tcatcgagct     66840
     ctttccattc aagacaatcc atctcggcgc cgacgaagtg ccgctcggcg catggtccgg     66900
     ctcgccggca gcgctcgatc gcctgcgcaa cgtcgccggc gatgcggttg ccgatgcgca     66960
     tgccaagcgg ctgaacgtcg tcaccaatac gcatggcgcc gacgatatcc acggctcggg     67020
     tgcggcgatc ctgcaggccg aattcctgga gcgcgtccag cgcttcctgg cgagcaaggg     67080
     ctgcatcacc ggcggctggg aagaggcggc gcacggcgat gtcatcgaca aggcgaagag     67140
     ctatctctgc agctggcgca atgtcgaggt ctcggccgaa cttgccgaac gcggctacga     67200
     aatggtcgtc tgccccggcc aggtctatta cctcgacatg gcgctgcggc cggactggga     67260
     cgagccgggc gccagctggg cgggaacgtc ggatgcggaa aaactctata atttcgatcc     67320
     ggttggcggc tggacagcgg cgcagaagca gagactgctc ggcatccagg cctgcatctg     67380
     gtccgagccg atgaccgatc gcgccgtttt cgaccgcctc gttttcccac gtctttccgg     67440
     acttgccgaa accggctgga cgaagccgtc gtcgaagtca tgggaacgct tcaaggcgct     67500
     ggccgggctg atgccgctgc tctatgggct acaggagtcg taaagccggg ctaggcaccg     67560
     tcatcggctt tgaggatcgc ccaaagatcg tcgtgcgcga actgagaaac gttagcgcac     67620
     gacgacgccg aaatattggt caatccgggc ggtcacttcg cgacggcctg ctgaagcgcg     67680
     cctccggccc gcaaaaactg ctgcgagacg agataggttc ggccccctcg ttagagcccg     67740
     acgacacctg gcaattccga gatatcggcg atctcggtat aaccgtaata gggattggcc     67800
     ggctcatgac cgcgattgac ccagaccttg ttcttgatcc cgaggtcatg ggcgctcatc     67860
     agatcgtagc ggaacgagga ggagcaatgg agtatgtctt ccgggccgca gccgagcatg     67920
     tccagcatat attcgaaggc gcggaaatgc ggcttgtagg caccagcctc ttcggccgta     67980
     taaactgcgt ggaagggggc gccgagcttt ccgacattcg acatgatctg cgcgttcatg     68040
     gcgttcgaaa ggatgacgag tggaatttcc ttggcgactt tggcaagacc agcgggaacg     68100
     tccgcatgcg gtccccaggt cggtacgcgt tcgtatacga gccttgcgtc ttcgtccctg     68160
     aagtcgatgc cgttgcgttt gcaggttctt gagagcgcgt tatggaccac gtcggcatag     68220
     ggcttccaat ccccgatgac ttcatccaga cggtatgcgg agaagtcctt gatgaactcg     68280
     agcatcttct gctcgttcat acggtcgcca taaaggtcgc gtgcggcttc cgccatctga     68340
     aaattgatca gcgtgccgtg gcagtcgaag gtgatgtatt tcgggcggaa aatagccatg     68400
     cgcttcgtcc ttgatttggc ttcgggaaag ccgtctgctt cgagagaaag cataggtcag     68460
     cgtcagtcgc tgagaaggct gaattccccg acgtcttgag caggaaattc cgaatttgaa     68520
     ggtccgaacg tgtttttgat tgcgatggac agtgaatctc cggccctgac tgtcggtgac     68580
     ggtcggccgt cgggggcacc cgatcgggtt agcgcggtaa gtattgtaga atatgcgaat     68640
     gcacgcataa ttcccgcggc tggcgctgcc aggcaagacc gatcgagggc tgttggggga     68700
     taccatggaa acgatcgccg aagacgccga tgctggcgtc gtgtcacccg aactcgtggt     68760
     cgatgcgctg tttgcctgcc gcaagacggc agcgatcagg gcggccatcg agctcgatct     68820
     ctttacccat atcggcgagg gcaaaacggc agccttgctt gcatcggcaa ccagcgcatc     68880
     ggagcgtggg gtgcgcatcc tctgcgacta cctggtggtc aacggtttcc tgacaaagga     68940
     gagcggggag taccggatga ctgccgcgac ccggatgttc ctcgatcgca attcgccggc     69000
     ctatatgggc tccgctgtcg agttcgttgc tgcacccgaa atactggata atttcctgcg     69060
     cgatccggcc gccgtcgtgc gcaacggcgg ttcgcccggg ctcgcgaaca tgtcgccgga     69120
     caatcctgtc tggttgaagt ttgcgcgcgg catgggctcc tttaccggcc tcagcgccaa     69180
     attactggct gacgaaatct ccggctgggg aaagcctctc aaaaaggttc tggacatcgc     69240
     cgcaggtcca ggcctgttcg ggatcgaaat tgcaaaggcc cttccgtcgg cggagatcgt     69300
     cgccgtcgac tgggccgcgg tcttggagct gtcgcggcag aatgcagaaa gagccggcgt     69360
     cgctgacagg tatcggacga tcgccggcag tgccttcgat gtcgactggg gcacggatta     69420
     cgatctcgtc ctgctgccga atttcctgca ccacttcgat ctgccgacat gcgcagggct     69480
     gctgcgaaag atcatcgcca acctggcagc gggtggccgg atcgtcgcgg tcgatttcgt     69540
     gccgaacgaa gatcgcgtgt cgccgccttt tccggcggcc ttctcctggg aaatgctcgc     69600
     cagcacgccg gcgggccagg cttatacgca agatgagttg accgagatgg caagactggc     69660
     cggccttacc ggcgtcacag tcaagccgat gccgccaacg ccggcaagtc tcattctgtt     69720
     tgaatagccg ctcgacggtt gcttagccaa ccggcttttg cagaacgtcg aagcgcggat     69780
     tggtttcgga aaagatcggc agggcggctg caccgaggat ggccgtatcc ttgccggtca     69840
     tgccgatcat cacccggggc acgctgcgcg cccggttggg atcgatcggg acgtgcaatg     69900
     gctccagccg ttctgcgagc cggcgcataa gcgatgtcga tatgctgccg ccgaacacga     69960
     tggtctgcgg atcgaaggca agttcgagga agtcgagcgt ctgccgcagc ggctggacgg     70020
     cctggtcgag ccaggcatcc aggccttcgc cacccccagc gatccgcgcg tcgagatcgt     70080
     ctggagacag ttcctcggca ttggttatgc ccatgaattc gtaagcgacg gtcggcgaga     70140
     tgtagcggtc caggcagccg cgcttgccgc agctgcagag cttgccatgc ggctcgacga     70200
     tgatatggcc gatctcgccg gcattgttgc ggctgccctt gtagaggtgg ccgtcgagga     70260
     acattccggc gccgatgccg ccgccgccgg ccagaaacag atagacgaag ctgctcaaac     70320
     cgcgggcgac gccgtggagg cgctcgccga tcgcagccgc ggtcgcgtcg ttttcgacga     70380
     gcaccggcac cttgacccgc tgctccagct cgtgcccgac aggaaaatcc tgccagccgg     70440
     gcagattttg cgggctgaga gaggtgatgc cgccatcggc atagcggccg ggcagggcca     70500
     tgccgacgcc gagcagccgg tttcggtcga attcgaaggc ctgctgaatg tcctcgacaa     70560
     tcgattgcag aaccggcatc gcccgttgcg gatcgggatg ttcgacgtgg cgctcgatgc     70620
     gcgcgcagac ggcgccggag agatccgtca gaaccccgct ggcgcgctgg cgaccaagct     70680
     caagaccgat cgaataggcg ccggcgggat tgatcgaata ggggatgatc ggctgtcccc     70740
     gcgccagctt ctgcgcctcg gccggaacga gaagatgcga ccgttccagt tcctcgacga     70800
     tattcgacac ggtctgggcg gtcagtgccg tcatccgggc gatcgccgcg cgcgacaagg     70860
     gaccgttggt ccgcacggcc tcgatcacca cacgccggtt gtgagacttg gcctgctcga     70920
     gattcgtgcc ggagattgcc ttcatgtcgc cttcaaagga aatggtgcac cacccttgtc     70980
     acaagacgga tagggatgaa agccacattc ttcgtcagct tttattgaac ctcggcgtcg     71040
     acaggcgcaa cggcattgcg cctctgcagc aggccgagga ttgtgatgcc cgacaatccg     71100
     gtgacggcgc ccagcatggc ggttccggaa taacctgtcg cccaagtgcc ggcggcgaaa     71160
     accagtgcgc cgatccccgc actcgcaaag atattgacgg agatcagcgc gctgccgagc     71220
     cctggccggt cggcgatgag gtcctgcaga taggtgatcg gaaagctgat gatcgccgca     71280
     gcaccgatgc cggcgagcaa ggtcaatgca tagaggtgcc atggctcgga ggcaaagccg     71340
     agaaggctga ggaacacggc atagatgatg gtgccggcgg caagcgccgt catctgcccg     71400
     gtcttccggg caatccgcga ccagacaatg atgaagacga tctccagcag ggcgacgatg     71460
     ccgacgagaa taccgacatc gctgagcgcg ccatgggcag caccagtggc gatcaacggc     71520
     agcagggcgt cgttgagatg cagtgtgctg gtaatcagcg cgacgccggc gatatgcgcc     71580
     gaaatccgtg gcgacaccac ctgcctgagc gccccgagat aggagagatg atgcgccgcg     71640
     gccatctccg ttcctgcccg cttcggcagg gaaaagacga tgatgccctg acagagcagg     71700
     caggagatgg ccgcgaagag gtaggccggc agcatgctcg atgcgccgga aagcacaagg     71760
     cccgtgatgc ccgggatcag cacccaggag agcgagatca tcgcgcgcac gcctgaattg     71820
     gccgtcacca tatcattgcg gttcatgccg tgcatcgccg cgcgcgcatt ggcaaacagc     71880
     agcgaattca aagccccgta gatcggcagc ggcagcagcc cgctgatgat gaaaaccgtc     71940
     gcgctcggaa aggcatagac catgccgtaa ccaacgatac cgaagaagca ggcgccgatc     72000
     atcgccgaac gatactcgcc gagccgatcg gcgaggttgc cgagcagaac actgatgacc     72060
     acgtttaccg ccgccgaggc gaaggccagg aaggaataga gaccgtcgct caagcccagt     72120
     tcgcggatgc cgacgatgga acgatagggg gcggtcatcg cccccgccat gccgaaggtg     72180
     aaaatggcga tcatgctggc gcggatcgca gggttgcgga agacgtcggg gaagaggcgg     72240
     ctcatggggt catcaatcgt caggaaaatc ggcaggcgcg gccgcggcgg gcagtctcga     72300
     aagtcatgtc atgtttcggc tcggagatgg gagcctgaat atcagtaatg ctccgattgc     72360
     gagaaggttc tcgccagttc ggcctggccg gccgtcaggc cgcaatcgac gggcaggcag     72420
     acgcctgata tggcggcggc cagcggtccg gcaaggaagg caaccgcatt ggcgacatcg     72480
     aggggatcga cgacgcgctg cagcggatac cagcggcgcg cttcctcgaa aacattcgga     72540
     ttggcggcgg cgcgtttctc ccaggcctgc gtcttcaccg tgccaggtgc aaccgcgttg     72600
     gagcggatgc cgaacttgcc gtattcgacg gcgaccagcc gggtgaaatg caaaaggccg     72660
     gccttggcgg cgctataggc cgggtgcccg aagacattca tgccgttgac cgaggcgatg     72720
     ttgacgacgg aacccttcga agccttcagc atcggctcga aggcacggaa acacaggaat     72780
     gccgcttcga gattgagcgc attgtccgcc cgccagatct cgggcgtcgt ctcatgcagg     72840
     ctggtggcgc gcgccgcacc ggcattgttg accagcgttc gcaccacgcc ggtatcggcg     72900
     gcgcgtctga ccaagtcggc aatactcgcc tcgctggtca cgtcacatcc ggccgccacg     72960
     aagcgatcgt ccggcccgag ttttgcggcc acggcagaag cagcggcggc atcgatatcg     73020
     gcaagaaaca cgacgtcatg gtcatcggcg agccgtgcgg cgattgccgc accgatatca     73080
     cccgcagcgc cggtgacgat cgctatcgac ttcgtcattt tctgtcgctc ccgttcatga     73140
     acctcaatct ccaagcaatt gccggtcgtc gccgtcgcgg tggatgacga gttgctgctt     73200
     gatgcgccgc agcgtggtcg tcgccttggg ctgcacggca taggcgacca ggctcgacag     73260
     aatatcgacc gtcgcgatgt aggcgatgcg cgtcgaggtc gggcgataga tgttgttacc     73320
     ctcgggaagg tcgatcggca cgacgatttc ggcggctttg gcaacggggc ttgccgtctg     73380
     ggtgagcgcg atcgtcttca ccttggcgcc gcgggcaagc tcgaaggccc gcaccagctc     73440
     catattgcgc ccggagaagg acgagccgat cagcacatcg cccggcttcg ccgcagccgc     73500
     catcatcagc tgcatgctgt gatcggagct tgccgtgatg cgaagcccga gacggaacag     73560
     ccggttctgc agctcgtcgg caatcatcga cgaattgccg cccgagccga aggcgtagat     73620
     catatcggcc ttggcgataa acgaaacggc ggcttcgatc gcggcaagat cgagcgaccg     73680
     gtgcaggaga aagagcgcgt tctgcgcctt ggtgatgata tcctgggcga catcggccgg     73740
     gtcggtgctt ttcgattccg gtttcagata acgcacgccg atatgggcgg tccgggcgag     73800
     ctgcaccttg aagtcggaaa agctctcgca gccgagccgg cggcaaaagc gggtgacggt     73860
     cggcggcgat accttagccc gttcggcaag ttcgatgatc gaggcattca cggcgaactc     73920
     gaagtcgttg acgatgatct cggcgatgcg gctttcggag ggagagagcc ggcccttgtc     73980
     ttcctgcaat gtcgaaaaga tatccaaagc cgctcccgcc cttattcctc acccatcctt     74040
     cttcttatag gccacgcagt cgatctcaac cttgcaatcg accatcatcg acgattgcac     74100
     acaggcgcgc gccggtggat gttcgccgaa atactcctgg tagatcttgt tgaaggtcca     74160
     gaagtcgcgc gggtcatcca gccagacgcc gacgcgcacg acatcctcga cgccgtatcc     74220
     ggcctcatcg aggattgcca gaacattggc gatcgtcttg tgggtctggg cgataatgtt     74280
     gccgtcgatg atctcgccgt cttccattgc aacctgcccg gaaacataga gccatccgtc     74340
     ggcttcgacc gcacgcgcga aaggcagcgc cttgccgccg gcccccgttt gaacagtgcc     74400
     atagcgcttg atgggcatgc tgatgtcctt gcaaattatt ttcttgataa gttgacaaag     74460
     gaccatagaa agcagaattt ggccagtgaa aaacagaaat tatgaaaaga atttcaatcc     74520
     ggggctgata tgcgcgatcc tttccagaat cctttcccct ccgacagcgc ccggcaggcg     74580
     atctgggaaa tgctcgttct gcgcgatatc gatgcttttc tcgccgccga ctggtcgaag     74640
     gtggagcatg atttcgtcga agagggcttc atcggcatcg atgcccagaa gcaggtcagc     74700
     cccgacaggt ggcgcctggc ctttccgacg ctgtcggcct atcgccagga atggctgaag     74760
     caggcaaagg atttcgccga gcagagcttt gcggaagatg cgcgcacggc gattttcacc     74820
     acgacgacgc tcgaagatat cgagatcgaa ggcgagatgg cgcttgtccg caagaagttc     74880
     gacggcggta ttgccaaggc ggacggcacc cgcgacatct tgcaatggca gacgctctat     74940
     tattgcaggc ttcaccaagg acgctggaaa atctcaggtt tcaccggcta cctgccgaac     75000
     ccgatggggt aaagcggggc cgacaacacg aaggccactt ttttgcgcat tttcacggca     75060
     gcattggcga ccgagaccaa tactttttcc ccgatctgcg tggatcgccg cgcattcgaa     75120
     gcctcgcttt atgcgccccc cggccagcat ccggaaacgc cgacgctctg caccgcgccg     75180
     atcaccgtcg gacggcgcgt caccagagac aaaggttggc agctgatcga gggaacggcg     75240
     acctgggccg accctgcggg cctcgtcaac cgggcgacct acgaggaatt gcgtgacgaa     75300
     atcctcggcc aactccgcgc cgcaatgccg gtcgatgccg tcgtcatggg cctgcatggc     75360
     gccatggtgg ctgccggata cgaggatacc gaaggcgatc ttctctcccg catgcgccag     75420
     atcatcgggc ccgacgtgct catctgcgcc gagctcgatc cgcacagtca tctgacggcc     75480
     aaacgcgtcg cggcgcttaa tttcgccgtc tatttcaagg aatttccgca taccgatttc     75540
     gtcgaccgcg ccgaggatct ctggcgcatc gccgtcgaca cgctcgaagg ccgggtcaag     75600
     cctttaatct cggtgttcga ctgccggatg atcgacgtct tcccgacatc gcgcgaaccg     75660
     atgcgctcct tcgtcgacaa gatcatgcag atcgaaaagg atgatccgga cattctgtcg     75720
     atctcggtga tccacggctt tatggtcggc gacgttcccg agatgggaac aaagctgctg     75780
     gtcgtcaccg acgacaagcc ggaaaagggc gcggctttgg cgcgcgagct cggcctcgaa     75840
     ttgttttcca agcgcggcac cttcatggtc ccgcagatcg acgagaggca agccgtttcg     75900
     cgcgcgattg ccgcgaccgc atggcccgtc gtcatcgccg atgtctggga taatccgggc     75960
     ggcggcacgg caggggatgc gacggttatt ctcgccgagc tcctggcccg cggcgtcagg     76020
     agtgctgtca tcggcaccat ctgggatccg gtggccgtgc agatctgttt tgccgccggc     76080
     gagggggctg agattccgct gcgcttcggc gccaaatcgg cgcccggcac cggcaatccg     76140
     atcgacggca cggtgaaggt cgtcaggctg gtaaaaaatg ccgagatgca gttcggcgag     76200
     agcctggcgc cgttcggcga tgccgcccat atcgtgcttg atggcatcga catcatcctc     76260
     aattcgacgc gcgcccagag cttcgatccc agcctgtttt cggtgatggg catcgatccc     76320
     gagaagcaga agatcctggt gatcaaatcc accaatcact tcttcgcctc cttctcccgg     76380
     attgccgccg agatccttta ctgctccgcc ggaacgccct atcccaataa tccggcgacg     76440
     acgccataca ggcgggcgcc gaagacaatc tggccgatcg tggccgatcc ccatggaaga     76500
     gaacgcggag ccgcctagat gcatgatgcc agctttgccg tcgtcgccag ggcgggagac     76560
     cggatcgccg atctctcgac gccgcgcccc gtgatcgacg aagaccggct ggctgccaac     76620
     atcgcccgcg tccaatccta tatggacgag cacggcctga acttccgccc gcatatcaag     76680
     acgcacaaga ttccggcgct cgccgtcgcc cagatcgccg ccggcgccaa gggcatcaac     76740
     tgccagaagg tcagcgaggc tgaggtcttt gccgaagccg gcttcggcga catcctgatc     76800
     accttcaaca taatcggaca gcagaagctc gagcgcctgg ccaggctgaa cgagaaaatc     76860
     ccggccctca aggtcgtcgc cgacagcgaa acgacgattg atgggctggc agcccatttc     76920
     tccggccaca agccgctgac cgtgcttgtg gaatgcgaca ccggcggcgg ccgctgcggc     76980
     gtgcagaggc ctgaagaagc cgcctccctc gccaggcgca ttgccgcggc cgacggcctg     77040
     accttcggcg gcatcgtcac ctatccgaag ccgcaatcgg cagccagcgt cgaggccttc     77100
     atcaccgaga cgctggactg cctgaaatcg gacggcattg actgcccgat cgtcagcaat     77160
     ggcggaacgc cgagcctgtt cgaagcgcat ctcgtcccat ccgccaccga acaccgcgcc     77220
     ggcacctata tctacaacga ccgccagatg gtgcgcatgg gccattgcac cgaggacgac     77280
     tgcgccatgc atgtgctggc aaccgtcgtc tcccgcccca ccgccgaccg cgccgtcatc     77340
     gacgccgggt cgaaggcgct gacctcggat ctccagggct tcagcgacta cggcctgatc     77400
     gtcggctatc cccaggcgcg gatcagcagc ctctcggaag aacacggcgt gatcgatctc     77460
     gcaaactgca ccggcccccg gccgcagatc ggcgaaaagc tcttcatcat cccgaaccac     77520
     acctgcgtgg tctccaacct gttcgacacg atggtgtttc atcggggcgg cgtggtgacc     77580
     cgcgttgaga gggtcgcggc ccgcggcctc gtctggtaga tggcgagtgc agtttaaggg     77640
     cgaaacagcc cccgaacgct ggggccgcag ttattgggga ctacttatga tctcggcatc     77700
     ggctttggag ccgtacgcag tctagcgcct tttagagtga gggagcggaa aagccacgtc     77760
     gtttgtacga agaatgcagg taagttgcac gctcagcatc gctcctgtgg aatggaactt     77820
     gatcaactgg agcaccatct agtttcgggg ttccaaggat cgcctgcgac gtgctaattc     77880
     ggttggggca actgggcgtt ttttgaagag atcgagcaat ggcggagacg cctggaaggc     77940
     aaaccattgg tggcgcggga gctgctacca gcgcgggcat tctgtttcag aagcaaattg     78000
     gtgccatcat aggcgcgtgg ctggtggccg aacagccttt cgaccaacgg ctggatttgg     78060
     gagcggcgaa acctgtatgg ctgcgcttcg agacggaggc gcccgttgac gacatactcg     78120
     tcggaacgtc gactggtgga ttcgtagcag tacaggcgaa aacgacggca tccctgtcgc     78180
     gcgaaatcgg aagcccattt ggaaagacgg tctcacaatt cgtgcggcat tggcttgcgt     78240
     gtcgtgaggg cgacggaagc cttcgttgga accgaccgct cgacgcccgc gtagatcgac     78300
     tggtcctagc ggtcggccca caggctccag ttatgattcg tgaagtgctt ccggctgctc     78360
     tgcgcctcaa ggcacagccc ggcggaggag agctcaacga tgcgcaacgg cgcgccttcg     78420
     ctgacttcga ggcgtgtgtc gagcaggcgt ggagccaagc gaccgcgctt ccctatgagc     78480
     ctgccaccgc acgagatctg gctgcactga taagcgttgt ggcatttgat cccgtggggc     78540
     tcgcccggca agccgtagtg gcgagcttgg ttggcatggt cgcttctcct gctgatgctg     78600
     ccgcagtgct ctccgctctt gaggcgctgt gcggcgaact tatggcgcaa cgcggcgggg     78660
     ttgacctcgc gaccgtccgg cggaagctga tggggcgagg catctcgctc cgaccacctc     78720
     ccgacttccg ccgcgatatc gagcgtctga tggctcacag caccgcgacc gccgcgactc     78780
     ttgaacgctt cgaggtcatc gaagtcgtcg aaggggacag ggtcacaata ggccgagaat     78840
     gccaggacgc agtccgaggc gcggctatca aaggcgactt gctcatagtg ggcgagcccg     78900
     gagctggcaa gagcggggtg ctgaacgcac tggcgcgcga tcttcggctc gagggacgcg     78960
     atgtggtgga gctcgcggtc gatcgatatt cggtcgacac tctcgaggga ctgcgtcaag     79020
     agttaggcct cacccacggc gtcgtcgaga cgttaaaagc ttgggatgac acggagcccg     79080
     cctggctcat catcgatgcc cttgatgcaa cgcggggcgg ccgcggcgag ggcgtcttcc     79140
     gaacgttgat tgagcaggtc atggccagcg gcgggcggtg gaatgtcatt gcctccatta     79200
     ggacattcga tcttcggatg ggtcagcagt tccggacgct gttcaaggga acgcctcccg     79260
     tcgagggaat gatggagccg gggttccccg cggtccgtca cgtgagggta ccatcttgga     79320
     cacagagcga gtttgcccaa ctgctcgcga gagcgcccgt gctagcggct gcgttggcga     79380
     acgcgccacg ggctctccag gacctcgcgg cgatcccctt caatacccgc ctcgtcagcg     79440
     atcttgtgaa agacggtgtc atcacctccg acttctcgca catagcgacc cagtcggagc     79500
     ttctccagtt gtattgggag caccgggtcg agcgctatgc tgcgcccgcg cgggcgtgca     79560
     ttctccgaat cgtaacggca atggtcgagg cgcgcgcgct gcgggcatca ttcgctgtcg     79620
     cggcgcagtc cgacgcgagt gcccttgacg acttagagcg cgagggcgtg ctgatttccg     79680
     tcgacaatcg ccgctggatc cagttccggc atcacctgct tttcgacttc gccgctgcgc     79740
     ggatcatgct cgatccggag gaactgatcc aaggggacct gaggtttggc aaggcagaag     79800
     cccgcggact aatgctggcg cccgcactga gcttcgtact ccgcgagatc tggatgcgcg     79860
     agcccgaccg tgcagagttc tggacggcgg cggggcacat cctctctgat cgtgacggcg     79920
     acccagtcat acggagcgca accggccgca tttgcgcgga atatccttta gcagtttccg     79980
     acatgaaagt cctcgccgga agaattgttg ccggcgacga ggaagcggcg caagcattcg     80040
     ttcattcctg cggagcgctt gtaactcggc tagaagattt tcccgaaaca tcgttgacgc     80100
     catgggttgg gcttgttctg gagatcgcac cgaatgtcgc gcccgttgcc ggaaccctgc     80160
     gtttcctcct gttccgcatc gttgagagcg tcgaggatgc cgcgcagcgt aagaaccttg     80220
     gtatcgcggc acgcgccctt ctggagtact cgctcggcct agaacaaccg cgtaatgctg     80280
     tgtcggcagc agtcgacttg gttgccgaga cttacgggac ggacgtaatg gcctcccgaa     80340
     cattgctagc gaagattttg acgcccgagc gtttgacact tcatgctgcc gaagaggtgc     80400
     ccgcactctg ccggaagatt gagcagatcg gcacgcttga cccggctttc acggaactga     80460
     tctaccagaa gacctatggc ttcgacgtga ttggcgatca ggagaccatg atgggcgata     80520
     gtcagatcat gcccttcagg tccaactccc gccaggacta cgccatggcc cggtattcgc     80580
     tgagcgagtt ctttgaaaca ttccttgagt tgcacccttc gcacgccgtc agcgcagtcg     80640
     tccaggcgac ggaggcttat gtcgtaagag agcattcccg aattgacaaa atgctcaaca     80700
     ccgagcttga ggtcgctggc cgtcgcatcc gtcttcgcga ggactggagc cacatatggg     80760
     cgcacgatcc tgacaagagt tatggccatg acgctgaaag tctggtcaag aagttgctca     80820
     atcacctgag gtgcacagag acagacgcag ctgtccgtat cgccgagcgg cttatccaga     80880
     ccgccagtct ggcgatcttc tggtcacgtc tgttcctagt cgcgactgag cgcgaggatt     80940
     cgctggctgg catcttgctt cctatcgcga tgcaggagga ttttctcacc ctcccagata     81000
     cgcgcaagga cgcagtaggc gtcgtcgcaa agggttaccc aggattagag gaagccgtgc     81060
     ggtccgactt cgaggaggct gtagggcgtt tcgacttttc gcgataccag agaccagacg     81120
     aggcgcgcgc aagcttcgag cgccggctct tcggcgcgat cgggccgacg aatctggcaa     81180
     ccgaacgcgc acgccgcata gctggcgagc agggcgatat agaagacgtt cagaacgacc     81240
     gcctcttcac cgtcagggcg accatggagc ctcccgagcc atattattgg atacaaggtc     81300
     tcgatcagaa ttcgcccgca aatcgcaagc taatcggcgc catcgaagag gctaagcagg     81360
     cgctaggaac ggagggggac gctctgggag ccgtcgggct agaggccgct cttgacgcaa     81420
     tgaaggagtt ggctgcgctt atcgaccgcg ataagcagaa tcctcatctg gtcatctatg     81480
     cggaaggcca gatctcgcaa gcgctcattc ggctagtgga gcgcaaaata ctgccctccc     81540
     cagaagacga tgctgcaacc actcgcttcc tcgaaatgtt ctcaattgca gaggcctcgg     81600
     caggcccgcg ggtggaggaa gacaccgaaa ccgacttcga gcgcggagcc tcgtggggct     81660
     caccggcacc gcgcgtcgac gctgcgcaga tggctctcga cattgtgctt cagcggccgg     81720
     acctttatcc cgatctcgaa ccggccatcg acctgttgct gaatgaccgc catcccgcgg     81780
     tcagattgca ggcgctcctg cgaatcgtcc gtatttggca tctcgatcgg aatggcttct     81840
     ggcgtcggct gtctgcgcgt ctatccggcg agggcaacca gagcgtaatc gaccacgtct     81900
     cggccgcggt gctagggcgg gtggttcacg aagagcctga gaaggtcgag acgctggcct     81960
     tggcgctcct agaacgcttc aacggcgagc cagcgcgcca agcgcggatg cgcgacacgg     82020
     tgtctgacct cctcgcgatc ctctgggtga cgcacgagcg gcgagcgtca ctcgaggtgg     82080
     tcgcaagctg gattgccgaa cccgcggcgc atagtgccga gattttgaag atccttagga     82140
     cattgcgagg agcgctgatc gccgggctta aggatcaggc tgttcttgag gaaagggggt     82200
     tgcgtcaccg ctcgcagaag atcgcgagcg aagtcgtcct caccgccaac cgcgttttga     82260
     aggcctatta cgagaacgat cgatctgcgc ccgagcagtc agagaaggca cgcgattgtg     82320
     ccctcctcct agatgcggtg tgtatggagt tgttcttcgc ggcgggagcc ggacgcgaca     82380
     ctggtgtagc tgaaggctcg ctccgcggcg acgccatggc gacctttttc gatgaagtaa     82440
     gcccgacgct acaggccctc ggcgatttcg ccacgccgca aaccgtatat taccttatac     82500
     agcttctcga gttcctgttg cctgccaatc cagcgcgcac gttcgatctg actgttcacg     82560
     ccttgaggtc gggcgggagg cgcacggggt accagttcga atcgctcgga gccgacctgc     82620
     tcgtccggct ggttggtgtg ttcctagcgg atcacaagga gctcttcgac gacgatgccc     82680
     gtcgcgccgc gctgatcgac tgcctggaga ttttcatgga ggccggatgg cctgctgcgc     82740
     ggcgccttct ctatcgcctt ccggaactga tccagtgaat cgagtcgaag ccgagagtga     82800
     attccggacg ggaatggccg cgattctcgc cgcgatcgac cgtcagccgc aagctggtgc     82860
     caccaatccc tacgcgggag cgggggacga ggtattccac gagcacgaca cgcgagtatt     82920
     cttcttcgat cgcctgatga ggctcctcgg ttgggaacta gggccgggtg gaaatgtcgc     82980
     cgaggaggct agaatcaagg ccgacacgac caaattcgtc gactatctgg gggtcaacgc     83040
     catcacgcgc gcacccgccc tgatcctgga ggcgaagtct tgggacaagc ccaacatcac     83100
     cgggaaaggc aggtggcgcc acgagacgaa gccgaatctc atagttgctg ctgtcaagca     83160
     tatcaactcg gatggtccca aggacaagtc cccagtaacc ggcgagtggc acgacaacct     83220
     atcgcagctc gcgcgctacg ttagactgtt caaggagcag catgagcatg acgtcccctg     83280
     cgccgttctc tcaagcggcc agtggctcct gatattcaag acgccggtcg cgacgttctg     83340
     caattcggat gttaacgacc aacagttttg tttgattgag cgcgacgact atgttgcgca     83400
     ggcgcacgtc atcttcgagc aaatggcgcg ggtgaagctc gctgacacgg cgcctactcg     83460
     catccggtcc actcagctgg cgaactacgt ccgtgccggg agcttcacgg cggcgtatca     83520
     tggtctgctg attaactatg aagcctctgg aagcccgcta ttcgttcagc agccgaggat     83580
     tctcgtgtat cctgcgatct tcgttcagcg cgatgataat gcattgttca cggtgatcga     83640
     cgccgagatt cccatcgttc tgcagctgtc gcgcactgac gacggcgaag agactcttgc     83700
     cccgcacatc aacgaagtcg ctgccgccgc cgcgaagctg ctggcaagct gcaccgcgga     83760
     gttggccatt ccaattcaac ctagtggact agacgagttc ccgggctttc ccgaatcgtc     83820
     tgctgtagcc gctggagggc ttgcgttagg cgagcccaga aaactgctca ttcaaccggt     83880
     tcgaaccgct ccaaacaatt ggctcgccgt cactggcacg ctaccgcact acctgcatga     83940
     ggcgccggtc cttcaatgcc gctttcacgc gtggtccgag tgccaggtgg tccactgctc     84000
     gattggcgcc aatgcggtca actcgccaag tatcgaccgc ccgcgtgcct tcttcattga     84060
     taccaagtta caccactgcg cccaccagac ggtcgccgac cgtcgcgccg accgatgcca     84120
     catcaaggct atcgatgccc ggacctgctg caaggcctgt gcataccatg tatcctgctg     84180
     gtccaccgct gagagcctag tcctcccctg cggaacctga agcctggccg tttccgaatc     84240
     tactgtatct ggacgctgtt cccgccctag tctgcttgcc gacgcgacgt caccagcggt     84300
     ctcgctttgc cgcctgaacg aacgtctgca tttagtatcg cggccggccg gattgaacgg     84360
     cagaaactag gtcgcaatac agctagattg tctacaacgg gcccgattct tccatccgca     84420
     ggggattgtc caacgaagga cacatggtga atacagcccg aactctaccg gcgagcagcc     84480
     gtaactgccc aaggtatcat gtcgccctcg aatgaagccg aacccagtcg cttcaagccg     84540
     ccgtcggatt gatcacattc atatcgattt ccgtcagttc cacccgccgc tcaaacgcaa     84600
     tgcccgcctc gtcgaagagg tggcagtccg cggcattgat gccggttgat actggcgtgt     84660
     cggcgcggat gccgacgctg ccggggagca tggcgcagaa attctcggcc tcgccattga     84720
     gcgaggcata ggcgacggta ttggcgccga ggcgctcgat gacggtcggg gtgacggtga     84780
     agacgatatc gccgccgttc agttggatat gctccgggcg gatgccgagg gtcagcgtct     84840
     tgcctgatat gccgtcgcgc ggcgtcaccg gcaggagggc ggtctggccg cgatattcca     84900
     cctcgacgcc ggcggcgctg gcgcccttgc aggtgacggg caggaaattc attttcggat     84960
     tgccgatgaa gccggcgacg aactggtttg ccggcttatg atagagttcc agcggcgcgc     85020
     ccgtctggga gatgtcgccg gcgtcgagca cgacgatacg gtcggccatg gtcatggcct     85080
     cgacctggtc atgcgtcaca tagatcatcg tcgccttcaa ctgccggtgc agcttggcaa     85140
     gctcgatgcg catatcggcg cgcagcgccg catcgaggtt ggacagcggc tcgtcgaaca     85200
     ggaagatctt cggttcgcgc acgatggcgc ggccgatggc gacgcgctgg cgctggccgc     85260
     cggaaagcat gccgggtttc tgctgcagcc gctgttccag gtgaaggatg cgcgccgcat     85320
     tctcaaccct ggccttgagc tttgcctctt ccatcttttc gacgcgaagc gggaaggcga     85380
     tgttttcgaa gacggtcatg tgcgggtaga gcgcgtagga ctggaacacc atggcgatgc     85440
     cgcgcctgac cgggggcagg tcattgaccc tgataccatc gatgacgata tcgccagccg     85500
     tcgtcgcgtc gagaccggcg atcatccgca gcagggtgga tttgccgcag cccgacggcc     85560
     cgacgaaaac gacgaactcg ccgttcttca catcgagctg cacgcccttc agaacttcgt     85620
     agtcgccgta gaatttctga actttgttaa gaaggagctg tcccaaaaat ctgtctccgc     85680
     cggcggcctt cgtcgcacgc tcgatatagg ggaggggccg cggcttatgc cgcgacccca     85740
     gagaggctcg ggaggcctta cttgaaggct tcgacttcgc cggcagcctt cttgagtgcg     85800
     gcttccggct cggcctttcc agtcaccacc gattggatca tttcgatcat cgagttctgg     85860
     aagcccttat aatcggtgaa gagcggctcc ggaccaccat agctgatgcc gtcgatcaac     85920
     ggcttccaat agggatcctt ggcgacgaac tcgtcgacct ttgcagaggg gcgcagcggc     85980
     gtgaggccgg cgccgccctg cagctcatat tccgactgca catccggcga ggtgatgaac     86040
     ttggcgaact ccgtcgcctt gtcctcgacg cccgaaccct tgaagatcgc caggctgtcg     86100
     gtgatcagca gcgtgccggg acccttggcg tcggggccga gcggcagcgt cgtgatgccc     86160
     cagctgatct gcgtcttctt cagacggtcg gccgcacccg agccggcctg gatcatcgcc     86220
     accttgccgt cgaggaagat ggcgcggact tcgttctgct cataggccgt cgggccttct     86280
     tcggagtagg ggacaatgtc cttataggct ttcagcgcgg cgagaatctg cgggctgtcg     86340
     agcgtgacct tgccgtcggc accgatcacg ctgccgttgt tggtgtaaac ccaatgcatg     86400
     aactggtgca tggtgttgtc gaaggtcttg gcggagagac cgaagcccgg aatgccggtc     86460
     ttttccttga tggtctttgc catctcgatt tcttcggccc aggtcttcgg cggcttctcg     86520
     ggatcgaggc ccgcctgctt gaagagatcc ttgttccagt aaagcgcctt ggtggagaag     86580
     gcgatcggaa cgccccactg gttgccctcg aaggttaccg tgtcgacgat gtgggggtag     86640
     taggtcttct tttcgtcatc ggtcatcggc accggaacga taagatcgtt ctgcgcgaat     86700
     tccttcagcg tgcgcgagcc gacataggcc atggcaaccg gcgtgccggc ggcggcaagg     86760
     gtcgtcgcct tgtcctggca ctgcgcccag ccgacgacct caggggtgat cttccagcca     86820
     gtgttctttt cttcccactg cttgatgtat ttggtgtgga ccgggtcgat cgtgtcgccg     86880
     caatagatcc agctgatttc cttgtcggcg gcatgggcag tgaccgtggt cattgccgtc     86940
     gaaccgagca aggcgagcgc cataaggcct gtcctgattg atatactcac gtcgtgactc     87000
     ccgttcttgt gttagctgtt cactcgtttt ttggtcttat tgtttcaccg caccggcggt     87060
     cagcccgccg acaaggtagc gctgaaggaa gaagatgacg accatcgccg gcgcgatacc     87120
     gacgaaggaa gccgccatca gttcgttcca gatgacctcc tgcttgccga aataagcaaa     87180
     gagacccacc ggcaggggca tgtattcggt cttcgagttg aaggtcagcg cgaagatgaa     87240
     ttgctgggcg taagcgccga tgaaggtggt gatggcgacg acgatgatcc ccggcatcgc     87300
     aatcggcagg atgacgcggc gaagcgtgta gaaatggctg gcgccatcca tataggcggc     87360
     ttcgttgagc tcctgcggga tacggatcat gtaggtgcgc agcaaccaga tcgccgaggg     87420
     gatgaggaag gcgacaccag gcacgatcat ggcgagatag gtgttgagca cgcccatgct     87480
     gcgcatcagc cggaagagcg ggatcagcag cacggcgccg gagaacatgt tcaccgtcag     87540
     gaaggcgccg agcaggatcc ccatgccctt gaattcaaac ttcgcaaagg cataggccgc     87600
     cggaatgacc aggcagagca cgatcagcgt gacgatgatc gagatgaaga aggagttgaa     87660
     gatataacgc ccgaaacccg gcacgctgac ccacatcgtc ctataagcct cgaaggagcc     87720
     gttctccggc cagaagcgat agggggagga gaagagctgg ctcagcggtt tgagcgaaac     87780
     catgaagcct tcgaagaaag gcgccagcac gaagaacaga aacagcgcga tgccgcaata     87840
     gatcaggatg atttcccacc agcggtaacg atcgatcatg gcagcactgc tcatgcgcgc     87900
     ttctccggat tgaggcggcg ggtaacgcgg aaataggcaa agcagaagag cgacaggaag     87960
     atgcagatca gcacggcgcg cgccgcccct tcaccgtatt tcttcgagcc gatggcggtc     88020
     tggtaggtat cgatgatcat cgtcgtcgtc tcgccgctcg gtccgccctg ggtcaggatc     88080
     cagatgatgt cgaacgagtt gaatgtggcg atcagcgaca gcatcgacat ggtgatgatg     88140
     gcgggcacca tcagcggcag ggtgatgcgg cggaagcggt accagcggcc ggcgccatcg     88200
     gtccaggcgg cctcgtagag atccttcgga atcgattgga tcgccgccag gaaatagatc     88260
     gtcaccagcg gcacgccgat ccacacatcg gtgacgatcg ttgcccagaa ggcggtgctg     88320
     ccataggcga ggaaagcgac cgggccatcg accaggccga ggcgctgcaa aacgcccgat     88380
     atcatcccga actggccatt atacatccag ccccacatga agatgccgat tgccatcggc     88440
     acgatccagg gcggcatggt caacagccgg aacagcgaac ggccaggtac cgcggcattc     88500
     aacatcgtcg caccgaatgt gccgatcacc attttcagcg cgaccgagaa gaaggtccag     88560
     acgaaggtgc ggaagatgac ctcggcaaag gtggcgttga agatcttctg gtaattgacc     88620
     cagccgaccc agttggtggt cttcttcagc gacgcatcgg tgaaggagag aatgaaggta     88680
     tcgacgaggg gataggcgac gatggcgaga acatagagga cggccggaag aagaaggatc     88740
     caggcgaaga tgaaggcgct tctttggaca ctcatcttgc cgccttcctc aagccgctct     88800
     tgcgtggagc gcctcgtcga aacggtccca gacgggacgc aggtcgacga cggttttctt     88860
     catcctcgcc tcatccatcg ccagggcgag gatgccggct tcgagcgcat tcagcgttga     88920
     aaccggaagt tcgagcccgg tgcgcacgct ttccagcaga tcgctcgcca tctgttcgtc     88980
     ggcgccataa tgctgggaga gctcggtggc ggcatattta ttttcgatca ccttgttgcc     89040
     ggtcagctgc tcatgcacat cgagatagcc gcgcacgaaa tcgccctcgg ccatgccgcg     89100
     cgaacccatg atggcgaaac ggcggaactg atcgggcacg ttcagattgg tgtggaagtt     89160
     catgccgacg ccattttcat attcgacgat cgccacctga taatcgatga tgtcggcatc     89220
     gctgtcgaag accttgtccg atcccatcca gccgctcggc ttgcggtgga aaagctcgag     89280
     gtcgttgatg ccttcgcggg ccgggtcgtt ggccggaatg aagctcttgc ggccaccgaa     89340
     actggcgacc cgctccggcc gcgcgccgac gacaccattg taaaggtcga ggtcgtggca     89400
     gcatttctcc agcatgaagc tgccggaata acgctcgtag cggcgccaat cgcgcatgaa     89460
     gaaggcgccg tgatagggct cgatatgttc ggaagcctcg atcgagacga tctggccgag     89520
     tttgccctcg gcctggatgg cgcgcagatc cttgtagagg ggcgaataac gcagcacgag     89580
     gccgaccatc agccgctcat ggccgaattt cgccatcaga tgggcaagct cgatgctttc     89640
     ggcaatcgtg gtaacgatcg gcttttcgca gaagaccttg agcccggctt gcagcccgag     89700
     cctgatatga tcgagatgca ggtgattggg ggagccgatc atcagcagat cgagcttttc     89760
     ggaagcgagc agctcttccg gcgacccata ggccttgccg accgagactc ccttttccgt     89820
     caatcctgga agtccggcgg gctccggatc cacatagccg acaatgtcga agctgctgtc     89880
     gatcgctttg aagacgtagc cgagatagcc gagccggaat cccagcccga tgattcccac     89940
     tttcatgccg atcaagttcc cagtttaggt aatttatttt ctttaagttg ggacaaaaaa     90000
     cgagaggcgt caatagaaaa cgggcctcac agcacgcgta tgaaatttat tttcatggat     90060
     cggtaggcgg ctgccgattg tgcgccgagc ccggccggac gtggattgcc ggatggaagc     90120
     gcccgcacgc gcctgaggtg ggaggcgaat tcgggcctca cgctcatctc gcgaaatgtt     90180
     gaaaagaacc gcgagtttac gtgtgtagga tgatctgaga acccgaggcc aggaggagcc     90240
     atcatgaccc gcatgacagc caaggatttc ccgcaggaac ttctcgaact ctatgactac     90300
     tacgcgcatg ggagaatcac caagcgcgag tttctcgacc gggccggcaa attcgccgtc     90360
     ggcggcgtga cggcagccgc cattctggcc tccctcagcc ccgattatgc gctggcgacc     90420
     caggtcgaat tcaccgatcc ggacatatcg gccgaataca tcacctatcc ctcgccgaaa     90480
     ggaaatggcg acgtccgcgc ctatctcgtc cgccccacaa aagccgccgg caaggtcggg     90540
     gccgtcgtcg tcgttcacga gaacaggggc ctcaacccct atatcgagga tgtggcgcgg     90600
     cgcgtggcga aggcgggatt catcgcactg gcgcctgatg gactgacctc ggtcggcggc     90660
     taccccggca acgacgaaaa aggcaaggag ctgcagcaaa aggtcgaccc ggaaaagctg     90720
     atgaacgact tcttcgcggc cgtggagttt ctgatgaaga gcgacctcac caccggcaag     90780
     gtcggcatca ccggcttctg ctacggcggc ggcgtcgcca acgcggcagc ggtcgcctat     90840
     ccggaacttg ccgccgccgt gccgttctac ggcagacagc cgcgcgccga ggacgtaccg     90900
     aagatcaagg cgcccctgct tctccactat gccgggctgg acaagggcat caacgaaggt     90960
     tggccggcct atgaggccgc gctgaaatcg tcgcaaaaaa cctacgaagc ctatgtctat     91020
     cccgacgtca accacggctt ccacaacgat tccacgccgc gctacgacga agcagccgcc     91080
     aagctcgcct ggcagcgcac ggtcgactgg tttacgaaat acctcgcctg agaaggccgt     91140
     cgcttgaacg atgctgcggg cggggaggcg ttccccgccc cctatccgtg tcgtggccag     91200
     cggcggccga tcacatatgc ccgcagccat tcttagccgc catttgcgtc tcgcctgaga     91260
     cagcaacgcc agcgacctgc atcccgcttg cagcacccta tgaaaaagca ctaaggatat     91320
     ggaagtcgaa agtgcggaac tgaggcattc accgctttcg aacctccaac atttcggaaa     91380
     aggcaaagat gacaagctcc gaatggcggg tgggagtgct gttttccaga agcggaatta     91440
     gcgaaattac ggaaaccgag cactttcttg gcaccgcgct tgcgatcgag gaagtcaatg     91500
     cggcgggagg cgtgctcggc aagcccatcg ttccgatcgc ctatgatccg ggcggggacc     91560
     agaccgccta tcgcaatctg gcgcggcggc tgctggcaga cgacgacgtc aacatcatct     91620
     tcggcgcttc gatgtcggcc agccgaaagg cggtgctgcc gattgtcgag cggcacaacg     91680
     gactgctgtt ttatccgtcg atgtatgaag gcttcgagta ttcggaaaat gtcgtctata     91740
     ccggcgccac cctcaatcag aacaccttcg cgctcgcaga atatctgctg cgccaccatg     91800
     gacgccgcat cctcttcgtc ggcgcggatt atatttatcc gcgcgaatcc aatcgggtca     91860
     tgcgggatgt gctggaggca aagggcggtg aagtcgtcag cgaacgatat ctgcctcttc     91920
     atgccgacga gcaaaccctg cgttcggtta tttccgatat cgtccgtctc gagcccgatg     91980
     ccatcttttc gacgatcgtc ggccggccgg cgcagcgttt ttatcgcatg tatgccgagg     92040
     cgggaatcga tcgcaagcgg gttccgatcg caagcctgac catggccgag agcgagattc     92100
     gcgagatcgg cgccgacgcc tgcaccggcc atattctttc ggcgacctat ttccagacgg     92160
     tcgaaaccga ggcgaacgcg cgcttcgtgg cggcattcaa ggcccgcttc ggccaggact     92220
     tcaccacgag cgtatggtcg cagccggcct atgcacaggt tcatcttttc gcccgcgcgc     92280
     ttgcccgggc cggctcgctc gacacccatc gcatttccga ggaaattctc ctggaagatt     92340
     ttcttgctcc ggaaggccgc atcaatttcg acgccgacac ccgtcatctc tggttgcatc     92400
     cccgcatcgg cgtggcgcgg gccgacgggc ttttcgacat tgcctggcag gcgcctggcc     92460
     cgatccggcc ggacccgtac ctgacggctt cgcggttcga agacgtttgg ttggaggcct     92520
     gagatggcgg gaccgaaccg gatcgttcag gatctgcggc gcgcacgcgt tctggttgtc     92580
     catccgcgcg acgaggacgg caacctgctg atcgcccacc tcaagcgcct tggctgcgag     92640
     gttcgggcga cctggccgct tccgcccgcc ttaccgcccg acatcgacac cgtcttcctg     92700
     catgtcgagg atgtccacgt cgagcatgcg ctcgagatca tcgaccttca gcagacggca     92760
     atcatcgcca tcctgacata tgaaagcccg acggcccttc aggcgatcat cgatctcaac     92820
     gcccacggcg ttatcagcaa accgctgcgg ccgctcggca tcctgacgca atttgcgctt     92880
     gcacgctatc ggcatagcta cgaaaaacgg ctcgccggaa aggtgcagaa actcgaggaa     92940
     acgttgaaaa gccggcggct ggtcgaaaaa gccgtttcgg cgctgcgggt catgaatggt     93000
     ctcgacgagg aagcggccta taagctgttg cgcgatcagg cgacgtcgaa gcgggttccg     93060
     atggcgacga ttgccgaatc catcattgcc gcgcaagaca cgatgaaaag ccttggactg     93120
     tcgatcggcg caaaaacgca aatttaaacc tcgagttgtc tgttcgcgcc tcttaaaaat     93180
     gttgaataga gcggcttgac ggtcgtattc tttcgtgcca gcctaaagat aacgagcagg     93240
     tttgctcagc ggcagggctg ccgcattcac atcatggcta tgtagcctct ggttcacgga     93300
     ttgaattccg tgccagaggt tttttgcgtt tggagacgag attgagcatc aagacctcga     93360
     ccgcacggat ggcaaccgtc gcaaccgtcc agttcgaacc gatcgtcggc gatcgcgccc     93420
     ataacctcgc ggccatcgag cggctggcga gggcagcgaa ggccaagggc gcagagatcg     93480
     tcgttctgcc ggaattggcc gacagcggct atagcttcca tgacggcgac gaggttgccg     93540
     cattggccgg cccggtgccc ggcggcctga gtgctgagac gctctgccgc cttgccagag     93600
     agctttgcct ttatatcgtc agcggcgttg ccgagcagga tggcgatcgg ttttataaca     93660
     gcgctcttct ttgcggcccc gacggatata tcggcaaata ccgcaagctc catctctgga     93720
     acaacgaaaa ccgtcttttc cgaaaaggtg atatcgggct gccagtattc gacctgccct     93780
     tcggccgtat cggcatcgcc atctgctacg atggatggtt tcccgaaaca ttccgcgaat     93840
     tggcgctggc cggcgccgaa ctggtctgcg tgcccaccaa ctgggtaccg atggctggtg     93900
     cggaaagcat tgcagagccg atggccaata tcctgcacaa ggcagccgcc cacaccaatg     93960
     gcctttacat cgcctgcgcc gaccggatcg gcgtcgagcg cggccagtcc ttcatcggcc     94020
     gcagcctgat cgtcggcccg caaggctggc ccatctccgg tccggccagt gccgatcgcg     94080
     aggaaatcct gcttgcgcaa atcgatctgt cgagcgtcac ggagacccgc acgctcaaca     94140
     gcttcaatca tctgctcggt gaccgccgag ccgatgtcta cgggtaatct cgacccaact     94200
     caagaaaggg gaacaaaatg caaatgaaaa ccatcatcct gaccctggca tctgcagcat     94260
     tcgccaccgc agcttttgcc gaggatccga tcaagatcgg cgtgccggtg gggctttcgg     94320
     gcgcaaacag cgtggtcgcg ccgtcggtcg tccaggctgc cgaactcgcc gtcgaagaaa     94380
     tcaatgccaa aggcggcgtg ctcgggcggc cgctggcgct tgagatcgcc gacgatgcat     94440
     ccggggcggc cggcgcgcaa aaggccttcg attccctggt tttccagaag gaagtgaatg     94500
     tcgtcatctc catggaaacg agtgctgcgc gcaatgccgg actgccgatc atttccaagg     94560
     gtgacgtgcc gtatatctac acgtcgttct acgaaggcaa atcctgcaat gccaagcttt     94620
     tcgtcaatgc ctgggtgccg gaacagcagg tgccgcctgt cgtcgacaat ttcatcggca     94680
     aacagggcgc caagaagttc ttcctgatcg gttcggatta ttccttcggg cgcggcatgc     94740
     tgaccttcgc caaagcctat atcgaaaaag ccggcgggaa agtcgttggc gaggaatatc     94800
     tgccgatgga cggcagcgac tggacggcca tcatctccaa ggtccgctcc tccggcgccg     94860
     acgccatcat cacctcgacg gccggcggcg caccgaacgt gaccttgacc aagcagttgc     94920
     gctcgtccgg cgtcagcctg ccttacggca atctggcggt cgacgaaggc accgccaaga     94980
     gcatgggcac ggatgccaag gacatcttcc tctccgcttc ctacgtcacc ggcatcgaca     95040
     gccccgagaa caaggctttt ctctcggcca tggaaaagaa gttcggcaag gaactgcgca     95100
     cgccgaacga tctttcggtg ccgcaatatg aggcgatcta cctgtataaa gcagccgtcg     95160
     agaaggccgg cagcaccgat acggctgatg tgctcaaagc ccttcccgat gtctccttca     95220
     ccggtccgcg cggcaagatc tcgatgaaca agcagcacca tgcgccgctg acgatgtatc     95280
     ttggccaggt aaaggacgac ggcagcgttg cggtcgtcga tagcttcaaa gacgtcgatc     95340
     ctggcaatca gtgcccgaat ctctgaaacc agcgaggcgg ggcagggtgc cccgcctcca     95400
     gcatcggagt tctagaaatg actctctttc tcgatatcgt aagcaccgcg gccattctct     95460
     tcatcgtcgc cgccgggctg cttgcaatct tcggcgtgct gaagatcatc aatttcgcgc     95520
     acggcgcttg gctgaccatt gggtcttact gcgctgtcgt cgtcagcggg ttcggcctca     95580
     atccatggct tgccattccc ttcgcgtttc tggtcggagc gatcctcggc ggtatggccg     95640
     aacggttcat cgtgcggcct ctctatcgcc ggcccctcga cgccattctt gcaacctggg     95700
     gccttggcat cgtcatcggc cagctgatca cgctctggtt cggccgcgac gtgcagttca     95760
     cgccggccct gctgcccggc accttcgacc tctttggcac cggctactcg gcctaccgcc     95820
     ttttcgccat tgccgcggct atcggcctgg gtctcggctt caccttgctg ctcgatggga     95880
     caaggcttgg cctttccgcc cgggcagtca tcatgaatga aacactggcg cgcgggctcg     95940
     gcatcgacac cgagaaggtg cggctcgcga ccttcatgat cggcactggc cttgccgccc     96000
     tggcaggcgt gctgctggcg ccgctgacca gcgtcgatcc caatatgggc gtcgcctggc     96060
     tgacgggcgc cttcatgctg gtgatggtcg cgggctcttc gttcgccgca cttgccggcg     96120
     cctgcctgat cttcggggcc gcgcaggtgc tcgtcagcac ctatttcagc ccaatcctcg     96180
     gcggcatcac cgtggccgtc ctctgcgcaa tcacactgcg catacgtccg aaaggatttg     96240
     cccgtgcgtg acagacaaaa actccggctt gtccttcttc tggcgctggc gctcgcagcc     96300
     ctcctgctga tcgtcttcgg accgatgttt ctcggccgtt tcagcctcaa cgtcctgacg     96360
     cgctcgatga tctacgccat gctggcgatc accgtcgacc tgctctgggg ttatacgggc     96420
     gttctcacct tcgggcaggc tgcattcttt ggcgtcggcg cctatgccac cgccatggtt     96480
     ctcacccata tcggcgcaag tccggcgctt ttcgtcgtcg cccttgtcgc cgccgtactc     96540
     gttccgctgg tgcttggcct cgccgtcggc tggctgtcgt tctatcacgg atcgacaccg     96600
     ctctatgcca ccgtgatctc gctcgttgtg ccgatcgtcg tcacacagct ggtcttttcg     96660
     ggcggcacct ggaccggttc ctcgagcggc cttgtcggtt acgacactct gccgctcggg     96720
     cttcccggct acttccgcct gtcgggcgcc tgcttgctgg cattggccat tgttgcgatc     96780
     gtctttgtcc ggtcggacgc cggccgtctg cttgtcgcaa tccgcgacaa tgaagcccgc     96840
     gtcgcctatc tgggcatgaa tccggctcgg ttgaagatcg tcctgacggg cgttcttgcc     96900
     ggcgtatgcg gccttgcggg cttcctctat gccaatgcat ccggtgtcgt cgccccagag     96960
     aataccggct tcgtcttcgg aaccgaactc gtggtctgga cggcgcttgg tggccgggga     97020
     acgatcatcg ggcccatgtt cggcgcaatc ggcatcgatt atctgagtgc cagcctgtcg     97080
     ggcgatctgc ccttcctctg gcaactgatc gtcggtgcgc tcttcgtcgt catgatcatc     97140
     cttttgccgg gcggcctcgc ctccctggtg acgcgtttcc tcaagaccgc aaactccaac     97200
     agcactctca agtccttgcc gacgcgcatc gtcgccagga atggtccggc ggcaggcaaa     97260
     agccttctgt cgatccgcgg tctcggcaag tcctatggca gcctctccgt cctcaagggc     97320
     atcgacctgg aaatcggcgc cggagaactc gtcagcctgg tcggcccgaa cggcgccggc     97380
     aagaccacgc tgatgcgttg tctgtcggac ggcaccgaga aggtcgaagg tcaagtagat     97440
     gtcatcggca ccaatatcgc cggtcgtgca ccggaacgga tcgtcgccct cggcgtcggc     97500
     cggaaattcc aggtcgccag catcttcgac agcatgacga tcggcgaatg cctgaagatg     97560
     gcacggctca gccgcgaaac acccaaccca gtccgatcat ccgccgagat catgctgccg     97620
     ccagctgcag ccgagatcct gacgctcacc ggcatggctg agatgctgga caaaccggtc     97680
     gtgctgctgt cgcacggtca aaggcaggct ctcgaactgg caatggtcgt cgctctggaa     97740
     ccacgcatca tcctgctcga cgaaccgacg gcgggtctta ccaagatcga gcgcatgacc     97800
     atcggcacta tcctcaagaa actgacggac gagatgggtt ttgccgccat cctggtcgaa     97860
     cacgatctgg atttcgtgcg tgagatatcg agccgcatcg tggttctcca ccagggtaag     97920
     ctggttctcg acggcacggt gaatgacgtg gtcaattccg aaacggttcg caccatctac     97980
     gcaggaggcg cacatggctg acgcgttcaa actcgagctc agcagcgtgt cgagcggata     98040
     tggcgcggtc gatgtcgtca atggcgtgtc gctcgccatc cggcccggcg agatttttgc     98100
     cctcatgggc aagaacggca tgggcaaaac gacgctgctg aagacgatcc tcggcttcct     98160
     gcgcgccggc aaaggcaaga tcgaggtcga cggcgcccct atcaccgaca ggaagccggc     98220
     ggagctgatc gcttccggaa tcggctatgc gccccaggaa ttgccgttgt ttcaggatct     98280
     ttccatccgt gacaatctgc gcctggcgct gaaagtcgac cgggacctgg catccgccct     98340
     ggagagggtc tacttctatt tcccgttcct gaaggaccgg ttgacccaga aggccggcac     98400
     gctatcgggc ggtgagcaga aaatgctgat cctggcacgg gcgctgatgc tgcggccaaa     98460
     gctgctgctg atcgacgaga tctccgaagg cctgcagccc tccgtcgtcc agaacatcgc     98520
     caaggcgttg agggacgacc gcgagaaacg cggcacgacc atcctgctgg tcgaacagaa     98580
     cctggatttc accctttcgg tggcggaccg ctgggccatt ctcaaacttg gagcgatcga     98640
     agacgaaagc accaatggtc cggacagccg cagccgtgtc ctgcaacatc taaagatcta     98700
     gggaacggtg aagtgcagga ccggtggaat gccttcatgc cctatccgga tgcggatgtc     98760
     ggtcacgcgc ccatcggttc gctcttcggc cttcgcctgg cggtaaagga ccttttcgac     98820
     gttgccggct atccaactgc ggccggcaac gcggcggtgc tcgtcgcctc cggaatcaag     98880
     agggcgacgg cgcctttggt ccagacgctc ctggaggccg gcgcctgttt tgtcggcaaa     98940
     accaatacgg atgagctcgc ctattcgctg attggcggca acatccattt tggcatgcct     99000
     atcaatccac gcgaccccac cctcatcccc ggcggatcgt cgtccggttc agccgtcgcg     99060
     gttgccgccg gccttgcgga cctcgggctt ggaacggaca cgtccggctc catccggctg     99120
     cccgccgcca tcaacggcct catcggctgg cggccgacac atggaagcct cgacaacagg     99180
     gcactgcgtc cgctggcgcc aagcttcgac gtgccgggtt tcatgacgag aagcctggaa     99240
     tccatggccg cggtgatgag cgccgtcggc atgcccgcgg caaatgaccg accaatatcc     99300
     attctcattc ccgaagatat cttcgaaacc atcgatggta caatcgccga tgagatgatc     99360
     gccagcatcc gatcggcggc catgcctatt cgcaggatcg actttatttc ctcattcagc     99420
     ctcgcggatc ttgctgtggc attcaccacc atcctgcaaa aggaagcctg ggaaagcaat     99480
     aaaacgctct ttgagcggag tcctgacgcc attgctcccg atatcgccgc gcgccttcgc     99540
     gcaggatctc gcctggacga cggggagatg cgcgaggcgc gcagaatccg cacgctcttt     99600
     tccggggaga tcgagcgact tctctgcgaa aatatggtca tcgctcttcc gaccctggcc     99660
     atgaacccgc caacgcgcga tgccgggccg gaaagcttcg ccgcatttcg atccgcctgc     99720
     atcaagcttc tgtgtctcgc aggcctgagc ggctgcccgc aactggcttt tccaatcgcc     99780
     agtcgcgtgg ggaacgcttc gctgtccttg ttcggcgcac gcagcactga cagtctgctc     99840
     atgaatgtgg cccggcgaat aggagccgag tgaacgagca cgctgcgggc ggggccggcc     99900
     attctcattt gcgcttttct aaggtggagg aaatttcgca atatgtggta tcgtcatttt     99960
     tcgcaacgcc gctcgaaggc caaaatggcg atgcgaaagg aacaagaatg cccctaatgg    100020
     gtttcgaacc ttagcgttca ataggaggag catttcatgc ctacggttgc cgccacatcc    100080
     atcactcccc cggaccagca tcttgtcaca gcgcgcgaag cccttgagcc gctttatgag    100140
     aagctcgagc ttcaaacgga atcgctggtg ctggctgcgg cgctggaggc gggatggtct    100200
     ccggatgagg cgacggaggc gcttgcggca ctcagactgc aggacgccct tttcaccctt    100260
     ggacgcacga attagccgat attccgtccc tgacagcttc ggcagaatgc cggcggctat    100320
     tacgagccgc cgcttttgcg tcgcctccgg ctgaccatca ttccgccgac gatgagaaca    100380
     attcccgtcg cgttcgccca gaacgacgtc ggagcggcgc gcgcataatc catcgccaca    100440
     ccggtgacca tctggccgcc aatgatcagc agagccgtat tgaccgcgcc gatgcgcgca    100500
     atcgcccagc tgcctgccgc cacgaaaacg acgccgatcg gaccacccag atagatatac    100560
     caaggcgcct cggcggcgcc ggccggtagc aggcctccga caacgagacc aaggcaggtc    100620
     agcacaataa agcctacggc atggttccag aaggatgcga tgagcggcgt ggtcgatatg    100680
     ctcaaccgcc cattgagctg acggctgagg ccgacgagca cgccgccgag gcaggcaatg    100740
     agaatgaaca ccgtcacgcc ccacctcgcc caaacaggat gatgagtgcg ccgccggtga    100800
     cgaccaggcc gagcgcggcg atgtcccgca tatccgggcg ccgttttggc agaccgaaca    100860
     gtccccaatt gtcggccgcc aggctgaaag cgacctggcc tgccaaaccc aaggccaagg    100920
     tgccggagag cccgagcggc gagttgaccg cggtcgaggt caaaatgacc gttgcggcgc    100980
     cggatacgcc cccgagatag gcccacaatg gcgccctggc ggtttttccc gccgtcggcg    101040
     cgcgccggcg gtaaagcgcc aaaagaagga tgacggcggc gaccatgcct gtgccgtgcg    101100
     cggtccaaga tgagaacagc ggattggcgt atcgtgccag ttccccattc agatgcacca    101160
     tgaaggtgag gagcccaccg gtcgcaaaag cgccgatgaa atagatggga tgcggattgc    101220
     gtgccgcttc gatggtcatt gcagatcccg tcaaagaatc gattgcgccc ggttttttcc    101280
     gattgctacc acagcacgcg cagcttttca ggaggcgcga aagacgcggg agaattgtcg    101340
     cgtcttgcat ctggccggag cttttcgctt cgacatcgga gtgctaaacg gcggcgtctg    101400
     cgtttaaagg aaatataatg agaaaattgt ttcgcctgct gctgacgatc gctctggccg    101460
     tcgtcgtctt taccggtttc cgctggtatc gctatgtcag caacactgat agcccctatg    101520
     atgaaatcgg catcaccctc aacaatgcca tgcccggccc gatcaacagc tggggctgcg    101580
     ccaagctaaa aaccaccttt gccggttccc tgccaccttt gggctgcgct gccgccgacg    101640
     cgacgcagtg gaagtaagac tgcaaggctg cgccgccggc gcagcctgaa ttgccttgcg    101700
     gtgtaggccg aatgctccgg gtcagatcgg ccagactgcc agcagggcag gcacactgac    101760
     gagcacgaca atgagcgaga gtggcaggcc caatcgggca taatcgccaa atcgatatcc    101820
     gcctgggccc atgaccagcg tgttgcattg gtggccgatc ggcgtgagga aatcacagcc    101880
     ggcgccgatg gccaccgcca tcagaaacgc atcgggccga aagcccagct tggcggcaaa    101940
     ggtcgcggcg atcggcgcca tgaccagaac ggtcgccgcg ttgttcaaga acggcgtcac    102000
     cgccatggcc gcaaccagga tgagcgtcag ggcgccgaat ggcggcagca tttcggcggt    102060
     ccgcgacagc agatcagcga tgatttcggt ggttccggtg gttctgagcg aatcgctgat    102120
     cggaatgaga gcggccagca tgatcagaat gggcgcatcg agatgatgat agacttcgcg    102180
     caggggaacg gatccggtca ccaccatcag aaaggcggcg gcaaaaaatg ccgtcgccac    102240
     gggaatgccg ccgaaggccg tcgcccccat cgtcgccagc aggatcatga cggggatcat    102300
     gccgttgcgg gcattgccga gcttcagatc gcgtgcgacc agcggcaaac atccccattc    102360
     gcgtaaaaga tccggcagct tctgcaagtc gccctgcaag accacgacgt cgccgttgcg    102420
     gatcttgatc tcgcccagac gctcggtgaa gcgcctgtcc cggcggctga cggcaagaag    102480
     attgaggccg gtattgtgga agagagcgac gtcttttgcg ctgacgccaa tcaggcggga    102540
     atgttcgccg acgatggctt cgacggaact gatgtcctgg cgcgtctcgg cctcgtgttt    102600
     acgatcggac agttgaagct tggcttcact gacgatctta tcgagtgcgc tctgctcgcc    102660
     ctcgatgatc agaaggtcgc catccttgag cacggtgtcg ggaaggggcg ttcgtctttg    102720
     gccgccgccg ccgataatcg cggtcaccat ggcatcgccg ccggccggct tctgcagcca    102780
     gctgacggac cggccaatcg cccccgacgg catgatgacc ttggcctcgg tcgtatagtt    102840
     cttgatcgcc accgcctcgt ccatcgacgt ttccacccgc gatctttcag gcagcagctt    102900
     gtagaacagc ccgagaaaga caacgccggc gaccgagagc gccaagccga caggcgtata    102960
     gtcgaacatc gtaaacggct gcccggtgat ctcctcccgc acccgggaaa cgatgatatt    103020
     cggcgatgtg ccgatctgcg tcataagccc tccgagcagc gaggcgaaag acatcggcat    103080
     caggaacatc gacggtgaca cccgtgattt ccgggccatc tgcacggcaa ccgggatcat    103140
     gatcgccagc gcaccgatgt ttttgacgaa agccgacagg gctgcgacga tggctaccag    103200
     gatgatcagc tgcatccgcg gcccgcgtct ttcgggagaa aatcggcgca acgccagatc    103260
     catgatccct gatctcgata tcgccgcact gacgatcagc gcactgccga cgatgatgac    103320
     aatgtcatct gaaaaacccg aaaaggcgct tttggcaggg acgatgccgg caatgacggc    103380
     gacgagaagc gaactcacgg cgacgacgtc gtatcgataa cgcccccaga cgaaggcgcc    103440
     catcatcagc gcgatgatga gaagagagag ccattggtca acgcgcatgt ttgcatcccg    103500
     gtggtagcaa ttaacgtttg aagcaggaga acgatacgag gcgacggcga aaattttcat    103560
     cgccgcctgt cgccggcaaa tcggatgggc tgaacagccg tccgctgcga ggctgccatc    103620
     atggaacttc cagccgccag ccggcatttc gtgctttggg gatgctgatt cggaaacgac    103680
     catggccagt gacaacctct cgacataccg atcgaagcgc gactttaaaa aaacggcgga    103740
     gccgagcggc gagaagcaga tcgcgcgcag caatcgccgt cgtttcatca tccagaaaca    103800
     tgacgccacc cggctgcatt acgacctgcg gctcgagctc gacggcgtct tcaaatcctg    103860
     ggctgtcacc aaaggccctt cgctcgatcc gcacgacaag cggctggccg tcgaggtcga    103920
     agatcacccg ctcgattatg gtgattttga aggcacgatc ccgaaagggc aatatggcgg    103980
     cggcacggtg atgttgtggg accgcggcta ttgggagcct gagggaaaga agagcccgga    104040
     gcaggcgctt gccaagggcg acttcaagtt caccctcgaa ggcgaaaggc tgcacggcag    104100
     cttcgtcctg gtgcgcatgc gcaatgaccg cgacggcggc aagcgaacca actggctgct    104160
     gatcaagcac cacgacgcgt tctcggttga ggagaatggc gcagccgtcc tggaggagaa    104220
     cgacacctcc gtcgcctccg gccggacgat ggatgcgatc gccacgggca agggccgcaa    104280
     gccgaagccg ttcatgatca agggcgggga tatcaaggcg gatgcggtct gggacagcaa    104340
     ccaggggctg gccgccgaag agaggaaaga ggagggtcga gccggcagga cgccgaaaac    104400
     ggcggcaaag gtcgacctcc cggatttcat cgcgccacag ctttgccaga ccctggagcg    104460
     gccgccggcc ggcgagggct ggattcacga gatcaagttc gacggctacc gtatccagat    104520
     gcgcatactc gacggcgagg taacgctgaa gacccgcaaa gggcttgact ggaccggcaa    104580
     atatccagag gtcgccgagg cggcatcggc gctgcccgac gccatcatcg acggcgagat    104640
     ctgcgctctc gacgaccatg gcgtaccgga tttcgcagcc ctgcaggccg ccctttcgga    104700
     aggccggacc ggcgatctcg tctatttcgc cttcgatctt ctttacgagg gtggcgagga    104760
     cttgcgatcc ttgcctgtga tcgagcgcaa ggcgcggctt cagagcctgc ttgcggatgc    104820
     cggtgacgac cctcggctcc gtttcgtcga gcatttcgag accggcggcg atgcggtcct    104880
     tcgctccgcc tgcaagctct ccctggaagg catcgtctcc aagcagagcg atgcgcccta    104940
     tcaatccggc cgcaccgaca gctgggccaa gtcgaaatgc cgcgccggcc acgaagtggt    105000
     gatcggcgcc tatgccaaga ccaacggcaa attccgatcg ctgctggtcg gcgtctaccg    105060
     cggcgaccac ttcgtctatg tcggccgcgt cggcacggga tatggcgcca agaaagtgga    105120
     aacgttgctt ccgaaactgc aagcgctcga gacggcaaaa tcgcccttca ccggcatcgg    105180
     tgcgccgaag aaggaggccg aggtcacttg ggtgaagccc aagctcgtgg cggaaatcga    105240
     gttcgccggc tggaccgccg acggcatcgt ccgccaggcg gccttcaagg gcctgcggga    105300
     ggacaagccc gccagggagg tcaaggccga acggccggcc aagccagcgg agaccgacgt    105360
     gccggagccg gagccggcgg cggaggtgaa ggcgaggcca gcccgccgaa agggcgccaa    105420
     agccgaggtc atgggcgtga tgatctccaa tccggacaag ccgctttggc cggatgccaa    105480
     tgaccgcaaa ccggtgacca aggaggagct ggcccgctat tatgaagccg tcggcggctg    105540
     gatgatcgcg catatcgagg ggcgcccctg ttcgatcatc cgtgcgcccg atgggctggg    105600
     cggcgagcag ttcttccagc gccatgcaat gcccggcacc tcgaaccttc tcgaactggt    105660
     caaggtcttc ggcgataaaa agccctatct gcagatcgac cgggtcgagg gcctagcggc    105720
     tgtcgcgcag atcggcgccg tcgagttgca cccctggaat tgccaaccgc acaagccgga    105780
     ggtgccgggc cggctggtgt tcgacctcga ccctggcccc gacgtgccgt tctcgacagt    105840
     cgtttccgcc gcccgcgaga tgcacgatcg gctcgacgcg ctcggtctcg tcagtttctg    105900
     caagaccaca ggcggcaagg gcctgcacgt cgtcacgccg cttgcgatca ataagcgcaa    105960
     gccgctttcc tgggcagagg cgaagagttt tgcgcacgac gtctgccagc agatggcgcg    106020
     cgacaatccc gatctctatc tgatcaagat gaccaagagc ctcaggaacg gccgtatctt    106080
     cctcgactat ctccgcaacg accggatggc gacggccgtg gcgccattgt cgccccgtgc    106140
     ccggccgggc gccaccgtct cgatgccgct gacctggacc caggtcaaat ccgatctcga    106200
     cccgaaacgc tttaccatcc gcaccgtgcc ggcactgctg tcgaaatcgt cggcctggga    106260
     agattatagc gatggccagc gcccgctgga gcaggcgatc aaacggctga gcaaagtctc    106320
     gaacgcggcg tgagcatcac gaacgacagt ccgcccgtgg ccagctgtag ggccggatat    106380
     taccccttgc gaactgctct gaataacagc ggagcgatcg gggattaagc gaacaaacac    106440
     aagcgttata tccggcggaa tattacgttg ttcgaccttc gttaacatgc tagccctcac    106500
     gctcatatca gagggtctac gttcatgaca attcgactgt tttccggcct gagactgatc    106560
     ttcgtcatcg gcggtctgct cctctcctcg tccgcgtggg cggagcgcgt cgtcaccgac    106620
     cagatcggca ggaaggtgca catccccgac catgtgagcc gcgtcgtcat tctgcagcac    106680
     cagacgctca acataaccat acagctcgac gcgatggaca aggtcgtcgg cgtcctcgaa    106740
     gaatggaaga agcaactcgg tgcgaattat gtgcgtcttg cgccgctgct accgacgctc    106800
     gccacgccgg gaggcctcac caaggccaat atcgaagaac tgctgaagct cgatcccgac    106860
     gtggtcttcg tgaccaacta cgcgcccgct gatatggtca agcagatcga agacgcgggc    106920
     ctgccggtcg tcgcgatctc gctgctcgac gtgccgccgg aagaggcggt caagctgaac    106980
     ccgaccgtca aggatgagcc ggccgcgatc gacgcgggct ttgcgacggg tgtgcgcctg    107040
     atcgccgaca tcctggaccg gaaggaacag ggtgaagcga tgattgccgt aacccaaaaa    107100
     taccgaaaac tcgtcgccga tcgcctggga gacatccccg aagacaagcg cgtgcctgtc    107160
     tacatggcca atccgaacct cgagacctat gggcacggaa aatataccgg gctgatgatg    107220
     gaccgggctg gcgcccacaa cgtcgcccat gagatcgccg gctataagca ggtcagcatg    107280
     gaagacgtcc tcaagtggaa tccggcagtg atattcgttc aggaacgtta tccgtcggtc    107340
     gtcgacgaaa tcaaatcgac cgcttcctgg cagacgatcg acgccgtcaa gaacagccag    107400
     gtctacctga tgccgcaata tgccaaggcg tggggctatc cggagccgga ggccatgtcg    107460
     atcggcgagc tttggatggc gcaaaagctc tatccggatc ggttcaagga catcgacatg    107520
     cagaaggaag cggagaccta ctacaaagag ttctttcgcg ccgattacgc tggcgaatga    107580
     gcgagcacgg cgctttgcgg cgatcacccg gaatgaccat cggtgttctg ctggtcatac    107640
     tcgccttcgc cgcgatagct tcgctgggga tcggccgata cgacatatcc ttcggcaggg    107700
     tcgtggaaat cctggtcggc cggctgaatt cgccgcatgt gccgatcaca ccgaccgaag    107760
     cgaatgtcgt gttcacaatc aggatgccgc gcatactgct gacgctgctg gcgggttcgg    107820
     gtctggcgct gtcaggtgcg acgatgcagg gattgttccg caatccgctg gtcggaccgc    107880
     aggtcatggg ggtttcctcc ggagcggcgt ttggcggggt gctggccatc ctcttcgacc    107940
     tcacgcgtta cggcctgctc ggatcttcat tcgtgttcgg cctttcggca ctcgtcctcg    108000
     tctatgtgct caacggcgtc gtcgcccggc gcaacgtcct ggccctggtg ctggcgggtg    108060
     tgatcgtcag cggttttttc gcagcacttg tcagcctcgt ccaatacctt gccgatacgg    108120
     aagacaagct gcccgcaatg gtgttctggc tgctcggcag cttcgcgacc gccaattggg    108180
     aaaaactctt cttggtcgcc gcgccgatgc tgatcggcag tcttgtattg cttggcctgc    108240
     gatggcgcat caatctcctg tcactcggcg acgaagacgc ccgagcgctc ggcgtcgaag    108300
     tcgagcctct gcgctgggcg atcctgatcc tcgtctcctg catcgtcgcg gcgcaggtgg    108360
     cggtcagcgg cattgtcggc tgggtcggcc tcgtcgtgcc acacatggcg cgcatgttgg    108420
     tcggcccgga tcatagggtg atgatgcccg cctcgttgat catcggcgca ctttacctcc    108480
     tggcgatcga tacagtcgca cggacggcga caagttcgga aattccgctc ggaatcctga    108540
     ccgctttgat tggaacgtcc gtattcgctt tcgtccttag gcagacccag agaggcacgc    108600
     gtggtctctg atccccccaa gctgcgcata acggaggcca gccagtcgta tgacggacgc    108660
     cgatggcaat tccgcggtct cgatctcgac ctgaagtcag gcgagatcac ggtcattctc    108720
     gggccgaacg ggcgtgggaa atccacgctg ctgcgtgtgc tggcaggggt tctgaaaccg    108780
     acatccgggg agctccagct caacccttgt acgggcttcg tgccgcagga gttctcaggc    108840
     tcctttccct atacggtcct tgacaccgtg cttatgggcc gagcgcgtca cgtcggcctg    108900
     tttcggactc caagcaagat cgacatcgac aaggcgatgg acgccctgaa cgccaccgga    108960
     atgtccggct ttgcgtcgcg caacatcgat gcactttccg gtggcgaacg ccaactcgtg    109020
     ctcatcgcca gggcgctcgc cggcgaaaac gaagtcttgc ttctcgacga gcccgcatcg    109080
     gcgctcgacc tcaagaacca ggacaaggtg ctggcgttga tcggcgactt ggcggaccgg    109140
     gaaaagctcg ccatcgcctt caccacgcac cagccaaacc atgccgtgac ggtggctgac    109200
     aaggttctct tgatgttgcc ggaagcaaca acgattttcg gcccgaccgg cgcggtgctg    109260
     acggagacca atctggaagc tctctatggc attcccgtcc gctcggcccg catcggtgac    109320
     aatgagcgcg aggagaccac cttcgcaccg ctttttcgca gccggaaacg gaaagggata    109380
     agcgcatgac ggcgatcgtc cgggtcttct ccgccggaag ccttcggcac gcgtttccgg    109440
     tcatcatcga cgccttcaca gcggcgacgg gcatccgcat ctcactttcg ctcgggcctg    109500
     ccggcctgct gcgcgaacgg atcgaagcag gcgaggagtt cgacctgttc gcctcggcaa    109560
     acatggccca tccccgacgg ctcgtcgaaa tcggcatggc agagcaggtc atctgtttcg    109620
     ccagaaaccg gctttgcgtg atcgctcgcg ccgatcttgg actgacgacg aagaacttcg    109680
     tggatgttct ggccgacccc ggagtgaaga tcggcacgtc gacgcctggc gatgatcccg    109740
     gcggtgacta tgcattcgaa gtctttgacc gcatcgaaac gcagcatcgg ggtctcggtt    109800
     cggcattgaa aaggcgtgcc caccagcttg tcggcgggcg caattctcaa ccggcacccg    109860
     gcggcacggc cgcactcatc agggatcgtg aagccgacct gatgatgagt tatttttcca    109920
     acgcccggct gctgatctcc gagacgacgc tcagccttgt agagattccg cccctgttcg    109980
     ctccgaagat tgagtacggc ctggcgttgc ggagaaatgc ctcggatcaa gcccggctcc    110040
     tgatggagtt catgcttggg aaaagcggac aaaccgccct gcgcgaagca ggtttcactt    110100
     tgccttgacg ggagactgac caagtcgacc gcatgcggcg ttccgagcgg tgaaacgaca    110160
     tagtcgtcgg ggcagcgttt tcaggcgttg acaagctttc accactgagg tctactggcc    110220
     cacttaccgg accagtagac ctcaggggga ggggcatggc aatggatgtt cgagcgatgc    110280
     tcgaagaggt tgcgacgctt ggcggcgcac cgaagaagtc gatgaaagac ttcgtcgtcc    110340
     agaagattgc gaccttcatc gccaccggca tcctcaaagc cggcgacccg ctgccgagtg    110400
     aacgtgagct ggctgccgcg ctctcggtca gccgcgagac cgtccgcggt gcgatcctca    110460
     ttctctccac gcatggaatt ctctcggttg cgcagggaac gcgcacggtg gtggcatctg    110520
     aggatgtcgg cgaattggct gtccaggcgg cgcgttatcg cgacattgcg gcctacagtc    110580
     tcgacaatgt tcatgaggcg cggctgctga tcgaagcaca agtggtcagg gctgccgcgg    110640
     tcaagatgga agaggcgacg cttgattatc tccgcaagtc gatcgcggca caggaagccg    110700
     cctgtgacga tcccgtccgt ttcttgatct gtgaccgtga gtttcacacc gccatctacc    110760
     ggtccagcgg caatgcggtg ctcgccgaca tggccgccga cctctattcc tatcttctca    110820
     gccaccgcag gcgcgtcgta tcgcagcctg ggacgatcgc cacgagcatt gccgatcacc    110880
     ggttgatcct cgccggtctg gagacgcggg atccggatgc cgcatgcgcg gccttcgcga    110940
     tccatgaaac ccgcatttat accacaacca agctgctcct cgcgtagttc gcaggcaaag    111000
     agcggcagag acgacacatc gaagacaggg ggaataggat gcatattctc attatcgggg    111060
     cgggaggaat gatcggccgc aagctcgccg ccagcttggc gcgcagcggt tgcctcggcg    111120
     cccaaacgat cacgcgcatg acgcttgtgg atatcgcccc gccgccggtg ccatcaggcg    111180
     ccgttgccgc ggtcgaagcc ctggctgccg atatttccga aggcgatgcg gcgcaagcct    111240
     tggcggctcg ccgggccgac gtgatcttcc atctcgccgc gatcgtttcc ggcgaggccg    111300
     agcgcaattt cgaactcggc taccgggtca atctcgatgg cacgcgtgcg ttgctggagg    111360
     caatccgtca tgagggaagc cggcaagcct atgttccccg cttcgtcttc tcctcgtcga    111420
     ttgcggtcta tggctcgccg tttcccgatc cgatccccga cgattacgtc caggcgccgc    111480
     tcaccagcta tggcgtgcag aaggcgatat ccgagcttct gctcgccgac tattcacgcc    111540
     gcggcttcat cgacggcgtg ggcattcgat tgccgaccat cgtgatccgg cccggtgcgc    111600
     cgaacgccgc cgcatccggc ttcttttccg gaatcctgcg ggagccgctc tccggccagc    111660
     gggcggttct tcccgtcgag gaaacggtca agcactggct ggcaagtcca cgctccgccg    111720
     tcaaatttct gatccacgcc gcgacgctcg acacatcgtc gctcggtgcg cggcgcacgc    111780
     tcaccatgcc cggcgttgcc gccaccgttg ccgatcagat cgccgcgttg cgccgggcag    111840
     ccggccccga ggcggtcgag ttgatcgacc gccgccgcga cgaggtcatc gaagggatcg    111900
     tcgccggatg gccgaaatcc tttgcgcctg accgcgcgac gcaactgggt ttcaccgccg    111960
     aaaccagcgt cgatgagctg atcgaggtct acctcgcgga agacgctccg ggtgcgccgc    112020
     gagcagattg aggagagggt ggagggaggt cccgcccggg cacccccaca gatgcgggat    112080
     tgcggtggct gacggacttg ggagagatgg cagccgccga agacatagtg agatacgaat    112140
     acataagcat gtagcgctcg atttctggga ggagtgagta tggcaggcgt tcaattcgcg    112200
     gatgtgcgga aatcgttcgg tgtgcatcct gtcatcaggg gggtagatat cgacattgcc    112260
     gatggggaat tcgtcatcct ggtcggcccc tcgggctgcg gcaagtccac ccttctgcgg    112320
     atgctggcag ggctcgaaaa catttccggc ggcgagatca aaatcggcgg gcgcgtcgtc    112380
     aacacgctgc cgccgaagga ccgggacatc gccatggtgt ttcagaacta tgcgctctat    112440
     ccgcatatga cggtggagca gaacatgggc ttctcgctga tgctgaacaa ggcgccgaag    112500
     gcggaagccg aaaagcgggt gaaatatgcc gccggcatcc tcggcctcga caaattgctc    112560
     gaccgttatc cacgtcagct ttccggcggc cagcgccagc gtgtcgcgat gggccgggcg    112620
     atcgtacgcg atccggaggt cttcctgttc gacgagccgc tgtccaacct cgatgcgaaa    112680
     ctgcgcgtcg ccatgcgcgc cgagatcaag gaactgcacc agcggctgaa aaccaccacg    112740
     gtttacgtca cccacgacca gatcgaggcc atgaccatgg ccgacaagat cgtcgtcatg    112800
     catgacggca tcgtcgagca gatcggttcg ccgctcgagc tttacgacaa gccggccaat    112860
     ctcttcgtcg gcggcttcat cggctcgccg gcgatgaata tgatcaaggg caggctcgat    112920
     ccggaagacg cccgccagtt cgtcgccgcc aacggcacgc ggctgcccgt cgccaatccg    112980
     ccggcaagtg cggtggggcg cgaactcgtc tatgggctgc gccccgaata tatctcgctc    113040
     gatccgaacg gcgtgccggc cgagatcgtg gtgatcgaac ccaccggcta tgagacccat    113100
     ctgaccgttc gcctcggcgg cagcgatgtc agctgcgtgt tccgggagcg tgtcaatgcc    113160
     cgcccgggcg aggcgatccg cgtggcgatc gacgcttcgc acgtccatct cttcgatgcc    113220
     gaaggcggac agagattgac cgactgatgc catccggcgg tgcgggaggg gaggagcctt    113280
     cccgccgctg gagcgcaagc attccgtggg cgcttccgct ccggggatgc caggccgccg    113340
     tccatccaag cgggaggtgg acgccggaga attgcttccg ctgtttcaat gaggaggaat    113400
     ctcatgacga tcaagagacg tgaatttctt gctgcctcgg cagccgttgc cggcgctgcc    113460
     ggcttcggca tcaagccatc ttttgcgcag gccgaaccga cctacacgcc ggaaagcggt    113520
     gccagccttc gcctgcttcg ctggacgccc ttcgtcaagg gcgacgagga ggcctggctt    113580
     gccaacacca agaaattcac cgaagcgacc ggcgtcgagg tgcgcatcga caaggagagc    113640
     tgggaagaca tccgcccgaa ggctgcagtc gccgcgaatg tcggctccgg cccggatctc    113700
     atcatgtgct ggttcgacga cgcgcatcag tatccggaca aactggtcga tctcaccgaa    113760
     ctcggcaatt atctcggcaa caagtatgag ggctggtacg acggcgtgaa gggttatgcc    113820
     acccgcggtg acaccttcat cgccatgccg ctgacggcga tcggcaatgc ggtggtctat    113880
     cgcgacagcc atgtgaaggc cgccggtttc aacgaattcc cgaacgatac ggcaggcttc    113940
     ctcgagcttt gcaaggcgat gaaggcaaag ggtacaccgg ccggcttccc gcacggcaag    114000
     gcggtcggcg acggcaacaa ttacgcccat tggctgctgt ggagccataa cggcatgatg    114060
     gtcgacgagg gcggcaaggt gacgatcaac agcccggaga cgctcgcttc gatcaactat    114120
     gccaaggagc tctacgcgac cttcattccg ggcacggaaa gctggcagga cgtcaacaac    114180
     aaccgcgcct tcctggccgg ccaggtctcg ctgatcgcca atggcgtctc ggtctattac    114240
     acggccaaga acgatccgaa gctcgccgag atcgccaagg atatccgcac gacgaacttc    114300
     ccgatcggcc ctgtcggcaa gagcgtcgag ctttgccaga cgagctcgct gcttctcttc    114360
     aagcacagca aatatccgga agcggccaag gcttacatca agttcatgat ggaggccgac    114420
     cagatgaacg cctggatcca gggctccagc gcctattgct gccagccgct caaggccttc    114480
     gccaagaacc cgatctggac ggccgatccg gtccatgcgc cttatgcgcg cgcttcggaa    114540
     aaactgcgcc cgaacggcta tgccggcccg ctcggctacg cctcggcggc gaccatggcc    114600
     gactatgttc tggtcgacat gtatgccgcc gccgttaccg gccagatgtc gccggaggat    114660
     gcgatgaagg aagctgaacg ccgggcaaac cgttactatc gcgtctgagc cccgcttaat    114720
     gcatgtcgcc cggaagtggg tagcggttcc gggacaacga catgcatgga aacaaaaaaa    114780
     tacgcggcgt gccggccttt cggcatgccg caagctcctc cgggagatcc aaaacgcgat    114840
     ctggagataa gcaatgtcga tggcaaattc gggggatagg cgtgggccgg tctcttcgct    114900
     cctgcagaac aacaatgtgc tcggcttcct gttcatgctg ccggcggcgg tgttccttgt    114960
     ctgctttctc acctatccgc tggggctcgg cgtctggctc ggctttaccg atacccggat    115020
     cggccgcgac ggcatcttca tcgggctgga gaactaccag ttcctgatgg acgactccgt    115080
     cttctggctg tcggtcttca acaccattct ctatacctcc gtcgcctcgg tgctgaaatt    115140
     cgcgctcggc ctctggctgg cgatgctgct caaccagcat ctgccctaca aatccttctt    115200
     ccgggccatc gtcctgctgc cctgggtggt gccgacggtg ctttcggcac tggccttctg    115260
     gtggatctac gattcccagt tctcgatcat ctcctggtcg ctgatgaagc ttgggctgat    115320
     cagcggaccg atcaacttcc tcggcgatcc gatcaatgcg cgcatatccg tcatcgtcgc    115380
     caatgtctgg cgcggcattc ccttcgtggc gatctcgctg cttgcgggac tgcagacgat    115440
     cccggcgtcg ctgcaggaag cagcctcgct cgacggcgcc acgagctggc agcgtttccg    115500
     ctatgtgacg ctgccgatgc tgacgccgat catcgctgtc gtgatgacct tctcggtgct    115560
     tttcaccttt accgatttcc agctcatcta cgtgctgacc aagggcggtc ccgttaacgc    115620
     gacgcatctg atggcgacgc tgtcgttcca gcgcggcatt cccggcggcc agcttggcga    115680
     gggtgcggcc atcgcggttg ccatggtgcc cttcctgctc ggcgcgatca tgttcagctt    115740
     cttcggcctg cagcggcgca aatggcagca gggcggccag gattaggaga ataacgatgt    115800
     cgacacgttc aaacacagtc gatcgggcaa acgcagccga tcgggccaac accgccaatc    115860
     aggtcgtgac cgacaatgcc gaaggcatga gctatctgaa ccgcctgccg cggcggatcg    115920
     tgatgctcta tttgccgatg gccgtcttcg tcttcgtgct gctcttcccg ttctactgga    115980
     tggctatcac cgcggtgaaa cccaacgaac agctgaccga ctatagcaat tacagcccgt    116040
     tctgggtggt cggtccgacg ctggcgcata tcaaatacct gttcctcgag acatcctatc    116100
     cgggctggct gtggaatacg atgctggtgg cggtctgctc aaccttcctc tcgttggtgg    116160
     cttcggtctt gggcgcctat gcgatcgagc gcgtccgctt caccggctcg cgttcggtcg    116220
     gcctggtgat cttcctcgcc tatctcgtgc cgccgtcgat cctcttcatc ccgctggcct    116280
     tcatcgtctt caagctcggg atctacgact cccggctggc gctgatcttc acctacccga    116340
     ccttcctcat tcctttctgc acctggctgc tgatgggcta tttccgctcg attccgttcg    116400
     agctggagga aagcgcgctg gtggatggcg ccaacagatg gcagattctc accaagatca    116460
     tcctgccgct cgccgtgccg gggctgattt cggccgggat cttcgccttc acgctgtcct    116520
     ggaacgaatt catctatgcc ctcactttca ttcagtcatc ggagaataaa accattcccg    116580
     tcggcgtgct gaccgaactg gtgcgtggcg atgttttcga atggggagca ctgatggcgg    116640
     gcgccctgtt cggctcgctg ccggtggtca tcctctactc gttcttcgtg gattactacg    116700
     tgtcctcgat gaccggggcg gtgaaggagt gacagacgct gagcactggg ccttcttgcg    116760
     acaagtggta tagttgaatt ccggtcgtcc tcctggacga tacgacaagg gaattattcc    116820
     atgggtgacc agaaacgccc gctgcagcct ggtgaagccg cgcccggatt cgcactggcc    116880
     acggccaact tcgacggaat ggtctcattc gccgacttaa gcggtcgccc attcctgatc    116940
     ggcttctttc gcgggctgca ctgcccgttc tgccggcgcc agctggaaca gcttgccgcg    117000
     gtacagccga ccctctacgc cgccggggtg gagaccgtcg ccgttatcaa cacgccggtg    117060
     gaacgtgccc gtctttattt ccgccaccgg ccgacgccga taacgcttct ctgtgacccg    117120
     gattgccgca cgcaccgggc ctacggtgtg ccgcatgccg agttcctgcc cgatgggagc    117180
     cgcgagcagc ccgaatggcc ctataggaca acgatggcgc agttccagac cgcgcgcatc    117240
     aaccccaccg gcgaactgcc ggaaccgctg cacccgatgg aagccaacac catactcaac    117300
     gccaaggacg gcttcgagct tgtcgaagcc gatcatgtga tcttcgagaa ccacgcgacc    117360
     cagctcgtcg ggcactacct ggtgaaggcg aacggcacga tcggctgggc acgcatcgag    117420
     gcgctcgacg gaccgaacag cctctccatc ttccccacga cggcggagat catcgccgcc    117480
     gccggcagcc ttggacgctg acctgcagca aaccctgtcg ccagcgcagc cggctgatca    117540
     cagacgctcc gaaagcagcc ctgccgccaa ggcatgaaag gcctcgaccg ctttcggcag    117600
     cacgctctgc ggattttcgc tggcggcgat ccagagagcc gcattgagcg ccgcgccgct    117660
     cagcaatcgg gccgtcgcct ccgcgtcaag cggcttgagt acgccttgtg cgatcaggcg    117720
     ctccacagtg ctcttggtca cctgcagaca ggtgttctgg ctcggccatt gcgagggatc    117780
     gccaagcacc gcaggcccgt cgagcagaac gatgcgttgg acttccggat tgagcgccat    117840
     ctcgatataa gccgcaccct cggcaagcag gccttgccaa tcgttacccg ctcgcgcccc    117900
     gatcgccttg gcgcgcgccg ccatttccat gtcgatctga tcgacaaccg ctgccagcag    117960
     gccgcgcttg tcgccgaagt tgtggtaaag cgcgccccgt gtcagaccgg cgtccgccgt    118020
     tagctcgtcc atcgatgctg cggtgtagcc cttttccgcg aaagcctttc gtgcagccgc    118080
     gatcaacttg ccacggtttt cctgcatcgt ttcgctgcgt gttctcgcca tccgcccctc    118140
     ctaaactcac atacgccacg tatatgagat tgacatacgc cacgtacgca ggatattaca    118200
     catacgtacc gtatatcaaa cattgcgcaa gcctgtgaag cgtcacgccg cgctgatcgg    118260
     tcgttgccaa cgataaagag agatgaggat gactgaacgc gaagcaatct ttcctgccga    118320
     caggcacgct ctttacgagg agcacggcta ttccgccgcg atccgctccg gggatctgct    118380
     gtttgtgtcc ggacaggtcg ggagccgtcc ggatggaaca gccgagcccg atttcgaacg    118440
     ccaggtccgg ctggccttcg aaaacctgca ggcgacgctc agcgctgcgg gctgcacgat    118500
     cgatgacatc gtcgatgtca cgacctttca caccgaccct gaaaatcaat tcgcaaccat    118560
     catggccgtc aagcagcaga ttttcagcaa gccaccttac ccgaattgga ctgcactcgg    118620
     cgtcaactgg ctcgccggct tcgacttcga gataaaggtt atcgcccgca ttccggcaag    118680
     cacatgaagc gccacacccg gcggcacggg aaacgccctc aaggtgaaaa cacgcaactt    118740
     gcgccgccgg tcttgtcaag aacttgccga catcgctagc cgcccctatc tcatgtcgaa    118800
     cagacttgat ggagcgacga gatggtggaa cttgtggttg acactctctt cgatacgacg    118860
     atcgagatca ttcctccgga agatagagaa gaccagccca atggccgtgt ctgcctttgc    118920
     tgcaaacgcc ggtgtcgatg gatggacgat gacggctgcg gcatctgcga ggaatgtctg    118980
     gcctcatgat gaacgcagca agggcgtagc gcgatggcac tccggagcgc cggacttctc    119040
     atctatcggc gggtatccaa cgacctcgaa gttcttctcg ttcatccagg cggccccttc    119100
     tgggctggga aagacgaggc tgcctggtcg atcccgaagg gattggtcga gcctgatgag    119160
     gatgaactcg cagcggcgat gagggagacg gccgaagagc ttggagtggc catcgacggc    119220
     agagtgacgc cgctcggcga atatcggcag cctggcggca agatcgtcgt cgcgtggtcg    119280
     atcgaagccg atccggcatt ggacgtgaac gcaatacgaa gctctgaatt tcaaatggaa    119340
     tggccgccga gatcaggcca gatgaagagt tttccggagg ttgaccgcgc gggatggttt    119400
     tccttggccg aggcgggaac gaagctgttg aaagggcagc gaccgatgct tgccgacctc    119460
     ctgaagcatc agaaatgatc ggcgcgaaat gattgcttga gccgcccgtt tcgctgcacg    119520
     catgcgtgaa gcgcgcggca gccatgcgtt gcttctgcag acttccatct ccatctgaca    119580
     gtcacagccg cctcactcaa tcgagacaac cggcgctgcg acccgtcttg ggcacgcgcg    119640
     aggagacaat catgaacggc atatcgaaaa ccctgaacga catgacgctg gtcgagcggt    119700
     cgagcctgct cgacaccgtc gccgacgccc tggaggcaac cgccgaggag gccgaagggg    119760
     agggcgacgc ccgcttcgtc gccaattcca tctgtatcgc caatacgatc cgaggattat    119820
     ccgggcagct tgcaccgcgc gatctgcggg cggccgagct gctcctcgag cagggtatca    119880
     tgctcgttca ccaattctcc agcagggtga aaccaggcgg aatgaagcat tagcgcaaag    119940
     cgcaaagcgg gccggcaaag ccggcccgtc tgcaatcact gctgctcgat cggcgccggc    120000
     accgcagccg gtgaagccgg ccgtccaagc cgatcggcga ccagcatcga cagcatcatt    120060
     tccacaaggc cattggctgc gcccttttcg ccgccggcgc cgccgacctg tatctgcggc    120120
     acgagcggca gcctgccatt ttcgatcgcc tcggcgaagc gcatgagcac ctgcgagtgc    120180
     agctgataat ccggcccacc gaaggctgcg accttcttct cggtcgcctc ggcttctgcc    120240
     aaaccgatgg cacgcacctt ctgggcatcg gcaagaccgg tcgccttgat gcgttcggca    120300
     tcggcaagcg cgacggcctt gatccggtcg gcctcaccca ggccggcgag gcgcaccttc    120360
     tcggcctctg ccttggcggt gacctgaatg gtttctgcct gctggcgggt gcgagcgagc    120420
     tgcgctttgc cttcgttctc gctgatctcg atggtcagcg ctgatgtggt gatcttggcc    120480
     tgctgttcgg ccagtgcttg cttctcgcgc aatgtgcgct cctggaccgc cgcggcctcc    120540
     tgcaatttat aggtctcgac cttttcaacg gcgatctgac gctcgcgcag ctggatcagg    120600
     atctgctcga tgctgttctg gccattgttg gcgcgcggtg taccgatcag cacttcctgc    120660
     aattcgaggc tgtaggagtt gaacttctcg cgcatttcgt cgccggattt gcgctgaatt    120720
     tcgctgcgtt cctgcagcag ttcgatcagg gtcttggtct gggcgatgtt cttgaaatag    120780
     gccgagacca tcggatcgag cgtctgttcg accagccgtt tgatatcgcc gaaacgctgc    120840
     acgacgaggg gcgccttcat atagtcgata tgcacgacga ccgagagcgg cagcaccggt    120900
     tcgaacgcat ccttggtgat cagcgacact tcggacagat tctcgtccag cctgtgctcg    120960
     ccgaactgtt ccttcgtcca tttgagcacg aagttggtgg tcggcacgat gatgatattg    121020
     ccggcataag tgttgaaggc atatttgccc ggcagaagcg gagtcgacca gacaccgcgt    121080
     gcgccggtct cgactagttc gccatggcga taggactggc ccgagatatc cgcgcttcgc    121140
     cggccggtat aggagacgac cacacccacc gtgccgacgt cgatgatcgt cttctccacg    121200
     agttcgacgg tcgcgaagat acggttgagg aaataactgc cgtcggcaag cacctgcaat    121260
     tgccggccgc gataaccgcc ggcattgaga aatttctccg gatcctggaa gttgttgtgg    121320
     aagttcggat ctttggggtt gttggcaacg gtcggtgcga tgatctcgcc atccggcagc    121380
     gccggaccgt catggatggt gacgacgccg atcaggtcct cggcgtcatg aatgacgacc    121440
     ggctcgaagc cgctccgctc actgatcagc gtcgacatgt cggcaaacag tccttgttcc    121500
     gacgcgttca ggttgacggc ataggtcgat tgtgcggtca gcacgatgaa ctgcgccaga    121560
     ttgatggcat aggtaccttc gcgcaggatc ttgcgctgcg gccccttctg gccgcccttt    121620
     gtcagaaagc cgcgcacatc ctgaaaatca tcggcgtcga cattcgaggc aagcgtctgg    121680
     gtcggcggca gcggctcgcc gtcacgggcg aagacataac cgatctggcc ctgtggaatg    121740
     gtcacgagat tggcgcgatg cattgcatac tggaacggca tgaagaaatg caggccgcca    121800
     cgcacgactt ccggctggaa gccggcctcg ccgtagagcg caatgaagcc attgtcgacg    121860
     gagccgcgaa agctccagag cttttcgagg atgccgagcc tgtcgttggg gatatagcgg    121920
     atcacgccgc tccaccggaa caggattgcc agcacgatga gcgtgacggc gatttcgatc    121980
     gccttccatc ccatcgggct cagatattgc agggtttcca tcttttctct cgcatgggcg    122040
     cacgggttcg ttccacccga tggccgccgg ttggtgttgg ttgataagac ggggagatgg    122100
     cgcgcctgtt cgttcgacgc actaaaggtg tatcgaacgc ctgggctgct cattgtctgg    122160
     gaaaaacgac cgcgcgtccc gagtccccga tgaggggcgg cgtggtcgtg agtgatctca    122220
     catcggtgtc gccttgatag acatgacgat ggaggacgta gggattacgc ctagaggttt    122280
     aaagatgctc gatgcggaaa tcaggcaagt acttccaacg atttcaatat ttcgagcatt    122340
     caattctact gaattatgcc gcgtcagcct gtttgtttcg gccgatgttt ccttgctagg    122400
     cgcccgcaag gtttgcgttg tcggcaggtt ccggatgccg gacctgccga caatctcgcc    122460
     atcagtcagc ctttttggaa tacagcaatg tcatgagcgc gaggatgcat cccaaggctc    122520
     ctaccgttgc gaagatgtag aaattccact gcggagccag gcctgcgccg agaaccgcac    122580
     caccgatggc cggtcctatc atacctccga tacggccgat gccgagcgag aagccaaggc    122640
     cagttccacg aatctcgacc ggatagaggt ttccaaccag aatattggcg aggatctgcg    122700
     tgccgatcgt tccggtccct gcaagtgcga cgagaccata gacctggagg ccctgatcca    122760
     cctgcgtcag caaccagatc gagcaggctc cgagaagaaa catgcctgac acgacaattt    122820
     tgacatttcc gcggtcggca atccttgcgc caatcaggag gccgattgcg gctccgagat    122880
     tgagcgttac cgaaaacagc agggcagaac cgaggtcata gcccatcttg ttcatgatgg    122940
     tcgggagcca gttgaccatg ccgaatgtca acagaagcga acagaagtgg atgccccatg    123000
     cgttcaaggt cggcagcagg cgaccttcgg aaaacagcga tacgatgccg gcctggcgtg    123060
     gcgcaaccgg ccgggcgaca ggattgggca gcccgtactg gtttgcgatc tggttggctt    123120
     cgggctggcg gctcttcgtc gccagccatt cgggggactc gggtatgaga cggatgaaga    123180
     aaggcagaag caggctcggt gcgccgccga tgatcatcag tggccgccat ccgtatttct    123240
     gtatcagcaa cattccaagg atacccgaaa tgatgccgcc ggcgagataa ccaagaagtg    123300
     caatcgaata ggcgattgcc ttccgtttcg gcggagaaaa ctcgatgatc aacgcggtta    123360
     ccgtgggaaa gagagctcca aggcccagac ccgcgagaaa tcgtgttccc tcgaaaacga    123420
     gaaagttcgg cgcaagaccg ctgccgatca tcatgacgga gaagctcagt agactgccta    123480
     tgatcacctt gcgacggcct atcctgtcag cgagcgttcc cgcaacgaga gcgcccagca    123540
     gcatgccgaa cagggtgatg gaggcagcgc gaccgaccag gccgggcgtc aagccccagc    123600
     tagcttcacc gagcaaggcc ggcgcgactg cgccgtacac aatcaggtca tagccgtcga    123660
     acaggatcag cagaccacaa agggcaatga tgatgttcgg actgcgaacg cgttccttga    123720
     aaatagcgag atcttgtatg gccaattttc cctccccata cattgagcac aggaagtacg    123780
     ctcctgccag cggcaggtcc gcatcaatcc atgtacaaat cctcctggat cgctgccggc    123840
     gtggttcctc ccagcgccag actcacccgc gaacgggcga tgtcaagaca acgatgacac    123900
     gctattaaat acttgctgat aaaatatttg caactgcaaa cttttcaacc cgcaactttt    123960
     ccctttccgg atattgccgg caagttgctg tgcattcggc gcagcgcctt cttcagcgcc    124020
     gcaacttcct cgtccgacat cccctgaacc gcggtgcgtt caagctccac ggcaagcggc    124080
     atgagccttt ccgtcagtgc ctcgccctgc ggggtcagcc ttacgatgac gatacggccg    124140
     ttatcttccg gacgtgttct cgacaccagt ttgcgcttgg ccagcgtgcc gacgaggcgc    124200
     gaaagcgtcg aaatctcgac agagacgacg tcggcgagat cccccagggt gctctcccgg    124260
     cgctccttga gcatggcaag aacccggtac atcgccacgc tgagattgtc ttcggcaatt    124320
     ctctgcgcga acacctcggc gatccgcacg ccggcgcgat taagaagata cgggactgaa    124380
     tcggtaagtt tgtacatatc tctgtctgct ggcgggattc ggcttgctga gcgttctctc    124440
     cgacatgcac ctaaattacc gtgatgacaa catgattggc tttcagcccc cgagaacggt    124500
     tgggcagatc aaacattttc ccgttcggct tatagatttg cattgacaat agttgcaaat    124560
     gcaataattt gacgtcgagg agacacggga ggaaatcatg tctgccactg ctgccctcgg    124620
     catagcgccg gcccccgcac ccatcagcga tgcgtttcga tcgaccatgc gccgcttccc    124680
     ggcgacggtg acggtcattt ctgcctgccg caacggtgcg gaccatggaa tgacggcaac    124740
     cgccgtcaca tcgctttcga tggatccgcc atctctcatc atctgcctga acaatcgcac    124800
     ctacctgcat gacatgctgc ttgaggtgcc ggaattcgca gtcagcattc tgaccgacag    124860
     gcaggcagcc gtatcggaag gtttcagcgg caagattgcg cctgagcgtc ggttcgacgc    124920
     tgccgactgg gttcgccacg agcgcggcat gatggtgctg gattccgctc atgcctcggt    124980
     tatctgccgc cgcacgggcg ctgttcctta tggaacgcac acgatcttca tcgggcaggt    125040
     ggtggataca cgcctttccc aagacacgat cgcactgatg tacgagaact cgaaatattg    125100
     cgcgccactg cacgcacttc ctgcatccca gaactgaagg tcgctccatg aacaacacag    125160
     ctgccctgtt tcccgcctcg gcgcgggttg agaacgcatg ccttgcagat cgcatcgccc    125220
     cgatgctgga cgaaatccgt gccggcgccc gcgatacgga aaaatccggc cgtgtgccgg    125280
     cgcgtaatat cgatctgctg cgttccgtcg gctatttcga tatcgtcaag cctgcgcgtt    125340
     tcggcggcga cgaaggatca tttgccgagc ttgtcgatgc aaatatccaa ctgtcgtcgg    125400
     cctgtgcctc caccggctgg gttgccggcc tcctttccgc gcatcaatgg ctgcttgcca    125460
     tgttcgacga gagggttcag caggaagtgt ggggcagcaa tccggatgca ctgctctgcg    125520
     gatcctatgc gccggtccgc gcggctgaac gcgtcgaggg tggtttccgg ctatccggcg    125580
     actgggcctt tgcgagcgga tgcgaaaatg cccagtgggc gctctgcgcg gcgatcattc    125640
     cgccaaaccg cgagggggag cgttctgtgc cgacgttcct tctggttccc gctaccgatt    125700
     ataccattgc cgagacctgg gatgtggtgg gccttgcggg caccggctca aaaagcttga    125760
     tcctcaaaga tgtcttcgtt ccggaatacc gcatactgac ctttccggat gcgacctccg    125820
     gcagaacgcc cggcgggcgt ggctataagg gtatcggcct tttcaacatt ccgctcctca    125880
     tggggattcc gttctgcctc ggcagcgcgg ccgtcggtgc ggcgaagggc gcattggata    125940
     gctatatcga ccacatcggg acgcgagtga cgcgcggcgc ggttgccggc ggcaacagca    126000
     agatcgcgga gtttccgaca atccagcttc gagtggccga agccgccgca tccgtggatg    126060
     cggcccgcga aatcgttctg cgggatattg cccgggcgca gcaactggcc caggaccgcg    126120
     aggacggtct ccgagagatc accgaggagg atcggattct cgcccgtcgc agccagtcct    126180
     ttgcggtcag cctggccctt cgggccgtgg aagcgctcaa tgcatcgaca ggcggtctcg    126240
     gtctccagat gtccaacccc gtccagcggg catggcgcga tgccaatgcc gtcgggcgcc    126300
     acatttccat gaactgggat gccgtcggca ccatggtcgg ccagcagctg ctcggccttc    126360
     cgcccaaggg gcaattctga tccgccatcc tcattatttc gattgaagac aggaaagaga    126420
     gcatatcgtg caaggcaaga tcgcgcttga agaacatttc gccattcccg agacgctgca    126480
     ggattcggct ggattcgtgc cgggcgacta ttggacggaa ctgtccgccc gtctgctcga    126540
     tattcaggac aaacgtttgc ggctgatgga tacgcacggc atcgagaaaa tgatcctgtc    126600
     gctgaacgct ccagccgtgc aggcgatccc ggacaaggca aaggccgtcg agatttcccg    126660
     acgcgccaac gactttctgg cggagcaatg cgttaagaac ccgaaccgtt tcctgggatt    126720
     tgcggctttg cccttgcagg atccggacgc tgctacgcag gaattgcagc gctgcgtgac    126780
     aacgatgggt ttcgtcggcg cactggtcaa tggcttctcg caggaaggcg acggaacgac    126840
     gccgctctac tacgacctgc cgcaatatcg cccgttctgg gccgaagtcg aaaaactcga    126900
     cgttcctttc tatctgcatc cgcgcaaccc gctgccgcag gatagccgga tctatgcggg    126960
     ccattcctgg ctgatgggtc cgacatgggc gttcgcgcag gagaccgctg ttcatgcatt    127020
     acgcttgatg ggatccggcc tgtttgacga acatccggct ttgcggatca ttgtcggcca    127080
     catgggcgag ggactgccat atatgatgtg gcgcatcgat aaccggaatg cgtgggtcaa    127140
     ggtggaaaag agttatccgg caaaacgccc gattgccgat tatttcaacg agaatttcta    127200
     catcacgacg tcggggaatt tccgcacgca atcgcttatc gatgctatgc tcgaaatcgg    127260
     cgcggacaga attctgtttt cggcagactg gccattcgag aacgtcgacc atgctgcaaa    127320
     ctggttcgac agcgccacca tctccgaagc cgaccgtctg aagatcggtc gcaccaatgc    127380
     cgtttcactg ttcaaactcg atcgataaca tggtcgcacc tttcagatat acggtcggcg    127440
     cggcccagat catcttcggg aggggctcgc tcagccgtct cgccgaggcg attgcagggc    127500
     agggcggcac gcgcgccctg atcctttcga cccagcacca gaaagcggaa gctgaacgca    127560
     tcgccgcttc cctcggcccg ctggcggcgg gactattcgc cgatgctgcg atgcatacgc    127620
     ccgtcgatgt caccgagcgc gcgatggcgg catacaatcg agccggcgcc gattgcgtcg    127680
     tcgcgatcgg cggcggatcg acgattggtc tcggcaaggc aatcgcctat cgcaacgacg    127740
     cgccgcaaat cgtggtggcg acgacctatg cggggtcgga ggttacaccg atcctcggcc    127800
     agacggagaa cggccagaag acgacggtcc gcgggccggg catcctgccc gaagtggtga    127860
     tctacgaccc tgaattgaca ttgggattac cggtcaacat cagcgtcagc agcgggctca    127920
     atgcgatggc gcatgccgtc gaaggtctct acgcacagga tcgcaatcca atttcgtcga    127980
     tgatggccat cgagggctta cacgcgctga agcaggcttt accgcaaatc gtcaatacgc    128040
     ccggggacat cgaatcgcga agtgaagcgc tttacggatc ctggctgtgc ggcacggtgc    128100
     tcggtgcagt cggaatggcc ctgcatcaca agctttgcca tacgctgggc ggcagtttcg    128160
     atctgccgca tgcagaaacc catgcggtca ttcttcccca ttccgccgcc tacaacgccg    128220
     tagccgcaac ggatgcgcta aagcccgctg ccgatctttt cggcggctcg ctcggcggcg    128280
     gtctttatga ttttgccgcc tcgatcggtg cacccatgag gctgcgagat ctgggtatga    128340
     aggaagccga cctgcaccct gcggcggaac tcgccgcccg gaacccttac tggaacccgc    128400
     gcccgatcga acgggacgcg atccgggctt tgttgcagag cgcctgggag ggcgcgcggc    128460
     cgcgttgaca ctttaggaga atggccacgt gcctgaatat ttcagcgaag agagatccgt    128520
     ggaagccgtc aacgcgcgga tggggcaggg catcaatccg cgtctggccg aactcatggc    128580
     atcgcttgtc aagcatctgc atgcctttgc caaggatatc agcctgaccc aggaagaatg    128640
     ggagctggcc ataagcttcc tgacccatac aggccatctc tgtcatgacg agcggcagga    128700
     gttcatcctg ctcagcgata cgctgggttt ctcgatgctg gtggatgcca tcaacaaccg    128760
     gcgtccgccg ggcgctacgg aaaatacggt gtttggaccg ttccatgtcg aaggggcgcc    128820
     cgtacggcag atgggtgaaa atatctcgct cgatggtaag ggcgagagtt gtctcttcat    128880
     cgggcgggtg ctggatctcg acggcagtcc gatcgaggga gccaaaatcg atgtatggtc    128940
     ggataacgcc gatggcttct atgacgtcca gcagccggat ctccagccga aatggaacaa    129000
     ccggggcgtc ttcgtcaccg gcgcagatgg tgcctatagc ttcatcggga taaaaccggt    129060
     ctcctatccg atcccggatg acggcccggt cggccagctg ttggcgtccc tcggccgcca    129120
     ttcctaccgt cctgcccata cccattatct gatcacggcg tcaggttatc agaagctcgt    129180
     aacccacact tttgtcggcg acgatcccta tctggaatcc gatacggtgt ttggtgtcaa    129240
     aaacagcctg atcgcgcctt tcgaacggat cgatcatccg acgatctggc gctccgattt    129300
     cgatttcgtg ctgacgccag tcgagacgac tagacgatga tcgttgtccg ctatgcagta    129360
     tcagatcccg gcaaggctgc cgaacgttcc cgattgctcg agcaacacaa ggcctatctg    129420
     tacggcgcgg cgatccgcat cctgctttcc ggtccctctg caccgccggc agaaggaaag    129480
     ggttctaccg ccgtggtgat cgcggacgtc gaaacgctgg ccgagttcga gacgttcagc    129540
     gcaggagatc ccttcgtccg cgccggcgtt tacaggagcg tcgatgtatt cgaatggcgg    129600
     cccagttttg ggcttctgct ggacagtctt tgatcaactt ttactttctg atcccggccc    129660
     accaaaggcg acgactgacg ctcgtgatcc tcaacggtca aagccggtca tatcgaacac    129720
     ggccgcattg tcctgaacct cgcgcagccc cttataggag gcgtgacgca ggctgccgtc    129780
     atcggtccag ccgcgaaatt cgatctcggc gatgagggtc ggctggacga agacgtagcg    129840
     cttgcccttc aggggaacga ccggccggtt ggtcttcaac cggtcgagcg tctttttcag    129900
     ctgcgcggcg tcgctggcgc tgaaaccggt tccgaccgag cccacggaaa tccaatcgaa    129960
     acccctcttg ccggcgagca gcaggctgcc gatgccgccg cgggcggctg ccgattgttc    130020
     gtaaccgaca atcatgaagc tctcgctctc aacgcacttg attttcagcc agtcgcccgt    130080
     gcggccactg ctgtagggcc ggtcgcgatg tttggcgatg atgccttcca tatgatggtg    130140
     gcaggcgtgc tcgaggagat cttcggccgg taggtctatt tcttcggaaa agcggatcgt    130200
     ccgattgtct tccggtatca ggtctttaag aaggtgccgg cgtacggcaa gctcggtgcc    130260
     ggtgaggtca tgcccgtcaa gatacaaaag gtcgaaggcg tagagaatgg actcgcttga    130320
     ggcccgcttg ccgcctcgac cgccgagcga acgttgcagc gcgccgaaat ccgatcggcc    130380
     gtggtcgtcc aaaaccaccg cttccccgtc cagtatgccg gtggtcacac cgagttcttt    130440
     ggcggccgcg gcgatggtgg gaaaacgatg cgtccagtca tggccgccgc gggtgatgac    130500
     acgaacgccc ttcggctcga tgtggatcgc aagccggtag ccatcccact tcgcctcgta    130560
     gagccaatcc ggccctatcg gcaccttggg cttcagcagt gcgaggcacg gctcgaccct    130620
     cgccggcatt ggatcgaacg gaaggcttgg ctggtcagga tcgcgcttgc ggatcggacg    130680
     agactgcagc gttgcattgg actcgttgag gaatggcaat gaggggcggc gcgagcgcgt    130740
     catgatcgtt gtctgtcctt cccggactgg ttttcaggct cttctccaaa cacaatgtcg    130800
     cctttcccac tctgctcaat cggatttagg tccggcgagt atttcggcaa gaaccatagc    130860
     ctggcgccgc agacgctaca cggcctgcac acgctggtcc ttcggcagcg agatcgtcat    130920
     cgccgcggcg acggcggccg taactgcaac ggcgagatag atgccgctga aactttcagt    130980
     cgatgtcttg atcacgccgc caaagaagtt ccctgtcgtg ccgccgatgc cttggaacac    131040
     ggtgcagatg cctaagacag tcaccgcgac gcggggtgtg gcccgatgtg agacgtaggc    131100
     cggcagcaag ccatagatcg gataaaagcc cagcgaaaag aagacgccgg acaggatcga    131160
     gagttccatc gagggttcga ggacgacgag ggcgccggcg gcgaggaagc ttgagtaaca    131220
     ggtcagcatg gcatagcgcg atccgagacg cgacgatatt gtgccaatgg cgaagcctgc    131280
     gctgatcccc accgccccga tcgttgccca gagccatgag gcaaagccga cggaatagcc    131340
     gagctcctcg cgcaggaacg gcgagagata ggtgagatag gggtatggca tcaggccgtt    131400
     gatgaagccg agcgcgaaga tcagcgtcac ccatggcatg atggagcgca ggcttgctga    131460
     accgccggca gttggcgcca gcgtttcgtg acttgtcccg ctgtcgaaga ggccggcccg    131520
     cccgaagaga atgtgggtga caacggccag tgcgatcgtg gccgcgcccg tgaggaacca    131580
     gaccatctgc cagtgaccgc ttccggcgta tgccgccacg agtgcgctgt tgatgaggac    131640
     gccaaaggcc ggggcgctgg agatcaggct catggcaaag ccgcgctgtt ctgctcttac    131700
     cacccgcgag gcaagattaa tcatcggcac gaaagtcgat gcgccagtcg cgccggcgac    131760
     catcagcagg ccggcaacca catagagatt gtcgctgatg gggatgctcg acaggcagag    131820
     cccgcagagc gagacggacg ccaccaccgt ccgtgcggcg ccgatgcgat ggacgagcca    131880
     ggtaccgagc acggcgaatg ccactgtgga aaactgcacc aggccggtga ccgtgccgac    131940
     gaaggcatag tcgaaggcaa gatctttccg catgtcgggg atgatctgag gaaaaaggct    132000
     gaggccgaat ccgtaacatg tgccgacgca ggcgatcatg acggctacga ggacgttatc    132060
     ctggatacgc actctagcca tgatgatcga cctctgttgg caaccgtgtt cgcgctcccg    132120
     ctcgacgcga tgatcatcta aagcgcgccg cgtcaaatct gattcatgcg acgcgcttta    132180
     gctctttgtt ttgatgcatg tcgttatccc ggaaccgctg cacacttccg ggcgacatgc    132240
     attggtatgg gcagccggcg gactgtcgga tctgcgacgc cggctgccta aaacctatac    132300
     aagttaaggg agcgccgagc acgcgctatg gcgtgctcgc ctatgctttt cgccgaaccg    132360
     atcgagccgc cgaaacagcc agttcgatcg atcacccgtt gacgctccga acgctcgcaa    132420
     cgctgccgtc gcaggccgcc cggcgctgag caagcacctt gaccgaaaag agcgcgtaga    132480
     tgatcaacgg aaggcagacg agataggatg tcctgatgcc cgcatgttcg gcaatgaaac    132540
     cgagcagcgg cggcgccagg aagaagacga cgaaggtcat ctggccaagg gcggcgacgt    132600
     tgagatgtgc cgcgcgatct atgcgctggg ccgccgccga gacggcgaga ggatagaccg    132660
     cgctgcagcc ggcgcccatc aaggcaaagc ccgccagtgc cacataggca tgcggagcgc    132720
     cccagacggc gcaaatgccg atcgccgaaa ggacaagcaa catcgtggcg acggcccgcg    132780
     ggccaaaccg atcgaccagc ggatcgacga acaggcgcgc cagtgccatg cagaaagtaa    132840
     agagcgtcaa tcctagtccg ccaataaagg gctcgactga aaacacgtcg cgcatataga    132900
     tcgccgacca gtcgatcccg gcaccttcga cgagaaaggc cgcgatgccg atcacgcaga    132960
     gtggcataag gctccgggtg ggaagcgcca ccagtggcgc cttgccttca ttcaacgggg    133020
     ttcgcgcggg cgcattgcgc atgcctgaaa tcgcccagac gccgagcaca agcaccgcga    133080
     caaaggtcac ggcgagatgg agttgcatcg aaataccggc ttggcggacg actgaggaga    133140
     caagcgccgt gacgaagaag ccgaggctcc agaaaccatg cgccctgttc atcacgccgc    133200
     gtcctaactg tgcttcgatg cgatcaatct cgacattgag attgatctcc agcgccccgg    133260
     cgagcaatcc ctcgacgaaa agcacacaga acacgaccgg cgccgcaccg atccacggca    133320
     ccagcgacag caacgcagac gtgccgagaa cagtaatgaa tgccgttgtc cgcgcgccaa    133380
     ggcgggcgat caccggcgaa gacaaagtca acgaaatcaa ggcgccgatc gcagccccga    133440
     tcaacgtcaa cccaagctcc gacttgtcga cgccaagcgc aacctgcaaa tccggcatcc    133500
     tcgacaacag cgcccccagc gacacggcga agagaaagaa gcagacatag atccgctgct    133560
     gcggcgcgat tttcatgatg caactccggg aattgacgct cgaagccgaa cgcgcgcttt    133620
     tggatttgtg atgtctaact cacagagccg gagatcaaaa cttttttctg aggagatgcg    133680
     acggagcgag acgccgagca gaatcacgct ctcacggcat ctgagccccg ctgacggcga    133740
     catagactga atagatcgaa cgggtcgccg cgatgaatag ccggttgcgc ttgggaccac    133800
     cgaaggtgag gttagcgacg gtttgcggca cgcggatctt gccgatcagt ttgccggccg    133860
     gatcgaagca atgcacgcca tcaccagcgc tcgaccagag gtttccgttc acgtcggtgc    133920
     ggatgccgtc cggaatgccg ctgtcgatca ggcagaagac gcggccgttt tcaagcctga    133980
     ggccgtcgac cacgtcgaaa gctcttatat ggcgcggcag gctttcatca tggcttgccg    134040
     ccgaatccgc cacgtaaaga atgctctcgt cgggggagaa ggccaagcca ttcggctgga    134100
     tgaaatcggt gacgacagcc gcaagccccc cggtcgccgg atcgagccgg tagacgttgc    134160
     gggtcggctg ctccggcacg gcgcgatagc cttcataatc cgacatgatg ccgtaggtgg    134220
     gatcggtgaa ccagatcgtg ccgtcggatt tcaccaccac gtcgttcggc gaattgagcc    134280
     tgacgccttc gaaacgatcg gcgagcacag tgatcgagcc gtcgatctcg gtgcgtgtga    134340
     cgcggcgcat cccgtgttcg caggagatca gccggccctg ccggtcgcgc gtatggccgt    134400
     tggcgaaatt ggagggttgc cgatagacgg agacgccgct ctccggcgtc caccgcagca    134460
     tgcgctgatt gggaatgtcg ctccacagca gctggttcgc atcgttgaac cagacgggac    134520
     cttcggccca gcggcagccg gaatagagtt cgtcgagagc ggcgctcgtt acgatcaact    134580
     gccggaagcg cgggtcgtgg atttcgtaaa tgctggcctc ggccatggcg gtctttccgt    134640
     ttatcgcatg ccggcccggc ggccgccggc aagcatgatg acgctgatga tgatgaggcc    134700
     ggtcatgatg aggcggatgc ccgcgccgac cccgtaggtg ttgagcatgg agacgaccag    134760
     gaacatgaag agcgatgcgc cccagatgcc cggcacgttg gaatcgccgc cggcgaccgc    134820
     cgtgccgccg atcacgacga cggcaatcga catcaagaga tattccgagc ccatgttgag    134880
     tgccgcccca ccggagaaac aggcgagcag atagcccgcg agcgaggcaa gcacggcgca    134940
     gaacaggtag gtgacgaaac gtgtgccgtc gaccgggatg cccgccatgc gcgccgccgg    135000
     catgctctgg ccgatcgccg agatccagcg cccgtagatc gtcttctcga gcaggaacca    135060
     ggcgaagagc gagatgagga gggcgacgat cgccacattc ggcacgccga gcgtgttcga    135120
     ggtggtgaat tccgccagca tgcccggagg cttgatgcgc aagccgcggt tcgtccaaat    135180
     cgcggcggac tgcacgatga agctcatcga cagcgtggcg atgatcggcg gaatgcgcag    135240
     cgccttgatc agcgcataat tgccgaggcc gacggcaagc ccgaggacga tggcaatgag    135300
     aagaccgggc aggatcatgc cgttttcgac attcatcagc ttcagcgcca cggtgccggc    135360
     aagcgtcatc gtggcgggaa ccgagaggtc gatattaccg ggaccgaggg tgatgacgaa    135420
     catctggccc aggccgacga tgaccgagaa ggccgcgaag gtgagggccg cctgcgacag    135480
     gccgagcgtg ctcgccccga gcgtcaccat gatcgtcagg aaccagacgg tgagggcggc    135540
     aagccacgac cagatccacg gtttgctgaa aagacgaagg acaggagtca tcggcgtttc    135600
     tcccgcttct ccagccggtt cagcatcagg cgaagcgcga gcacgacgat caggatcgcg    135660
     ccttgcgccc cgatctgcca atcgggcgag atgcgtagga aggacaggaa cgagccggca    135720
     agcgtcagcg tcagcgcgcc gatgactgcg ccgacagggg agacgcggcc gccgatgaat    135780
     tcgccgccgc cgaggatcac gccggcgatc gacagcagcg tgtagcgcag cgcgatattg    135840
     gcatcggccg aggtcgtcag gccgacgagg gcgatgccgg caagcaccgc aaacaggccg    135900
     gcaagaccat aggcgccggc gcgtgctgcg acgatcgacc agccggcgcg ctcgaccgag    135960
     cgctggttgc cgccgatgcc gcggatcagc acgccgagcg aagagcgcat gacgaggaga    136020
     tgggcgacgg cggcgatggc gatgctggcg acgatcgcca tcggcgccag cggcggcttg    136080
     acggtcatca gccagcgcac ccaatccggc gcctggccgc ccggcgccgg cagcagcagc    136140
     accgcaaggc cgccccagac gaagctcatg ccgagggtga cgacgatgga gggcaggttg    136200
     cgcagatgga tgacgacgcc aaggcccgca tagatggcga ttgcgccggc aaggatcagg    136260
     atgccggtga ggggagcatc ccgcagaaag gtcgcggtga cgcaggcgac gaagctgacg    136320
     aaggtgccca tcgacagatc gagatcgttg accgccatca ccagcatctg agcgatcgtc    136380
     gcaagcgcga tgggaacagc caggttgaac agcaggttga gcccgacata gctcatggcg    136440
     cgcggctgca gccagaagac ggcggcaagc agcagcgtca gcgacagagc ggggatcgca    136500
     agacgcaagg cgtcggaaga cagccggaac gtcatgcggc gaccccctcg aaggatgcag    136560
     cgatgatatt cgtctcgttg acggcgtcgc cggcgagttc ggcggtgatg cggccttcgc    136620
     ggaagacgta gacacggtcg caaaggcgga cttcgtccat ttcggtggag taccagatga    136680
     aggtgcggcc gtgcgccgct tcctcgcgga taatggcgta gacctcctgc ttggtcccga    136740
     cgtcgacgcc gcgcatcgga tcgtccatca gcacgatcgg cgcgcgcgtc gcaagcgcgc    136800
     gggcaaagag caccttctgc tggttgccgc cggaaagcga caggatgcgg ttggccatat    136860
     ccggcgtgcg gatctcgatc cgccgcttcc agtcggcgcc cttcgtctcc tcgtcgttgg    136920
     cgaggatcag gccgcgccgg gtaaggtcac cgagcgaagc gatcgagaag ttgcgcagga    136980
     tgctccagag ttcgaagacg ccgttgaggc ggcggtcgcc ggcgacgaag gtgacgagcg    137040
     gatcgcgctc gggcagccag ttgctggact gggcggcatg cagggcgagc aggagttcgg    137100
     tctgcccgtg cccggccagt cccgccagtg cgatgatctc tcccttgcgg gccgtgaagg    137160
     gaaggccttt cgtctgatgg gacagaatga gcggagcggt ggattggtcg cgcgtcgagc    137220
     gctgcgccgt ctccttcttc gcaacggtgc ccatcgcttc gacgagaccg tgatggtcga    137280
     atccatcagc cggacgctcg gcaacgacgc ggccgtcctt catgacgacg atgcggtcgg    137340
     aagtttcgag gatctcgtgc aggatatgcg agatgaagat gaccgagccg ccggcggcga    137400
     cgaagcggcg gacatgatcg agcatctggc gggcaaggct cgcatcgagc gacgaggtcg    137460
     gctcgtcgag gatcaccagc cgcggcgcaa cgccggcgtc ggaaaaggcc attgaaatct    137520
     cgaccatctg ccgctcggcg atcgacagat cgccgacggc ccggccgctg tcgatgccgt    137580
     ggccgggaaa gacggcgtcg aggctcttct cgatgatccc ggccgcgcgc ctgcgccagc    137640
     cgaagccgcc gagatgacga tgcatgatgc gcgtgttctc gacgatggat aggttggggc    137700
     agagcgaaag ctcctggaag acgcagcgca cgccgcgggc ccgcgcggcg ttgatgccat    137760
     aacgctccag ccgctcaccg tcgcttgcca cacttccttc gtgcggggtg aggccgccat    137820
     tgatcacact gacgatcgtc gatttgccgg cgccattgtg gccgacgagc ccgacgcatt    137880
     cgcccggcat gacgcggagc gtgacgccgt cgagcgccct gaccgcaccg aagctcacct    137940
     tggcgccatc gacggcgatc accgccttca aaacctcatc catcctgccc gccagatccg    138000
     cttcacaaag aatgccgcgc ggccatgtgc ggccgcgcgg cagtcgccgg gagacttact    138060
     ttgccgactc gatgaccttg atggcgtctg cctgcgtgta ttccacgttg gcgacgccgc    138120
     cggcctgggt attggcgagg ttcgtttcga gattgtcctg gtcgatgcgc aggaagggca    138180
     ccacgaggtc cttcttgacc tccttgccgt cgaggatctg ctgagcgacc cagaaggcga    138240
     gtgttgagac gccgggcgcg atcgacacgg acatggtctc gtagcccttg ccgtccttct    138300
     gctccttcca ccacttcagt tcatcttcgc ggttgcccat gatgatggtc ggcatcttcc    138360
     ggtcggtcgc cgcaatcgcc tgcgcggcgc cataaccgtc gccgccctgc gtcaccacgc    138420
     cgacgatgtc gggcaggctc ggcaggatgc cggcaaccgc cttctgcgcc acgtcctgcg    138480
     cccaatcgcc gtgaacggag ccgacgacct tgaactgcgg gtactgcttg acgccgtcgt    138540
     gaatgcccgc cgagatctcg tcatcgacga agacaccggc aagaccgcgg atctcgagca    138600
     ggttgccgcc ctcagggagt ttcttcgaca ggtactcaac ttcgctgcgg cccatttcct    138660
     tgaagttgac ggcaatgcgc caggcgcaag gttcggtcac gatgccgtcg aaggacacca    138720
     cggtgatgcc ggcatcgcag gcttctttga ccgcgccgtt cagtgccgtc ggcgaggcgg    138780
     cgttcagcac gatggcgtca tagccctgca ggatcatgtt ctgaatctgc gcggcctgct    138840
     ccgtcgcctg gttctcggcg gtggtgaaag ggtcggctgc ggcaacggtg ccggccttca    138900
     cggcttcgcc cgtcaccttg ccccagctcg tcagcatggc ctggcgccat gagttgccgg    138960
     cataattgtt ggaaagagcg attttcttgg ccgacgtgtc ggcaaaggca gaaacgggca    139020
     tcgcggcgca agcaatagcg gccgatgcca gaagcatctt gcggattgtc atgtcttcct    139080
     ccctgatgat cgcgccggtc ggcggatcgc ttcactcctg cctgcccaat cggggccgag    139140
     tgaaaattgt tcttgcactg agcttcctcc tctcagtaag ggcaggatgc gggagatcga    139200
     ccggcctgta caggggcaag gcagcaagtc gtttgcgggt tttgcgcaat tagctgcggg    139260
     tttacgcaag acggcggcgc ttccgcgggc gcttactgcg aagggatcgc ggcgggttga    139320
     ggagcctgtg ccgtctcggg gaggaactac aatgctgcaa ctcacaccgg cagcgatgtt    139380
     cgaccactat ctcggtattt cccggctgct cgccggccag ctcgacttcc gctcggccat    139440
     ccgttcggtt gcggccgagg tcgcccatat catcccgcac gaccatctcg atgtctgcgt    139500
     gctcctggag ggcggcaact accacacggc ctacgagacg ggcatcgaaa ccgcctgggg    139560
     cgatcttgcc ggcgcaccgg tggtcaacag cccgatccgt tcgctgctct ggggcgaggt    139620
     ggagtttctg ctggcggaag acgccatgac ggacccgcgt ttccatttcg agggcgcgtt    139680
     caagcggccg atcgttgagg agtcgctgag aagccgcctg catgtgccga tgaaggtgca    139740
     gggcacgatc atcgcggcgc tctcctgttc gtcgcgaacg gctggtgtct atacgatgga    139800
     ggatatcgag cgcgcccgca tcatcgccga cctgctgacg ccctatttct tcgcgctgca    139860
     ggcggccgag caggcgcagc gctcggcgat cgtcgaggcc gaggcccggg cccgcgagga    139920
     ggggctgcgg cagggcgcgc tgaagctgac cgaggcactg gaacaggaac gccagcggat    139980
     cggcatggac ctacacgacc agacgctcgc cgacctgacg cggctcgccc gccggatcga    140040
     tcggctgtcg cgcaacggcg aggtgacgcc ggaggcgctg gaaccggtct cgcgttcgct    140100
     gcagcattgc atgcaggatc tgcggcagat catcgaacag gcaaaaccat cggtgctcca    140160
     gcttttcggt ctcgcgcagg cgatcgagca tcatctcgac cggtcgaccc gcgacacggg    140220
     acaggccatc gaatggggtc tggtcgacga aacgcacggc gcgctggagc ggctggaacc    140280
     gaccgtcagc gtcgcgctat tccggatcgc gcaggaggcg atcaacaatg cggtgcgcca    140340
     tgccgcgccc ctcgccgtga cggtgcggct cgaggccgac gaggaacggc tgtcgatcga    140400
     aatttccgac gacggaacgg ggcttgcgaa ggcacgggga cggatcggcg gcggcatcga    140460
     caatatgaag acccgggcgc ggctgatctc ggcgcgcttc acgaccgggc ccggccacaa    140520
     caatcgcggg accgtggtgc gcgtcgtgct gccgctgacc ccgcccgacc cggcaagcgg    140580
     gccggactga ggagaaacgc gcaatgaagg ttctgatcgt cgaggacgac ccgctgcacc    140640
     gctcctatct gcacgaggct gttaacgccg ccctgccgga atgcgacacg gtgatcgagg    140700
     ctgagaacgg cacggtcggc gagaagctcg cccgcgacca caagtcggcg catatcgtca    140760
     tggacctgca gatgacgagc cgcaacggca tcgaggcggc gcgcaccatc tggaaggagc    140820
     ggccggagac ccgcatcctg ttctggtcga actattcgga cgaggcctat gtacgcggcg    140880
     tctcgcgtat tgtgccggat ggcgccgcct acggctatgt gctgaaatca gcctcggacg    140940
     agcggctgaa gctggcgctg cgctcgatct tcatcgagag ccagtgcgtc atcgaccgcg    141000
     aggtgcgcgg cctgcagcag aaaagcctcg gccagaccaa cggctttacc gattccgaat    141060
     acgagatcct cgtcgatatc gcgctcggtc tgacggaccg ggcaatcgcc aaacgccggg    141120
     gcctgtcgct gcgcagcgtg cagaaccgcc tgcagcagct ctacgacaag ctcgacgtct    141180
     accagagcgc cggcgacgac catgaggacg gccgcttcaa cctccgcgcc cgcgccgtca    141240
     ccgttgcttt cctacgcaag ctcttgaatt atagcgccct ggagcgggcc gatgccgagc    141300
     tgcaggagtg gctcgacgga aagtagtcgc tggctgaaca gcgacatttt cgcccgcaag    141360
     gatcaggcaa tggctttcaa cggagcccgg ctgctcggcg ctgcctcagg cttgccgaac    141420
     aggaagccct gcatctgggc cggatggctt gcatgaagga tcgcaagctg ttcctgcgtc    141480
     tcgactcctt cggcaatcac cggcaggttg agcgtcgacg ccatctcgat gacattctca    141540
     aacagcgccc tgatggttgg atcggcgccg atgccggcaa ggaaacgtcg atcgatcttc    141600
     agcttgtcga acggaaaatc ccggaggttg gcgagcgagg aataaccggt cccgaaatcg    141660
     tcgagcacca cccggatccc catcgcgcgc agctgaccga gcgtggaaag aacggcagcc    141720
     cgatcgtgaa acagcgccgt ctcggtgatc tcaagctcta gacggtcggg ctgcagcccc    141780
     gttttcgcaa gaatgtgcga aaactgctcc accaggttcg gcatcaggaa ctgaaccggc    141840
     gaaatattga cagcgatcgt cagcggggtc ctccacgagg ctgcttcgct gcaggcttct    141900
     tcgagaaccc agatgccgat gggaatgatg cagccgcttt cttcggcggc ggcgatgaag    141960
     tccgccggtg caaggacgcc tctgcttgca tggcgccagc gcaacagcgc ctcgtagccg    142020
     cacggttctt gcgaggaggt gtcgacgatc ctctggtaga ccaggaacag ctctcccttg    142080
     gcgactgcgt gccgcagatc gtgctcgagc tgccgcttgg catgcagttc aatgtccatc    142140
     gccgcctcga atgtgcaggc tctgccgcgg ccgccgctct tggcccggta gagagccata    142200
     tcggcgttgt ttcgcaggcg ccgatcggta acgccgtgct ccgggtacaa cgcaatgccg    142260
     atgctggcgc cgaatcccga agaggtggcg agatctgcga attcctgcgc gaaggcgtgc    142320
     tgcagatcgg ccgacaacgc ttccgtctgt tggcgagacg cgttttccaa gatgatgcag    142380
     aattcgtcgc ctcccatgcg ggcgatcgta acatcggccg gcaaggtgcg gagcaagacc    142440
     tgggcgacac gctgcaggac cgcgtccccc tcggcgtggc cgaatgtgtc gttgacgagt    142500
     ttgaaacggt cgagatcgag ggcaagcagc gccaggccgc ttggcgtttc ggcagcgcgg    142560
     gccatcgcca tctcgaaacg ctggtcgaac tcgcggcggt tcgccaggcc ggtcaatgag    142620
     tcatggcgtg ccatatgctc gatcctgcgg ctcgcctcat gacgctccgt cagatcgcgc    142680
     acggcgatca cctggcactc gcgcccgcga tattcgatcg tccgagcaag gatctcgacc    142740
     ggaatcgtat cttggccgtc gcacaatacc gctccctggc aggtgtcgat gccaaggcgt    142800
     ctttcgatcg caagcaccgc ctcgactggt tggcctttca gaagtgcggc tgctttgccg    142860
     gccatcgcag cgaatttctc gttgagatcg atgacgacat tctcctgggc gatgacgagc    142920
     ccctcgaacg aggcattcgc caacccgcgt agatcggtca aatgacgatc gaggaacagc    142980
     gctgcggcgg caccgagcag gatcaacgtg gagatgatcg agacggcgat ggcgatggcg    143040
     atccgatcga cggaggagag atcggcgtgc acgggctcgg cggaaggggt gatctggacg    143100
     ccgctcatcg acacggtgtg gaggctgcag atcgccagga cgatgcacgc cgcgccggcg    143160
     aaaatatgaa aacgcctgct tgcgctatgc cgcagggccg caaccgcaac aatgccgaag    143220
     ccgattgcca acgcacaggc gacgatcgat ttgtcgaggg cgagcgaaac catgctgaac    143280
     ggcgtgatgg cgagcagccc cacgaaatgc attgccgcaa tggcaacgcc aaacaggacc    143340
     ccgccggacg cctggacaag ctggccgcca ttcataaagg cgatttcaac cgctcctgca    143400
     aacaggacga tggcggcgat aatcgacaga atgatcagag gaccgtcgta gccgatcggc    143460
     accggaccgg cataggccag catcgcgata aaatgggttg cccaggtgct ggcgccgaga    143520
     acgacggcag cggcgatgag ccaataatgg tgatgctgct gcacgcattc ctgcgcacgc    143580
     gtcagcatga agacggccgt caggctgccg aagcagcaga tcgacagggc gacgaaaagc    143640
     aacgtccagt catgctggtc ggcgatacat gaaagcacag tgaacatggc atctcccgaa    143700
     ggtgcgggga gggtgccaaa gcggacctaa cgaaatcata cgggcttcgt taaaatgcta    143760
     gtcatcccag caaaaaccac aacgaaaaga cgaaaataaa atatcgcccg acaaagcgcg    143820
     gatggaggcg gccgcgaccg cagttccgct gcttcaatcg aagaaagccg gcttccgaca    143880
     aggcgtgtta agaacccgtc agcgggatcg aacgcctggc atctgccaat gatgggttgg    143940
     aaatgacgcg gtaccgagcc tcgacaaggt tgtatattcc gaaggctgcc aatccggcgg    144000
     cgacggcgat gtagaggaag gatccgaacg gaagctggcg gacccattcc agggcatcgc    144060
     ccatgctgcc ggcctgttgc ggatccaccc ggaagccggc ataggcgaac agtatcccgg    144120
     tgatcgcgaa caccacgccg cgggcgacga gaccataaac gcatatcaag gtcacgatac    144180
     ccttgctgtc cggtatcttg acgtagcgct cgaactttcg ggtgacgcct tttgcgaccg    144240
     tcacgatgcc gccgatgaca aagccggccc caacggcgat cgcaaggtag gagccgaacg    144300
     gctgcgacat gatccatccc gccagcccct tttcacccga gccttcgctc ccgccgccga    144360
     ggaagatggc acgactgagt gcatatccgg caaggccgag ataggtgacg gcgctgccga    144420
     gcagtgccgc ccggatcgcc aaagcctttc cgtttcggcc gtggccgtcg ctatccgcca    144480
     aggactgggc cagcctccag gcgacaaatc cgagaagtcc aagaccgatc attccgaccc    144540
     agatccggcc gaacggctgc gaaagcagcg tcgagagcgc cgacttcgtt tccggccggc    144600
     cgccggcgac gccggagaag agcgcgagcc ccgctatcag cagaaaaacg acaccccgcg    144660
     ccgtgtagcc gcccttggcg agcacatcaa atcgaaagcc tttgctcatc agcattttcc    144720
     tctgcgtcgc cgctgcgcga gattaacgca ccagctttcg gaaagtttgc tgaaagggct    144780
     cgcaacgggg cggcggcgtg atcagccgtt aggaatggct accagtcaca agttccataa    144840
     gacagattac gccacatttt caatttaaag ttgtacataa gctatctggt aacgcgacag    144900
     ttgggccagt tagagatgcg acagtctcgc ctctcgacgt gctggtcaat gccagcgttg    144960
     ggaacaagga gggccggttg atgatcttcc gacctgcaca gattcgctcc agttcagcta    145020
     tgacaacgct caacccagac gtgatcattc gagtcaggca gttgagcttc tcgacgcctg    145080
     acgagggcca aaggcggcag agctgcgttc aaccagcttg caagagataa cccgactgcc    145140
     cggataaatc ttctcgcccc ctatcaaatc gttcagccac ttcgccccgt ctcggccgag    145200
     atcgtagtat ggtaacgccg ccgtggtcag ctccggcttc agtgccatag tgactgttcg    145260
     aaaatcgtca aagccgacga tgctgacatc ttgtggaata cgcaatccca gtgccatggc    145320
     ggcaatgtaa atttgaattg ccatttcgtc gttgccgctc atgatcgcgg tcggacggtc    145380
     gtcttgtttg agcatttcgg tcgccgccgc aaagacgtag ttgttttccg ccccaacagg    145440
     gccatccata ccaaggctga tagagaggtc gctctctgtg agaccgaatt cgcttgtggt    145500
     tcggcgaaat gcatccaggc gcagttcggc tcccaagagg atcggattga gccggatgta    145560
     accgattctg cgatgacccc gctcaaggag ataacgggta agatctcgcg ccccctgata    145620
     atcatcgggc tcgatagacg gcaagagctc ccttgtttgc tgccgacaat ttatcatcac    145680
     tgtcggaatg ctgacatcgc cggtctccgg atccacgatg cggcggtaca tggtgacata    145740
     taagactcca tcaatgcgat gggattggaa cattttccag atttccacct ctcgctcgga    145800
     agaaccaccg gtgttggcta tcaggatggt tttcccattc gcattcgccc aatcctgaat    145860
     tccgcggaca atatcgaccg aatagggcgt cgtagaaaca taatcagtga taatcccaaa    145920
     ggtgttggag cggttggacc gtatgaggcg cgccgccata ttcgggacat agccgaggtc    145980
     gcgaatagcc ttttccactc tctcccgagt ttcctcagtc acatagggct cgccattgat    146040
     gacacgagag actgttttgt ttgaaacccc ggccgctttc gcgacgctga cgatgctcac    146100
     catgtccgcc aattctcctc gtgtgggtct gttgtaaacc agacgcatga caacgtcgac    146160
     atatttttct gacaacgtcg acattgtcgt tgacaacgtc gtcatagcgc gcttatggtc    146220
     ccaacaatgc aacagcctga ggcaaatgct tccggcggaa tgagggagga actcatgaag    146280
     aaattgcttg gcgccagcgc gctcgcgctc gtttgcattg cggcctccgc taaggccgag    146340
     accatcaata tcctcgtgga aggtggcggc gaaatgctgc agaaggcagc cgcggagaag    146400
     ttcaccgccg agaccggcat caaggtgaac ttcaccgtcg ttccctatca gggcgtcttt    146460
     gacaagtttt cggccgaaat cgcctccggt tcatcggcgt tcgatgtggt aacgatcgac    146520
     gtcgtgtgga acgcgaaatt cgcaagccac gtcgaggacc tcgcgccgct tttcaccgat    146580
     acggttcgta aggacctgcc gcctgccttg cttgccgacg cgaagatcgg tgacaaactg    146640
     attggcatgc ctgcttgggc caatgccgaa attgttttct atcgcaagga cctcttcgac    146700
     aaaccggagg aacagaaagc gttccaggca aaatatggtt atcccctcgc cccgccgcag    146760
     acttggcagc aatggcgcga catcgcaaaa ttcttcaccc gagacacaga cggtgacggc    146820
     aaggccgatt tttggggcac cgacaccatc ggcagcttct ccgaagagtg gatggcgcat    146880
     gtgcttcagg cgggctcgcc aggtgtgatc ctcgacaagg atgggaaggt gatcatcgac    146940
     aacgaggcac ataagaaggc gctcgaattc tacatcgcgc cccactgcat cgatcattcc    147000
     gtgcccgaaa acgtcaacga gatcggctgg ggcgaagctc agaacctgtt ctatcaaggc    147060
     aagacggcga tgatgaaatt ctgggcgcac gcctacaaga tgacgcccac cgattccaag    147120
     gtcagcggca aggtcggcgt cgtcccgatg ctagccggcg atgcagggat cgcggccatt    147180
     ccgggtcctt ggtacaatgt cattccgtcg acctcccagc acaaggacgc ggccaagaag    147240
     ttcatagcct tcgcgatcgc caacaatgcc ctgggtatcg aagcgccgct tggattggct    147300
     gcgacgaact cggcctataa cagctatgcc agcaagcccg gttatgagca tttcacgccg    147360
     ttgcttgaga cgttgcatgc tcctgccacg caaggccgtc cgatgaacga aaaatatcag    147420
     gaaattgtcg acgaagcggt tcttcccgcg gtgcaacagg ccctgacgtg caaagcggat    147480
     gtcggcaagg tcctgacgga cgccaaggaa acgatcgaag acatcctcga ctaatccctc    147540
     ggcgtcgagg aggacgaacg gtcgtcctcg catcatcagc tttcggagag agccatgtcg    147600
     ggtgaagacc gattcgtgct gtgcatgctt gcgccagccc tcgccatcct tggcgtgctg    147660
     gtcgcatacc cggtagggct tttggtgttc gattcctttt ttaaggtcga taccattact    147720
     ccccacatac gagagtggat cgggctcaag aactatatcg acgcgctaac ctcgaagcgc    147780
     gttgcggaaa gcgcattcag aacaatccag tattcgatct ttgcactgtt cttcgagttt    147840
     accttcggct tctgcgccgc tctgctgttc tcggcgctcc ccggtcactc aaggtggcac    147900
     cgcacgatct tcacgctgcc attgatggtg ccgcccattg tcgccggcct cttgtggcgc    147960
     tttctcctgg tcgggaacat cggcatcttg aattatgggc tcgtccatct gggcgtcatc    148020
     agcgatcccg atgcgattgc ctggttgtcc gacgaggata tcgtcatcta ttccgtctct    148080
     ttcgccgata tctggctgac gacatccttt gtcgccctcg tctcctatgc cggattgaca    148140
     aacattccca aagacctgct cgaggcggcg aggatcgacg gcgcgaacgc gttcaagcgc    148200
     ttctggcatg tcacactgcc gctgatgcgc ccggtgatcg ccgttgtcgt catcgtgcgt    148260
     ggggtggatg cggccaagac cttcgacctc atctggatcc agacgcaagg tggccccaac    148320
     cacgcctccg aagtgttttc gatgaacatc tatcagcgca tggtgcgctt cggcgatctc    148380
     ggcgaggcgt cggcctccgg cacgctgttt ctgatcgtca tgatgcttct ggccgccgct    148440
     gcctattgga agatatggag gccggtccat gcttagtgcg cgccgcctca atttcaacgg    148500
     catggtgatc aatgccgctg cactcgtcct cgtcctgtcc tatgcgctgc cttacatcta    148560
     tctgctcatg acgtcgatca agccggcggc ggatgtccag cagattccgc cgagcttctt    148620
     tcccgcggtg atctctttcg agaattttcg cgatgtcctg caatcatcga ccctgccgcg    148680
     ggccttcgca agctcgctga cggtggcggt gctgacaacc atcctttccc tcgccgcggc    148740
     ggttccggcc gcttatgtcg cgacccaata ccggcgccgg atcaccactc tgttcctgct    148800
     tttcgcgctg gtcacgcgca tggtgccctc agtgtcgctc ggcgtgccat tgttccagct    148860
     tctgaagtcg ctcggtctgc tggataccgt tcccggcctg gtgctcgccc atacatcagc    148920
     cgcggtccct cttgcgcttc ttctcatggc agccttcttc gaaggcgtgc cgaaggatct    148980
     ggaagaggcg gcgcgcatgg acggctgcac ccgcttccag gcctttctga aggtcattct    149040
     tccgatcatg acgggcggaa tcgcggtcac cgcgctcttt accttcatca cgagctggaa    149100
     cgagttcctc tacgcattgc tgctgacgtc agaggcgacc aaaacggcac cgatcgtcat    149160
     tgctgaatac aactccgtct atggcctggc ctggggagcg atgacggcgg cggccgtgct    149220
     ctattcactg cccgtcatca tcataacact cgcacttcaa aagcagatcg tcggcggcct    149280
     gactttcggc gctgtaaaag gatgagggag gcggagacat ggccgatata gaactacgca    149340
     acgtcaacaa gatctacggc aacaactttc atgcgttgca cgacctgaat ttcaacatca    149400
     gggatggtga gttcatggtg tttgtcggtc cctcgggatg tgggaaatcg acggcgcttc    149460
     ggatgatcgc cggccttgag agcatttcga gcggcgaact caggattggg gacagggtcg    149520
     tcaacgatgt cgatcccaag gatcgcgaca tcgccatggt ctttcagtcg tacgcgctat    149580
     acccgcacaa gaccgtgcgc gaaaacatcg cctttccact actgatggca gggttgccaa    149640
     aatccgacat tgccagccgg gtggatgaag ccgcgcgcat cctcgaactg acggctctgc    149700
     tcgaccgcaa accggcgctg ctctcgggcg gccagcggca gcgcgtcgcc atgggtcggg    149760
     cgatcgtccg ccagccgtcc gccttcctga tggatgaacc gctgtccaat ctcgatgcaa    149820
     aactgcgtgt gcagatgcgc gccgagattg ccagccttca gagaaagctt aacgtcacca    149880
     cgatctacgt cactcacgat caggtcgagg caatgacgat gggtgaccgt gtcgctgtca    149940
     tgaaaggcgg tgtgctgcag caagtcgaca caccgcaaaa cctgtacggt cgccctgaca    150000
     acgtctttgt tgcggccttt atcggatcgc cctcgatgaa cttgtacgag gccgttctga    150060
     atggaaggac ggtgaccctg ggcagcaaca gtttcgaaat tcccgaccgg gtttttgaat    150120
     gccgtccctc gctcaacggt gcgtccaacc gtcaaatcct tctcggtatc cggcccgagc    150180
     acatgaacga cgctgcaatc cggccttctt cggccgagat ctcggccccg gtcactcttg    150240
     ttgaggcgct cggttctgaa tccatggtgc atctgaatat cgacgcacct tgggtggatg    150300
     ccggcgaccc ggacgccatc gccgacatcg gcgacgaaaa agctgctgta gcccgttttt    150360
     ccccaaagag cacagcgcga gcaggtgaca tcgcgcgcat cgctgtcgat gccgaagaac    150420
     ttcacttctt tgacccggac acccgcacca gcatctggtg atggcatagc caaaagaaaa    150480
     caagataact ctcgctgtcc gaggagacat tataatggtt ggcgaaaatt gctacgacgt    150540
     taccaagtat ccagccggca atcctcgtga ggatattggc gcggtcatca atagcatcat    150600
     tgccgatatc aaaaacaggc aagcggttgc cgatgtaaat gacggcggaa aacctggatc    150660
     ggttatctat ataccgccag gcgattatcg tcttgtcact caagtcgtta tagacgtgag    150720
     ctatctgaaa atcgtcggct ctgggcatgg ttttacgtcg tccagcatcc gtttcaacac    150780
     acccgcaagc gagttggccc actggcacga agtgtggccg ggcggaagtc gcatccttgt    150840
     ggacacgtcc ccagaggccg cagacggtga ggctgctggt gccgcctttt atgtcaagcg    150900
     cggcggaaat cctcggataa gctctgtgga gtttgctgac ttttgcatcg atggcttgca    150960
     cttcatcgac gatggttcgg ggcaaaacga cgcagaaaat acatacagaa atggcaaaac    151020
     gggaatctac gtaggcagcg ccaatgactc attccgaata accgggatgg gccttatcta    151080
     cctcgagcat ggcgttactg ttcatgatgc agatgcgctc gcgatagata acaatttcat    151140
     tgcggagtgc ggcaactgta tcgaactgaa aggtatgggg caggcctcaa gaatagcaaa    151200
     taattttgtc ggcgccggat atagggggca ctccatttac gccgagaatt atgcgggcat    151260
     tctggtatcc tcaaacaacg tatttcctcg cggagcgagc agtgtccatt tctccggcgt    151320
     ggtgcgttcc tcggttacag gaaacaggtt ccattccttt tatcccggga tgttggtttt    151380
     tgccgccaac tgctgcgaga atttggtctc ctcaaatcac tttctgcgag atcgcgagcc    151440
     atgggcgccg atgcagaagt acgacaacgg cctggatgat ctgtttgggc ttttgcagat    151500
     tgacggcagc aacaattcgc tgatcgcgaa ccacatttcg gaaacaatag ataccaaata    151560
     catcaagcct ccagaagtaa agcctgtgat aattaatgta gtttccggta gtggcaacta    151620
     catagccagc aaccacattg tagccaccgc cgaaatatct caaaaggaca agagcgatgc    151680
     gccaaacagc gcctgttttt caacacaggt gagcgcgttg ctttcaaccg ggaattcgac    151740
     gttgctcgac gtaacgacag tgctggtgca aaaggaatcc gtgcggaata cggtcctgga    151800
     ctccggaaat gacgaacaag ttgtgatgga cagaacggta aatgcattca ggggcactcc    151860
     ggttcctggg caatagaacc cgcagccgcc gggcctttcc cgccggtcgt gggaccgcaa    151920
     gtcctcttcc cgagaataac ttgggccagt cttcggaccg gccgttcttc actcagattg    151980
     cgtctccaaa tggctaaagc gacggtctct tttgcttcgg gcgagcgttt ggaattctgg    152040
     gcatctggcc ctggggccgt caccatttca cactatggtg agatcctctg gcatgtgccc    152100
     gttttcgaaa ctcatccatc atactattcc tatcaccacc gcgaggccgg cagcgtcgtc    152160
     gttgaatggg accggccgga agcattcctg tgggcttacg cctacgatcc agcaaccgtt    152220
     gcggaggccg gcataaaact atgggaattc agcacggatg agattcttat tcgcgcagga    152280
     aaggaaatcg acacatggct gcgaagcgat cccgggcggc ctcgaattca tttttctccg    152340
     tgtcgcaact ggatgaacga tcccgtgggt ctctgcagga tcggcgattg ctggcacttg    152400
     ttttatcaat tccatccatg cggcggcgac tgggggccaa tgcactgggg acatgctacc    152460
     agccctgacc tgttcacctg gacacacatg ccggtttttc tccatccgga gcagaaccta    152520
     tggcgtctcg gtgcaaccgg aggcgcattc tccggcaatg catttcatga cagggatggc    152580
     agcctgatgt tcttctatac ggaacgcctg cctgcctatg accttttcaa aggctaccga    152640
     gaaatacaga agatcgcccg gccggaccgc cggatgatca aggcggaaag tatctcgacc    152700
     gtactcgagc agcgccccga aggcgttgag cacgatttcc gcgatccaaa ggtgtggtgg    152760
     gatgaagcct ccggcgctta tcgcatggta cttggcgctt ctcttcatgg cgatccggca    152820
     gtcttgcttt acggttccga ggatctgctt gagtggaaat acctgggacc gctgtaccgt    152880
     gcaccgcctt tcttccgcga gcagggcgcc agggcaattg aatgcccgga cttttttccc    152940
     atcgacggca aatgggtgct gatcatggga tttgtcggac accgtgatcc tgacagcggg    153000
     cgacacaacc tgctctatgg gctcgtcgga ggtttcatcg atgaccgctt ccttccagac    153060
     tccgatgccc tgcaactcct cgatttcggc agcgactttt atgcgatgca gaccttcgcg    153120
     acgggcggca ggcagattgc ctttgcatgg ctcttcaatt gggagttccg taagcctgcc    153180
     ggatcgccgt attccggcga attgtcccta ccccgccagc tgtcgctgga tgcgcgcaag    153240
     aggatatgta tgagacccgc tgacgaagtg gaggcggccc tcactcatgc gcctctgtct    153300
     tccgcagagc ccggcagata tgttctggac gaggtgtcga tcgatatccg gttgaacggc    153360
     atactcgacg gaacaaggat caccgcgacc gaagccgggc aattgtcatt ttccatcgtg    153420
     gtggaagatc aaaatgtctc cgtgcagctg ccgcacgatg acggatcgat ccgttatgcc    153480
     gcggccattg ccgatgcgac ggatctgaga gtcatccacg acaagggcat cttggagatt    153540
     tttgctgacg gaggagccgt ttgcggcacg cgacgcaact atctcaacgt cagaccggac    153600
     acccttgtta ttatgtcaaa ggcacatgtg agcgttttca gcggggagta atcgcatcgt    153660
     gctgaaggcg ctaaagggca ggttctgtac gtcgacgcca tagccccaaa gttaggcaaa    153720
     gttggaatgt cacactcccg gcatttgctg catgcgcttg atccgagacg tcgtttccta    153780
     tcgcacctcg aattccggat cgggcggaac ctgcatcgcg agagcgagat gatttgtctg    153840
     ggcggcaagt ccgatgatcg tcaggagttc gccatgttgg gcatcggtca tcccgcgcgc    153900
     gcgggcggcg gcggtgtggg attggacgca gtactggcag gcattggccg tcgacaccgc    153960
     gatgtagatc atctcgcgcg tcaacggatc gagcgcgcct tcgaccgtca tgacggattt    154020
     cagcgtttcc cacacgcgct tgagatttgc cggatcgttt gcgagagcac gccagaaatt    154080
     gttgatgaaa tcggtcttgc gtgtcgccct gatgtcatcg aacacggctt gcacggccgg    154140
     gatggccgcg gcctcttggt ccgacaggag tttgactgtt gccatcgaaa gttcctttcc    154200
     cggcgcttca agcatgattt ttgcgcggcg atcccacaca acggcggaag atacgaagaa    154260
     atgacagtgg ccgccagact tcccgccggt gaggaaatcg aagacggctg tttcaggaaa    154320
     acaggtaaaa atagaaatta ttgtctatag attttatagc ttataaggtt tcatagcccc    154380
     gtcgacttca gcgatgagat ttcgaacgcc caatggatgc atccttgggt gcgtgtgaac    154440
     tgccgacttc ttccaagatc aacaggagat ttccatgagc aatccggttc tcgtcaatca    154500
     gatcattccc gagtccgatg tcatcccgct gaccggccgt gtcggggccg aaatcaaagg    154560
     tgtccgcctt ggcggagacc tttcggatgc aacggtggca gccatcaacc agcttcttct    154620
     gaagcacaag gtgatcttct tccgcgatca gggacatctt gaggattccg aacaggaagc    154680
     cttcgcgcgc cgcctcggcg atctcgtgcc gcatccgacc cagggaccgg tcgccggcac    154740
     ggcttccatc ctcaatctcg attccagccg cggcggcggc cgggcggacc agtggcacac    154800
     tgacgtaacc ttcgtcgacg cctatcccaa attttccgtc ctgcgcggcg tcgtcattcc    154860
     ggcagccggc ggtgacacca tctggtccaa cacccatgcc gcctatgaaa gcctgccggc    154920
     gccgctgaaa ctgctggcgg agaatttgtg ggccattcac agcaacgcct atgactatgc    154980
     cgccgtgcgc cctcgcgcca ccgctgaaga gaagaagcat ttcgaggagg ttttcacctc    155040
     gaccatctac gagaccgaac atccggtcgt gcgtgtccat ccggaaaccg gcgagagatc    155100
     gctgctgctc ggcaatttcg ttcagcgcct tgtcggcctg tcgaagagcg actccgccaa    155160
     actctacgag gtattccaat cctacgtcac tgccccggaa aataccgtgc gctggcgctg    155220
     gagagcagga gatgtggcga tctgggacaa ccgcgccact cagcactatg ccgtcaacga    155280
     ttatggcgac cagcaccgcg ttgtccggcg cgccaccgtc gacggcgacg tccccgtcag    155340
     catcgacggc cgccgcagca taacccacgt caaaactgcc aagccgcagg caaaggcggc    155400
     gtgatcacgg acgcgcggat gtcgcccggc ccatgaagcg accgagcttc atgggctggg    155460
     tgacatccct gcagtggccg gggccgcctt tcgcaagaag tccgcgcctt acgagaagga    155520
     aagcttctcg ctcggccggg tcagcgtttc cgggcgcagc accgcatcca gatgctcctt    155580
     ctgcatcagg ccgcgttcga gaaggatttc atagaccccc cgtcccgaat gatgcgcttc    155640
     cagcgcaacc tcagtggcgt tgcggtagcc gatatagggg ttgagcgccg tgacgatgcc    155700
     gatcgattgc tcgaccgtct gccgcagacg gtcgcggttg gcggtgatgc cttgaatgca    155760
     attcgcctcg agcgtcaggc aggcattggt caggtggctc aggctgcggt agaggctgta    155820
     gaaaatcacc ggctcgaaag cgttcaactg cagctggccg gcctcggcgg ccatggtgat    155880
     cgtcacgtcg ttgccgatca cttcgaaagc gacctggttg acgacctccg ggataacagg    155940
     gttcaccttg ccgggcatga tcgaggagcc ggcctggcgt gccggcagat tgatctcgtt    156000
     gaagcccgcc cgcggccccg aggacagcag ccgcaggtcg ttgcaggtct tggaaagctt    156060
     gaccgccacg cgcttgagaa cacccgaaag ctggacgaag gatccgcaat cctgcgtcgc    156120
     ctccaccagg tcaggtgacg tcaccagatc gacgccgacg atttcggaca ggcgctcgcg    156180
     caccagcgcg gcatagcggg gatgggcggt gatgccggtg ccgatcgccg ttgcgccgag    156240
     attgatctcg cggatcagcg agaccgcttc ggagagccgc gcctcgtcct ccgccagcat    156300
     cagcgcgtag gttccgaatt cctgccccag cgtcatcggc acggcgtcct gcaactgggt    156360
     gcggcccatc ttcaggacgt cggcgaactc gaccgccttg gcctcgaacg cccggcgcag    156420
     gatcgccatg gcgtcaacca ggcggtgaac gccgatccat gcggcaagct tcagcgctgt    156480
     cggatagacg tcgttggtgg attgcgagag attgacgtgc tcgttcggat gcaggtgctg    156540
     gtattcgccg cgaccatacc ccatgatttc gagcgcccgg ttggcaatca cctcattggc    156600
     gttcatgttg gtcgaggttc ccgcaccgcc ctggatcagg tcgacgacga aatggtcgtg    156660
     cagtgcaccg tcgcgaattt cgacgcaggc cgcaatgatc gcatcggcgc gctcctgatc    156720
     cagaaggccg aggctcgcat tggcctgagc cgccgcctgc ttgatcgccg cgagcgacgc    156780
     gatcagatcc gccgattcct tcagcgtctg accggtaatc ggaaaattct cgaccgcgcg    156840
     cagcgtatgc acgccgtaat aggccgtggc cggcacgtcg cgatcgccga tcaggtcgtg    156900
     ctcaacgcgg attgtcgtga tctcggattt cgtcatggca ggagctttcg agtggagcgc    156960
     tgcgggcacg cattgcggcg gcaggctgaa gacgagaatg gctggtgacg cggcagaatg    157020
     gccgcgtccg cagacgtcat cgggcaaggg cggcaaggcg gggatcgtcc ccgtccgcct    157080
     tcgatccgcg cattttgaat ggaaaagaca cgccgcccgt cgtaacaccc atcgtattga    157140
     cacgctgagg atggtggaac ggcgcgagct ggctgcggat ctcaggcgaa ccgatcccga    157200
     gccgttcgag gatctccatc acgacggcgt agagaatttc gagattgccg tcctcgatct    157260
     tgaccgagat gccgagcgca ccgtccgtcc ccaatcgccg ggtttcatcc gaggcccgca    157320
     cgccgatcgc gtagctggca tcggccccga gcttgccgat aacggcgccg ttgaatgcgc    157380
     gcatcagcgc cgtgcagtag cgcccctcgc ccgcgaccat gtcagggtgg tgtgccattg    157440
     catggaagat gcgggccagt gccgccccgc gcgtcgacgg cccctcgccc gccccgtcgc    157500
     catccgctgc cgccgcaagt ttggcataga tgcgggccag gcggtccaga ggaaaggccg    157560
     gggtcggaag attgcatccg tcgatccccc attcgacatc ccggacatcc agatcgcaga    157620
     gttcggcgac agtgcgcttg accctcccct gcatcggatg atccggcagg tggtaacctt    157680
     ccatgcctgc cccgatcgcc cgggcgccgg caagcatgcc gacgtgcttt cccgaacaat    157740
     tgctgcagac ggctgtcggg acaaagtcct gcttgatcca ggagcgattg accgtttccg    157800
     acagcgaggg atggccgccg cagcgaaggt ccgcctcctc ggccttgatc ttcgacagca    157860
     tggttcgcgt gcgcgcgata tgccgctctt cgctgctgtg ggacgcgcac atcagcgcaa    157920
     tgtccgcatc gtcgaagccg taacccgcga aaccctcggt ctccaggatg gcaagcgcct    157980
     gggccggctt ggcggcggag cgggcaagca tcatacgctc gggatttccc agtgcgtaaa    158040
     gccgcctgcc ctttgcatcg acgacagccg cgtggacgcg atgactgttc tcgacgatgc    158100
     cgccacgatc ggtgacgacg aaatcctcac tcggggtcat gtctctctcc attcatgccg    158160
     cgccccggcg gcgacatgcg ccgccggagc aagctcggct atcgagcgat gtcaggccag    158220
     atcgaaaccg ccgcgatcct caccccgttc ggctgcaatc gtgtagatgc gctcgcgcat    158280
     cagcagccag ccaaccacca gggccggaat gatcagagcc agagaggcga ccgtgtaggt    158340
     cccgacggga tagtcgagcg ccatcaggat cacgacgacc gccaggaagc ccagcgtcag    158400
     caagccggta tagggcgcgc cgaacatgcg gaattccggc cgcaccatct tgccctgccg    158460
     cgatagctgc cacagcttga gctggcacag gacgatcacg ccccacgccg cgatgatacc    158520
     aagagcagcg acgttcaggc cgatctcgaa agcttctgcc gggacaaggg cgttcagcac    158580
     gacgccgaag gcggtcacga cagccgtcac cgcaatgccg ccatagggca cgccggatcg    158640
     gttcatcttc gccagcgcag ccggcgccga gccggaaatc gccatggaat gcaggatgcg    158700
     gcctgtggaa tagaggccgg cattgagcga cgacaggacg gcggtcagca cgacgaggtt    158760
     catgacgacg tcagcgccct gaatgccgat cttgccgaag aaggtgacga acgggctctc    158820
     gccgccctta taggcggtat agggcagcag cagcgacagc agcaggaccg agcccacgta    158880
     gaagaccacc agacgcaata cgaccgtgcg gatcgcccgc ggcatgacct tgcgcgcatt    158940
     ttcggtttca ccggcggcgg tgccgatcag ctcgatcgaa gcataggcga aaaccacgcc    159000
     ctgtatcacc accaaggcgg gcaggacgct gttcgggaac atgccgccga aatcggtaat    159060
     cgtgttgagg cccggaacat ggccgtcgat cggcgtgccg gtgaccacga agtagacgcc    159120
     gacgaccagg aagacgacga gggcgaggac cttgaccaga ctgaaccaga attccagttc    159180
     accgaagacc ttcaccgaca gaaggttcat ggcgagaacg aggaccagcg ccgccagcgc    159240
     aaacacccat tgatcgatca ttgcgatcca agggacataa gccttgaaga aattcatgta    159300
     gagggcgacc gcggtgacgt cggcgaccgc cgtcatcgcc caagtcagcc aatagagcca    159360
     gccgaccgcg aaggcgagct tttcaccata aaattcccgg gcataggaga cgaacgagcc    159420
     cgaggtcgga cgatggacga tcaattcgcc gagcgctctc agaacgagga acgcgaaaaa    159480
     gccgcacaag gcatagacca gcacaagtgc cggaccggca gcggcaagcc ggccgccggc    159540
     gccgagaaac agccccgtgc cgatggcgcc gccgatggcg atcatctgga tctgccgcgg    159600
     cttcagcgcc ttgtggtagc cgagatcctc ctcggcaaag acttggcctt cggcctcggt    159660
     cctgttggat tccatgactg tcatttctcc tccctgtggg ttcggcaacc tcccggccgc    159720
     ccctccgcgc agatatgcgt aaagatgtta atctgctatg cggtctgaca ggttttggga    159780
     ttaacgggaa aaatgcgacc cagtcaagga tttttcacac ggtgaggttt agcgttgttc    159840
     tgagccgatg atgcggctaa ccgctgcctc gacctgtttc agatgaattt ccatcgccgc    159900
     ccgggcctcg gcctccgacc ctctgcggat ggcttcgacg atcgcccgat gctcttcgtt    159960
     cgattcctga cgccgcggtc ccaagaccgt cagcagcccg gattgctgcg ccatcgcctc    160020
     gcggacatca tcgacgatgt cgcggaagac ggcgttcttc gatgcctcag cgatcagccc    160080
     atgaaaatcc gaatccagcc tcacccaggc ttcggtatct tcttcctgct ccattcggtc    160140
     gcaaagtccg agcaaccggg acagttcgtc atcgtcccga cgcagcgccg cccaaccggc    160200
     ggcggacacc tcgacgaagg gccgcgcctc catcagatca cgcgccgaat aatcgccgta    160260
     acggatatct ccgccgccag ccgcgagcac ataggttccg cttcccgttc gcgtctccgt    160320
     cagccccaaa atctgcagcg agcgtagcgc ttcccgcacg atcgggcggc tgacgccgta    160380
     ttttgccgcg agcttggctt ccgacggcag cttggaacct tcggcaaacc ggccggatag    160440
     aatgagattg cgcaactcct cgaaaacaag ttccgaggcg ctttttcgac tgaggatcgc    160500
     agagtcggaa agccagtttt ccagatcatt catggtgttg cattcgagcg gcagggcagc    160560
     cggatatggg gtgcaaattg aaaatcatac cttcggcgca gttcgtcttt catcggcaat    160620
     cccgatgatg gaacgcttta cctccagcag gtgctctgcc atggcaacgc gtgcatcctc    160680
     ctcggtgcct gcggcaaccg cctccagaat tcggcggtgc tcggcgttgg aggctttacg    160740
     ccgtccgcga acatgttcca ccagttccga ttgcgtcgac agcgcgccgc gaacatcggc    160800
     gacgactttc ctgaagatcg cattgcccga ggcttcggcg atttctccat gaaacgccgc    160860
     gtccatgcgc acccatgtcc ggacatcctc ctcgtcatcc atccggtcgc acaaggatga    160920
     gagcgaagcc aactgctcct tcgaacgccg caatgccgcc caacccgccg ccggtatttc    160980
     gatacagggg cgcgcctcga tcaggtcgcg ggcggaatag gcgccgccgc cgagttgccg    161040
     cgccgggctc tccgaaacga cgaaagtgcc ccgcccggtc ttggtttgcg tgaaccccag    161100
     cgtctgcagc gagcgaagcg cctcacgcac gatcgcccgg ctgatgccat accgttcggc    161160
     gagctgcact tccgagggaa gacgggtgcc gagagccagt ttccgatcga caatggccgt    161220
     gcggacatct tcgaagaccg cttcagcagc gtttctccgg tgtatctctt gcttctccga    161280
     cagccatgaa cccatatccc gcatccaagg acgatgcggt caatcgcaag agctgtcaag    161340
     caactggaca gatccccaaa ccgggtcggc catacgcccg cacggcatgc gaaactggct    161400
     accagagctt catgtgccgg ttgacgtcct tgtagagcag gtagcggaag cggccgggac    161460
     cgccggcata acaggcctgc gggcaaaagg cccgcagcca catgaagtcg ccggcctcga    161520
     cctcgaccca atcctcgttc aggcgataga ccgcctttcc ctcaagcaca tagagaccat    161580
     gctccatgac atgggtttcc atgaagggga ttacggcgcc cggttccaag gtcacaatgg    161640
     tgacatgcat gtcgtagcgg acgtcggcag gatcgataaa ccgcgtcgtt ccccagcgcc    161700
     cgtccgtgtc gggcattgct gctgcgggat gctcatcctc atgcgtgaca atcgccggcg    161760
     gcggctccag cccctcgacc tcctgaaacg ccttgcggat ccagtggaat atcgccgggg    161820
     ccgatccgtc gtttttcagg cgccagaccg aacccgccgg aagataggcg aaggagccgg    161880
     cgcgcagcgt gtggctgacg ccctcgagtt ccaccgtcat gccgccttcg acgacgaaga    161940
     gcaccgcttc ggcccgcttg tcgggttctg gccgatcgct tccgccgccc ggctgaactt    162000
     ccatcacata ttgcgaaaag gtttcggaga agcccgaaag cggccgggag agaacccatg    162060
     cccgcgttcc cgtccaatgc ggaaggaggc tggtgacgat atcgctcatg acgccgcggg    162120
     ggatgaccgc gtaagccgtg gtgaagacgg ctttgccgga aagcaattgg gtctgcggcg    162180
     gcaggccgcc aagcttcgaa taatactctg tcttgtccat tgatgcggct ttccaggcag    162240
     gtgtcactac atctgcttta tgcgccgtcg gcgcgttagg caactgccat tgggccaagc    162300
     cagcctaccg atcggccatc accagatggc ccggcccgac ttcgcgatag acagtggccg    162360
     gaggctggta gtcgactgat cgcatcgggc tcttgatctc gtcattcgcc accatgcgct    162420
     tctcatgacg gcggtcggga tcgggcaccg gcacggcggc gatgagtttc ttggtgtagg    162480
     ggtgctgcgg attttcgaag acggcggcgc gcgggccgat ctcgacgatc tcgccgagat    162540
     acatcaccgc cacgcggtgg ctgacgcgct cgaccacagc catgtcgtgc gagatgaaca    162600
     ggaaggcgag gttgaggctc tgctgcaggt cgagcatcag gttgatgacc tgcgccttga    162660
     tcgacacgtc gagcgccgat acgctttcat cggcgacgat gaccttcggc tgcagggcaa    162720
     gcgcccgggc aatgcagatg cgctggcgct ggccgccgga aaattcatgc ggataacgcg    162780
     ccgccatatc cggggagaga ccgaccttga ccagcagatc ggcgacgact tccctcgcct    162840
     ctcgcgcgct gcccatcctg tgttcgagat agggttcggc aattgccgca cccaccgtca    162900
     tgcgcgggtt gaggctggcg aaaggatcct ggaagatcat ctgcacggat ttgcgcatct    162960
     cgcgcagatc cttcctgtca aggccaagca cctccctgcc ctcgacgaga acggagccgg    163020
     cctgcggctc gatgagacgc atgatggcgc gccccgtcgt cgatttgccg cagccggatt    163080
     cgccgaccag cgacagcgtc tcgccggcat gcagatcgaa ggagacgttt tcgaccgcgt    163140
     gcacccggct ggtcaaccga ttgaacaggc cggagtggat gtcgaaacgc ttggtgaggt    163200
     tcttcacctc aaggaccggc gtgggcgcaa cggtatcggc ggcctcggcc ggactatccg    163260
     attgccccgt cgccgtgttg accaccggga agcgcagcgg ccgctggcgg ccctgcatcg    163320
     agccgagcac cggcacggcc gatagcaacg ccctggtata agggtgtttg ccgcggtgga    163380
     aaatatcggc ggtgatgccg ctttcgacct gctcgccgcg atacatcacc accgtccgat    163440
     cggcgatctc ggcgacgacg cccatgtcat gggtgatgaa gaggactgag gtcccctcct    163500
     cctcctgcag catcttgatg agatcgagga tctggccctg gatggtcacg tcgagcgccg    163560
     tcgtcggctc gtcggcgatc aagagcttcg gccggctggc aagcgccatg gcgatcatca    163620
     cccgctggcg catgccgccg gaaaaccgat gcggatattc gtcgaagcgc gaggcggctg    163680
     aggggatgcg gactttttcc agcagcctga tcgtctcggc acgggcgtcg gcgcggctca    163740
     tagcggaatg gcagagcagc gcttcggaaa tctgatcgcc gatggtgaag agcggattga    163800
     gcgaggtcat cggctcctgg aagatcatcg ccacctcgtt gccgcgcacc tgccgcatcg    163860
     caggttcggg caaggccagc aggtcgcgcc caccgagcgt gacgcggcct tcgatgcggc    163920
     tcatgtccgc ctgcaacagc cgcatgatcg agagcgaggt gacgctcttg cccgagccgg    163980
     attcaccgac gatcgccacg gtttcaccag gtgcgacggt gaaggagaca tcgcgcacga    164040
     ccggtttcca ggcgccgtcg accagaaagg acgtcgtcag cccttcgacg gaaagaacgg    164100
     tgctggcagt ctcgatcgat tgtgcttgga cgatgcccat gtcggtcggt tcctttgcgg    164160
     ctcaatccgg ccagcgcagc acaccgtcga agcggtgccg gctgcgattt tcgatcgggg    164220
     ttgcgatgat ctcgttggag gcgcgcgcct tgtcgagttc ctcggccagg cggtttgcaa    164280
     cgatgacatc ctggcccgga tgcaggttgc acgggtcgag atagaaatag cggtgctcca    164340
     cctcgtgatc gcgcacgatg atcggcgggt cgcccctcgc cagcgcatca gccagatccc    164400
     aggcggtgat atgcgcctgc tcgggatcga cgatgagacg cagccggtcg agcggattgt    164460
     tggtcggatc gggctcgatc agcgcgctaa cgccgggacg gccgtcgagt gtgcgcttcc    164520
     acagattgag agagctggtc tcgcgctcgc ggatgccggc gtgatcgcgc ttttcccagg    164580
     cttcgagtgc ggccatgacg ccgaagatgc tctccttgcc gaccttcatg ccgcggccga    164640
     tgcccatgtt ctgcaggaag gcatgacgca ccagctcctt ccggccggca acgatgcccg    164700
     aggtcgggcc gccgaggaac ttgtggccgg agtaaagggc gatatcggcc ccctgctcca    164760
     ggaaaatcct gaggtcgtat tccgatgccg catcgacgat gacgggcaca cccctggcat    164820
     gggcgatctc gacgaattcc ttgaggttca gcaggccgta atcgacgaca tggtgggaga    164880
     cgacaaagac ggccgcggcg gtcttgtcgg tgatcgcctt ttccatgtga aagcgatgcg    164940
     tcgaggtcgc ctgtcccaca agcacgacct tgccgccggc aagccggatc gcctggtcga    165000
     cgggggcgcc atagctcacc acatggccca tctgcaccag cacttcgttc ttctcggaca    165060
     cggcatccgg cagcttctcg atcgccagca gattgtcgcc ggtgatggcg ccggcgacgg    165120
     ccagcgaaat gccggccgag caggaagcgg tgacgaagcc ggcctcgccg ccggtcagcc    165180
     gggcgatgac ggcgcttgcc ttgcgctgca ggtcgttgat ctcgacgaaa tgcggcagga    165240
     tcgacgccat cgcctcgatc gcctccggca cgacgatcga agcgccgagg ctggtcatcg    165300
     tgccggatac gttgatgacg gggcgaaggc cgagcgaagg tctgatgtca ttgggcatga    165360
     aggtctccag aagtctcagt cgaggaacgg gccatggtgg acgctgctcc aaatatgaaa    165420
     gctctcgtca gccattcaag gcgacgatcg cctcgatttc gacggtgatg ttgccgggca    165480
     gcgagccgaa gccgacggcc gagcgggcat gttcgccggc cgcgccgaag acggcgatca    165540
     gcagatccga gcagccgttg atgacactcg gatgatcctc gaactccggc acggcattga    165600
     ccatgccgag cagcttgacc acccgcttga cgcgggagag atcgccgagc gcatcatgca    165660
     tgacggcgag cagattgatg ccggtcagcc gcgcatgccg gtaagcctca tcgacaccga    165720
     cattggcgcc gactttgccg gcgtgcagga agccgtcggc ctcgcgcggc ccctggccgg    165780
     agaggtagag catattgccc tccaccacat gcgtcacgaa attggcgatc ggcggcggcg    165840
     gcggcggcag cttgatgccg agggcggcta accgttggta aggcgaattc tcgaccttgc    165900
     cggcggcgtt gggaaactgg ttcacgcaaa ctcctgtcat gcgaattttg atttggaatg    165960
     gccgatttag gtcggcggat taaaggtcct tgcgaagtct tgggtcgagc atgtccctga    166020
     ggccgtcgcc gaccatctgc agcgacagca ccgagagaat gatggcgacg ccgggaaaca    166080
     gcgtcatcca gtcggcctgg ccgatatatt ggcggccggc ggcaatcatc gttccccagg    166140
     tcggaatttc cgggctgacg ccgaggccga ggaaggagag gccggcttcg gcaagcatgg    166200
     cgctggcaaa gaggaaggtg gcctgcacca ggatcggcga cagcagattg cgcagcacat    166260
     gccggatcat gatgtggaag gtggaaatgc cgagcgccct cgccgcctcg acatagggca    166320
     actcgcgaat aaccagcgtc gaggcgcgga cgatacgggc aagccgcggc gcatagacga    166380
     tcgacagggc aatgatcacc gtggtcaagg acgggccgag ggcggcgacg agggcgatcg    166440
     ccagcagaat atccgggaag gccatcatcg catcaatcag ccgggcgatc ggcgtatcga    166500
     gcttctggaa aaagccggcc agaaggccga gcgtcacgcc gatcactgcc gacaggctga    166560
     cgaccgcaac gccgaccaac agcgacaggc ggccggcaaa gatcgtccgc gagaagacgt    166620
     cgcggccaaa ctcgtcggtg ccgaagaaga aggcgccacc tggcggcttc agccggttga    166680
     cgatggaaag cttggagggc gaatagggcg caacgacagg ggcgaagacc gccagcagca    166740
     cgaagatcgc caggatcagc aggccgaagg ccaccgtctt gcgcttcagc aggcggcgga    166800
     cgaatttgct gccttcgctc tcggctgatt tgattgcgat atcggccatc agtagcgcac    166860
     cctcggatcg accagcagat agagcatgtc gatcgcaaaa ttgatcagca cgtagagggc    166920
     ggcgatgacg agcagcgccc cctggatgac gggatagtcg cggcgcagca ccgccgagac    166980
     gacgagattg ccgacgcccg gcaggccgaa aacggtttcg gtgacgacgg cgcctgagat    167040
     cagcaccgcc gccgtcaggc cgagtacggt caggatcggg atcagcgcat tcttcagcgc    167100
     gtgcttgagg atcaccttgc gctcgaccag ccccttggcg cgcgccgtgc ggatataatc    167160
     gtcgccgagc acatcgagca tcgaggcgcg ggtgaagcgc aggatcagcg ccgaggagac    167220
     gatgccgagc gcaaaggccg gcagtgtcag atgatacatg cggtccgcga aggtcgagcc    167280
     ggggccgcca taacccgaga ccgggaagag attgagccgg acggcgaaga actgcatcag    167340
     gatgaggccg agccagaagc ttgggatgct ggcggcaaac atcgccagcg tcgttgccgc    167400
     ctggtcgacg aaggagccgc gccgataggc ggcatagatg ccgatcggca aggcgatgat    167460
     gctggcgatg gcaagcgaaa acagcgtcag gaagaaggtc ggctcggcgc ggtcgagcag    167520
     agccgaggtc accggcatgt tgaggaagat cgactggccg agatcgccct tcagcagctg    167580
     gccgatataa tagagatatt gcaggccgag tgactgatcg agcccgagcc gggcgcggag    167640
     atcggcaata tcctgcggcg tcgcatccgg cccgagcatg acgggggccg ggtcgcccgg    167700
     cgtcactcgc acgatgacga agacgatcgt gacgacgaga aacatcacga cgatcatgcc    167760
     aaagaagcgc tggaggatgt agcggatcat gaatgctggc cttcaagccc ttgcagatgc    167820
     agcagaaaag accggcgccg agccccgcag ggccggcacc ggcggcgatg cttacttctt    167880
     gatcgaagcg ttccagaaat atggccacgg ggccgcatcg acgccttcaa gcttgaccga    167940
     ctttgccgcg acggcgttga aatcgccgat cttcatgaag ggcgcgtctg tatagatagc    168000
     cttctggaca tcggcccaga gtgccacgcg cttcttcggg tcgacctcgg aggtgaaggc    168060
     atcgacggcg gccttgcggg ccggcgtatc ccaccagccg ggcgagctgg tcgagagcga    168120
     gccgatcagc gccggctccg gcaggaaggg gctgtgggtg atgtagatat cccagagctt    168180
     cgggtcggtg cggcgctgcg tcagcgtcgc ccagtccacc acctgcatat cgacggtgaa    168240
     gccggcaagc ttcagatatt cggcggcgac ctgcgccatc ttgtagtgga attcgtactg    168300
     gcggctggtc agaatccgga tcggctcacc gttgtagccg gccttcttgg cggcagcggc    168360
     agccccttcc ggatcggcga cgttataggc gccctcgacg ccggcatccg tcgaccagga    168420
     aaaggtcttc ggatagatgg cgccgtcgag cgcataaaaa tccttgctgc cgaaggcggc    168480
     ggccagcatg tcttccatgc tgagcgcctg gcggatcgcc ttgcgaacct cgacattccc    168540
     ggccacacct tccttggtat tgaagacgaa gaccgggtag ccgaagggct tcaacatgac    168600
     cggctgcgag gcgttggaag ctttcagctt gtcgtaggat tcgaccgcga tcgagtcgac    168660
     ataatcatac tggcctgaga tggcggcctc gacgcgggtg ttcggatccg gcaccggcac    168720
     gaagcggatt tcatcgagat attgatggcg ggcgccgcca tacccattgc tgtcgccttc    168780
     gcgggacttg tagccgtcga agcggacgag ctggatatat tggtcggcct tgcgctcctt    168840
     cagcatatag ggaccggtgc cgatgaagtc cttcatcggc tcgtcctgct tttcggcagg    168900
     gatgatgatt gccgccgaat tgttgaaggc aagcagcgag gtcagcggcg catagggctg    168960
     cttcagcgtg atggtcactg tcgaggcatc agcggcggta atcttgtcga tgaagccggc    169020
     cacctgcttg ccgcgcgagg cgatcttcat ccagcggcca agcgaggcga cgacatcgtc    169080
     cgaggtcatg tcgctattgt cgtggaactt gatgccggtc ctgagcttga tcgtataggt    169140
     tttgccgtcg gcgctgatct caggcaggct ttcggccagc agcggtgtga cgttccagct    169200
     cttgtcgaaa gtgtagaggg tttcgaaaat atgctgcgtg acgatgccga cgagatcggc    169260
     cgtcgacgac atcggatcga gcgtcggcgg ctcgccgatc gtcgcgacat tgatgacgcc    169320
     gcccttttcc tgggcgagca aggtcgaagg cagggcgacg agcgcggtgc cgagcaggaa    169380
     tgcgacaagt gttttcatgt gaaggctccc gtttagttcc acaattatgt aattcatctt    169440
     tttgtaacag aataagagat gaagcgatgg tgtcaagcgg aagccgcgga ttatatcgtg    169500
     ggacgagggt cagaacgtcg ggaagcgcgc tcccactggc cgcctgcgcc agggttgcgc    169560
     attatatcag ggtggagaat caaccgcgcc ggggcttcag cagagggagg gtggaatgaa    169620
     catcgacttc aacgacggaa aatggctgaa cgaaccggcc agctggcaag ctgacgcaac    169680
     cggcctcacg ataacgaccg acgagaaaac cgatttctgg cgcgagaccc attacggctt    169740
     cacccgcgac agcggccact tcctcgcctt tcccacgacc gagagcttca ccgcccagat    169800
     ccgcatccag ggcgaattcc gcaccctcta cgaccaagcc ggcctgatgg tgcgcctcga    169860
     cgaaagccgc tgggtcaaaa ccggcgtcga attcaccgac gacgaagcct tcctcagcac    169920
     cgtcatcacc gacggccggt ccgactggtc ggtgtcgcaa cccttcaagg agctggagga    169980
     cttccgcatc cgcgtcaccg tcgcaaacgg tgccctgcgc atccaggcct cccgcgacgg    170040
     ccgccgctgg ccgctgctgc gcctagcgcc cttccccgcg gctggccact acgaggtcgg    170100
     gcctgcggcc tgcacgccgg agcggagtgg gttgatggtg cggttttcgg agttttcgat    170160
     cgggccggcg attacgacag atctgcatga tttgagttag cggcaacgtg acctgccact    170220
     gaacttgtga gcaaccggcg gaaacgcgaa gctttcatct cgcgcagcgt tggagccggt    170280
     tgcggcgatg aacccggcat agtctgccgg ggtctggtat ccgagcgatg agtgcggccg    170340
     gaaatggtta tagtcatccg cccactcggc aatggcactg cgggcatggt cgagaccgaa    170400
     gaacaggctc tcgttgagca gttcgtcgcg cattcgacca ttgaaactct caacatagcc    170460
     gttttgcatt ggctttcccg gcgcgatgta atgccactcg accttgtgat ccttcgacca    170520
     ggcaaggatg gtattcgatg tgagttcggt gccgttgtcg gagacaatca ttccgggctt    170580
     gccgcgccgc tcgatcagcg tcgtcaacgc agcccgcata aacccaggca cacggctcac    170640
     aggtcagggt catccttgca agctccagtc atcaggcatt tggagccgat tgatgtttta    170700
     tggggcaatt gcccgaggac ctcgcacgtc cacatgtgtt ttgcgaaatt ggaatcaact    170760
     tctgtgccgt caatcatgac cgttccgcct ctgacaatgg gctggaaccg cccgtctcca    170820
     atcgcaatgg cgattgctct gatcaacaca ttcgcggttt ggcatggccg catggccagc    170880
     gcaatcttcc gctgctcagc ctctccaagc tcccccacgc ccgccagctc agaaagcaga    170940
     ggcccatcct cgtcttggat ttgtttgcta agcgcattca gacccggcca atcggccttc    171000
     tcaaccagcc cggccagttt gattgccaat tgctgagcgc cgctgccgtc gttgaaccgt    171060
     tcgagtgtag atatcatctg cgtcgaatcc gtagcgaacg caggcgccgg caacgtaacg    171120
     accgcacaga aagcggcgac caatttattt cgaaacatcc aaggtgcctc ctgctgcatt    171180
     ctacactggc aacgcctact acaattttta gttgctcaag gccgagaacg tctatttggt    171240
     aagcagtgct ctctggggta ccgctccact ggcccgaccg tttccggaat tgcatctaaa    171300
     ggactctgag agtttaaagc ccgcagcgct cgcacacgga ccaatctgca tgaagtaaaa    171360
     gcgcgctcat tcattctctc cgcgggcagt cacgagcggc aaagaattta gaatctcgtc    171420
     taacgcacgc atgacgcgat taacttcttc gagcctggct ccgattcgtg tctcaaactc    171480
     gaagatttca atcccgttgc aaatctcgtt taaggccgca tacaaaatat gcagctcttc    171540
     cagatttgcg gccaccatga gattggcgcc tctatcgacc gatattaatt tcatggctcc    171600
     acctcaggga tatcgaagca tgctttttgc atcacgaaag caatccgtca cgtcgaccac    171660
     aggctcccgc tcggtgcctc aatttctcag caaccgtttt acccgagcag ggaaaatcaa    171720
     tgtcaatcct atcagcgtta cgacagccgt tacaaaaagg cttctgcctg acactaccag    171780
     caacgtggga tcagcaggca agattgagaa gtaaccaacc ttatgcagac tgaggatgac    171840
     tgcccaagtt tttagacttt ccgcaagcac cgaaagggga agaagaaata tcaacgcgat    171900
     aacggccaat ttcaaacctc gcgcagtatt tatcggttgt gtcgtacctt tgacataaat    171960
     agctgcaagc ggaagcgccg cgaagatgat gtctccagga tggagatgga gggctgtatt    172020
     aataaatttt tcgaacccaa taaagggaag agctgctatt ataaatgatg taaaaatcca    172080
     tattgccatg cttaaactga caaacacccc tacaattctt aaatctttca tttctaaaca    172140
     cctcctgcga aagattgaat tactgtatgc aaaacctgac tgcggcctag ttccgaaccg    172200
     atattttggt gaaggtcagg ctcttaccgc gggcggcctc ttccgaatga tcactactca    172260
     tggccccctc ttcggtgaga ctcagttgat gtcgcgttgg gcagggagga agctttgaac    172320
     gagttcctca tctagaaccc gactaggcga aagtccgatc tgttaggaca tttcgatgag    172380
     cggtatttct ccgacaaaat ccaagatcga catcggcgcc gccgcgtaga gattaaaccc    172440
     ttctggaccg atctgatgac tggcagcggc caaaatctcc cttcatgcgc ccccaccgcc    172500
     tggcaaaagt agtccatcat gccaatcgca agtcccgcgt attgctttca attcctgggc    172560
     agtcgttatc cgagcgagga aaatcaacgt cagtcccaac gacagctgtt acaaaaaggc    172620
     ttctgccctg aatggacgag tgaaggtgag actgggggag tgccacaatc ctagattaga    172680
     ttgggtcatg ctcggcacgt cgaggcagga tatgcggaag ttttttgttc tcatcgtacg    172740
     acctaactac gagaggcctg aacggctcgt atcgtaccgc gggtcggcct cgagcagatc    172800
     gaataacggc ctccagagat gcccatagat caaaaatgat tcttcctcgc gcgctttatc    172860
     ataggcacgc tccgctgccc tcacgaaggc attaaaccct aatttccctt gtctgttcag    172920
     aactataaat ggcatccctt gatcatctaa ggtttcatat atttccctct tgaatatttc    172980
     atcctctaca tgaaattcat ttcggattct ctcgattaaa tagtacatcc cgaacgaatt    173040
     cagaggaata ccaaccttgt cagatattaa aattgatcct gccattttta cctcatgagg    173100
     atgattttgc ttttctgaga aacaggcaga ctatcaacca aattcagcaa catttcctga    173160
     tttttctgcg taaggaagcg catatctaaa ggcactaagt ctgccttatc gatgtgtagc    173220
     tgaaggtttt cagtgaatgc cgaaagattc ttctcaaaga actgattggc cattccagct    173280
     tgccgcacat tatttggggt gagcatgaag tccacagttt ttccggcata aggtccagat    173340
     tgaaatacaa aatcggcgct gcctccctct gccctaccta aagtgccacc gagataattt    173400
     tccagttccg ctgcggcgct cgcttcgcca ggctgtatct ttcctgtagc cggatccaca    173460
     acattaagac gtttaaacgc atcaaaatca accgagccgc gagcaataat tgtcgtagga    173520
     ctatcgctgg aaagggtaat gacacgagca gtcgccgtcg gcgctggggg aagcgtagca    173580
     cgtaaggctt gaagaccatc ttccgtcagc tggacgggtt tcccagtcgc ttggtcgagc    173640
     acaccgatta tctgatcacc tttccgcaga ataagttgac cagaagcaac ggcaaagctg    173700
     atgccatagc tggctccgcc aacggcttcg ccaaaggcgg catctgccac catcaatccc    173760
     atttcataga aacagacgct gctgcgtgca caagctacag ctgccgagaa tgcgctaggc    173820
     gccaagtaaa tggctgcagc cccggctcca atgccagcac ctaaaccaag accatttagc    173880
     gtgatctgca tatcctgggc gtcgcgatca ccgatggttt cactgagcga ctgacgtaac    173940
     tggtaaatct cccaagcttc agcagccatc tggttgggat cgatgccccg ctcacgaaga    174000
     tacgcattat atgcgtcctg gtcactatag cccgcatgtg ccgctgcata gctgattgcg    174060
     gccctgtatg tgtcctgcaa ggcactcagg cacatcaagc gaccaccgta ggcgcacgca    174120
     tactgcacct gcgcgtcgcg caattcgtcg agcgcgtcgt atcggctaat ctcctgctgc    174180
     agattcgcca cttcagcctg actgcaggat tgtggtttgg ttttgcaggc cgcgaggttg    174240
     ctctcagcct tcaatttggc tgctttctca tcgtgataga ggtagttgta ctgatagttc    174300
     gctgcgccat acccagcacc ttcagcacca cccacagctt cgcccacggc agttgctagg    174360
     cttgcgccga tcaacttagc gagtgcgtca ccctctgcag ttccctcata cttagtgccc    174420
     ttgagcatac ccttgacgag tttggctatt gccggcgcca tcaaggtcgt cgcagcaccg    174480
     cccagagccg ctttaatcgc gccttcccag ccattgacgc caccaagaat accgccaccg    174540
     atggcatgca acagcgcccg gcctgcccct ccctccttcc acaagtcgcg ttcggcttgg    174600
     gtcgtcgact gcttgtacaa ctcagacgca atatcgccca ccaatgtcgc catcgtcttt    174660
     tgagcagcct gcagatcggc ctgcgtcttg tactggtcac gcaaaatgtt ttgcagatcc    174720
     ggcaggcccg gcagcgacgt gtttgtattg tcggtgtcgc gacggatcgt cccaatatct    174780
     tgcgtctggt gctcgggatc ggtgatggcg atgccgatat tgccgccgat ggccgaatag    174840
     gccttgccgg tttcgctctc tccgtcgttg acctttgcaa ggcttaagcc gccggagccg    174900
     atcgaggcgc cgtaggtgtc ggccttccaa cgcgaatggg tgtcgacgtc ggtgacttcg    174960
     agcgtgccgg tttcgagatg attcagcgcc tctgaagctt ggctggtgag caggccacct    175020
     acaagcgttg tcttcttgtc gacggtcagg tcgaggccgc cggtaccggc acggatgccc    175080
     gactgctcgg agacgatggc agcatcgccc gtcgccttct gcgtcgagcc ggaagcgctg    175140
     aaaccatctg tgccgatcga gccggagagg ttgagctggt gggcctcggc agttgccgta    175200
     tccaccagac tttggaccgt cagattgcgg acagcagcgg tcaccgagtt gccggtgaca    175260
     gtggcgcctc tcagagtgag gtcgttggtg agaatggtga tgtcgccggt gccattgaca    175320
     tgggtattgt aattcgtcag ccccgtcgtg ccgtcattac ccttgccgta ggaaccgctg    175380
     acactgaccc cgggcacaca tttcgacttc gtgccgcact cccacttgac gccgacgccg    175440
     aagctatagg acgagttctt gcttgacgta tctgaggtgc cggtcgccgc actgaggttg    175500
     atattgccct tgtccgccga caggaatatg tcgccggcga gaggatcatc ggagatggtc    175560
     ggcagaccga acttgtcgta gccagcggca atctgcgcgc cgtcgctggt gatcgagccg    175620
     ttttcagcct ccaaggtgat cgagcggccg gcgcggatgt cggtgacgac gggtgtcgac    175680
     gatgacgagg acgagctgtt ttcctgatgg ttgacgccgg ccgtcagcga cactgagaag    175740
     ctgagccctt ccgctgtggg cgacgtgtcc gtcagttgct tataggcttc cttcagaccc    175800
     ttgtagccct gatagaagcc aagaccggca atggcggtgt tggtgaccgc gttgacgcgg    175860
     gtatcgccag caaggcgctc agccgagttc atgatgctgc tggcggcttg gctgacctga    175920
     cttgagacgc tgagcgtcac gccggcaaag gtcttctcgt gaatctcctc gtagttggtc    175980
     ttatcggcgg ccgacagcag attgatgtcg ttggtcgcaa acagattgac gtcgcgctcg    176040
     gccgaagctt gtgctgcctg caggttgaga ttgttgccgg cggagatgtt gaggtcgcgg    176100
     ccggcagaca gcgtcgacgc cgcattggtg tcggactgct gcgcggagct gtccttactc    176160
     ctttgcgcgc cgatgcctat ggagatgccg ccattgccgg cagagaagga caggccgaag    176220
     ccggacttct tctcctgctc ggactgggag aagctttccg cgccgggcgt tacgttgacg    176280
     tcgcgggccg ccgacaggtt gatgtcgcgt tcggcatcga ccgaggaacc cataatattg    176340
     agatcggtcg ccttcgccgt caggttgacg tcctcgccag cggaaagcgc tgagccgaca    176400
     ttgagggtcg aggcctgggc gcccttgttc tgctggctgc cataaatcga aatgaatccg    176460
     ccaccgccgc cgatgccgaa gccggacttc ttgcgctgct cttcgagctc gtgcgtttcc    176520
     tgcgccccga cgacggagac gctgtcgccg gagatgttga tggagccgtc ggcatcagcc    176580
     ttcgagccgg cgatcactgc cgcgccgccg gcgctcagat tgatattgcc ggatgcgccg    176640
     agttcggagg cgacggtcgt ttcgtcatag cttttgtggc tggaggagcc tttggacagg    176700
     aagccgctgc gcgacccctt gtcatccttg gctgtggtgt ccttgcccga tgcgatgacg    176760
     aggtcgccgc cggtggtgat gttcaggctg gccggagtgg tgccgccttc cttgccggct    176820
     tcgatcttcg aggcggagat gaccgtatcc ttgccggatt caatatcgac gccgccaccc    176880
     cctgtgatgg cggagccgac ggccgtcgtc gtttccagat gcgtggtcgt cttctcgctc    176940
     gtgccgagga aaccgccctt gctgctgagc ttggtatcga gggtcgcggt gtcggtggct    177000
     tcggcgatcg tcacgtcgcc gtcggccttg agagcgacct tgccgtcggc ggcaagcttg    177060
     ctgccgacaa tgttgagatc gtgatcgccg ctgccgttgc ccgctttcac cgagaggtcg    177120
     ccgccggctg cgatctcgga gccgacatgg gtgatcgacg aggcggactt cttgccgaag    177180
     gtggatgccg attgctcctg ggcggcagtg atattgatat cgtcgccggc gctcagcgcg    177240
     atattgccac cggccttgac ggaggagccg gagagcagga tgtcgtcgcc ggccgtgatc    177300
     gttgcgttcg tgcctgatga aagctgcgat tgctgctggt cggtggaaag cgtcctggtg    177360
     tagccggact ggttgttgcg ggcgacgtct gtcgagacga cggccacaga gccattgtcg    177420
     gcggtcacat caagcgtcgt tcccgccttg gcggaactgc caatgatgtt gacattgtcg    177480
     gttgccttga tcgtcagggc tccgccgctg gcgacctggg tgccggtggc gttctgctgc    177540
     ccgccgttat cgaccttcgc cgctgcgagc gtgacattgg tgccggagag ctgggcggag    177600
     ccgccggcgt tcaccttgac gcctttgagg gcgagatcgc cgctgccgcc ggcaagctgc    177660
     acgttgcccg atgccgtcac accggcattg gtgttgacca tgttctggcc gccgatcgtc    177720
     atggtctggg cggccagcgt aataccattg gtggcgttga gcaccgtgtc gccgcgcgac    177780
     aggaacgttc cgctgccctg aatggtcttg ccggcgatgg taagcccgcc attggacgcg    177840
     atcaggccgg aattggcgag atcgtcgaca ttcatgtcga ccgagccgcc cgccatgacg    177900
     gcgccggcgc cggtcagttt ctgccggtcg gcggccgcga cgtagacgac aggcgcaagc    177960
     acctggacgc cgttgacggt ttgcatctgg tagaggacga tcgactcggt gagcgccgcc    178020
     gcctgctccg gcgtgaggcc ctggccgacg gccaggccgt gatccttcgc ataggtcacg    178080
     ccgttgtcga gcagcgtctt catctgctca atcgcgctgt tgccggcaat gaaggtgctt    178140
     ctgccgaggc cttcgccgac gagttggcgc agctgcgtgt cgatcagctg gttctcgaaa    178200
     taggcatcgc ccaggaacgg aaccgtcgtc tccggctgat aaccgatctt gcccatgaaa    178260
     taggcggagc cgtagaaggt gccgacgtca agaaacttgg cgcgggtttc gaacaggaat    178320
     gtctgtcccg ggatcgggtc gccgaaaccg cccgagcgcg gattggttga ggcgacaagg    178380
     gtggtgccga ggcccgagtt gacgttgaag agggtgccgc cggccgtcag gccggagagc    178440
     gccgacaacg gatcgccggg attgcttgcg gcggcgacgc tggcgccgcc ggccatcgag    178500
     ccggctgccg acgtgttgtt gacgctgccg aaatcgacgg agagcgcgcc gtgcgccttg    178560
     atgttggccg atacgccgcc gattgcctgg acggagctca cgatcgtcgt gccgttggcg    178620
     atgttcttcg agggattggc gtggccgctg gcatcataag cggtgcaggc gccctgggcg    178680
     ctgcaggtcg tcgtcgtcgt gcggaagagg gtgacgccgg tgttggtcag cgtcgagccc    178740
     ttcagcgtcg cgtcgccgcc ggcctcgatc gagctgtagg aattggtgag attggtggcg    178800
     tcgatggtga ggttgcggct tgcccggatc gtcgcttcgg ggctgagcgt gccgatcagc    178860
     cgatcctcgt agaccgactg gctgagatgg gacgaccaat cccatgaata ggtggtgctt    178920
     tcgtccgagc cgctgaaatt cacctcgtcg acgatgaaat agcgcgacgg attgttggga    178980
     tcggcaaccg gattgccgtt cgcatcccgc ggcacgcggg ccctgatcca gtcgatgatc    179040
     ggcgtgacct tctccggccc gtcggccgag atccaggtcc atgcgcgata ggtcgtgccg    179100
     tcggcaagcg tcgccttcga ccagagcagc ggctcataat cctgccacaa ccccggatcg    179160
     acgccggcat agagctggaa catgttttga tctgcggtct cgagatagcc gaaaggcagg    179220
     ccggcggcgg cgggattgag cgtgaatccg gtcaggacgc cggaggaaat cagcgtcccg    179280
     gtcgtccatt gcggcgtggc ggcccgcttg ttggtcagct cgctggtgag gatggacatg    179340
     tcgtttccag cctggatcag gccggaaata ttggtgacac cagtgtttct cagtcccgat    179400
     gccgtcccgg cgatctcaag gtcgttgccg gataggatgg cgccctggtt gttggtgagc    179460
     accccgccga tgaagaggct cgcgtcgtgg ccggcatagg caaggcccgt ggcgttgttg    179520
     gtgaaattgc cggaaatctt gagcgtcaga gcatctttgg ccgccaattg cccggcattg    179580
     gtcagcgaca gcagcgtcag cgtcaaatcg tcggcggcga gcagcgcggt gctggccgag    179640
     gtggagaggc cgtcggcatt gatggcgatg tcgccggagc cgccggcacc ggtgacggcg    179700
     ttgatggtgg cgccgctgag atcggccgag ccggagagat tgagggcgag gccgccgagc    179760
     gtgaggctgt tgttgctgag attggcgcta tcggcgttga