(data stored in SCRATCH3701 zone)

EMBL: CP001213

ID   CP001213; SV 1; circular; genomic DNA; STD; PRO; 1933695 BP.
XX
AC   CP001213;
XX
PR   Project:PRJNA19423;
XX
DT   10-JAN-2009 (Rel. 98, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 5)
XX
DE   Bifidobacterium animalis subsp. lactis AD011, complete genome.
XX
KW   .
XX
OS   Bifidobacterium animalis subsp. lactis AD011
OC   Bacteria; Actinobacteria; Bifidobacteriales; Bifidobacteriaceae;
OC   Bifidobacterium.
XX
RN   [1]
RC   Erratum:[J Bacteriol. 2009 Mar;191(6):1995]
RP   1-1933695
RX   DOI; 10.1128/JB.01515-08.
RX   PUBMED; 19011029.
RA   Kim J.F., Jeong H., Yu D.S., Choi S.H., Hur C.G., Park M.S., Yoon S.H.,
RA   Kim D.W., Ji G.E., Park H.S., Oh T.K.;
RT   "Genome sequence of the probiotic bacterium Bifidobacterium animalis subsp.
RT   lactis AD011";
RL   J. Bacteriol. 191(2):678-679(2009).
XX
RN   [2]
RP   1-1933695
RA   Kim J.F., Jeong H., Choi S.-H., Yu D.S., Park M.-S., Yoon S.H., Kim D.-W.,
RA   Hur C.-G., Ji G.E., Park H.-S., Oh T.K.;
RT   ;
RL   Submitted (21-OCT-2008) to the INSDC.
RL   Systems Microbiology Research Center, Korea Research Institute of
RL   Bioscience and Biotechnology (KRIBB), 111 Gwahangno, Yuseong, Daejeon
RL   305-806, Republic of Korea
XX
DR   MD5; a3f60c1f4f38405ab17786c842b5c4d1.
DR   BioSample; SAMN02603485.
DR   EnsemblGenomes-Gn; BLA_r0001.
DR   EnsemblGenomes-Gn; BLA_r0002.
DR   EnsemblGenomes-Gn; BLA_r0003.
DR   EnsemblGenomes-Gn; BLA_r0004.
DR   EnsemblGenomes-Gn; BLA_r0005.
DR   EnsemblGenomes-Gn; BLA_r0006.
DR   EnsemblGenomes-Gn; BLA_r0007.
DR   EnsemblGenomes-Gn; BLA_t0001.
DR   EnsemblGenomes-Gn; BLA_t0002.
DR   EnsemblGenomes-Gn; BLA_t0003.
DR   EnsemblGenomes-Gn; BLA_t0004.
DR   EnsemblGenomes-Gn; BLA_t0005.
DR   EnsemblGenomes-Gn; BLA_t0006.
DR   EnsemblGenomes-Gn; BLA_t0007.
DR   EnsemblGenomes-Gn; BLA_t0008.
DR   EnsemblGenomes-Gn; BLA_t0009.
DR   EnsemblGenomes-Gn; BLA_t0010.
DR   EnsemblGenomes-Gn; BLA_t0011.
DR   EnsemblGenomes-Gn; BLA_t0012.
DR   EnsemblGenomes-Gn; BLA_t0013.
DR   EnsemblGenomes-Gn; BLA_t0014.
DR   EnsemblGenomes-Gn; BLA_t0015.
DR   EnsemblGenomes-Gn; BLA_t0016.
DR   EnsemblGenomes-Gn; BLA_t0017.
DR   EnsemblGenomes-Gn; BLA_t0018.
DR   EnsemblGenomes-Gn; BLA_t0019.
DR   EnsemblGenomes-Gn; BLA_t0020.
DR   EnsemblGenomes-Gn; BLA_t0021.
DR   EnsemblGenomes-Gn; BLA_t0022.
DR   EnsemblGenomes-Gn; BLA_t0023.
DR   EnsemblGenomes-Gn; BLA_t0024.
DR   EnsemblGenomes-Gn; BLA_t0025.
DR   EnsemblGenomes-Gn; BLA_t0026.
DR   EnsemblGenomes-Gn; BLA_t0027.
DR   EnsemblGenomes-Gn; BLA_t0028.
DR   EnsemblGenomes-Gn; BLA_t0029.
DR   EnsemblGenomes-Gn; BLA_t0030.
DR   EnsemblGenomes-Gn; BLA_t0031.
DR   EnsemblGenomes-Gn; BLA_t0032.
DR   EnsemblGenomes-Gn; BLA_t0033.
DR   EnsemblGenomes-Gn; BLA_t0034.
DR   EnsemblGenomes-Gn; BLA_t0035.
DR   EnsemblGenomes-Gn; BLA_t0036.
DR   EnsemblGenomes-Gn; BLA_t0037.
DR   EnsemblGenomes-Gn; BLA_t0038.
DR   EnsemblGenomes-Gn; BLA_t0039.
DR   EnsemblGenomes-Gn; BLA_t0040.
DR   EnsemblGenomes-Gn; BLA_t0041.
DR   EnsemblGenomes-Gn; BLA_t0042.
DR   EnsemblGenomes-Gn; BLA_t0043.
DR   EnsemblGenomes-Gn; BLA_t0044.
DR   EnsemblGenomes-Gn; BLA_t0045.
DR   EnsemblGenomes-Gn; BLA_t0046.
DR   EnsemblGenomes-Gn; BLA_t0047.
DR   EnsemblGenomes-Gn; BLA_t0048.
DR   EnsemblGenomes-Gn; BLA_t0049.
DR   EnsemblGenomes-Gn; BLA_t0050.
DR   EnsemblGenomes-Gn; BLA_t0051.
DR   EnsemblGenomes-Gn; BLA_t0052.
DR   EnsemblGenomes-Gn; EBG00000997081.
DR   EnsemblGenomes-Gn; EBG00000997083.
DR   EnsemblGenomes-Gn; EBG00000997085.
DR   EnsemblGenomes-Gn; EBG00000997086.
DR   EnsemblGenomes-Gn; EBG00000997087.
DR   EnsemblGenomes-Gn; EBG00000997088.
DR   EnsemblGenomes-Gn; EBG00000997089.
DR   EnsemblGenomes-Gn; EBG00000997091.
DR   EnsemblGenomes-Gn; EBG00000997093.
DR   EnsemblGenomes-Gn; EBG00000997095.
DR   EnsemblGenomes-Gn; EBG00000997096.
DR   EnsemblGenomes-Gn; EBG00000997097.
DR   EnsemblGenomes-Gn; EBG00000997098.
DR   EnsemblGenomes-Gn; EBG00000997100.
DR   EnsemblGenomes-Gn; EBG00000997102.
DR   EnsemblGenomes-Gn; EBG00000997104.
DR   EnsemblGenomes-Gn; EBG00000997106.
DR   EnsemblGenomes-Gn; EBG00000997107.
DR   EnsemblGenomes-Gn; EBG00000997109.
DR   EnsemblGenomes-Gn; EBG00000997111.
DR   EnsemblGenomes-Gn; EBG00000997114.
DR   EnsemblGenomes-Gn; EBG00000997116.
DR   EnsemblGenomes-Gn; EBG00000997118.
DR   EnsemblGenomes-Gn; EBG00000997122.
DR   EnsemblGenomes-Gn; EBG00000997123.
DR   EnsemblGenomes-Gn; EBG00000997124.
DR   EnsemblGenomes-Gn; EBG00000997125.
DR   EnsemblGenomes-Gn; EBG00000997130.
DR   EnsemblGenomes-Gn; EBG00000997132.
DR   EnsemblGenomes-Gn; EBG00000997135.
DR   EnsemblGenomes-Gn; EBG00000997137.
DR   EnsemblGenomes-Gn; EBG00000997139.
DR   EnsemblGenomes-Gn; EBG00000997141.
DR   EnsemblGenomes-Gn; EBG00000997142.
DR   EnsemblGenomes-Gn; EBG00000997143.
DR   EnsemblGenomes-Gn; EBG00000997145.
DR   EnsemblGenomes-Gn; EBG00000997147.
DR   EnsemblGenomes-Gn; EBG00000997149.
DR   EnsemblGenomes-Gn; EBG00000997151.
DR   EnsemblGenomes-Gn; EBG00000997152.
DR   EnsemblGenomes-Gn; EBG00000997154.
DR   EnsemblGenomes-Gn; EBG00000997155.
DR   EnsemblGenomes-Gn; EBG00000997156.
DR   EnsemblGenomes-Gn; EBG00000997157.
DR   EnsemblGenomes-Gn; EBG00000997158.
DR   EnsemblGenomes-Gn; EBG00000997159.
DR   EnsemblGenomes-Gn; EBG00000997160.
DR   EnsemblGenomes-Gn; EBG00000997161.
DR   EnsemblGenomes-Gn; EBG00000997163.
DR   EnsemblGenomes-Gn; EBG00000997164.
DR   EnsemblGenomes-Gn; EBG00000997165.
DR   EnsemblGenomes-Gn; EBG00000997166.
DR   EnsemblGenomes-Gn; EBG00000997167.
DR   EnsemblGenomes-Gn; EBG00000997168.
DR   EnsemblGenomes-Gn; EBG00000997169.
DR   EnsemblGenomes-Gn; EBG00000997170.
DR   EnsemblGenomes-Gn; EBG00000997171.
DR   EnsemblGenomes-Gn; EBG00000997173.
DR   EnsemblGenomes-Gn; EBG00000997174.
DR   EnsemblGenomes-Gn; EBG00000997175.
DR   EnsemblGenomes-Gn; EBG00000997176.
DR   EnsemblGenomes-Gn; EBG00000997177.
DR   EnsemblGenomes-Gn; EBG00000997179.
DR   EnsemblGenomes-Gn; EBG00000997181.
DR   EnsemblGenomes-Gn; EBG00000997183.
DR   EnsemblGenomes-Gn; EBG00000997185.
DR   EnsemblGenomes-Gn; EBG00000997187.
DR   EnsemblGenomes-Gn; EBG00000997189.
DR   EnsemblGenomes-Tr; BLA_r0001-1.
DR   EnsemblGenomes-Tr; BLA_r0002-1.
DR   EnsemblGenomes-Tr; BLA_r0003-1.
DR   EnsemblGenomes-Tr; BLA_r0004-1.
DR   EnsemblGenomes-Tr; BLA_r0005-1.
DR   EnsemblGenomes-Tr; BLA_r0006-1.
DR   EnsemblGenomes-Tr; BLA_r0007-1.
DR   EnsemblGenomes-Tr; BLA_t0001-1.
DR   EnsemblGenomes-Tr; BLA_t0002-1.
DR   EnsemblGenomes-Tr; BLA_t0003-1.
DR   EnsemblGenomes-Tr; BLA_t0004-1.
DR   EnsemblGenomes-Tr; BLA_t0005-1.
DR   EnsemblGenomes-Tr; BLA_t0006-1.
DR   EnsemblGenomes-Tr; BLA_t0007-1.
DR   EnsemblGenomes-Tr; BLA_t0008-1.
DR   EnsemblGenomes-Tr; BLA_t0009-1.
DR   EnsemblGenomes-Tr; BLA_t0010-1.
DR   EnsemblGenomes-Tr; BLA_t0011-1.
DR   EnsemblGenomes-Tr; BLA_t0012-1.
DR   EnsemblGenomes-Tr; BLA_t0013-1.
DR   EnsemblGenomes-Tr; BLA_t0014-1.
DR   EnsemblGenomes-Tr; BLA_t0015-1.
DR   EnsemblGenomes-Tr; BLA_t0016-1.
DR   EnsemblGenomes-Tr; BLA_t0017-1.
DR   EnsemblGenomes-Tr; BLA_t0018-1.
DR   EnsemblGenomes-Tr; BLA_t0019-1.
DR   EnsemblGenomes-Tr; BLA_t0020-1.
DR   EnsemblGenomes-Tr; BLA_t0021-1.
DR   EnsemblGenomes-Tr; BLA_t0022-1.
DR   EnsemblGenomes-Tr; BLA_t0023-1.
DR   EnsemblGenomes-Tr; BLA_t0024-1.
DR   EnsemblGenomes-Tr; BLA_t0025-1.
DR   EnsemblGenomes-Tr; BLA_t0026-1.
DR   EnsemblGenomes-Tr; BLA_t0027-1.
DR   EnsemblGenomes-Tr; BLA_t0028-1.
DR   EnsemblGenomes-Tr; BLA_t0029-1.
DR   EnsemblGenomes-Tr; BLA_t0030-1.
DR   EnsemblGenomes-Tr; BLA_t0031-1.
DR   EnsemblGenomes-Tr; BLA_t0032-1.
DR   EnsemblGenomes-Tr; BLA_t0033-1.
DR   EnsemblGenomes-Tr; BLA_t0034-1.
DR   EnsemblGenomes-Tr; BLA_t0035-1.
DR   EnsemblGenomes-Tr; BLA_t0036-1.
DR   EnsemblGenomes-Tr; BLA_t0037-1.
DR   EnsemblGenomes-Tr; BLA_t0038-1.
DR   EnsemblGenomes-Tr; BLA_t0039-1.
DR   EnsemblGenomes-Tr; BLA_t0040-1.
DR   EnsemblGenomes-Tr; BLA_t0041-1.
DR   EnsemblGenomes-Tr; BLA_t0042-1.
DR   EnsemblGenomes-Tr; BLA_t0043-1.
DR   EnsemblGenomes-Tr; BLA_t0044-1.
DR   EnsemblGenomes-Tr; BLA_t0045-1.
DR   EnsemblGenomes-Tr; BLA_t0046-1.
DR   EnsemblGenomes-Tr; BLA_t0047-1.
DR   EnsemblGenomes-Tr; BLA_t0048-1.
DR   EnsemblGenomes-Tr; BLA_t0049-1.
DR   EnsemblGenomes-Tr; BLA_t0050-1.
DR   EnsemblGenomes-Tr; BLA_t0051-1.
DR   EnsemblGenomes-Tr; BLA_t0052-1.
DR   EnsemblGenomes-Tr; EBT00001522963.
DR   EnsemblGenomes-Tr; EBT00001522964.
DR   EnsemblGenomes-Tr; EBT00001522965.
DR   EnsemblGenomes-Tr; EBT00001522968.
DR   EnsemblGenomes-Tr; EBT00001522970.
DR   EnsemblGenomes-Tr; EBT00001522971.
DR   EnsemblGenomes-Tr; EBT00001522972.
DR   EnsemblGenomes-Tr; EBT00001522973.
DR   EnsemblGenomes-Tr; EBT00001522974.
DR   EnsemblGenomes-Tr; EBT00001522976.
DR   EnsemblGenomes-Tr; EBT00001522977.
DR   EnsemblGenomes-Tr; EBT00001522978.
DR   EnsemblGenomes-Tr; EBT00001522979.
DR   EnsemblGenomes-Tr; EBT00001522980.
DR   EnsemblGenomes-Tr; EBT00001522981.
DR   EnsemblGenomes-Tr; EBT00001522984.
DR   EnsemblGenomes-Tr; EBT00001522985.
DR   EnsemblGenomes-Tr; EBT00001522987.
DR   EnsemblGenomes-Tr; EBT00001522989.
DR   EnsemblGenomes-Tr; EBT00001522990.
DR   EnsemblGenomes-Tr; EBT00001522991.
DR   EnsemblGenomes-Tr; EBT00001522992.
DR   EnsemblGenomes-Tr; EBT00001522993.
DR   EnsemblGenomes-Tr; EBT00001522994.
DR   EnsemblGenomes-Tr; EBT00001522995.
DR   EnsemblGenomes-Tr; EBT00001522996.
DR   EnsemblGenomes-Tr; EBT00001522997.
DR   EnsemblGenomes-Tr; EBT00001522998.
DR   EnsemblGenomes-Tr; EBT00001522999.
DR   EnsemblGenomes-Tr; EBT00001523000.
DR   EnsemblGenomes-Tr; EBT00001523001.
DR   EnsemblGenomes-Tr; EBT00001523002.
DR   EnsemblGenomes-Tr; EBT00001523003.
DR   EnsemblGenomes-Tr; EBT00001523004.
DR   EnsemblGenomes-Tr; EBT00001523005.
DR   EnsemblGenomes-Tr; EBT00001523008.
DR   EnsemblGenomes-Tr; EBT00001523009.
DR   EnsemblGenomes-Tr; EBT00001523010.
DR   EnsemblGenomes-Tr; EBT00001523011.
DR   EnsemblGenomes-Tr; EBT00001523012.
DR   EnsemblGenomes-Tr; EBT00001523013.
DR   EnsemblGenomes-Tr; EBT00001523014.
DR   EnsemblGenomes-Tr; EBT00001523015.
DR   EnsemblGenomes-Tr; EBT00001523016.
DR   EnsemblGenomes-Tr; EBT00001523017.
DR   EnsemblGenomes-Tr; EBT00001523018.
DR   EnsemblGenomes-Tr; EBT00001523019.
DR   EnsemblGenomes-Tr; EBT00001523020.
DR   EnsemblGenomes-Tr; EBT00001523022.
DR   EnsemblGenomes-Tr; EBT00001523025.
DR   EnsemblGenomes-Tr; EBT00001523026.
DR   EnsemblGenomes-Tr; EBT00001523028.
DR   EnsemblGenomes-Tr; EBT00001523030.
DR   EnsemblGenomes-Tr; EBT00001523031.
DR   EnsemblGenomes-Tr; EBT00001523032.
DR   EnsemblGenomes-Tr; EBT00001523034.
DR   EnsemblGenomes-Tr; EBT00001523036.
DR   EnsemblGenomes-Tr; EBT00001523037.
DR   EnsemblGenomes-Tr; EBT00001523038.
DR   EnsemblGenomes-Tr; EBT00001523039.
DR   EnsemblGenomes-Tr; EBT00001523041.
DR   EnsemblGenomes-Tr; EBT00001523042.
DR   EnsemblGenomes-Tr; EBT00001523043.
DR   EnsemblGenomes-Tr; EBT00001523044.
DR   EnsemblGenomes-Tr; EBT00001523045.
DR   EnsemblGenomes-Tr; EBT00001523046.
DR   EnsemblGenomes-Tr; EBT00001523048.
DR   EnsemblGenomes-Tr; EBT00001523049.
DR   EuropePMC; PMC2620821; 19011029.
DR   EuropePMC; PMC2869156; 20348299.
DR   EuropePMC; PMC2937518; 20805404.
DR   EuropePMC; PMC3318781; 22307308.
DR   EuropePMC; PMC3697524; 23645200.
DR   EuropePMC; PMC4335975; 25515139.
DR   EuropePMC; PMC4908950; 27379055.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01747; msiK.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   SILVA-LSU; CP001213.
DR   SILVA-SSU; CP001213.
XX
CC   Bacteria available from Dr. Geun Eog Ji (geji@snu.ac.kr).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1933695
FT                   /organism="Bifidobacterium animalis subsp. lactis AD011"
FT                   /sub_species="lactis"
FT                   /strain="AD011"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:442563"
FT   gene            165..1916
FT                   /gene="dnaA"
FT                   /locus_tag="BLA_0001"
FT   CDS_pept        165..1916
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaA"
FT                   /locus_tag="BLA_0001"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /note="COG0593: ATPase involved in DNA replication
FT                   initiation"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28307"
FT                   /db_xref="GOA:B8DV06"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8DV06"
FT                   /protein_id="ACL28307.1"
FT                   /translation="MNAENLDPATQAQTIWSDTLALIKQNSRLTAREQGWLAGVTAEAV
FT                   VGTTIILDVENAQTLQVLQTELNEPIIGALEIANGGSPMFPAFKVMPPAQPEPQTTASP
FT                   EDSGSRAADAQGAAKESVQPDEDSRTPRHSAEQTGDSRPAAAQEREDSAVHMARPDEQT
FT                   AESHREPEHEPAQQPVTSHYDEAIVQTFEDIDPVAGFGPSVAGTTAPQYPPQSEMQGSF
FT                   TPGVTGNYRDPVTHLNSNDTFDTFIQGDSNRFARTVALAVAEGSGRDYNPLCIYGGSGL
FT                   GKTHLLHAIGNYAVQNQKPRPRVLYVTSEEFTNDFIESIRTSGQDNEDPAMEKFYRKYR
FT                   EVDVLLIDDIQFLGGKRGILEQFFHTFNSLYQANKRIVIASDVPPHNLEDFEDRLISRF
FT                   EQGITVDVKPPNLETRIAILRMLAEQNHIRVPNDVLNLIAERFANNVRELEGALKRVIA
FT                   MASLNHQPVTRALTERTLQDFFTTDVEVKPTDIIARVAKYFHLTFDDIVGPGRPRSVTL
FT                   ARQIAMYLTRDMTSMSLMNIGQIFGGRDHTTVMHACKHIADKMQEKQEIYNYVNELTVE
FT                   LKQHLND"
FT   gene            2520..3644
FT                   /gene="dnaN"
FT                   /locus_tag="BLA_0002"
FT   CDS_pept        2520..3644
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaN"
FT                   /locus_tag="BLA_0002"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="COG0592: DNA polymerase sliding clamp subunit (PCNA
FT                   homolog)"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28308"
FT                   /db_xref="GOA:B8DV07"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:B8DV07"
FT                   /protein_id="ACL28308.1"
FT                   /translation="MKVEVNTASFADAVAWTTSVIDARPANPILAGVKLEAADGTMQLS
FT                   AFTYEISARDHIEAGVDESGTVVVLGKLLADISKVLPAEKTYLSANETTMTITSGPATF
FT                   TLQLMPESEYPDLPQLPPQIGQVDAETFTQTVTQAAVAVAHDENRPVLTGVHMRFAGEE
FT                   VTLSSTDRFRLGRASFRWTPDEADLDTAALVRGSHLVKIARSVDERANVVIYLDPANPK
FT                   LIGIANAGRISTVQLIDGEFPAVDRLYADSYPIQAVIRKEDLLGAAKRVSLVAERNAPI
FT                   RMVFTDQQLTLTAGGADEASAKETLQIDLDGEDITVAFNPSYLREGLSVISEPYIRMKM
FT                   TTAVKPVEFNGQQDEDGEESMSYRYLLVPMRFNV"
FT   gene            3690..5117
FT                   /gene="recF"
FT                   /locus_tag="BLA_0003"
FT   CDS_pept        3690..5117
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recF"
FT                   /locus_tag="BLA_0003"
FT                   /product="recombination protein RecF"
FT                   /note="COG1195: Recombinational DNA repair ATPase (RecF
FT                   pathway)"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28309"
FT                   /db_xref="GOA:B8DV08"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/TrEMBL:B8DV08"
FT                   /protein_id="ACL28309.1"
FT                   /translation="MITVSRLALDHFRSWTNCVLDFKPGVNILEGPNGLGKTNIVEALE
FT                   VLSTGSSHRASTSQPLVEQGFPAAAIRANIEELSEDFENNTETIDDRTTTFELTIRVRG
FT                   ANRARVDGGPSLYMRDIVGRVPLVAFTPDDQRLVWGDPAVRRSFIDQAASVLVRGYTDL
FT                   LQRFTHIAKQRAALLKQIGAQEGVSVSEEARQMRMNGLEVWTAQFIETGLELTRQRMAV
FT                   IGMLNEYFGTIVQELSDVDQTATLVYEPSFDELYLTQGAEAGEQGGPERVKAAISEHFQ
FT                   RIYTGEVARGVNLIGPQRDDVSIELNGMPAREYSSNGESWTLALALKMALYRLLERKAG
FT                   ERPIVVLDDVFAQLDPSRRAKIMEFALRQDQVIITVAAAGDVPELPGDAHAHVIDVAAL
FT                   KLQGSGGEGTAFMPEPLPADDPFAGQLAAVQASRRTAGMHAGSDGKHKVEQSADQSAEQ
FT                   VSGEREIGLTKHESAHA"
FT   gene            5114..5617
FT                   /locus_tag="BLA_0004"
FT   CDS_pept        5114..5617
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0004"
FT                   /product="conserved hypothetical protein"
FT                   /note="COG5512: Zn-ribbon-containing, possibly RNA-binding
FT                   protein and truncated derivatives"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28310"
FT                   /db_xref="InterPro:IPR007922"
FT                   /db_xref="UniProtKB/TrEMBL:B8DV09"
FT                   /protein_id="ACL28310.1"
FT                   /translation="MSEPPIAVTLKLDERALPAEEFEHVSARAGLIAERRVKREEALEN
FT                   FGKPGRDEVAFGSLFAGIAKRAGWVPHMKLAQLRHDWASIVGDVIARNTWVGAIDNGVL
FT                   TIHAKSPSWTTQLTFMLPELREKVLERLNGLDIRDIRVTGPQAHGPATRRKQYVRQNMH
FT                   YRPQ"
FT   gene            5808..7925
FT                   /gene="gyrB"
FT                   /locus_tag="BLA_0005"
FT   CDS_pept        5808..7925
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gyrB"
FT                   /locus_tag="BLA_0005"
FT                   /product="DNA gyrase, B subunit"
FT                   /EC_number="5.99.1.3"
FT                   /note="COG0187: Type IIA topoisomerase (DNA gyrase/topo II,
FT                   topoisomerase IV), B subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28311"
FT                   /db_xref="GOA:B8DV10"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B8DV10"
FT                   /protein_id="ACL28311.1"
FT                   /translation="MADQPTDSAAESLESASNDPIDQNLEANGTDQNDEQLDDTLSPEH
FT                   YDASDLRVLEGLEAVRIRPGMYIGSTGPRGLHHLVYEIVDNSVDEALAGYATHIEVTIL
FT                   PDNGIRVVDDGRGIPVDEVPGEGKSGVETVMTKLHAGGKFGGGGYAVSGGLHGVGISVV
FT                   NALSTRVDVEVRRQGYYWTQTYIDQHPTGPLERGRAMRDDESTGTSVTFWADPKIFETT
FT                   IYDFETLRSRFQQMAFLNKGLKITLTDMRQVDEARDEVAGDGDNTVEELHQTVTYQYKN
FT                   GIKDYVAFLVKSRGSAPIEPDVIDIESEDLTIGVSAEIAMQWTSAYSESVHTFANTIAT
FT                   TEGGTHEEGFRAALTSMINRYARDKNILKDKDDNLSGDDVREGLTAVISVKLTNPQFEG
FT                   QTKTKLGNSEAKTFVQRVMNEKLGDWLDAHPNEAKNIIQKALEASRARLAAKKARENTR
FT                   RKSIFESAGMPDKLKDCQSNDPSECELFIVEGDSAGGSAIQGRNPLTQAILPLRGKILN
FT                   TERASLDRMLKSDTIESLITAIGGGYGEDFDLDKVRYHKVIIMADADVDGAHIATLNLT
FT                   LFFRYMRPMITAGYVYVAMPPLYRLKWTKGPHDFVYTDAERDRVLAEGKANGRQLPKGE
FT                   GIQRYKGLGEMSYQELWETTMDPDHRILKQVHIEDALQADETFSMLMGDEVEPRRLFIQ
FT                   RNAHNARWIDA"
FT   gene            7994..10756
FT                   /gene="gyrA"
FT                   /locus_tag="BLA_0006"
FT   CDS_pept        7994..10756
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gyrA"
FT                   /locus_tag="BLA_0006"
FT                   /product="DNA gyrase, A subunit"
FT                   /EC_number="5.99.1.3"
FT                   /note="COG0188: Type IIA topoisomerase (DNA gyrase/topo II,
FT                   topoisomerase IV), A subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28312"
FT                   /db_xref="GOA:B8DV11"
FT                   /db_xref="InterPro:IPR002205"
FT                   /db_xref="InterPro:IPR005743"
FT                   /db_xref="InterPro:IPR006691"
FT                   /db_xref="InterPro:IPR013757"
FT                   /db_xref="InterPro:IPR013758"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR035516"
FT                   /db_xref="UniProtKB/TrEMBL:B8DV11"
FT                   /protein_id="ACL28312.1"
FT                   /translation="MADEPTNNGLDNGPVNDSGDEQHLPDGSLEPLSPQEADNTDYGLM
FT                   VGQRVQPIDLQDEMRQSYLSYALSVIVERALPDVRDGMKPVHRRVVYAMYDGGYRPDRG
FT                   YNKCSRVVGDVMGKYHPHGDSAIYDTLVRMAQSWSMRYLLVDGQGNFGSPGDDPAAAMR
FT                   YTECRMAPLAMEMVRDIDKDTVDFVPNYDGKTQEPTVLPARFPNLLVNGSSGIAVGMAT
FT                   NIPPHNMREVADGVHWALDHPEASREELLDALIERIKGPDFPTGATILGHKGIEQAYRT
FT                   GRGLITMRAVVNTEEIKGRMCLVVTELPYQVNPDRLVASIREAVRDGKITGIADMRDET
FT                   SGRTGQRLVLVLKRDAVPKVVLNNLYKHSQLQQTFGANMLALVDGVPRTLSLDAFIRHW
FT                   VSHQLDVIARRTAYLKREAEERDHILQGYLKALDMIDEVIHLIRSSQTVEIARTGLMDL
FT                   LGVDDVQADAILAMQLRRLAALERQKILDEHDELMRRIADYADILAKPERQRKIVGDEL
FT                   DEIVARYGDDRRTKILPFSGEMNVEDLIAEENVVVTVTHAGFIKRTKADEYRAQHRGGK
FT                   GIKGAKLRDDDVVDHFFLTSTHNWLLFFTNKGRVYRCKAYELPEGSRDSKGQHVANLLQ
FT                   FTPDESIQTVLSIPDYEVADYLVLATRSGKVKKTRLSEYDSPRQGGLIAVRLMQDESGE
FT                   TADELIGAALCNATDDIILVSKLGMSLKFRADDEQLRPMGRQTAGVQGMKFRAGDELLA
FT                   MDVIWGETDKDLLVVTNQGFAKRTAISEYRLQGRNGFGVKAVQLTDERGTLVGAVVVSE
FT                   EDQIMAIMKSGKVIRSNVSEVKLTGRTTQGVTLAKPDAGDEIISIARNAETEDEADGDT
FT                   VVTESSAEATATQPAQGEPVFEVKSENGMPMIEEESAAIDKTKEESREE"
FT   gene            10882..11418
FT                   /locus_tag="BLA_0007"
FT   CDS_pept        10882..11418
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0007"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28313"
FT                   /db_xref="GOA:B8DV12"
FT                   /db_xref="InterPro:IPR021949"
FT                   /db_xref="UniProtKB/TrEMBL:B8DV12"
FT                   /protein_id="ACL28313.1"
FT                   /translation="MSNTNPLEPGQQPRAAASSAADNAPRVARSASNTPLIADRDRPEE
FT                   NRPVRPIRNRKKPHARRMNLSLTRVSAWSVAKVSFMLSLAGAIIQIIAVLFLWLLLKAV
FT                   GVFDQVTQIFSSAGLDSGSINLSNILSLPTVLSAVTIFSIVEMVIITILCTIFALLYNV
FT                   VSALVGGVHVTLGDD"
FT   gene            11574..12695
FT                   /locus_tag="BLA_0008"
FT   CDS_pept        11574..12695
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0008"
FT                   /product="putative membrane protein"
FT                   /note="COG4767: Glycopeptide antibiotics resistance
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28314"
FT                   /db_xref="GOA:B8DV13"
FT                   /db_xref="InterPro:IPR006976"
FT                   /db_xref="InterPro:IPR010432"
FT                   /db_xref="UniProtKB/TrEMBL:B8DV13"
FT                   /protein_id="ACL28314.1"
FT                   /translation="MFRYLGSFSQSFTLALMLWPFVSLLLTLPIVAFVYHRNHRLSFTS
FT                   AFSAYVAVLYALGLVAFTMYPMPDDPTLFCATHNLAPQLDILRFIQDAQTGLYGVLQLV
FT                   MNVVLFMPLGFMLCRWAGWRFWVTSAFALGCSIFIETSQLTGIWGIYPCAYRQFDVDDM
FT                   LTNTLGAMLGYACALLYTKLVPKKAKQLTGTNTRPGFVHRMVSMCIDFLLIALVYVPLS
FT                   ILYIFLFYLVFKSTGDGHYVWLSLTVEPRVLDYMTWITAALSFLLFEVWIPWRHHGQTL
FT                   GCRYTHMTIETRDRSRGQRIAFYAIRTLFFGVIFGGLATNHPIWGWTLLALLIFWLVKK
FT                   CMPWDLVPGTDPQTPPTSPQPQVSTLPEPNLQR"
FT   gene            complement(12776..13639)
FT                   /locus_tag="BLA_0009"
FT   CDS_pept        complement(12776..13639)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0009"
FT                   /product="predicted membrane protein, hemolysin III"
FT                   /note="COG1272: Predicted membrane protein, hemolysin III
FT                   homolog"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28315"
FT                   /db_xref="GOA:B8DV14"
FT                   /db_xref="InterPro:IPR004254"
FT                   /db_xref="UniProtKB/TrEMBL:B8DV14"
FT                   /protein_id="ACL28315.1"
FT                   /translation="MANRRANPSQRKPPRSSYLEDSRMKRNNRHIGQVTRSQKPRKVVT
FT                   AKKLRAQSKRNEQYRTKMQLRQILLEKPKLRGWLHLIAFPFSVATSVILICLAPSGWMK
FT                   VAISVYSATIILLFGNSAALHLGHGYFPKAVDDVLCRIDYSNIFLVIAGTCTPFFFALN
FT                   NTVICWVYVGVVWVTALLGTFVHLIYPVGLDWLFTIVYIVLGLAPITIIWLFWKSPYIG
FT                   PVPTILVIAGGACYIAGAVCFALRKPNPFPKWFGFHELFHLGTIGGYVCHVIALFMVVL
FT                   RMRALM"
FT   gene            complement(14049..15395)
FT                   /gene="gdhA"
FT                   /locus_tag="BLA_0010"
FT   CDS_pept        complement(14049..15395)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gdhA"
FT                   /locus_tag="BLA_0010"
FT                   /product="glutamate dehydrogenase"
FT                   /EC_number="1.4.1.4"
FT                   /note="COG0334: Glutamate dehydrogenase/leucine
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28316"
FT                   /db_xref="GOA:B8DV15"
FT                   /db_xref="InterPro:IPR006095"
FT                   /db_xref="InterPro:IPR006096"
FT                   /db_xref="InterPro:IPR006097"
FT                   /db_xref="InterPro:IPR014362"
FT                   /db_xref="InterPro:IPR033524"
FT                   /db_xref="InterPro:IPR033922"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B8DV15"
FT                   /protein_id="ACL28316.1"
FT                   /translation="MLTDEYVKRVYAQVEARDPDQSEFLQAVQEVFESIEPVFAKHPEY
FT                   EAAGVLQRFVEPERLVKFRVAWADDNGDVQVNRGYRVQFNSAIGPYKGGLRFHPTVTES
FT                   VIKFLGFEQILKNSLTGLPMGGGKGGSDFDPKGRSDAEVMRFCQAFMTELQRHIGQFTD
FT                   VPAGDINVGAREVGYLFGQYKRLRNEFAGVLTGKGLEFGGSLARTEATGYGLCYYTQEA
FT                   LRVLRDDSFEGKTVVVSGSGNVAIFAIEKATQLGAKVVTCSDSNGYVYDPNGIDLDVVK
FT                   DIKLNKRGRIREYADRVDGAEYHEGCREVWTVPCDIALPCATQNEIDGESAQKLVDNGC
FT                   TVVCEGANMPSTPQAIEVYQKNHVLYGPAKAANAGGVAVSGLEMSQNSYRLSWSFEKVD
FT                   EELKGIMKNIVAESLDAAKEYGHDGDLMFGANVAGFTKVANAMVAQGIF"
FT   gene            complement(15508..16830)
FT                   /locus_tag="BLA_0011"
FT   CDS_pept        complement(15508..16830)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0011"
FT                   /product="multidrug transport protein"
FT                   /note="COG0477: Permeases of the major facilitator
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28317"
FT                   /db_xref="GOA:B8DV16"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B8DV16"
FT                   /protein_id="ACL28317.1"
FT                   /translation="MTAGNNTHRKTSSATDSATDSTQRQSNPSGYTTSAGERAAGKARE
FT                   RLITRDVALIMAATFFYMTSSMMGTPIIAGFSQSLGASGALMGFLAGALSLSALICRPI
FT                   AGNLSDRTSKRKLAVIGALIFLASNLGYYFVPNTAWLLAARILNGVGFACISVCLSTWL
FT                   SMLLPISRMGAGMGLYGTMNALAQAVGPDLGIRASKAIGYRNTFLIAVGLTCCIVICVL
FT                   LIKDGGKPPRARLGRQQGGERHHIRLDSLFEPRVIPIALIFMLFAIPYFANQSFIVDYA
FT                   NARHAHVIVSLFFPCYAITLLISRIVLRNWFDTKSFLFFMVTGTICQIVMLASLTVMRN
FT                   NWFVMLAGLATVGAYGMMSSVTQARAVLIAGKARSGMANTTYYAGIDLGMFLGPLIGGF
FT                   LYGGLPIIWFYPALLLTMPVAWIVYAFAHRTIQSSERAPRI"
FT   gene            16878..18201
FT                   /pseudo
FT                   /locus_tag="BLA_0012"
FT                   /note="frameshift: mannan endo-1,4-beta-mannosidase
FT                   precursor"
FT   gene            18449..18949
FT                   /gene="mscL"
FT                   /locus_tag="BLA_0013"
FT   CDS_pept        18449..18949
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mscL"
FT                   /locus_tag="BLA_0013"
FT                   /product="large conductance mechanosensitive channel
FT                   protein"
FT                   /note="COG1970: Large-conductance mechanosensitive channel"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28318"
FT                   /db_xref="GOA:B8DV17"
FT                   /db_xref="InterPro:IPR001185"
FT                   /db_xref="InterPro:IPR019823"
FT                   /db_xref="InterPro:IPR036019"
FT                   /db_xref="InterPro:IPR037673"
FT                   /db_xref="UniProtKB/TrEMBL:B8DV17"
FT                   /protein_id="ACL28318.1"
FT                   /translation="MIDGFKKFIARGNMVDMAVGVVMGAAVTAVVNSVVDGIINPLVAA
FT                   IFGKPDLSKTWNWTITNWAGENSVISFGSVLNALLNFLLIALAVYFCIVVPINNLRDMT
FT                   EKAMAKVKGDDSDVAAEEPDLSPEEQTVILLQDIRNALAAQQPAGAHAAPVATDTTAAP
FT                   ESK"
FT   gene            19184..19480
FT                   /locus_tag="BLA_0014"
FT   CDS_pept        19184..19480
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0014"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28319"
FT                   /db_xref="InterPro:IPR007302"
FT                   /db_xref="UniProtKB/TrEMBL:B8DV18"
FT                   /protein_id="ACL28319.1"
FT                   /translation="MKRATVAMICGLLCGSFRKICRGEDNLRIPSGASSPLFECDIERR
FT                   TTPRLFRDVRVRYKTVFFLIMVGLLCGDAVIDHTAENYGRLLTQMYGNRPYLP"
FT   gene            complement(19680..19752)
FT                   /locus_tag="BLA_t0001"
FT   tRNA            complement(19680..19752)
FT                   /locus_tag="BLA_t0001"
FT                   /product="tRNA-Ala"
FT   gene            complement(19784..19857)
FT                   /locus_tag="BLA_t0002"
FT   tRNA            complement(19784..19857)
FT                   /locus_tag="BLA_t0002"
FT                   /product="tRNA-Ile"
FT   gene            20005..20763
FT                   /locus_tag="BLA_0015"
FT   CDS_pept        20005..20763
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0015"
FT                   /product="predicted metal-dependent hydrolase"
FT                   /note="COG1451: Predicted metal-dependent hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28320"
FT                   /db_xref="GOA:B8DV19"
FT                   /db_xref="InterPro:IPR002725"
FT                   /db_xref="UniProtKB/TrEMBL:B8DV19"
FT                   /protein_id="ACL28320.1"
FT                   /translation="MPFNSVPRARSISRRAQFDRSTRAREVLNVDGLQVNVLRKKNRNM
FT                   YLRVKPPYGAIEVTAPVRMPQHTIVEFVRERRSWVDEALHKMAQARSRTFASPDLDPDV
FT                   GGSRTTVLRDARDPGSPRMETPHETSSFTWNEEYVERARRSIEQQLPDLLSKWTPIVGK
FT                   SPTKITLRTMTSRWGSCTPKTGRIRLNLQLGLMDPQFLEYVLVHELTHLWESGHGRTFQ
FT                   ERMSLVLPNWKELRRELNRCTIFDVPQSRG"
FT   gene            complement(20788..21213)
FT                   /locus_tag="BLA_0016"
FT   CDS_pept        complement(20788..21213)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0016"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28321"
FT                   /db_xref="UniProtKB/TrEMBL:B8DV20"
FT                   /protein_id="ACL28321.1"
FT                   /translation="MAEATKHTITVDLDMFDKTPEEKTAHANEIAREFGVGEDALAAVE
FT                   DFKKELTKHNAWDLPFMGYVNEDGYGYAYVPNAAITTTPYWDAHAAFLALPKDAQTAFA
FT                   IRMLFTHRPVDRYGADMFLHYQRGISTNFIGTGANKY"
FT   gene            complement(21851..22693)
FT                   /locus_tag="BLA_0017"
FT   CDS_pept        complement(21851..22693)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0017"
FT                   /product="conserved hypothetical protein"
FT                   /note="COG2865: Predicted transcriptional regulator
FT                   containing an HTH domain and an uncharacterized domain
FT                   shared with the mammalian protein Schlafen"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28322"
FT                   /db_xref="InterPro:IPR025831"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR038475"
FT                   /db_xref="UniProtKB/TrEMBL:B8DV21"
FT                   /protein_id="ACL28322.1"
FT                   /translation="MVLREAIANAVVHREYDTLFRNDPVNIDVYSDRVEISSPGNLWGG
FT                   KTLQNLTNGVSRCRNTTLMQLLQKTPLIRGDHDGSAVEGQGSGIQFMINRMKELSLAQP
FT                   DFHPTFDRFRVILYRGGAEIAANQQWVRSHVGHDLPGRESSVLYTVRALGRASVYDIRD
FT                   RLGYDSDDIRAILATLVESGLIRQVATDIYEPPETPAITNASDAPAPPAAAPSSRQAII
FT                   DTIPTFGTISARDIAEATGKSLQTVHRILRELVDEGVITAIGKKQSRLRTYTRKQTID"
FT   gene            23204..23530
FT                   /locus_tag="BLA_0018"
FT   CDS_pept        23204..23530
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0018"
FT                   /product="alpha/beta hydrolase fold precursor"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28323"
FT                   /db_xref="GOA:B8DV22"
FT                   /db_xref="UniProtKB/TrEMBL:B8DV22"
FT                   /protein_id="ACL28323.1"
FT                   /translation="MGTRCTPQALAGRVNVYNRISPTKAPCGSIRRVASIRITTAHGVQ
FT                   EHTHVTLGGIEQYVQIRGEDRRNPVILWLHGGQCTVPDYSSRSGDGALSAPTAECTRGL
FT                   YARQ"
FT   gene            23569..26070
FT                   /locus_tag="BLA_0019"
FT   CDS_pept        23569..26070
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0019"
FT                   /product="excinuclease ABC subunit A-like protein"
FT                   /note="COG0178: Excinuclease ATPase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28324"
FT                   /db_xref="GOA:B8DV23"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041552"
FT                   /db_xref="UniProtKB/TrEMBL:B8DV23"
FT                   /protein_id="ACL28324.1"
FT                   /translation="MAQTIDITGARVHNLKRVDVRVPIGKMVAVAGVSGSGKSSLALGV
FT                   LYAEGSRRYLEGLSTYTRRRISQSGEAKLDAIEHVPPALALHQRPSVPGIRSTFGTMSE
FT                   LLNSLRLMTSRLGNYTCPNGHMLDPTPNVALERPIICPVCGEEVQALGAEDLAFNSGGA
FT                   CPTCSGTGIVRTVNQATLIADPNLTIEQGAVAPWRSLMWSIMVDVCREMGVRTDVPYKD
FT                   LTAHEKEIVLHGPAEKRHIIYHSKKENRAGELDFTYFSAERTVLNALDKAKDAKALKRV
FT                   EPFITEEPCPDCHGTRLNKRARILPVDGKTLPEQCAMQLDNLAQWVRTVPATMPDDMHE
FT                   MAQSIVDEFTRTARRLLELGLGYLTLDRAGSTLSTGERQRIQLARAVRSELTGAMYVLD
FT                   EPSIGLHPANVDGLLGVMRDLKAQGNTVVVVDHDTRVLRDTDWIIEMGPGAGSHGGTVI
FT                   AQGTVSDIEGNPHSLIAPFLASERLQIVRPQTPANKVFDEGALEIKTAPLHTVHALDAR
FT                   VPKHRLTVVTGVSGSGKTTLVLESLVPALTAKIAGERLPEHVRALDAPGIDRVTMIDAT
FT                   PIGANVRSTVATYSGVLDDLRRLYARTDAAKARGLKAGAFSYNTGSLRCPTCDGTGQIT
FT                   LDVQFLPDVDIDCPDCHGTRYGDVAGEITWTPKNGHKPVSLPDLLAMTVDEALDIFTGT
FT                   GQRRLHAELETLHELGIGYLTLGESTPALSGGEAQRLKLASEMGRAQDGTLFVFDEPTI
FT                   GLHPLDVRTLIGVFQKLIDHGASVVVIEHDLDMIANADWIIDMGPGGGENGGEIVATGT
FT                   PVQIAENPLSVTGRYLKPCVE"
FT   gene            26429..27184
FT                   /locus_tag="BLA_0020"
FT   CDS_pept        26429..27184
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0020"
FT                   /product="methyltransferase"
FT                   /note="COG0500: SAM-dependent methyltransferases"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28325"
FT                   /db_xref="GOA:B8DV24"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B8DV24"
FT                   /protein_id="ACL28325.1"
FT                   /translation="MDYQSENAQTIDRWVDEGWQWGVPISHDAFVDAQHGSWNILLTPT
FT                   KPVPHEWVGDVRGKRVLGLASGGAQQMPVMAALGAQCTVLDYSSRQCEREYEVADREGY
FT                   DIEVIQADMTQPLPFADESFDLIINPVSNCYIEQVKPVFRECYRVLKPGGSLIGGYDNG
FT                   INYIFDNEETTLTYALPFNPLHDERARQLLLDEDAGMQFSHTLDEQIGGQLEAGFTLRA
FT                   LYEDTNGEGNLHEHHVPTFVATWSVKPAR"
FT   gene            27233..28147
FT                   /locus_tag="BLA_0021"
FT   CDS_pept        27233..28147
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0021"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28326"
FT                   /db_xref="GOA:B8DV25"
FT                   /db_xref="UniProtKB/TrEMBL:B8DV25"
FT                   /protein_id="ACL28326.1"
FT                   /translation="MAEYSGSSGYAEYEYLGTANGTSFAKRHPYLLWQIIGWSILLADA
FT                   VFFVVAALQDFGEWCYPVIVFPFIAALFAVIGSPFLIYFSRKAKIPQAASKREASVVRS
FT                   HITMISQIRGESHPVLMALLIIALALGLLVLTLQLGMRGYILPGFLAMVAMVVVPFVVY
FT                   AQYSAAQRKRFMAVPDAAYLVGVHYADQSRYESVELRETDALMMPVPAKPSTAMLDFVY
FT                   NWLREYLATDWLTVTVLSFDDLLRSGVVVNDSDTEDTDPTASFPLIPARQFNLDGDARA
FT                   QLDEESKAIGAFWLSRWRGYTQM"
FT   gene            28521..29069
FT                   /locus_tag="BLA_0022"
FT   CDS_pept        28521..29069
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0022"
FT                   /product="predicted flavoprotein"
FT                   /note="COG0431: Predicted flavoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28327"
FT                   /db_xref="GOA:B8DV26"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:B8DV26"
FT                   /protein_id="ACL28327.1"
FT                   /translation="MKVLMIVGSLRKNSFNKQLAAMAEQELGDRASVSVLDWSEVPVFN
FT                   QDEEFPTPKSVAEARVAVNEADAIWIFTPEYNHSVPGSLKNLFDWLSRPLEDGTPSVLT
FT                   GKVMTMSGVGGLNTLRYAFAAWMPSLTLFKMRIVPVPFTGVTLNREMFSTDKLELNAAM
FT                   RTSLKYQADATLQAIAEAE"
FT   gene            29386..29985
FT                   /locus_tag="BLA_0023"
FT   CDS_pept        29386..29985
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0023"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28328"
FT                   /db_xref="UniProtKB/TrEMBL:B8DV27"
FT                   /protein_id="ACL28328.1"
FT                   /translation="MRQWRGIVSVIAAMAMIGGFAGCGQSQEQAGFSKSPQSSQTATGG
FT                   ASGEIGNMESEHHILPSSDVEELELRLESIGESTATGNLTLLGELHPTASYTERDGGRG
FT                   MPSLQNQDELTFSDCKSYMLSVLCMGEGSVSIEWTLGTQSEQRNLECAPKIAETALGMS
FT                   NVNAKSSTVKIVAEEGSKAEIAYRLDEIGKPGVVVD"
FT   gene            30631..30945
FT                   /locus_tag="BLA_0024"
FT   CDS_pept        30631..30945
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0024"
FT                   /product="Zn-ribbon protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28329"
FT                   /db_xref="UniProtKB/TrEMBL:B8DV28"
FT                   /protein_id="ACL28329.1"
FT                   /translation="MGRAVRKSENAKGVPMLFAEPRRATRMANMGDYADMDAENVESAE
FT                   VVCPRCGSRHVAQILHGMPAFTEELQRELAEGKVVLGGCDIDIFHPTPSYHCNDCEEEF
FT                   "
FT   gene            31586..31855
FT                   /locus_tag="BLA_0025"
FT   CDS_pept        31586..31855
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0025"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28330"
FT                   /db_xref="UniProtKB/TrEMBL:B8DV29"
FT                   /protein_id="ACL28330.1"
FT                   /translation="MALFMLNHHVLAEVAYDSGARTYAVDFPDRQPWLPSGFSFQVCTA
FT                   YTQVVSCEDSADTTIPADEKIRQMLNEQIEIWHRDWQCTGETWE"
FT   gene            complement(31993..32292)
FT                   /locus_tag="BLA_0026"
FT   CDS_pept        complement(31993..32292)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0026"
FT                   /product="predicted pyrophosphatase"
FT                   /note="COG1694: Predicted pyrophosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28331"
FT                   /db_xref="GOA:B8DV30"
FT                   /db_xref="InterPro:IPR025984"
FT                   /db_xref="UniProtKB/TrEMBL:B8DV30"
FT                   /protein_id="ACL28331.1"
FT                   /translation="MIHQFSADRDWQQFHAPANMAKSVSIEAGELLECFQWSDEPRDGD
FT                   WEHVYEELADVMIYCIQMADVLDVDLDEIIRSKMAKNAKKYPVEASRGSSAKAE"
FT   gene            32704..33786
FT                   /locus_tag="BLA_0027"
FT   CDS_pept        32704..33786
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0027"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28332"
FT                   /db_xref="GOA:B8DV31"
FT                   /db_xref="UniProtKB/TrEMBL:B8DV31"
FT                   /protein_id="ACL28332.1"
FT                   /translation="MAGKEKIDVRILRYTENGQKRYMAASCLLVLILSIVNAYVHEIEY
FT                   MLRKKEYNYSWSELYNYFIDFYPNVNSPFSLLLELFSFLSTLAIALAVVVEGEGKMLIL
FT                   SKFSYWLCVGSCSVLAVMSRALFSGLGVIKAIAVIVSSIIILYYLGRFSIVIGQKNFIN
FT                   ARMAFDKSVSLIYLKLYERYGGERSAARSLVKVFVLLSILLIMAIGPWVLLITDALSAT
FT                   RYDNGNILSVLLVFLFIYCLTFVALLKNEEHGMNGLLLVTSCFVPLLPLLFYVFHSIHN
FT                   SIHYVIIFFIALSLSFWSLFCVACSRMSSGELSEKLRKRRPWILVAEIESIHSIKARLY
FT                   MKIHLKYIDRVEYMNGLGGS"
FT   gene            34631..35992
FT                   /locus_tag="BLA_0028"
FT   CDS_pept        34631..35992
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0028"
FT                   /product="modification methylase SinI"
FT                   /EC_number="2.1.1.37"
FT                   /note="COG0270: Site-specific DNA methylase"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28333"
FT                   /db_xref="GOA:B8DV32"
FT                   /db_xref="InterPro:IPR001525"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR031303"
FT                   /db_xref="InterPro:IPR041657"
FT                   /db_xref="UniProtKB/TrEMBL:B8DV32"
FT                   /protein_id="ACL28333.1"
FT                   /translation="MSENALLNTKETAQYIGVSAGVVTRLANTGELEFDTCGARKVFRK
FT                   EAIDAYLERNNLIQAAVDQVSTKDFEDNICALSFFSGAGGLDLGFERAGISAALYCENN
FT                   RECRMTLHRNRPDVALLGDITKISADEVRRMARIPQGREIDVMFGGPPCQAFSTAGARR
FT                   AFEDPRGNVFLRYLDLASELKPRYLVIENVRGLLSTPFPVESGGKPIRGGVMRYILNKL
FT                   EEMGYGVSFNLYNAANFGAAQIRERVVIIAKRDGTKCDWLIPTHTDPDGKYVQNWNLPS
FT                   WVTFRDVVYDIEDSRQTHTDFPEKRLLYFSMLKEGQCWNKLPIEIQEEAMGKAYKLGGG
FT                   KTGFYRRIAWDRPSPTLVTSPTMPATDLCHPKELRPLSVEEYKRVQGFPDDWWIAGSIH
FT                   DQYRQIGNAVPVSLGEAIGRAILDDMRGEAHDERWRNFPYSRYAHTSDQNWNLA"
FT   gene            complement(36087..37040)
FT                   /locus_tag="BLA_0029"
FT   CDS_pept        complement(36087..37040)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0029"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28334"
FT                   /db_xref="InterPro:IPR032793"
FT                   /db_xref="UniProtKB/TrEMBL:B8DV33"
FT                   /protein_id="ACL28334.1"
FT                   /translation="MKYAFQPEILRQTLHSLIKICICRIRTLRLIHMEDQVRIYDSAAE
FT                   EEARRESARSILNAYIQSRIAFYDGTGSSSMTYERLLGKDFAIYALRGIETAEDYAREA
FT                   FHAVESSSEETAMGTRWQELIASIAENAIDTGDLTATRDGAVYVIELKSQENTTNSSSF
FT                   PNELRSLRQRMKEITGRKRASNQRVEAAICITRSTISKDEWRTFEVSGVTQENADLKNF
FT                   RYRYLSGTAMWQWLCGIDSPYGLIRPFSSINSEAVLLARESSLERVTTQLLEELDKNGL
FT                   PHTLDGVAELSDRYKAEKEAKRREREAKRNARNTGR"
FT   gene            37575..39923
FT                   /locus_tag="BLA_0030"
FT   CDS_pept        37575..39923
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0030"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28335"
FT                   /db_xref="GOA:B8DV34"
FT                   /db_xref="UniProtKB/TrEMBL:B8DV34"
FT                   /protein_id="ACL28335.1"
FT                   /translation="MQSERHIEGTKDEASQSGSRIDEDTTIEIEDIEEENNSDQDESHR
FT                   VDYMLAAGCGIISGAIDSLWVGKFDFDRAREWGSERVNEFVMAVAKMDPEYKGDDVKSA
FT                   IRFLEKKYPFVGDRATSEFGGGRQHHLRDFSHHMSLGGLAFSLLTQFTGKVYGTDQHGV
FT                   FMVVPVADEELIGKTIEEKLMLGAVRWFFHMVSDMAGSSGSAGKGTGIPGPILSLMKQL
FT                   SALPLFKDAMTDEALFRKMLSKLFNGTLLKTVDEEGKKIYRRFDLRAELGIAHELARQS
FT                   VPVLVNECLVCVCYAARRLYTMCSNGEVHDFKSLLSVGLDALLPHGSPLGTRMVTIATG
FT                   VFSVVDMTDGAIRTLMRSGGKLNPGMVSDFLLHVNVVGVVRFVFAVHTDYKVHAKAKRE
FT                   TRLQAKFHGRGNGYGDDASVMRFFELDMAQANMVVSIEYQAARLDIEQTKNKKTREEKE
FT                   REFSDWENDNCSEFILRDKEALVNEIHRIQRYATPVWQKLVALEASQFMPYQSKKLKYD
FT                   AATLDMVCSDLPGFEDKECTKYRKAVIKETSAIKGVKKAVLAGCVGIGVVAVATGGAAY
FT                   VFAPAIAPILAGPSVAGLSGAALTSASLAAVGGGSLAAGGLGMSGGVALIAGGGALLGA
FT                   VTGGGAATLGTWVLANQDAYVLNTCAKLIVFCRDVLMEIDGGVELVRQVRQSVCEQLRE
FT                   TEPQLDFLGQLKQFIKQSGSRDADSDPSAKRERSEALKGIDKSEKNMKRSVKYMRKCVK
FT                   ELGKVTGITDENRGASGAQWKPVAQIEKG"
FT   gene            complement(39951..40571)
FT                   /locus_tag="BLA_0031"
FT   CDS_pept        complement(39951..40571)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0031"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28336"
FT                   /db_xref="UniProtKB/TrEMBL:B8DV35"
FT                   /protein_id="ACL28336.1"
FT                   /translation="MRLNSPHSSTGLTMVRRLVDVMAHDLGVPRRASDDPDGEALACRC
FT                   TFTALRFWMQAYCIDDGYGGAAGIAQTAVEQKSLAWIKQMSALYPQLRSKFTPALIHQY
FT                   CSALTAIGDLAETSEGMLRCTKPHDLRIPYSGGTFVIAQLGLRDLTVQDWEGCVLSDAV
FT                   VFAGVSKHNGIVGFDPDMIGWELPYRDELLFLAKWQEASNALR"
FT   gene            complement(40513..42648)
FT                   /locus_tag="BLA_0032"
FT   CDS_pept        complement(40513..42648)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0032"
FT                   /product="putative Viral A-type inclusion protein
FT                   repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28337"
FT                   /db_xref="UniProtKB/TrEMBL:B8DV36"
FT                   /protein_id="ACL28337.1"
FT                   /translation="MSQQFNESRQSWGLFVWNDNGDGQFIRIIDYVTDSAGNGCYDWVA
FT                   YPRWWERSRNPSSDDPLDPKTLYNPKLTQIMVKSDSDFKFLQWTPNYNRPDHPFVEIFQ
FT                   GGLRTTEPPLYEVIDCPANRAEELPDVLSQGIQYSGRPTAKILLLFAENNNMLDAAVLD
FT                   RSMTTIHNGLLTLSNTAPNSVPRVILDRRHVRIINQGFNRGDRLVYNLPTQLKSHSQVV
FT                   IKPMRDLAQLYVNWYIRKEHAMNGDELMRTAGDVLEQAFEKPANLEEYLGAKPSHNDVR
FT                   ALQTAIKATIRSNTDDVSEIIYDVLKNDDDVMAEFRKQATAQLDDEFEKHKQVLCKQLD
FT                   ELRAQRDEESEKAEQATAQLAELNQQLQRKRGEIRDAQAELELQKEEQHKALQDLENNV
FT                   ALKLGLQQIAQQNHSMMEELTIRHSTAPDSSRQLRMAPMMGPAKTQAATDMQQAVAQNM
FT                   QILGCTFTGQSNRNNERITHFAAHLCRTLRTTRLLAVDTVHVPTIANTLAFALAGTPAQ
FT                   HTGIPIDFSDFTMLEEFLEHSESPVIVLDNVFDTVNESLLFALNRYSPAKSVVILPIGS
FT                   FANIRLLAPEVWNKVFYVPTTGMVELSASDKPLHHAQEALKRIDITSRSILAQMDILRR
FT                   MTSIPQNALVTPSAITAIAQDTASARQWIMPHLCIETYEYQGAEKAHELSQEPTNKTIA
FT                   AQLAALIDRIDHGSQAR"
FT   gene            complement(42675..44117)
FT                   /locus_tag="BLA_0033"
FT   CDS_pept        complement(42675..44117)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0033"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28338"
FT                   /db_xref="UniProtKB/TrEMBL:B8DV37"
FT                   /protein_id="ACL28338.1"
FT                   /translation="MDTARQFIPMAPVCTVTADQVVHDFQGDIPAGVKFRCPSCDRPVQ
FT                   FHRGSRASTTSADASGDQAPAVRRNPRSHSSRSVHRTVRPHFRHAKNDPVARFCERYQA
FT                   GLGADPRIIVPSLPMFLRKDRNRAGSGHHAQSTPTFHLEISVRRRSLGHDLISELRKDR
FT                   ATLTVDGISHNLADLVSDRKYTIHLENPSFGLRARISVPEQWQRNVGSPEDGEQAFIFT
FT                   SEFGPNGGRRLSYGASLHAGFDYYVVARPSILRALQSCFDIAVPIGEINSSHGNLLVVR
FT                   IVTLWNSLNRTQADFWLADHGFRLTSLDLDPVPVWPPQLRSNGIDEPLFSNSQQIYQTP
FT                   FASRNENPVHDDIDFPRLNCDHLNPRRVGLLGFAPHGRVRSQIEGECCFLRANRYLPWS
FT                   AYVLSHTYPEGLMLADAPHLPSSDEQPHASSTALMPELAIKQTQCQTLNKHLDIEQRRL
FT                   EQPQHHGIPLSVSLARIRSTYR"
FT   gene            44292..44495
FT                   /locus_tag="BLA_0034"
FT   CDS_pept        44292..44495
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0034"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28339"
FT                   /db_xref="UniProtKB/TrEMBL:B8DV38"
FT                   /protein_id="ACL28339.1"
FT                   /translation="MRNLDEVIAAQGEDYAQFDQQAKQSVAACASLAMSIKSVLDTPIL
FT                   DESGALTDESGTLMRGFDGNPE"
FT   gene            complement(44759..44953)
FT                   /locus_tag="BLA_0035"
FT   CDS_pept        complement(44759..44953)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0035"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28340"
FT                   /db_xref="InterPro:IPR004386"
FT                   /db_xref="InterPro:IPR035093"
FT                   /db_xref="UniProtKB/TrEMBL:B8DV39"
FT                   /protein_id="ACL28340.1"
FT                   /translation="MIENSPASIAVLKQRHNMHTLAGKWQGRNECHVANAGDGPVIWSC
FT                   NGKVAFFEHTGSHDELFGT"
FT   gene            45245..45505
FT                   /locus_tag="BLA_0036"
FT   CDS_pept        45245..45505
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0036"
FT                   /product="PemI-like protein"
FT                   /note="COG2336: Growth regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28341"
FT                   /db_xref="GOA:B8DV40"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="InterPro:IPR039052"
FT                   /db_xref="UniProtKB/TrEMBL:B8DV40"
FT                   /protein_id="ACL28341.1"
FT                   /translation="MTMLTLSKWGNAQAVRLPKAMREQVGMPDDSQIEATVENGAIVLK
FT                   PARSAKRAIRVANLASVFKDRKEPYRACEDDFGAPAGNEGL"
FT   gene            complement(46078..46968)
FT                   /locus_tag="BLA_0037"
FT   CDS_pept        complement(46078..46968)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0037"
FT                   /product="transcriptional regulator"
FT                   /note="COG0583: Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28342"
FT                   /db_xref="GOA:B8DV41"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B8DV41"
FT                   /protein_id="ACL28342.1"
FT                   /translation="MTELEALRELVAFREYGTLSAAADELRITQPTMTRTMRKLERELG
FT                   VPLFDRRAKNRLSLTHTGELAAQEAEQLLDAYDRFVETVRNDANLHNEIVVGSVAPGPL
FT                   HFLEQAGERNAKWESSITVRHSLIEPDAVLDDLLLRKETMIITDREVDDPRVESLYLGE
FT                   EYLGVAIDNFNPLAQRTSVTFADLAGMDFVVAHDIGPWRAVIEEQIPGAHFLYQQDLSA
FT                   LEQISKYSAFPFFYSNLTRSLRMTDERFMPHTRTAVSIADPANRIDFYATFLGDNRRLA
FT                   LPIQQYLAQHRPREQ"
FT   gene            47112..47973
FT                   /pseudo
FT                   /locus_tag="BLA_0038"
FT                   /note="frameshift: aldo/keto reductase of diketogulonate
FT                   reductase family"
FT   gene            complement(48065..50314)
FT                   /locus_tag="BLA_0039"
FT   CDS_pept        complement(48065..50314)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0039"
FT                   /product="putative beta-glucosidase"
FT                   /EC_number="3.2.1.21"
FT                   /note="COG1472: Beta-glucosidase-related glycosidases"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28343"
FT                   /db_xref="GOA:B8DV42"
FT                   /db_xref="InterPro:IPR001764"
FT                   /db_xref="InterPro:IPR002772"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR019800"
FT                   /db_xref="InterPro:IPR026891"
FT                   /db_xref="InterPro:IPR036881"
FT                   /db_xref="InterPro:IPR036962"
FT                   /db_xref="UniProtKB/TrEMBL:B8DV42"
FT                   /protein_id="ACL28343.1"
FT                   /translation="MPHASQQNTTPAHELPLEKRAALTSGADAWHLNGLSESTSYMITD
FT                   GPHGLRKAAQSTSMDIEHSMPATCFPPAAGMASSWNPGLVREVGVAIGEECVQEKVAVL
FT                   LGPGVNIKRNPLGGRSFEFWSEDPYFAGHEAIGIVEGVQSTGVGTSLKHFAANNQETDR
FT                   MRIDARVSERALREVYLPAFEHIVTKAHPWTVMCAYNQLNGTPCSQNSWLLTKVLRDEW
FT                   GFDGVVISDWGAVHDRVEALKAGLNLEMPPTNTDEQVVVAVRDGLLDEDQLDRMAQGML
FT                   DLIEKAAPAMQQDDHPYDLVNHGAIARRAAQESMVLLKNDGGILPLAADGSVSIAVIGE
FT                   FARTPRYQGGGSSKLTPTYVSSFLGSLHIRDIPVDFSPGFTLDDAKQDAALTAHAIDMA
FT                   WRNDVVLFFAGLPEEAESEGFDRETIDLPQKQLRLLADIVKVNPNVVVVLSNGSAVSVT
FT                   PWRDSVRGLLEGWLLGQEGGNALADVIFGDVSPSSKLVQTIPMSVLDDPSMPNWPGEAG
FT                   HVDYGEGVFVGYRYYDTFGRQVAYPFGYGMTYSTFEIRNLSAIPHDNTVQVSAIVTNTG
FT                   QVRASEVVQLYVAPCACDAARPAHELKGFEKITLDPGEASIVTFELDSRSFAYWSEPRN
FT                   DWHVERGTYTIEIGSSSRDIAERVQVELPGDGIRLPLTLSSTFDEWSDDPIGGPILQAA
FT                   INRLSQQEGHPIIPESDMLRMLLGSMPMNATNVLLGSAAGRLCERIMGLYNASNQ"
FT   gene            complement(50528..51340)
FT                   /pseudo
FT                   /locus_tag="BLA_0040"
FT                   /note="interrupted by in-frame stop: kanamycin kinase"
FT   gene            51558..52010
FT                   /locus_tag="BLA_0041"
FT   CDS_pept        51558..52010
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0041"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28344"
FT                   /db_xref="GOA:B8DV43"
FT                   /db_xref="InterPro:IPR025328"
FT                   /db_xref="UniProtKB/TrEMBL:B8DV43"
FT                   /protein_id="ACL28344.1"
FT                   /translation="MQGTPMPAPPVQQMRPNAYRLPTNRSLTKFILLGLITFGIYDIVI
FT                   MTTTAEALNTIASPRDGKKTMNYCLMYFLIGWLTLGIGWLVWFHNFSDRIGEEQRRRGM
FT                   VPTVTASTFWLWEVLGSLIVVGPFIYHYKMLHAMNDLCASYNAYGI"
FT   gene            complement(52340..53671)
FT                   /locus_tag="BLA_0042"
FT   CDS_pept        complement(52340..53671)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0042"
FT                   /product="transposase"
FT                   /note="COG3464: Transposase and inactivated derivatives"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28345"
FT                   /db_xref="InterPro:IPR002560"
FT                   /db_xref="UniProtKB/TrEMBL:B8DV44"
FT                   /protein_id="ACL28345.1"
FT                   /translation="MNEETRPEPEFSVFDPQRFLGLDEMGLRVLSWRRLGRPDGPGLRQ
FT                   IRCEPDSHDARWCPSCGAYARVRSSWLRTLAHVPYGDDAVHLPVRVRRYECVPCSRSWS
FT                   DDLEAVGAGRGVLSVPAVMWALRRVCLDSMTVSACARLLHVAWAVVDRAVRERGMLLLE
FT                   QADRFSSVRAIGVDEHVWRHGAFGDRYVTVIVDLTPRCDGRPARLLDMVPGRSAQVLRE
FT                   WMQARGGEFTRRVGVVAMDAFAGWKQAVESVVPHAVEVIDPFHVVQLAAARVTKVRCRL
FT                   QRDATGRRGVKGDRLYDCRRALLTSDEYLGARGRARLMALFAIQANRDLMLAHDAYQRV
FT                   IHAYRCDDRRRGERMMRELIDDLTGPGRYKGCRELASLGRVLKRRMRDILALFRHPRSS
FT                   NGPTEAINGRLETLRGNAMGFANTTSYIQRCLIHSSQLKDILTH"
FT   gene            53745..55271
FT                   /locus_tag="BLA_0043"
FT   CDS_pept        53745..55271
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0043"
FT                   /product="glycoside hydrolase family 30 protein"
FT                   /EC_number="3.2.1.45"
FT                   /note="COG5520: O-Glycosyl hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28346"
FT                   /db_xref="GOA:B8DV45"
FT                   /db_xref="InterPro:IPR001139"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR033452"
FT                   /db_xref="InterPro:IPR033453"
FT                   /db_xref="UniProtKB/TrEMBL:B8DV45"
FT                   /protein_id="ACL28346.1"
FT                   /translation="MMKALKTTVHYDVTAGRTHTEQTELSVMDEAMNTEHIVESNVVGI
FT                   YPDYTFQMMEGYGCSLTESACYLLSKMDSATRKEALAQWFGPAGMDAWFVRVHIDSCDY
FT                   SLSEYQAVEDPLADPELETFSIDRDRQYILPVLKEAMAMAGHPIHVLLSPWSPPAQWKT
FT                   PPEMTRNDASVYGGEEGDVIDLSKPGRCFGGRLKPEYYSSWARYLVRFISAYMAEGVPV
FT                   TMLSIQNEAAAATSWDSCLWTGDQEREFLKHHLYPAMEEAGLTDAVKIFIWDHNKERAI
FT                   EHIDEFMSDPEAAKEVGGFAYHWYSGDHFEALSMLRGKYPDKVLMHSESCGLHIPGKVT
FT                   MLDMTDEQIEALPDGDYKTMVQTTTPNEMDFNDATAYAHDIIGDLNHGMQRWIDWNMIV
FT                   DRQGGPRHTPGGFAAPIVAEDDGRYTLTISYRYIREIAQAIKPNAVVLGTSTYSRDIEA
FT                   VSARNADGSIGVVLLNQAERDIPVNIRMGGLLVADVPLPARTLSTLVFTE"
FT   gene            complement(55803..57908)
FT                   /gene="bga"
FT                   /locus_tag="BLA_0044"
FT   CDS_pept        complement(55803..57908)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bga"
FT                   /locus_tag="BLA_0044"
FT                   /product="beta-galactosidase"
FT                   /EC_number="3.2.1.23"
FT                   /note="COG1874: Beta-galactosidase"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28347"
FT                   /db_xref="GOA:B8DV46"
FT                   /db_xref="InterPro:IPR003476"
FT                   /db_xref="InterPro:IPR013529"
FT                   /db_xref="InterPro:IPR013738"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:B8DV46"
FT                   /protein_id="ACL28347.1"
FT                   /translation="MARAYTDPILFGAAYYDEYIPRDLDRIDTDMEMMTRAGINVIRIG
FT                   ESTWSTCEPQPGHFDWTHIDRALDAATNAGINVIVGTPTYAVPTWLVAMYPDVLATTPA
FT                   GEPHYGARQIMNIVNPAYRLYGERVIRSLISHVAQQPCVIGYQVDNETKYYDSVSHDMQ
FT                   VMFIKQLRHEFKNDLEALNEAYGLDYWSNRINAWEDFPDLTGSINESLRARFDRFRRDQ
FT                   VAEYLAWQASIIREYMRDDQFITHNFDYEWRGHSYGLQPAVDHFRAARALDICGVDIYH
FT                   PSEDALTGKEIAFGGDMARSAGGGNYLVLETQAQGQHGWLPYPGQLRLQAYSHLASGAD
FT                   GIMYWHWHSIHNSFETYWRGLLSHDFESNPTYEEAGRFGREIGDPRIGDTLSHLSKRNA
FT                   VAILASNESLTALSWFHIETGFPMGGTLTYNDVLRSIYDALFELNVEVDFLPADASADQ
FT                   LAGYSLVIAPALYTTDQQTIDRLARYVKNGGHLLATMRSFVADENVKVWHDKAPHHLVD
FT                   IFGMTYNQFTRPMGVSLKCPDTLADLAGASANDFIEMLSPAPETHVLAWYDHYAWDSYA
FT                   AITRHAFGSGDAQWVGTQLQADAWRTVLAEALSNAGVHTPGMELAGTVCVRSGTNTAGD
FT                   TVTYLLNYSGSPITFRAPASGTFLLGHPTDDGEQAVTAETPVTVGDAVTLPRWGVDIIV
FT                   GRQPTMN"
FT   gene            58213..59472
FT                   /locus_tag="BLA_0045"
FT   CDS_pept        58213..59472
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0045"
FT                   /product="multidrug-efflux transporter"
FT                   /note="COG0477: Permeases of the major facilitator
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28348"
FT                   /db_xref="GOA:B8DV47"
FT                   /db_xref="InterPro:IPR001958"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B8DV47"
FT                   /protein_id="ACL28348.1"
FT                   /translation="MSTVSLEQTSSALSRSDRIRLLASFLVFPLLWCSGLFMVAAVLLP
FT                   QRLRDVMGADAATAAFGVINACTAFISLLSNLVVGNLSDHTRSRFGRRTPWVISGGIVG
FT                   GVSLALVGFLDNVWLIGISYCVCMIGLNMMIAPVIATLSDRVPANMRGTMSAFLAGGTA
FT                   VGSALGQMLGSRFLSNQIPGFLLSGTLMGLAGICTVLVWPKEPSSKHLAKTSNGFGDML
FT                   KSFIPPTKGARDFWLAFVGRSLFIFAYYMILNYQLYVLEDYVGQSAQQAGNTIAVMSMV
FT                   SMIVGLVSSLAGGPISDRIGKRKIMIVLASVLMAVGFVLPWILHSPLSMILFAGFSGFG
FT                   YGLYGAVDQALNVDVLPNKEEAGKDLGILNIATTLGQMVGPIVTSAVVAATGGYTVVFP
FT                   VAIGFAAFASLFIMLIKSVR"
FT   gene            complement(59527..60168)
FT                   /locus_tag="BLA_0046"
FT   CDS_pept        complement(59527..60168)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0046"
FT                   /product="possible TetR-type transcriptional regulator"
FT                   /note="COG1309: Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28349"
FT                   /db_xref="GOA:B8DV48"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:B8DV48"
FT                   /protein_id="ACL28349.1"
FT                   /translation="MQPSVEESVNTRTRKSPQQREEEILRATVKLISQRGYNGISLRDV
FT                   ASEVGMTQQGVLHYVGNKAGLAAMVMKEFYDPTSMPGDFLASGLPGSDRDAPHFPAYLR
FT                   YVVRENAKRRDLVQMFAILQAESIDPDHPAHDYFEHRPAIIWQTLSNYQWKLPPQIGTW
FT                   ENFKPLHRMALEAMDGIQLRWLRSDPIDLYDEWIAFERILFPSPVWDNYR"
FT   gene            complement(60321..60803)
FT                   /locus_tag="BLA_0047"
FT   CDS_pept        complement(60321..60803)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0047"
FT                   /product="DNA protection during starvation protein"
FT                   /note="COG0783: DNA-binding ferritin-like protein
FT                   (oxidative damage protectant)"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28350"
FT                   /db_xref="GOA:B8DV49"
FT                   /db_xref="InterPro:IPR002177"
FT                   /db_xref="InterPro:IPR008331"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="InterPro:IPR023188"
FT                   /db_xref="UniProtKB/TrEMBL:B8DV49"
FT                   /protein_id="ACL28350.1"
FT                   /translation="MALSFIIPGLDEVASEKIIGILQERLSQEQEAALVLKHAHWNVAG
FT                   PNFIAVHEMLDPQVDEVLAMADETAERIAALGGSPSGRPDDIVRYRTWDKFELEGRQNT
FT                   LDYLRALDKYYDSFIKADRTAIKELDDLDVISSNIVQDHVLKLEQFQWFMRSFLID"
FT   gene            complement(60928..62283)
FT                   /locus_tag="BLA_0048"
FT   CDS_pept        complement(60928..62283)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0048"
FT                   /product="hemolysins-like proteins containing CBS domains"
FT                   /note="COG1253: Hemolysins and related proteins containing
FT                   CBS domains"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28351"
FT                   /db_xref="GOA:B8DV50"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR002550"
FT                   /db_xref="InterPro:IPR005170"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:B8DV50"
FT                   /protein_id="ACL28351.1"
FT                   /translation="MSLGLNILLIFVFLLLGSVFAGTELALVSLRGSQIDQMEQEDARG
FT                   KRVAKIARDPNTFLSTVQIGVTLSGFLSASFGESSISPFIVPVVEGWGVPSNVAAPLTT
FT                   IVLTLVISYCSIVISEMVPKRIAMQRNEQIARAVVPAISAFAKVCRPIIWLIGKNTNGI
FT                   VRLLGFDPNETESEVSDEELRVLVSSNTNLTKDERTILDDVFDASETIVAEVMRPRADV
FT                   VFLDGDTPLADAAAQVRELPYSRYPVIGKSFDDVLGFVHVRDLLDVRDPNAKTVADVTR
FT                   EGISLPGTSKLLPSLSLLRKRGIHLAVVIDEYGGTDGIVTLEDMTEELVGDIRDEYDLP
FT                   EDTPKDKLPTDVFVDGVATIDGGMTIEDFADLTGIELEDGPYETVAGYFLAHSGKMGEV
FT                   GDHLVVDDAYTMTITKVDGRRIETIEVRKGTANGGTEVSDDQQANDPEHSDK"
FT   gene            complement(62567..63244)
FT                   /gene="icfA"
FT                   /locus_tag="BLA_0049"
FT   CDS_pept        complement(62567..63244)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="icfA"
FT                   /locus_tag="BLA_0049"
FT                   /product="probable carbonic anhydrase"
FT                   /EC_number="4.2.1.1"
FT                   /note="COG0288: Carbonic anhydrase"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28352"
FT                   /db_xref="GOA:B8DV51"
FT                   /db_xref="InterPro:IPR001765"
FT                   /db_xref="InterPro:IPR015892"
FT                   /db_xref="InterPro:IPR036874"
FT                   /db_xref="UniProtKB/TrEMBL:B8DV51"
FT                   /protein_id="ACL28352.1"
FT                   /translation="MTDSTQETTANSTWSRMLAGNRRFAEGNAEHPWRDKETRESLIDT
FT                   QNPDAAVLSCSDSRVPPEIIFDAGLGDMFTVRTAGEMLDQAVLQTLEYAVSSLHVSLLV
FT                   VLSHQHCAAVAQAEKELDALTEHLTHEITDAQERERIMEDLDEVIASSSSEFLKNIGIS
FT                   VWQARMAGLDSRDDYEQVHIAHTIEQLVTSSEMIRDALAHERLMIVGARYRLDTGLVEV
FT                   LSF"
FT   gene            63338..64453
FT                   /locus_tag="BLA_0050"
FT   CDS_pept        63338..64453
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0050"
FT                   /product="LacI-type transcriptional regulator"
FT                   /note="COG1609: Transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28353"
FT                   /db_xref="GOA:B8DV52"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:B8DV52"
FT                   /protein_id="ACL28353.1"
FT                   /translation="MAGHRGAKRPSIFEVAKLAGVSHQTVSRVINHSPNVAEATRAKVE
FT                   HAIAELGYHPSNSARSLASNRTRTVGMIAGGQRFYGPVSALASIEATARAHGMFVSVAM
FT                   VHEAECTQQEFDDLCGMFMQQGVDAFIFLTPTDEMFKVACKSQVSQPCVIITSSHGGVS
FT                   VSEGLHMFNARQRRRVSLVGIDQWAGMASVMRLIRKHGHRNVLFFAGPGQWRDASTRLM
FT                   AWNKLCAQNTVNSVTVQCGDDWESADAYRRMNHILDNIGSNGGRLPTCAVCSNDVMAIG
FT                   VIRALLEHGVRVPDDMSVTGFDDMPGMSNLYPPLTTVRQDFDDLGTMAMKEALFLMGEE
FT                   AEPGYPNSQHGVGLVSADLIVRQSVRAAPRR"
FT   gene            complement(64506..64733)
FT                   /locus_tag="BLA_0051"
FT   CDS_pept        complement(64506..64733)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0051"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28354"
FT                   /db_xref="GOA:B8DV53"
FT                   /db_xref="UniProtKB/TrEMBL:B8DV53"
FT                   /protein_id="ACL28354.1"
FT                   /translation="MNINSTARARLYALTAVACAIWLFQNCVEANASGDLLSWSNIILS
FT                   ICLIIVTGYCAVNAVLGWNTKSADTEDPSK"
FT   gene            64858..65760
FT                   /locus_tag="BLA_0052"
FT   CDS_pept        64858..65760
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0052"
FT                   /product="ATP binding protein of ABC transporter for
FT                   pentoses"
FT                   /EC_number="3.6.3.17"
FT                   /note="COG1129: ABC-type sugar transport system, ATPase
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28355"
FT                   /db_xref="GOA:B8DV54"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B8DV54"
FT                   /protein_id="ACL28355.1"
FT                   /translation="MACCRPTGLQSLALLALGEDVHRHGAQEHKTLDRLHHCGVDAHDR
FT                   QALVDDAHDQCADNGAGKSTLVHVLAGLEQPDAGSIAVGGETVRLDGVAKAIDLGIAPA
FT                   FQQPQFCENLDVSANIFLGREMRQGFASRDDEGMYNKAREVLNTLSTSVRAGQSIASLS
FT                   GGQRQTIAIARTLLNDPSLIVLDEPTASLSVTQTAEVLDYIVRLRSDDRSVIMVCHDLP
FT                   NVFAVADRIVVMRLGEIRAVHNTSETSYEEDIAEIAGVGGSGTTPSRPCERASRARMPI
FT                   ARESHPRPSRGGDRDGTMA"
FT   gene            65961..66302
FT                   /locus_tag="BLA_0053"
FT   CDS_pept        65961..66302
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0053"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28356"
FT                   /db_xref="GOA:B8DV55"
FT                   /db_xref="UniProtKB/TrEMBL:B8DV55"
FT                   /protein_id="ACL28356.1"
FT                   /translation="MGAAEIVVTVVTAVACLGMGVFLGSLPFKRDELTEWHMKYQQLGG
FT                   VLACGIVIVLMLLGYDLASWLAIAALAVGVAVSRIPVVRRGLLARFPELHPAERQSPLR
FT                   KGTSKKRRS"
FT   gene            complement(66297..67331)
FT                   /locus_tag="BLA_0054"
FT   CDS_pept        complement(66297..67331)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0054"
FT                   /product="LacI-type transcriptional regulator"
FT                   /note="COG1609: Transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28357"
FT                   /db_xref="GOA:B8DV56"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="PDB:5UFH"
FT                   /db_xref="UniProtKB/TrEMBL:B8DV56"
FT                   /protein_id="ACL28357.1"
FT                   /translation="MAKGVTIKDVAAEAGVSFKTVSNVINGTGSMRESTRGRVLEAMDK
FT                   LNYTINLSARSLKTGTTGLLGLAIFDFSQPFASYLADQIIVCAREHHYGVIINTYGQNE
FT                   HGLARAMRQANNLAADGWIVFADHAMGQHSKMLDQSYPLVLTGDWDAYGKVDQVTMPNV
FT                   EAMRYTTNRLLDSGYRSIALFGADGSLGARHYRQATEGTQELRVQGYMQAYEEHGIEAR
FT                   MDMLFSGGLLTSDSGVRATNLMMDQGVRPDAIICLNDAMALGALHQLQVRGIRVPDDVQ
FT                   VVGFDNVPEATYANPSLTTIDPHIDSYARHAVDMLIERIQGYDGAKRVYTSDFTLVERS
FT                   STSL"
FT   gene            complement(67449..68990)
FT                   /gene="abfA"
FT                   /locus_tag="BLA_0055"
FT   CDS_pept        complement(67449..68990)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="abfA"
FT                   /locus_tag="BLA_0055"
FT                   /product="alpha-L-arabinosidase"
FT                   /EC_number="3.2.1.55"
FT                   /note="COG3534: Alpha-L-arabinofuranosidase"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28358"
FT                   /db_xref="GOA:B8DV57"
FT                   /db_xref="InterPro:IPR010720"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:B8DV57"
FT                   /protein_id="ACL28358.1"
FT                   /translation="MPQHSEAQARLVVDDEFRVGPVHDRVFGSFVEHLGRCVYTGIYEP
FT                   GHPTADAEGFRQDVIDLVKELGATTIRYPGGNFVSGYQWEDGIGPKENRPRRLDLAWHS
FT                   TETNQFGLHEMVSWLNKAGGNELMEAVNLGTRGLPEALDLLEYANVPEGTARSEERIRN
FT                   GADNPFDIRMWCLGNEMDGPWQLGHKDAEAYGKLAASVAAGMRMLDPDLELVVCGSSNH
FT                   TMDSFGKWEETVLEHTFDKVDFVSAHAYYFPQLMENGSRDMASFLASGVDMDGFIKDVG
FT                   AAIDATKARLKSDHNVYISFDEWNVWYYEEEPSKNPEGIGNWPVAPRLLEDVYTVADAV
FT                   VVGDLLITLLQNADRVHAASLAQLVNVIAPIMTEPNGPAWRQTTFYPFSLTAAWAKGGD
FT                   VLEPKIESTQYHTNRYGNVNSTNAVAVRGKDGSVSVFVTNRSLDDGCDFEIKLPEGFTP
FT                   TELDVRTLHDDDMLATNTVNHQDRVVPHPNDTASIQDGMVTVTLPPVSWTAIHLR"
FT   gene            69315..70928
FT                   /locus_tag="BLA_0056"
FT   CDS_pept        69315..70928
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0056"
FT                   /product="probable sugar kinase"
FT                   /EC_number="2.7.1.17"
FT                   /note="COG1070: Sugar (pentulose and hexulose) kinases"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28359"
FT                   /db_xref="GOA:B8DV58"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="InterPro:IPR042029"
FT                   /db_xref="UniProtKB/TrEMBL:B8DV58"
FT                   /protein_id="ACL28359.1"
FT                   /translation="MADSKAIAQAIRDGRTSLGIEFGSTRIKAVLIDDERNTITTGDYG
FT                   WQSHLVDGLWSYDVDKIWRGLQSVYADVADRVEADYGLKLTRIGQIGFSAMMHGYLAFD
FT                   ADGELLVPFRTWQNTNTSEAHEKLSELFQYNIPERWSIAHLYQAVLDNEPHIGSVRYFT
FT                   TLSGYVHWKLTGRKVLGIGDASGMFPIDPNTKTYEQGFIEQFDALPEVAAQPWKLNDLL
FT                   PEPLVAGTPAGELTPEGAALLDPSGVLQPGTMLAPPEGDAGTGMVATNSVRRRTGNVSA
FT                   GTSIFATVVLEHKLSKLRPEVDLVTTPAGDLAGMSHANNFTADLNGWVDLFRQFSQLNG
FT                   RNVDDGTLYGELFRAAIGEDADPDAGGLLAYPFRTGEFLAGLAEGRPLFVRGPEARFSL
FT                   ANFMRAQLFGAFSPVTIGMNVMTEDEGVEIDSLVGHGGIFATPVVAQRILAAAFNTPIR
FT                   VMTTASEGGAWGMAVLADYLRHADLTLADYLDDVVFAGAESVTEAPRPDDVDGFQRFFA
FT                   RFVKALPVERSAVEHVEIGG"
FT   gene            70984..71676
FT                   /gene="araD"
FT                   /locus_tag="BLA_0057"
FT   CDS_pept        70984..71676
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="araD"
FT                   /locus_tag="BLA_0057"
FT                   /product="L-ribulose-5-phosphate 4-epimerase"
FT                   /EC_number="5.1.3.4"
FT                   /note="COG0235: Ribulose-5-phosphate 4-epimerase and
FT                   related epimerases and aldolases"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28360"
FT                   /db_xref="GOA:B8DV59"
FT                   /db_xref="InterPro:IPR001303"
FT                   /db_xref="InterPro:IPR036409"
FT                   /db_xref="UniProtKB/TrEMBL:B8DV59"
FT                   /protein_id="ACL28360.1"
FT                   /translation="MATLADYGPEVRAEVKQVREVVAALHEQLIKWNLVVWTAGNVSQR
FT                   LRTADLMVIKPSGLRYEYLTPSSMVVCDLDGNVVDGAESPSSDTASHAYIYRHMPEVYG
FT                   VVHTHSTYATAWAATGQNIPCGLTMMGDEFGGPVPVGPFRLIGSEAIGEGVVETLKAYP
FT                   KSPAVLMQNHGPFTIGKDAEAAVKAAAMTEEVAHTMWAAKQLGDIIPIPQEDIDKLNDR
FT                   YQNVYGQH"
FT   gene            71940..73457
FT                   /gene="araA"
FT                   /locus_tag="BLA_0058"
FT   CDS_pept        71940..73457
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="araA"
FT                   /locus_tag="BLA_0058"
FT                   /product="L-arabinose isomerase"
FT                   /EC_number="5.3.1.4"
FT                   /note="COG2160: L-arabinose isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28361"
FT                   /db_xref="GOA:B8DV60"
FT                   /db_xref="InterPro:IPR003762"
FT                   /db_xref="InterPro:IPR004216"
FT                   /db_xref="InterPro:IPR009015"
FT                   /db_xref="InterPro:IPR024664"
FT                   /db_xref="InterPro:IPR038583"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8DV60"
FT                   /protein_id="ACL28361.1"
FT                   /translation="MAMENPFEGKEIWFGVGSQDLYGEEALRQVAQQSAEIVDSLNASG
FT                   RIPVKLVLKPTLKSSDGVRRFMVDASADDSCIGVITWMHTFSPAKMWIRGLEALRKPLL
FT                   QLNTQHHFEIPWETIDMDFMNLNQAAHGDREYGYIVTRLGIPRKIVVGHYTDPAVADKI
FT                   GVWARACAGWQASNTMNVMRWGDNMRNVAVTEGDKTEAERVFGASINTWAVNELVAAYD
FT                   AVKENQIKDLIEDYKAKYEIAPELLDKDYDSLFIAAREECAMVNMMRANGCTAGVDNFE
FT                   DLGALPQLPGVGPQRFPSEYGWGFSAEGDWKTAVLVRIGAVMGYGLEGGASLMEDYSYN
FT                   FTPGNEMIMGSHMLEVSPSVGTIAKPRLEIHPLGIGGKADPVRLVFTVAPKKDAVVVSL
FT                   ADVRTRFRMLMNVVDVVEPLGSLDKLPCARALWKPEPNLEISAECWLRAGGSHHTCMTT
FT                   SVGREAWEDFARIAGVELAAIDAETTPREFERELEIEDVFHELANRH"
FT   gene            73592..74455
FT                   /locus_tag="BLA_0059"
FT   CDS_pept        73592..74455
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0059"
FT                   /product="dehydrogenase or reductase protein"
FT                   /EC_number="1.1.1.274"
FT                   /note="COG0656: Aldo/keto reductases, related to
FT                   diketogulonate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28362"
FT                   /db_xref="GOA:B8DV61"
FT                   /db_xref="InterPro:IPR018170"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:B8DV61"
FT                   /protein_id="ACL28362.1"
FT                   /translation="MSTLADQTPDIPLITLHDGSRIPQIGLGVLRIDDEGVVPVVESAL
FT                   AIGYRHIDGAAGYNNEEGVGRALAATGYNTGEQRESLWMTTKLRDSEQGYDSAMHAFDR
FT                   SLELLQLDYVDMYMIHWPTPFDWRSGETWKAFAKLREDGRVRTLGVCNFMPEHLDRLYE
FT                   ETGEYPTVNQIELHPTWQQRDVVEYCHAHDIAVEAYSPMARGADLANGVIERIAEAHGV
FT                   TPAQVILRWHIENGTIIIPKSVHTERQRENLDLFGFSLTPQEHAEIDALDGPTRAGHDP
FT                   MTFTYA"
FT   gene            complement(74696..77452)
FT                   /gene="ppc"
FT                   /locus_tag="BLA_0060"
FT   CDS_pept        complement(74696..77452)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ppc"
FT                   /locus_tag="BLA_0060"
FT                   /product="phosphoenolpyruvate carboxylase"
FT                   /EC_number="4.1.1.31"
FT                   /note="COG2352: Phosphoenolpyruvate carboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28363"
FT                   /db_xref="GOA:B8DV62"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018129"
FT                   /db_xref="InterPro:IPR021135"
FT                   /db_xref="InterPro:IPR033129"
FT                   /db_xref="UniProtKB/TrEMBL:B8DV62"
FT                   /protein_id="ACL28363.1"
FT                   /translation="MTDQEQTITPADATIVSSGLGTKGPEERTLPATLQEDMDLCLNIL
FT                   RQVLSEYDENLLKTFDTVRQYAVDASAERFSGVLTDTHPERDDLEMAVKTIDAMNLHDA
FT                   QLLARAFATYFHLANLCEENYRVAVLHEREAKVDDTQAIDPVNEMTKAYHQLISEMGPA
FT                   KAKELLERLEFHPVFTAHPTEARRKAVEGKIRRIAQLLEAHRLLGGSDKKEDSRRLYSE
FT                   IDALFRTSPIALKKPTPVEEADTILDIFDNTLFHTIPMVYRRFDDWMLGDKAGIEPPAC
FT                   PAFFHPGSWIGSDRDGNPNVTAKVSRQVARKFSDHVLAALEEATRTVGRNMTVESETTP
FT                   PSDELRALWNQQKEISERLTGKASLISTKELHRAVLLVMADRLHYTIKRDTDLMYHNCD
FT                   DFLADLRVVQRSLAEAGDKRAAYGPLQDLIWQTETFGFHMVEMEFRQHSVVHARALDDI
FT                   REHGLHGERGPLQPMTHEVLDTFRALGAIQKRNGVKAARRYIISFTKSAKNVRDVYELN
FT                   RLAFSNPDDAPVIDVIPLFEQLEDLEHSVSVLDEMLKIPEVQARLKQTGRKMEVMLGYS
FT                   DSSKDAGPTTATLALHSAQERIAKWADENDIDLTLFHGRGGAVGRGGGPANRAVLAQPK
FT                   GSVKCRFKLTEQGEVIFARYGNPVLAIRHVESVAAATLLQSAPSVEKTNTEMTEKYKPM
FT                   ANQLSEVSHETFLDLLNSEDFAPWFSIVTPLTEIGLLPIGSRPAKRGLGAKSLDDLRTI
FT                   PWIFSWAQARINLAAWYGLGSACESFGDLATLRKAYEEWPLFSTFIDNIEMSLAKTDER
FT                   IAKMYLALGDRPDLSKKVLDEMELTRKWVLKIVGDEWPLQHRHVLGQAIRIRSPYVDAL
FT                   SVTQVLALRSLRKKVDKEELSESQQAGFIYLILCTVSGVAAGLQNTG"
FT   gene            77763..79439
FT                   /locus_tag="BLA_0061"
FT   CDS_pept        77763..79439
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0061"
FT                   /product="integral membrane protein"
FT                   /note="COG2966: Uncharacterized conserved protein,COG3610:
FT                   Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28364"
FT                   /db_xref="GOA:B8DV63"
FT                   /db_xref="InterPro:IPR010619"
FT                   /db_xref="InterPro:IPR024528"
FT                   /db_xref="UniProtKB/TrEMBL:B8DV63"
FT                   /protein_id="ACL28364.1"
FT                   /translation="MHWRSRPVKSAAGAVRRFHSHAIPLDMEDIERDWDKPITDAGIAA
FT                   KASVIVRVGMLDLGAGTGSFRVREMMHRIAYPLGVHVRADVNLTDVQASCTDGKERITE
FT                   VVNLPTTGVNTERIWLLEHFADWFSVNLGAGTMYHRRTEVSRQLMQPNTLGTRDASQIS
FT                   AETAKQLRERLRQEARAQKLAAKRASLRSRVAERVAERAKKKLPEDEYAEHFDHLEEHA
FT                   EKRVRESGPITVGQVHKRLDLIERRKPLYSSAFSGFAAACACAAFVFLLGGAPYDMIGA
FT                   FIGAGLGQWARRRLFAHHLNQFFVTFVAVAVAALACVGTLRLIGIFDPVALHHDTAYIG
FT                   AMLFVIPGFPLITGGLDMAKIDFPSGVQRIAYVCCIILMATLAGWMVAVLVHLNPQGFD
FT                   TPPLNPWATGALRALFAFVGVWGFSVLFNSPQRMCLVAATIGMITDTLRLEIVDWGVPA
FT                   EAGAFIGALLAGLIASAWRSAVRHGLLAPHLGYPRICLTVPSIVIMVPGLYMYRAMFYL
FT                   GQFNTLLALDWAFRAFMVIICLPIGLAMARVITDKSWRYDV"
FT   gene            complement(79530..80861)
FT                   /locus_tag="BLA_0062"
FT   CDS_pept        complement(79530..80861)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0062"
FT                   /product="transposase"
FT                   /note="COG3464: Transposase and inactivated derivatives"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28365"
FT                   /db_xref="InterPro:IPR002560"
FT                   /db_xref="InterPro:IPR029261"
FT                   /db_xref="UniProtKB/TrEMBL:B8DT80"
FT                   /protein_id="ACL28365.1"
FT                   /translation="MNEETRPEPEFSVFDPQRFLGLDEMGLRVLSWRRLGRPDGPGLRQ
FT                   IRCEPDSHDARWCPSCGAYARVRSSWLRTLAHVPYGDDAVHLLVRVRRYECVPCSRSWS
FT                   DDPEAVGAGRGVLSVPAVMWALRRVCLDSMTVSACARLLHVAWAVVDRAVRERGMLLLE
FT                   QADRFSSVRAIGVDEHVWRHGAFGDRYVTVIVDLTPRCDGRPARLLDMVPGRSAQVLRE
FT                   WMQARGGEFTRRVGVVAMDAFAGWKQAVESVVPHAVEVIDPFHVVQLAAARVTRVRCRL
FT                   QRDATGRRGVKGDRLYDCRRALLTSDEYLGARGRARLMALFAIQANRDLMLAHDAYQRV
FT                   IHAYRCDDRRRGERMMRELIDDLTGPGRYKGCRELASLGRVLKRRMRDILALFRHPRSS
FT                   NGPTEAINGRLETLRGNAMGFANTTSYIQRCLIHSSQLKDILTH"
FT   gene            complement(81016..82119)
FT                   /gene="trpS"
FT                   /locus_tag="BLA_0063"
FT   CDS_pept        complement(81016..82119)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trpS"
FT                   /locus_tag="BLA_0063"
FT                   /product="tryptophanyl-tRNA synthetase"
FT                   /EC_number="6.1.1.2"
FT                   /note="COG0180: Tryptophanyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28366"
FT                   /db_xref="GOA:B8DT79"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002305"
FT                   /db_xref="InterPro:IPR002306"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:B8DT79"
FT                   /protein_id="ACL28366.1"
FT                   /translation="MTDDMNAQLTAAGNEMSASFLAAKKRSDETLAKLKANPGKFTMLT
FT                   GDRPTGRLHLGHFFGSIRERVAMQNLGVNTNIIIADYQVITDRDTTEHIDDNVLNLVLD
FT                   YMAAGIDPEKTMIFTHSAVPAENQLMLPFLSLVTEAELHRNPTVKSEMESSGHALTGLL
FT                   LTYPVHQACDILFCKANVVPIGKDNLPHVEITRTIARRFNERYAKKNPVFPEPAAILSE
FT                   APEIPGLDGRKMSKSYGNSIMLGATAEETAKLIKKSPTDSERTITFDPVNRPQVSALLT
FT                   TAGLVTGRDPSEIAAEIGNAGAGALKKYVIDSVNEFLAPHRERRAELAKDMDSVRDILH
FT                   DGNARANAIANQTLDEVREAMGMRYDR"
FT   gene            82280..82627
FT                   /locus_tag="BLA_0064"
FT   CDS_pept        82280..82627
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0064"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28367"
FT                   /db_xref="InterPro:IPR021426"
FT                   /db_xref="UniProtKB/TrEMBL:B8DV66"
FT                   /protein_id="ACL28367.1"
FT                   /translation="MGRGRQKAKQQKIARKLKYMTTDTDYDELAKELGAHEPGTGSFDP
FT                   FADVENDEFQAQDVDETVDDLDEYAKWAAEAAAKATTGEMPETHAQPKPKPHKPIPMPV
FT                   PETFKHTDQQE"
FT   gene            complement(82826..83233)
FT                   /locus_tag="BLA_0065"
FT   CDS_pept        complement(82826..83233)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0065"
FT                   /product="serine-pyruvate aminotransferase/archaeal
FT                   aspartate aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28368"
FT                   /db_xref="GOA:B8DV67"
FT                   /db_xref="InterPro:IPR041629"
FT                   /db_xref="UniProtKB/TrEMBL:B8DV67"
FT                   /protein_id="ACL28368.1"
FT                   /translation="MAAIRKQDMMRGMQAYDDWCTAARAAAETTPALDIAPRLDRATMA
FT                   MAVRYSLHQLEIKAPGPGVEVRVAPYAVVKILEGPASDPHNLTPPDVIELDPQVWLRVA
FT                   SGITTWHEEQKAGRISAVGERDDLSPLLPLG"
FT   gene            83811..86267
FT                   /gene="glgP"
FT                   /locus_tag="BLA_0066"
FT   CDS_pept        83811..86267
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glgP"
FT                   /locus_tag="BLA_0066"
FT                   /product="glycogen phosphorylase"
FT                   /EC_number="2.4.1.1"
FT                   /note="COG0058: Glucan phosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28369"
FT                   /db_xref="GOA:B8DV68"
FT                   /db_xref="InterPro:IPR000811"
FT                   /db_xref="InterPro:IPR011833"
FT                   /db_xref="InterPro:IPR035090"
FT                   /db_xref="UniProtKB/TrEMBL:B8DV68"
FT                   /protein_id="ACL28369.1"
FT                   /translation="MTELTAPKSPLTANEFADEIRQALKYTQGVTPEQAKTADVYVATA
FT                   TVVRRHLMDSWMKTQQDMINGDTKAVGYLSAEFLMGKQLRNALLNAGLTPQFEEAVRGL
FT                   GFDPQAVVDAEYEPGLGNGGLGRLAACFIDSLASLGVPAFGYGIQYKYGIFRQEFDDEG
FT                   RQIERPDYWLSNEDPWGHIDYERDQRVNFGGKVVEENGKRVWKPSWAVRAIPVDYMVPG
FT                   YASGRVNTLRLWQARSYDEFDLLTFNKSEYLDAVKPQVKAEDISKVLYPEDSTEVGKEL
FT                   RLEQQYFFASASIHDAIRVFYPDTDKPDLTTFADKITFQLNDTHPVIGIPELMRIMIDE
FT                   YGYDWDTAWEVTHKTFNYTCHTLLPEALEVWPASLIGKLLPRHLEIIERINKQFVSELE
FT                   AKGASEDQIKRMLILTDDEHPVVRMAYLATYAGSNVNGVAELHSQLLKDVTLRDFSDVY
FT                   PAKFKNVTNGVTPRRFIKLANPRLSELITEGLGTDKWLEDLDLLEGLAPLAQDDEFVKK
FT                   FAAVKHENKVAFADFSKQRYGAELDANTMFDTMIKRLHEYKRQALKILEIIATYSDIKS
FT                   GKVNVQDITPRTYIFGAKAAPGYYLAKMTIQLINNVAKVIDNDPDVNGKIKIFFPWNYN
FT                   IEVAQMLIPATELDEQISQAGKEASGTSNMKFALNGALTVGTLDGANVEIRERVGADNF
FT                   FLFGMTVDEVEKMYEQGYDPSKYYEADPRLKAAIDMVADGTFSNGDRNTYAPLVSDWLT
FT                   KDWFMTLADFSAYHDIQADIDALYADQLEWNRKAILNVANSGYFSSDRSIKDYLDRIWH
FT                   TRSLDK"
FT   gene            complement(86508..86750)
FT                   /locus_tag="BLA_0067"
FT   CDS_pept        complement(86508..86750)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0067"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28370"
FT                   /db_xref="GOA:B8DV69"
FT                   /db_xref="UniProtKB/TrEMBL:B8DV69"
FT                   /protein_id="ACL28370.1"
FT                   /translation="MKGAVMEKKSSNGWKFFALLFGGLLAAVVGLYIYKQQNPDYDPWE
FT                   EPWENSSSPVDLTLAQDKTEDDLDQPAADAAKDAA"
FT   gene            86979..87779
FT                   /locus_tag="BLA_0068"
FT   CDS_pept        86979..87779
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0068"
FT                   /product="membrane spanning protein"
FT                   /note="COG0705: Uncharacterized membrane protein (homolog
FT                   of Drosophila rhomboid)"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28371"
FT                   /db_xref="GOA:B8DV70"
FT                   /db_xref="InterPro:IPR022764"
FT                   /db_xref="InterPro:IPR035952"
FT                   /db_xref="UniProtKB/TrEMBL:B8DV70"
FT                   /protein_id="ACL28371.1"
FT                   /translation="MPRRGFSLFPDSPSARRIFSAESLRARWRSGEPVVTSAIILVCVA
FT                   VWLLETLFRFVWPAGLAGMLGFGMMQPASMTREPWTLVTAMFLHQPASLWHIGFNMLTL
FT                   WSVGPVLERLMGHWAFLILYMVSGIGGDAGMMIWALLNRSGEGWFTSSYGASGALFGLF
FT                   AAILVVYRKVGQDLTSMIVWMAINFLMPVIVPNIAWQAHVGGFVIGGLFTILMTDGVRA
FT                   LRRRPVLERALIYGAVLLVLLLVVCYACNTANPMRTGSWIPFLD"
FT   gene            complement(88381..88479)
FT                   /locus_tag="BLA_0069"
FT   CDS_pept        complement(88381..88479)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0069"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28372"
FT                   /db_xref="UniProtKB/TrEMBL:B8DV71"
FT                   /protein_id="ACL28372.1"
FT                   /translation="MFEFILPYSADYGTAIEHLFARRCQTAAPRYL"
FT   gene            88921..90183
FT                   /locus_tag="BLA_0070"
FT   CDS_pept        88921..90183
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0070"
FT                   /product="N6-adenine-specific methylase"
FT                   /note="COG0500: SAM-dependent methyltransferases"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28373"
FT                   /db_xref="GOA:B8DV72"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041497"
FT                   /db_xref="UniProtKB/TrEMBL:B8DV72"
FT                   /protein_id="ACL28373.1"
FT                   /translation="MANGCGTGSLVGMANLQMSQETREFIRAHAGEDVRELALHTKRDV
FT                   PGLDLPFALDQIAGREIARTKLPQWAACEGIVYPPHLAMEQCSSQFTAEYKAQVAAQLV
FT                   EEESEPTLVDLTGGFGVDFSAMVRGFAHGTYVERQERLCEVARHNLRELGLGGRADVVC
FT                   GDGVDHLAQMPPATLIYLDPARRDEHGARTYAIEDCTPNALALRGQLLDKAPFVMIKLS
FT                   PMLDWRKTIADFVGSVAQVHITATGNECKEIVVVLARGEHERVRVVCVNDAQRLEFEVG
FT                   ADSAGSWQRADVLDACELGAQRYLYEPNAAIMKAGAFGEITRNYDVRQIGANSHLFVSE
FT                   HPVADFPGRAFEITALGTMNKRDVRQVLGGISAANVSVRNFPLTVQQLRRKLKLRDGGD
FT                   VYLFATTVAGGHMLLRTRKLA"
FT   gene            complement(90437..91048)
FT                   /locus_tag="BLA_0071"
FT   CDS_pept        complement(90437..91048)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0071"
FT                   /product="membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28374"
FT                   /db_xref="GOA:B8DV73"
FT                   /db_xref="InterPro:IPR009619"
FT                   /db_xref="UniProtKB/TrEMBL:B8DV73"
FT                   /protein_id="ACL28374.1"
FT                   /translation="MITGSRLKETTQMAEEELHKTDADVSANDAADSNATVTDDVVVDA
FT                   ATDSEGDAVAVESETVTEEPQTDSEKKAEREEKRAEDNEKRAEEAAVVSEEEADDLSLD
FT                   KIQAVLNSTIDEKDMSPQMRRMVKRQQENTKRVEESIKGTKANPSWFVPLFCAFMIVGL
FT                   IWVVVFYMTAKYPIPGIGNWNLAVGFALIMIGFLMTVAWR"
FT   gene            91119..91916
FT                   /locus_tag="BLA_0072"
FT   CDS_pept        91119..91916
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0072"
FT                   /product="conserved hypothetical protein"
FT                   /note="COG3879: Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28375"
FT                   /db_xref="GOA:B8DV74"
FT                   /db_xref="InterPro:IPR010273"
FT                   /db_xref="UniProtKB/TrEMBL:B8DV74"
FT                   /protein_id="ACL28375.1"
FT                   /translation="MAKHGARHVRKTSVVGSMAVLVVVALVGYLVVTNLRVNKSATVSN
FT                   DAAELIEHRVQRVDELQSEVNKLGSQIDDYNTLLRNNEMQSGNSEEAGQSTMLPAVTGP
FT                   GVTVTLNDSSMWRSAVDSSGSTADIDKYVVHQQDVEAVVDALWAGGAESMQIMDQRVLP
FT                   TSAVICSGNVLLLQGRKYSPPFTISAIGPVDGMLQSLDDSRAIQIYKQYVDAFGLGYDV
FT                   EVNRSLTFQRTPLVLNPLRYAKAFESGGSNESANGGQTTSATN"
FT   gene            92004..93158
FT                   /locus_tag="BLA_0073"
FT   CDS_pept        92004..93158
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0073"
FT                   /product="sortase family protein"
FT                   /note="COG3764: Sortase (surface protein transpeptidase)"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28376"
FT                   /db_xref="GOA:B8DV75"
FT                   /db_xref="InterPro:IPR005754"
FT                   /db_xref="InterPro:IPR023365"
FT                   /db_xref="InterPro:IPR042003"
FT                   /db_xref="UniProtKB/TrEMBL:B8DV75"
FT                   /protein_id="ACL28376.1"
FT                   /translation="MKHGGRRGNASARQDGRIDRLPEVGGKRSVMRSVVMILAEILLTV
FT                   GLVCALYVVWMQWWTGVQSENRQIEERQSVGWAQPASDGANAKIAHPQQGDPPLQPEHA
FT                   SIGELIGRVYIPRFGDAWERNLVQGTDLAELNLHGLGHYVDSQMPGQVGNFAIAGHRNG
FT                   YGQPLGDVDKLQPGDAVVVRTKDYWYVYTYTNYTIVTPDETSVISANPEDPSAPPTKRL
FT                   LTMTTCEPKYTAPTHRWISFGEFKYWAKVSDGVPAELAKKGADGATKFISNEQTPFFAK
FT                   LKTLQPVIWGALIAYAIIFIAAAIAWRWPLLRAIREGRRPRPDVDIYGVLVRHQPGPAP
FT                   IRWLLALLLFVAVSLAIIEWACPWAASHIEILREMSNYTAVNTQ"
FT   gene            93399..94046
FT                   /gene="pabA"
FT                   /locus_tag="BLA_0074"
FT   CDS_pept        93399..94046
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pabA"
FT                   /locus_tag="BLA_0074"
FT                   /product="para-aminobenzoate synthase glutamine
FT                   amidotransferase component II"
FT                   /EC_number="2.6.1.85"
FT                   /note="COG0512: Anthranilate/para-aminobenzoate synthases
FT                   component II"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28377"
FT                   /db_xref="GOA:B8DV76"
FT                   /db_xref="InterPro:IPR006221"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:B8DV76"
FT                   /protein_id="ACL28377.1"
FT                   /translation="MTDSARILVIDNYDSFVYTIVGYLKTLGATVTVVRNDALDPHEDG
FT                   VLDDYDGVLISPGPGAPSESGVSEDVIRLCAQTGTPMFGVCLGMQALAEVYGCTVSHAP
FT                   TIMHGKTSLVEHVDDEIFAGVANPMTATRYHSLAAEPDSVPDELQVTAWTVDDHIVQGI
FT                   RHRELPLFAVQFHPESVLTQDGYRLFANWLAVCGQESAVEKSLGLQPKLAAE"
FT   gene            complement(94356..96488)
FT                   /gene="pknB"
FT                   /locus_tag="BLA_0075"
FT   CDS_pept        complement(94356..96488)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pknB"
FT                   /locus_tag="BLA_0075"
FT                   /product="probable serine/threonine-protein kinase PknB"
FT                   /EC_number="2.7.11.1"
FT                   /note="COG0515: Serine/threonine protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28378"
FT                   /db_xref="GOA:B8DV77"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR005543"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:B8DV77"
FT                   /protein_id="ACL28378.1"
FT                   /translation="MSSMPTTLDNGRYQLGQLVGRGGMAEVHIALDTRLGRTVAVKIMR
FT                   ADLAHDEIFLTRFRREAHSVAQMNNPNIVNIYDSGEEVVTLDNGQTEHLPYLIMEYVQG
FT                   QTLRDIIKANGALSVSDTEHVMIGVLNALEYSHRMGIIHRDIKPGNIMISEQGIVKVMD
FT                   FGIARALDDSATTMTKSQGVVGTAQYLSPEQARGENVDMRSDLYSAGCVLYEMLTGRPP
FT                   FTGDSAVAIAYQHVSEVAAKPSSIVPGLNPMWDQIVAKAMAKDRQNRYATATEFKNDIL
FT                   TYMNGGLPSAAAFNPLQDLSTINATKTQTMAAANDYPANEGSTRVYNPVTGQFQTVPQD
FT                   PNAAAGDTDTMVKSRSQKRLEAARKRKRNTIITVVVLVVLALAAAGGWYAWAHMQPPKK
FT                   EYVTVPTFSATTTEERAKAQLAELGLQASIKQDTDSREPAGTFTKQAPAGGRSVEKGST
FT                   VTVWFSAGPKSVPVPNVTGQSQADARAALEAAGFEVNSSVQTEDSATIERDHVTRTDPA
FT                   AGTSAEQGTTVSLWVSSGMTKVPSGLIGKSKDEAVDELQKNGFAVEINTENSSQPENTV
FT                   TRIEPNEGTSVERGASVTIWVSNGKVAVPNVVGRTLGEAKAALTDSALNLKWKVAANSK
FT                   DNDDAVVTASNPSAGSQVNPGTEVTLTTEPKESPSPSPSPSNSNGSSGSNGNSGNGDSN
FT                   SGSQSSQNQQNSDNKH"
FT   gene            complement(96481..97506)
FT                   /gene="pknA"
FT                   /locus_tag="BLA_0076"
FT   CDS_pept        complement(96481..97506)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pknA"
FT                   /locus_tag="BLA_0076"
FT                   /product="probable serine-threonine protein kinase"
FT                   /EC_number="2.7.11.1"
FT                   /note="COG0515: Serine/threonine protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28379"
FT                   /db_xref="GOA:B8DV78"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:B8DV78"
FT                   /protein_id="ACL28379.1"
FT                   /translation="MRLIEGQLIHCRYRLDSRLAQGGMGEVWKGYDIQLGRPVAIKALR
FT                   KDTTNQESKLRRLRAEARNSANLAHPNIAALFEYYEHDGIGFLIMEYVPSKSLADLYHE
FT                   LDGPMDPIRLLPILIQTARGLFVAHSHGVIHRDVKPANIMVSDNGEVKITDFGVSYSTN
FT                   QEQITQDGMVVGTAQYISPEQAQGQQATPQSDIYSLGVVAYEGLCGHRPFTGATPVDIA
FT                   AAHVNNPVPPLPNTVDFQLSQFVMSMLAKDPADRPQDALTVARVLSRIERRLLDQQTAL
FT                   SDTTMVNINGRVPRRVTSAPHHDLQTYQSAFPFAQQTQRDAGTDSPGHAIAGGFGRSIN
FT                   E"
FT   gene            complement(97503..98969)
FT                   /gene="pbpA"
FT                   /locus_tag="BLA_0077"
FT   CDS_pept        complement(97503..98969)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pbpA"
FT                   /locus_tag="BLA_0077"
FT                   /product="probable penicillin binding protein
FT                   transpeptidase"
FT                   /note="COG0768: Cell division protein
FT                   FtsI/penicillin-binding protein 2"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28380"
FT                   /db_xref="GOA:B8DV79"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR036138"
FT                   /db_xref="UniProtKB/TrEMBL:B8DV79"
FT                   /protein_id="ACL28380.1"
FT                   /translation="MNKTLRQLFTAVIVLFVILGISSSIIMVNRANRLSHDSRNTRALY
FT                   QTYGAPRGSILASDGTIIAKSDPVNDSFSYQRSYPQGDIYAPITGYFSIAQNADRGIEA
FT                   SENELLTGESNALFWQHVKALFTGKENKGASIETSIDPKLQTAAMEALKNNDGAAVAIE
FT                   PKTGRILAMASTPSYDPNELASHDTGSVSKAYTELVTNPSNPMLNRAISELYPPGSTFK
FT                   TVVAAAALDSGKYQLDTQIPAGASYTLPGTQTQLTNAEEPGNGTDGKISLKDAMAWSSN
FT                   TAFAQLGVALGDESVSNMAKKFGFDKPIVIDGTDSNGLPMQAVASRFPTNVGDDRLALA
FT                   SIGQGDTVETPLQNAMIAAAIANDGKVMKPTLVDRVRFSDLSVMPDTKPQVMDTAFSAD
FT                   TANKLTEAMEAVVTDANPNLEIPGVKVAAKTGTAQIGANNSSIDGWVMGFAPADDPKIA
FT                   VAVVVHNVDLYGSFAAGPIMTAIMKEALQQ"
FT   gene            complement(98962..100704)
FT                   /gene="rodA"
FT                   /locus_tag="BLA_0078"
FT   CDS_pept        complement(98962..100704)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rodA"
FT                   /locus_tag="BLA_0078"
FT                   /product="protein involved in cell wall formation and
FT                   stabilization of the FtsZ ring during cell division"
FT                   /note="COG0772: Bacterial cell division membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28381"
FT                   /db_xref="GOA:B8DV80"
FT                   /db_xref="InterPro:IPR001182"
FT                   /db_xref="UniProtKB/TrEMBL:B8DV80"
FT                   /protein_id="ACL28381.1"
FT                   /translation="MAARVRYLLQIIFALLISALGFFQLSERMNGKPTSGSVVMQIVCA
FT                   IMFLVAWGLMSRFQKFGNQSIFACVLMLTSIGILMISRIDGEMDTAVAIRQMMWLCLAL
FT                   VCCYALFAFMKDYRILRRFSYVSMVIGLALLLSPMIPGLGREIGGARIWIGVGSYQLQP
FT                   GEFAKLFLAFFFASYLFNHRDQLAVGGRKVLGLQLPRLRDLGPIVIVWVASMGVLILQH
FT                   DLGTSLMFFAMFVAMLYVATGRASWLIIGFLAFAIGCVAAAHLFAHVGYRVDAWLHPFD
FT                   SEIYNRYPGGSSQIVQGLFGLAAGGLFGTGLGEGHPAITPLANSDFIFASAGEELGLVG
FT                   VFAILMLYLLIIAAGMITAMKIKDGFGKLLASGLVFTMAFQVFTVVGGITLVIPLTGLT
FT                   MPYMAAGGSSLIANYILAALLIIISNAANKPQNDLMTDTFRMEAVHALSSRKPRQRKAS
FT                   GNATQVTKPRGNREEEPRPRTSQLPVTSAAVQQSAAVSASPAQDDSATQVVSPQPIVAP
FT                   QQTSEPVSNTRNIPVSPQQATPSAGEETEAMAPLNPSVPPLPQQPHTPTNHQATTSEGG
FT                   AEHE"
FT   gene            complement(100707..102260)
FT                   /locus_tag="BLA_0079"
FT   CDS_pept        complement(100707..102260)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0079"
FT                   /product="possible phosphoprotein phosphatase"
FT                   /EC_number="3.1.3.16"
FT                   /note="COG0631: Serine/threonine protein phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28382"
FT                   /db_xref="GOA:B8DV81"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR015655"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:B8DV81"
FT                   /protein_id="ACL28382.1"
FT                   /translation="MADLYMYSTTVSDVGTVRSNNQDSSFAGEHLVAVCDGMGGHAGGD
FT                   TASTIAIRSLAHIETDSAGGDVAKAAAIIEASTLAAHDAIVGKAKRERKLAGMGTTVTA
FT                   ITLVSDYWVIAHIGDSRAYLLRDGKLMRLTTDHSYVQHLIDTKRINEVEARNHPQRNVV
FT                   MRVLGDFDIDAHPDISIRRAEAGDRLLLCSDGLCGVLEDSTIEETLSHFTDPEECAQTL
FT                   VSMALKAGSTDNVSAVIADSTIALDADSFDLPHQTPLIGGAASATLEPIADIIHEPVAS
FT                   APALITRSSPAERAAALIASDSNKAAQSEEHDATQQVAQPSTVREENGELQDPDTGEIP
FT                   VIRKSDGRYSADPNDPEVARAIHHEHLQEKKQARSRRFRGKIIGSVVAVAIVAVLALGT
FT                   WAAYAWSQTQYYLASDNGVVTVYQGVPTNIFGYELSHAIEHTDLKVDELPEQWQDRLRQ
FT                   GISVDGYDEALSHVELIRTQFNDLKKEQEQKAKEDADAKAKQQKQANDSKSPTKSAQSR
FT                   "
FT   gene            complement(102267..102812)
FT                   /locus_tag="BLA_0080"
FT   CDS_pept        complement(102267..102812)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0080"
FT                   /product="putative membrane protein"
FT                   /note="COG1716: FOG: FHA domain"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28383"
FT                   /db_xref="GOA:B8DV82"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="UniProtKB/TrEMBL:B8DV82"
FT                   /protein_id="ACL28383.1"
FT                   /translation="MITELTFAVLKYAFLILLWLFVWFITRSLYRDVAAFSPRKSRARR
FT                   RKEREVRKSNDALAVSASAQPLPVSAPTPSAAAPSDTAPTPTLLVIIDGPLAGTSVPLN
FT                   SSVITLGRAASNTVVLDDEFVSSHHARVYPDPNTGVWAIEDLHSTNGTVVNQQRISAPT
FT                   ILGPRVPVRIGATTFELR"
FT   gene            complement(102831..103532)
FT                   /locus_tag="BLA_0081"
FT   CDS_pept        complement(102831..103532)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0081"
FT                   /product="forkhead-associated protein"
FT                   /note="COG1716: FOG: FHA domain"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28384"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="InterPro:IPR022128"
FT                   /db_xref="InterPro:IPR042287"
FT                   /db_xref="UniProtKB/TrEMBL:B8DV83"
FT                   /protein_id="ACL28384.1"
FT                   /translation="MSVLDRFEKSVEGAVNGVFAKFGSKDLQPVDLSSALEREIDAEAM
FT                   PVGRDRTVAPNEYRFKLSTPDFDRIESWGSEAMANELADNLTQYAKSQHYAFVGPVVVI
FT                   FEEDLQLTKGNFKLTSESVQGNAVPVTTDEQAEDCPMLEVNNNQYLLTKDKTILGRGSG
FT                   CDIVIDDPGISRKHLEIDITDNGVIARDLGSTNGTYVEGHQVPAATLLDGNTITIGRTR
FT                   ILYWASSQDQR"
FT   gene            104297..106711
FT                   /locus_tag="BLA_0082"
FT   CDS_pept        104297..106711
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0082"
FT                   /product="probable dipeptidyl peptidase IV"
FT                   /EC_number="3.4.14.5"
FT                   /note="COG1506: Dipeptidyl
FT                   aminopeptidases/acylaminoacyl-peptidases"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28385"
FT                   /db_xref="GOA:B8DV84"
FT                   /db_xref="InterPro:IPR001375"
FT                   /db_xref="InterPro:IPR002469"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR038554"
FT                   /db_xref="UniProtKB/TrEMBL:B8DV84"
FT                   /protein_id="ACL28385.1"
FT                   /translation="MESAIEEYPVRKAKTVRFTCGAPRSPKLIGDGSRMLFLRSAGEQD
FT                   TENSLWLAICGEDAYAEVELVNAGELVNTLGSDDVPAAERARRERARESATGIVAYSVD
FT                   GLGNHVAFTVNGELFVTTIDWDALAYTVGDDGVRAQVGAGVRTEHLVPQFADSAQNEFA
FT                   GPVLNPRMSPDGKRVAYATGSAVVVVDVQTAVANAVFTVSPQDRETMRAGLAEFAAGEE
FT                   MDRYDGFWWGPDSRTLLVECFDSSPEPVWTISDPADPAARGIQHRYPRALTENAVVDLF
FT                   AVRLGDDGTSVQKTAMIDWDNVAYEYLAVVDWQAERPVLRVLDRLQQHEQILRVAMPAE
FT                   NEWGDLRALDGNVMALLPVEVIAEHHNDQWIDLVGGTPCVTPSGAVVCSVNDMEADTNR
FT                   LSVDGRVFTPAGWQVREVLDAGTDDVLCVVQRTAERAAEVPEQWADSTAERYHDARSFD
FT                   IVTISYADGSVRAVSDEPGVWRASRRGDGLVVWGRTMDSAKAVMRLSYGAEGARTGHDV
FT                   CNVAAEPDFVPNVRFVRLGERKLFTAIVAPSASSRFAGAAELPVLMHPYGGPGHQEVVM
FT                   SRAAYLDAQWWADQGYLVVIADGRGTTGRGPVWDREVYLQMKRVSLADQVDAVHALAGA
FT                   VDELNRMGGAAEGCEFGGHDDAARPLPKPDLERVAMIGWSYGGFLSALAVLDAPDTFAA
FT                   ACAGAPPTDWTLYDTCYTERFLGLDPQVYADNSIVLDAPKLVRPLMLIHGFADDNVTIA
FT                   HSLRLSQALMEAGRPHTFLPLTGITHMTNDPDVARNLLILQRDFLSDALAR"
FT   gene            complement(106750..107667)
FT                   /locus_tag="BLA_0083"
FT   CDS_pept        complement(106750..107667)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0083"
FT                   /product="putative permease"
FT                   /note="COG0697: Permeases of the drug/metabolite
FT                   transporter (DMT) superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28386"
FT                   /db_xref="GOA:B8DV85"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:B8DV85"
FT                   /protein_id="ACL28386.1"
FT                   /translation="MSGKGEQTPSFEQTPRKMAIGIACVLIGGTCWGVNGAVSKILMEE
FT                   YHAAPLWIACVREIIAGIIFLVAAMIGTPHSLRSAVTSWREYPKFVGAALTCVTLVQVA
FT                   YLFSIHWTNAGTATVLQTVNLLMVLIYVCVRAKRRPTKREVIGVALAFVGVWLLATGGK
FT                   LSTLSMPLPGLFWGLMDAFSCACLAIIPVGLIARYGNLTFNGLTFLISGLILLPFVKPW
FT                   QNMPHFDARGWWLMAFTVVVGTVVAFWLFMAGVVRIGSMRATLLATIEPVTATISSVLW
FT                   TGSVFTPVDIVGFVLILIMSFLVQ"
FT   gene            complement(107887..108972)
FT                   /locus_tag="BLA_0084"
FT   CDS_pept        complement(107887..108972)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0084"
FT                   /product="lysophospholipase L2 PLDB"
FT                   /EC_number="3.1.1.5"
FT                   /note="COG2267: Lysophospholipase"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28387"
FT                   /db_xref="GOA:B8DV86"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B8DV86"
FT                   /protein_id="ACL28387.1"
FT                   /translation="MEIAMINEHEFQQDLEATALPALDSCMHDGYMDPAVSDWHGHRLR
FT                   TLHPADGTPNKLHVVRYDVEKFHALQIPGSSRQTHGTVLISHGFTEFAAKYKEMAWYFL
FT                   LAGFSVCILEHRGHGYSARDVRNDQIVYIDTWHRYVADLAKCARTIARPMAADKPLVLF
FT                   AHSMGGGIAAAMLERYPNIVDKAVLSSPMIEANLHTPNWLAALVCGAACDFGHAKSMAP
FT                   GQRAFTPLIDIKDNQGACMQRLEWMKKLRIADTHYQTSAAANEWVRQAIRLSIAMQDPH
FT                   MCERIETPILLFQAGNDHWVRNKAQNRFVKRVGKDGGDIRMVRVPGSVHEIFTMPNSVM
FT                   APYLKEILTFLQTSEPVTVLV"
FT   gene            109151..109489
FT                   /locus_tag="BLA_0085"
FT   CDS_pept        109151..109489
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0085"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28388"
FT                   /db_xref="GOA:B8DV87"
FT                   /db_xref="UniProtKB/TrEMBL:B8DV87"
FT                   /protein_id="ACL28388.1"
FT                   /translation="MVAQNIIMTVLNVIVLVALLVFGVYAVYNNKPNFELTPAHLYDQQ
FT                   MGQKYGIWVFICVIISWLVTLPGLFGPLSNTWNQILWWVELIFNIATLVFCVLASFYYS
FT                   RLNTRPHD"
FT   gene            109569..110522
FT                   /gene="rrmA"
FT                   /locus_tag="BLA_0086"
FT   CDS_pept        109569..110522
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rrmA"
FT                   /locus_tag="BLA_0086"
FT                   /product="rRNA (Guanine-N1-)-methyltransferase"
FT                   /note="COG0500: SAM-dependent methyltransferases"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28389"
FT                   /db_xref="GOA:B8DV88"
FT                   /db_xref="InterPro:IPR016718"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:B8DV88"
FT                   /protein_id="ACL28389.1"
FT                   /translation="MSPEKLARFADSWKYFVCPLCREELRLEGTSLRCERGHTYDVARQ
FT                   GYVNLAPGARQSEYYSRESFEHRGQILSAGYYSHIVDAVLSAVGRYCGQIAASIDFAGL
FT                   RTRSGAQLRGARGRADLRSSGPQMRAPVILDVGCGEGFYARAVQAAHPDATVLAFDISK
FT                   DSVQLAAREDAGCAVRWFVGNLAELPVRDGAVDCVLDVFSPVNYAEFTRVLGGSGVVIK
FT                   VVPGARHDEQLRELARGQLRHGDYSNEQVVGQFAEHFDVLERRLVSQTFPMPADDVLAF
FT                   ARMTPLLFNVDVDSLDLSRIHELTVEAEILVGSVCG"
FT   gene            complement(111024..111278)
FT                   /locus_tag="BLA_0087"
FT   CDS_pept        complement(111024..111278)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0087"
FT                   /product="predicted membrane protein"
FT                   /note="COG2261: Predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28390"
FT                   /db_xref="GOA:B8DV89"
FT                   /db_xref="InterPro:IPR007341"
FT                   /db_xref="UniProtKB/TrEMBL:B8DV89"
FT                   /protein_id="ACL28390.1"
FT                   /translation="MHWLWVLIVGAIIGAIAGAITHHSGAMGRISNIIAGLVGSALGEA
FT                   LLGHWGPQLAGMAIIPSLIGAIVVVAVVSFFLMRSSAKN"
FT   gene            complement(111550..111807)
FT                   /locus_tag="BLA_0088"
FT   CDS_pept        complement(111550..111807)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0088"
FT                   /product="integral membrane protein"
FT                   /note="COG2261: Predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28391"
FT                   /db_xref="GOA:B8DV90"
FT                   /db_xref="InterPro:IPR007341"
FT                   /db_xref="UniProtKB/TrEMBL:B8DV90"
FT                   /protein_id="ACL28391.1"
FT                   /translation="MDTMFWIWTLIVGAVIGAIAGAITNNGHSMGWISNILAGLAGSAL
FT                   GQGLFGSWGPSLGGMAVVPSVLGAVIVVAIVSFIVMKVRA"
FT   gene            complement(112363..112448)
FT                   /locus_tag="BLA_t0003"
FT   tRNA            complement(112363..112448)
FT                   /locus_tag="BLA_t0003"
FT                   /product="tRNA-Leu"
FT   gene            complement(112578..114026)
FT                   /gene="fprA"
FT                   /locus_tag="BLA_0089"
FT   CDS_pept        complement(112578..114026)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fprA"
FT                   /locus_tag="BLA_0089"
FT                   /product="probable ferredoxin/ferredoxin-NADP reductase"
FT                   /EC_number="1.18.1.2"
FT                   /note="COG0493: NADPH-dependent glutamate synthase beta
FT                   chain and related oxidoreductases"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28392"
FT                   /db_xref="GOA:B8DV91"
FT                   /db_xref="InterPro:IPR021163"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B8DV91"
FT                   /protein_id="ACL28392.1"
FT                   /translation="MTQDSELRIAVIGAGPAGVYSSDIFLRQLAKLGDELGLGTDARID
FT                   LFEKLPVPFGLVRYGVAPDHPSIKFIASALEKTLDNPNIHLYADVEFGKDVTLEDLLER
FT                   YDAILFATGAIKDKPLAIPGADLDGVYGAARFVEWYDGYPTGVREWPLEAERVAVIGGG
FT                   NVAMDVARELMRNADDLRAKTDIPDNVYEGIKNNKAKELHLFIRRGVAQAKFSVQELRE
FT                   MEKLPGVQLIIDEDDFELDDDTVEEAGKDKLTRQMVEELFVIRDMAEDMEDDGDVDFEG
FT                   NPADRKYYIHFNSAPTEILGEDGKVRGIRVERTETGADGKMHRTGEFTDYPVEAVYHAI
FT                   GYKPESVPGIAYDEGGAHLANANGDGRITVDHENGEVRERLYATGWAKRGPVGLIGSTK
FT                   SDALMIVTAMLEDLAQNKENARLAPDRDPESIDRLLAERGVRPIDFAGWKRVDAYERAE
FT                   GAKEGREHKKVIDPDQFRALAHGE"
FT   gene            complement(114216..116450)
FT                   /locus_tag="BLA_0090"
FT   CDS_pept        complement(114216..116450)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0090"
FT                   /product="probable cation-transporting ATPase V"
FT                   /note="COG2217: Cation transport ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28393"
FT                   /db_xref="GOA:B8DV92"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:B8DV92"
FT                   /protein_id="ACL28393.1"
FT                   /translation="MKKIIDLCKEVPLLPLTILAAIPLALIPQWRPWGHIHPAFDPGVG
FT                   EWIIILFVAWTIYTSIREMIDSIRHGHIGVDLLAIVALVSTVCVQQYWASWAVVLMVAS
FT                   GEAIESYAQNKARGNLTALIKAAPQQAHVVTLPGVADGGEAQLTEEGFRKVQQAVEQAQ
FT                   REGKPITMGNGHFDTVPVNDVKLGSVLIVLPGEIVPVDGQLLSGTASVDLSNINGEPVP
FT                   RTLFVGAKVLSGSINGSTTMMIRTTSLAADSQYQQILKLVSSAEESRAAVVRTADMLAV
FT                   PFTIISFAIAIVAWIVSGTGLRFAQVLVLATPCPLLIAAPVAYVAGTARLAKQKILIKS
FT                   QDVLENLGRVTHVFFDKTGTLTVKQPQVVRVEKAKDMPANVSEDEILMLAGMVEGFSVH
FT                   VLAKGIVAAGKEAMARLHRLPSSSGKTAADGAGQRELPNPNENYPVVGNVSETPGKGVT
FT                   GTVDGHKVEVGRFAFVTEQSIASEEVHTAQEEERNEKAMEQADREAAKLWPTELEPDEM
FT                   ATYIAIDGKLAARIVLRDVPRYNAKQSIAQLRELGVKEETMLTGDKKASAMIIANEVGI
FT                   TDVRYELLPQDKVNAVREAAAAEKTGRESGWKRFLAKLLGEPIHRDVTMMVGDGVNDSP
FT                   VLAVADIGMAMTDGTSTAASESAEVVIMNDDIGAVPLGVKIARQTKQRMLQAVLIGIAL
FT                   AIVGMVCAAFNLIPVVVGAFLQEAIDVVSILWALTALFNRKQASHAGIRT"
FT   gene            complement(116759..118600)
FT                   /gene="degP"
FT                   /locus_tag="BLA_0091"
FT   CDS_pept        complement(116759..118600)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="degP"
FT                   /locus_tag="BLA_0091"
FT                   /product="possible DO serine protease"
FT                   /note="COG0265: Trypsin-like serine proteases, typically
FT                   periplasmic, contain C-terminal PDZ domain"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28394"
FT                   /db_xref="GOA:B8DV93"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR001940"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:B8DV93"
FT                   /protein_id="ACL28394.1"
FT                   /translation="MADDNNNWPTGTPDQNAGSDEHHTDANIGANTEDLNTAPAAPADE
FT                   QPTSVLTPVSGSATEQGEKNDSTSVDGTRKPEPYRLAPQYGAYAPTSQQETTRIPTPPQ
FT                   QGAPNAQQSGLPYQTQNNPQNMPYGVRVDQNQPNAPQGAPNAQNRNPYGVPTGNPFAPS
FT                   NGTPAGPGNPNGPTQSPFGPGSPQQGQPARTPSNIIVAVVAALVAAAICLGVGYAALTN
FT                   GWVKIPTSSSLSSVSSNNHGSGSATVEGGQAPNWASVSANVSKSVVSIQTVVDQGEAKG
FT                   SGAILDKEGHIVTNNHVVSGAKQIQVTLDNGDIYSAKVVGTDSTTDLAVIKLDNPPKDL
FT                   TPITFANSDSLTPGEPIMAIGNPLGYDGTVTTGIVSALNRPVTVMDEENNNAIVTNAVQ
FT                   IDAAINPGNSGGPTFNAAGQVIGINSSIASTASSTQTAGSIGIGFAIPANLVKRVADEI
FT                   IQNGKVEHVALGVTIQSATVEADGVTRGGAVVKSVVANSPAAKAGVKTGDTIVGFNGLA
FT                   VNNNYSLLGFVRAAAMGSTAKLTVVRDGHTMELNVTFDQAEAAVNGSNRNENQNNQNGQ
FT                   NDQNNNGQNDQNNNDGNSDNNNRNRNNDGLIDPFGMW"
FT   gene            118775..119389
FT                   /locus_tag="BLA_0092"
FT   CDS_pept        118775..119389
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0092"
FT                   /product="possible alpha beta hydrolase"
FT                   /note="COG1011: Predicted hydrolase (HAD superfamily)"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28395"
FT                   /db_xref="GOA:B8DV94"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:B8DV94"
FT                   /protein_id="ACL28395.1"
FT                   /translation="MQTDFSAVVFDYFDVLVDWRPHRVVGAFYPPGVTDMFFDDHDPHG
FT                   YEFCRARAAAGVPDGKILDDYTREHGPAVGWILRLLLQHRALGFYDMPVGMPTLLRELR
FT                   AAGVRMVGLANCSETAVEQMQVKYPWLGLLDGTMVSARECIAKPDPALFERAIRAFHLD
FT                   TAHTLFVENTAANAAAACELGLHAVRFESAEQIRALLLPVS"
FT   gene            119887..121416
FT                   /locus_tag="BLA_0093"
FT   CDS_pept        119887..121416
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0093"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28396"
FT                   /db_xref="InterPro:IPR006597"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:B8DV95"
FT                   /protein_id="ACL28396.1"
FT                   /translation="MEDFEFLHEHEKGFEPSGEFIESRSKVPILEYGMDYYCFADIVIG
FT                   PVLPAVYLTNPLFATDNEGKPHYYGRERVGRYPGGTWWDWGPDEPKSSTMRIEPVPISP
FT                   VNVMGETVVPYERWVESYRNLPGTPFYSSLDDSGDYCDKASVFDPHGREAYRRAMFYME
FT                   EAMRVHRAYSDEDERQRFHDCVKLAEILFRHAAGRGDARAWVALGKIYKEDLNNGDYFN
FT                   SYYTASIKGHPPMIEQPPIGERARICFERAAELGDPEALVFLGDLRIEGMVCERDESAA
FT                   FELYRRAYALVDERHAMHYIKASAALRLARCLEYGVGCEIDLMQARDLYRFAHTYLRAI
FT                   ARTYFWWFARERREAMAHDQDLTQLLSHPSHVQRVALSRMGTPHPYESVTKFLPMLESM
FT                   GEFGDVVNPFYVSYNGIVLRFMDEVNRVLDRQPDLGFFDYLGLLHAKLLDAPIDVVDPA
FT                   DYDARTVMAMIIYVVRQEKFGEGLMLHSLNHGLIQRWLRRLVQIDDERASS"
FT   gene            121516..122853
FT                   /gene="tgt"
FT                   /locus_tag="BLA_0094"
FT   CDS_pept        121516..122853
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tgt"
FT                   /locus_tag="BLA_0094"
FT                   /product="queuine tRNA-ribosyltransferase"
FT                   /EC_number="2.4.2.29"
FT                   /note="COG0343: Queuine/archaeosine
FT                   tRNA-ribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28397"
FT                   /db_xref="GOA:B8DV96"
FT                   /db_xref="InterPro:IPR002616"
FT                   /db_xref="InterPro:IPR004803"
FT                   /db_xref="InterPro:IPR036511"
FT                   /db_xref="UniProtKB/TrEMBL:B8DV96"
FT                   /protein_id="ACL28397.1"
FT                   /translation="MTANTESIVQAPAPQLVEHPRGAEPGKPGDRSAFRFEQTTRLPDS
FT                   PNGKGKGGARYGRTGILHTPHGDIKTPAFVPVATQGAMKAVLPESMTQLGAQCLLSNAF
FT                   HLYERPGEDVLDEAGGLAKFMNWNGPTFTDSGGFQVLSLGAGFKKTLAMDVKGMKSDDV
FT                   IAEGKERMAFVDEDGVTFKSPLNGSLHRFSAEISMNIQHKLGADIMFAFDELTTLMNTR
FT                   RYQENSVERTYRWAQRCVAEHERLTQSRLGKPYQALYGVVQGANYEDLRRHAASQIASL
FT                   DFDGVGIGGAMEKRIIGDICAWICDEMPESRPRHVLGIAAVDDIFACVENGGDTFDCVA
FT                   PARCGRNGAIFTRDGRYNIKRAQYKHDFGPLEEGCQCYTCTHYTRAYVDHLLRAHEMNG
FT                   FTLATIHNEYFFVHLLDDIRASIDGGYFDEFRDETLARFYANGSRG"
FT   gene            complement(122913..122986)
FT                   /locus_tag="BLA_t0004"
FT   tRNA            complement(122913..122986)
FT                   /locus_tag="BLA_t0004"
FT                   /product="tRNA-Gly"
FT   gene            complement(123081..124052)
FT                   /gene="htpX"
FT                   /locus_tag="BLA_0095"
FT   CDS_pept        complement(123081..124052)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="htpX"
FT                   /locus_tag="BLA_0095"
FT                   /product="probable protease HtpX"
FT                   /note="COG0501: Zn-dependent protease with chaperone
FT                   function"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28398"
FT                   /db_xref="GOA:B8DV97"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="InterPro:IPR022919"
FT                   /db_xref="UniProtKB/TrEMBL:B8DV97"
FT                   /protein_id="ACL28398.1"
FT                   /translation="MTGKLHLHNHYNGLKTAVLFAIMWAIIMIIWWATGARTSTLGIYL
FT                   AIGVGTSFISYWFSDKLAIASMHAQPVTEQQAPELYRIVRELSQRAGKPMPRIYIAPTE
FT                   TPNAFATGRNENHAAVCCTQGILRILDEREIRGVLGHELMHVYNRDIRTSAIAGAMATV
FT                   LTYLGYSMMYIGNSSSSNRDRDNGAGLLGLIGILLSTVLAPIAASLIQMAISRTREYDA
FT                   DEDGSELTGDPLALASALRKISGGVDANPLPKTSTDTSTAAMMIESPFRGADVSRLFST
FT                   HPPTEDRIARLNQMAVDMGQIAPGAASPQVAGYAQYSQYRQH"
FT   gene            complement(124102..125118)
FT                   /locus_tag="BLA_0096"
FT   CDS_pept        complement(124102..125118)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0096"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28399"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:B8DV98"
FT                   /protein_id="ACL28399.1"
FT                   /translation="MVCLGVGLNIVGLGRDTQAIPPAPVTEVEAPQLPVPLTDDAIKAA
FT                   GLHEATPTVSVSQMTATALDNLSAVDGSSALDTVAISLSSDQREQIEQNLQAFADAGAQ
FT                   VSFAVADLGSGGVIAANGGVARYPASSIKAPYIVSLLQEGAVNLDETASGSTLSAQINA
FT                   DHIAGVLRYSDNDGYDALWNAHLNSAIIPWSEGLVENPERMRGFQYPDVSAVELAKMWV
FT                   KTYGYLFADAEGEPNAGETASAPAREWLASSMHHSLNSSIDAAHGGEENPDGTVVLSKA
FT                   GWINGEGDYYALNDAGIVLPSGESGNEPGYAIAIMSNACGRNDLLADLAGTLHNILS"
FT   gene            125420..126061
FT                   /locus_tag="BLA_0097"
FT   CDS_pept        125420..126061
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0097"
FT                   /product="conserved hypothetical protein"
FT                   /note="COG2135: Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28400"
FT                   /db_xref="GOA:B8DV99"
FT                   /db_xref="InterPro:IPR003738"
FT                   /db_xref="InterPro:IPR036590"
FT                   /db_xref="UniProtKB/TrEMBL:B8DV99"
FT                   /protein_id="ACL28400.1"
FT                   /translation="MCAHYLGLTDAELERLVDELTMQCQRSRARVGADDEFAGVGVEAY
FT                   PKSVVPIIVPKFDTAVGVPELEPGSLETARAQWGFEQQWTPQPVFNTRIESADKPMWRA
FT                   PMEHDRCVIACRWFYESHGSEMAVSARTGRKIKQQYVFRVPDEPVMLIGGVRRGSQFSM
FT                   VTTQANADMEPIHPRMPLIVRQGELDLWLGPDYRALADRSDIPLESKPVR"
FT   gene            126182..127408
FT                   /locus_tag="BLA_0098"
FT   CDS_pept        126182..127408
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0098"
FT                   /product="AraJ-like protein probably involved in transport
FT                   of arabinose polymers"
FT                   /note="COG2814: Arabinose efflux permease"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28401"
FT                   /db_xref="GOA:B8DVA0"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B8DVA0"
FT                   /protein_id="ACL28401.1"
FT                   /translation="MATRADRGGKQGRTGGNGLGLFALAAGAFVLGAAEFVMMGILPQT
FT                   AQTLQVSIPTAGHFISAYAIGVCVGTLMLVFGRRIPPRTLIVMFMVIACAGNALSAMAV
FT                   NAPMLVGARFLAGLPHGAFFGTATLVAKLLARKGKEARAVASMVTGQTVANMLGVPAGT
FT                   LLAEHMSWRLAFVALAVCAAVTAVLARAWIPSVAPVRDAGLRGQFRFLRQPGPWMVLIA
FT                   VFVGNTGIFCWWSYVSPWLQKVGGWPNNTISALMMLAGFGMVVGGLIGGRIADRWVPGG
FT                   TSALGQCIACVGLLAVFLVPGSRWSTALFAFVISFALFFVSAPQQLLMAEAGKGGGELI
FT                   GGATVQIAFNFGNAVGSMVGGGVLDASHMNYHYPALSGVPFAALAVLLLVLYSVRYERR
FT                   GRDENPLRA"
FT   gene            complement(127491..127754)
FT                   /locus_tag="BLA_0099"
FT   CDS_pept        complement(127491..127754)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0099"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28402"
FT                   /db_xref="UniProtKB/TrEMBL:B8DVA1"
FT                   /protein_id="ACL28402.1"
FT                   /translation="MGILFINGGEIGGNTAHLGHAFLEGRDFTQIDLAGKRLFFLFRGG
FT                   APTQQMYERGEYTINRFAGLYGMDYMGMARNASEARALAAKL"
FT   gene            127800..127892
FT                   /locus_tag="BLA_0100"
FT   CDS_pept        127800..127892
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0100"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28403"
FT                   /db_xref="UniProtKB/TrEMBL:B8DVA2"
FT                   /protein_id="ACL28403.1"
FT                   /translation="MRALPVATPRSADYHMPNMHDHAADWSDAI"
FT   gene            complement(127904..128002)
FT                   /locus_tag="BLA_0101"
FT   CDS_pept        complement(127904..128002)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0101"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28404"
FT                   /db_xref="UniProtKB/TrEMBL:B8DVA3"
FT                   /protein_id="ACL28404.1"
FT                   /translation="MAIVTHIKALPLLEQPAHDLRIAGEQPRAPAP"
FT   gene            complement(128067..128327)
FT                   /locus_tag="BLA_0102"
FT   CDS_pept        complement(128067..128327)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0102"
FT                   /product="putative DNA-damage-inducible protein J"
FT                   /note="COG3077: DNA-damage-inducible protein J"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28405"
FT                   /db_xref="GOA:B8DVA4"
FT                   /db_xref="InterPro:IPR007337"
FT                   /db_xref="InterPro:IPR013321"
FT                   /db_xref="UniProtKB/TrEMBL:B8DVA4"
FT                   /protein_id="ACL28405.1"
FT                   /translation="MSETATVSFRTDPKVKEEAKALYESMGMDLSTALNVFLRQSIRDN
FT                   GMPFKITREQPESIEARRQTEAHEGRSFTSSESLMKDLMDA"
FT   gene            complement(128425..128904)
FT                   /locus_tag="BLA_0103"
FT   CDS_pept        complement(128425..128904)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0103"
FT                   /product="methylated DNA protein cysteine
FT                   S-methyltransferase"
FT                   /EC_number="2.1.1.63"
FT                   /note="COG0350: Methylated DNA-protein cysteine
FT                   methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28406"
FT                   /db_xref="GOA:B8DVA5"
FT                   /db_xref="InterPro:IPR001497"
FT                   /db_xref="InterPro:IPR014048"
FT                   /db_xref="InterPro:IPR023546"
FT                   /db_xref="InterPro:IPR036217"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036631"
FT                   /db_xref="UniProtKB/TrEMBL:B8DVA5"
FT                   /protein_id="ACL28406.1"
FT                   /translation="MQGFATYASEYGPVRVDWQDDAVVRLRIIPQADYDADGAGETTGL
FT                   TDETFRELEQYFAGELRRFTVPIAFASGTPFQQAVWRALLQIPYGETRTYAQIAEAVGH
FT                   PKAVRAVGSANNRNPIPFIVPCHRVVGANGNLVGYAYGVEMKRSLLQMEMRTLGQ"
FT   gene            129148..130518
FT                   /locus_tag="BLA_0104"
FT   CDS_pept        129148..130518
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0104"
FT                   /product="oxidoreductase"
FT                   /note="COG4447: Uncharacterized protein related to plant
FT                   photosystem II stability/assembly factor"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28407"
FT                   /db_xref="GOA:B8DVA6"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR036278"
FT                   /db_xref="UniProtKB/TrEMBL:B8DVA6"
FT                   /protein_id="ACL28407.1"
FT                   /translation="MGRERQSQETARGNGFHRVRAIIIACVVVIGLLAGVAVRLSTWWH
FT                   AYRVPSMTGQTIARVSADSSVTDDVSQWYSQWKGRRQEIGVAPQYQLSSVRIRTVQRLP
FT                   NIASRYDQSDGRNIYVRLDATVRPRFASIQRITDVHGCQTYAVESGINESCVFTSEPRQ
FT                   DGYRIAQVMEPIMYQRLAYPEQFEKTEPDPTAPVLDGRNGYRLSKERLEVTYDGGTTWR
FT                   EVPDGVARIVGGINANTTLWLEPSRYVITPQFTAFVGYDEGTHTAQLLYSWDAGSTWLT
FT                   SALGHGVQAPSYISVVGDRIGVAYGYGDTLGSVGYAMVAGTLPELRADAEAVWRQIPMY
FT                   MQYPSDLTMAGWVNDTTVIVGQAGSLHVSSDSGATWRELGIPKEPGLEGKLGYYPFDTP
FT                   THVWVEDGTAYLAMGQGEDADYAPNGTVVEAVFSYDPATDACTFIRQQPAPTPMPAG"
FT   gene            complement(130478..131245)
FT                   /locus_tag="BLA_0105"
FT   CDS_pept        complement(130478..131245)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0105"
FT                   /product="putative carboxymuconolactone decarboxylase"
FT                   /note="COG0599: Uncharacterized homolog of
FT                   gamma-carboxymuconolactone decarboxylase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28408"
FT                   /db_xref="GOA:B8DVA7"
FT                   /db_xref="InterPro:IPR003779"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="UniProtKB/TrEMBL:B8DVA7"
FT                   /protein_id="ACL28408.1"
FT                   /translation="MAGITEQPNERLKETDPQFAERMLHFADVEVARDPETELEPTTRY
FT                   LAILATLLGCQGADEFRIQLGRALDAGLTPVQAKEVVHQAVDYLGIGRVRPFLAITNEV
FT                   LEARGVALPLPDQTTTTMENRLEAGNAKQVELFGEGMDKSYERSKVNYWLADNCFGDYY
FT                   TRTGLTNLQREMITFCYLAAQGSVEPQLLAHTKANIALGNTADFLRTVVLQNLPYIGYP
FT                   RTLNALRIVAEADKAKQGAAFNLQALAWGRAVA"
FT   gene            complement(131269..131712)
FT                   /locus_tag="BLA_0106"
FT   CDS_pept        complement(131269..131712)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0106"
FT                   /product="putative outer membrane protein probably involved
FT                   in nutrient binding"
FT                   /note="COG1917: Uncharacterized conserved protein, contains
FT                   double-stranded beta-helix domain"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28409"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:B8DVA8"
FT                   /protein_id="ACL28409.1"
FT                   /translation="MNNYPIPVGVPTAYAQSLMFPVGEPNDAYAQYFTGRSWLAPVSGE
FT                   QVSMANVTFEPGCINHWHIHHATKGGGQMLICVGGRGYAQIEGQEPIAMTPGTVVHIPA
FT                   NTKHWHGAAPGSWFSHIAIDVPGEGKSNDWLEPVDEAFYRSLK"
FT   gene            complement(131854..132849)
FT                   /locus_tag="BLA_0107"
FT   CDS_pept        complement(131854..132849)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0107"
FT                   /product="hydrolases of the alpha/beta superfamily"
FT                   /note="COG1073: Hydrolases of the alpha/beta superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28410"
FT                   /db_xref="GOA:B8DVA9"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B8DVA9"
FT                   /protein_id="ACL28410.1"
FT                   /translation="MNAMTALELTPVWDKTFPQSDKVEHGKITFHNRYGIELAADVYKP
FT                   KRVPANGRFKAIAVSGPFGAVKEQASGLYAQTLAERGFLTIAFDPSFTGESGGSPRAVA
FT                   SPDINTEDFSAAVDYLANRTDVDPEGIGIVGICGFGGLALNAAANDPRIKATVASTMYD
FT                   MSRVTANGYFDADDSAAKRNEMRTQLAKQRTEDYANGDYARAGGVIDPLPDDAPQFVRD
FT                   YHAYYKTPRGYHARSVNSNAGWNVTSSLPFMNMPLMTYIGEIENPALLIHGEKAHSLYF
FT                   SKAAYEKLEHGVNPANKELLIIPGANHTDLYDNLNAIPFDTIAGFFTRNL"
FT   gene            132975..133844
FT                   /locus_tag="BLA_0108"
FT   CDS_pept        132975..133844
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0108"
FT                   /product="transcriptional regulator, LysR family protein"
FT                   /note="COG0583: Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28411"
FT                   /db_xref="GOA:B8DVB0"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B8DVB0"
FT                   /protein_id="ACL28411.1"
FT                   /translation="MEIRELRAFLEVAREENMTRAAGNLHMSQPSLSKLIKSLEHELGA
FT                   KLFVRRSFGLTLTKEGRVLRERARDLVGMANRIEDEFASLGNITGGTLYFGLAESYQIQ
FT                   YLARQIKILREQAPDLRYHVESGVSAQVLEHLDQGSLDFAVLAQDPDLTKYEALTFPGV
FT                   DRWGIIVPADHRLASRSYVELDDLVGEPLFCSQQGWKHEIARWAGSRMPDLRLEATFGL
FT                   AYNAAVFAREGLGVLLTFDRIVDTSADSGIVFRPLKPALETKLHLVWRRNRPLSPIAER
FT                   FLDQLRRA"
FT   gene            complement(133885..134910)
FT                   /locus_tag="BLA_0109"
FT   CDS_pept        complement(133885..134910)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0109"
FT                   /product="oxidoreductase"
FT                   /note="COG0667: Predicted oxidoreductases (related to
FT                   aryl-alcohol dehydrogenases)"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28412"
FT                   /db_xref="GOA:B8DVB1"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:B8DVB1"
FT                   /protein_id="ACL28412.1"
FT                   /translation="MQYTTLGPSDLEVSRICLGCMSFGDAGNGQHSWTLDEESSRAIVQ
FT                   QALDAGINFLDTAIVYQNGTSEEYLGRALSSMAARDDVVVATKFLPRTDEEIENGVSGQ
FT                   QHVRDNLDMSLRHLGMDHVDLYIYHMWDWRTPIEEIMEGFANAVAAGKTRYIGAANIAA
FT                   WQLEKANAIAREHGWPQFISVQNHMNLLFREDEREMLPCAQEEGIALTPYSSLASGRLS
FT                   RRPGETSRRLREDSFAHGKYDAAAAMDADIIDEVRRIAEARGVTMTTVSLAWLLTKVTA
FT                   PIIGATKPHHLDGAVAAVDFELSDSEIAALERPYQPHPIVGVMAQNTKENAAVAKSWER
FT                   K"
FT   gene            complement(134967..135149)
FT                   /locus_tag="BLA_0110"
FT   CDS_pept        complement(134967..135149)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0110"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28413"
FT                   /db_xref="UniProtKB/TrEMBL:B8DVB2"
FT                   /protein_id="ACL28413.1"
FT                   /translation="MRIRHGHLFTRLAIAAIAALRDAGVSVETHEMNGWPHGFGADGGW
FT                   IDQYFAPWLTTVFAR"
FT   gene            complement(135203..136498)
FT                   /locus_tag="BLA_0111"
FT   CDS_pept        complement(135203..136498)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0111"
FT                   /product="putative oxidoreductase"
FT                   /EC_number="1.14.13.25"
FT                   /note="COG4097: Predicted ferric reductase"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28414"
FT                   /db_xref="GOA:B8DVB3"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR013112"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:B8DVB3"
FT                   /protein_id="ACL28414.1"
FT                   /translation="MKRIAIRRFPIQAVLVWAAALVVVPMPFTAIPWATLGPMYRSMLT
FT                   PITAGIYAYIWMLECVWLGCRPRWLDRIIGLPGIYVLHGVLGTGALALVVYHQYVLPSF
FT                   GPAKTTGEIAFWTLVGIVALALVMMAGWLDTLVPPLATVRSWLERVFRHEFTVWLHRIV
FT                   LVAVVLACLHFNLVFYIKDLTAFIVTMDVTTGLVLAWYAWVKLRDRMFAARGKVVSARR
FT                   VSNDIVEILVDCPAMHSWEYGDFVFLRLPRERGMHGSHPFSIANLPGEHGDAMRFAVRI
FT                   NGDFTERLYRTARAGMRVDVIGPFGMYERFIARHDAHAPIVVYAGGVGITPIIPTIMAL
FT                   SGTNRPVTVMYTAKRADDLLYADELRKWSASEAHTPHMQVGRWSKTELAEQITDGAIYL
FT                   IAGPSGMIRDVRRMLLRHGVPGSRMFYEPFTR"
FT   gene            complement(136535..137134)
FT                   /locus_tag="BLA_0112"
FT   CDS_pept        complement(136535..137134)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0112"
FT                   /product="conserved hypothetical protein"
FT                   /note="COG0716: Flavodoxins"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28415"
FT                   /db_xref="GOA:B8DVB4"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:B8DVB4"
FT                   /protein_id="ACL28415.1"
FT                   /translation="MVLGFSACGSTSGSSSNSSGSSTASNDSGNNTGTSGDTPTVTKGS
FT                   NGKALIAYFSKTGTTQRAAEEIQKLTGADMFRIEPVQAYPEEYQRTTEIARDELNQNAR
FT                   TQVKGKVDDMAQYDTIFVGYPIWWMEPPMPVLTFLESYDLNGKTVIPFATSASSGIDGT
FT                   LDMLRSSAKGANVTEGLRVTSNDEIQPWLQKIGVLK"
FT   gene            137520..137930
FT                   /locus_tag="BLA_0113"
FT   CDS_pept        137520..137930
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0113"
FT                   /product="transcriptional regulator"
FT                   /note="COG0789: Predicted transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28416"
FT                   /db_xref="GOA:B8DVB5"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="UniProtKB/TrEMBL:B8DVB5"
FT                   /protein_id="ACL28416.1"
FT                   /translation="MGATMYTMKQACELTGLSYETLKFYCRSELVPRVHRDARNHRVFD
FT                   DHNIAWIRSLVCLRRCGLGIAEMKRCVALCLEGEASIPQRREILAEKREELQHRLQDIE
FT                   DSIAYIDAKEQFYEAVLDGTTPYVSNVLGLEE"
FT   gene            complement(138051..138455)
FT                   /locus_tag="BLA_0114"
FT   CDS_pept        complement(138051..138455)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0114"
FT                   /product="probable flavodoxin"
FT                   /note="COG0716: Flavodoxins"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28417"
FT                   /db_xref="GOA:B8DVB6"
FT                   /db_xref="InterPro:IPR001226"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:B8DVB6"
FT                   /protein_id="ACL28417.1"
FT                   /translation="MSKQLVVYISATGTTRRVAQNLAKAIDADLAEIVPVPPFTAQDID
FT                   WTDPTSRASRQHADRAMRPPISASPSADGYDEIFVGYPLWWDTAPREVRTWLESHDFTG
FT                   KTITTFATSSSAHAAHSASNCTIRHRTPIG"
FT   gene            complement(138523..139311)
FT                   /locus_tag="BLA_0115"
FT   CDS_pept        complement(138523..139311)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0115"
FT                   /product="predicted nucleoside-diphosphate-sugar
FT                   epimerases"
FT                   /note="COG0702: Predicted nucleoside-diphosphate-sugar
FT                   epimerases"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28418"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B8DVB7"
FT                   /protein_id="ACL28418.1"
FT                   /translation="MKPTHVLVVGASGSIGRHAVEKARAAGYRVRALVRDPSRIHFGCG
FT                   VEVVQGDLTSVESMRQALDGIDGIVFTHGSNGGPTLTETVDYGAVRNALEALDGRPARI
FT                   ALMTSIGVTNMDNDYNRSTEAHDWKRHSERLVRASGNEYTIVRPGWFDMEGADEHQLKF
FT                   EQGDRRDPMGPQDGSAARRQVAQTLVDALGCKEADHKTLELIDVAGTAQTDAELASMFA
FT                   ALQPDTGLDGVLDRDNFPECTQPKRVREQIARIETMRAEQ"
FT   gene            complement(139329..140372)
FT                   /gene="adh"
FT                   /locus_tag="BLA_0116"
FT   CDS_pept        complement(139329..140372)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="adh"
FT                   /locus_tag="BLA_0116"
FT                   /product="alcohol dehydrogenase"
FT                   /EC_number="1.1.1.284"
FT                   /note="COG1063: Threonine dehydrogenase and related
FT                   Zn-dependent dehydrogenases"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28419"
FT                   /db_xref="GOA:B8DVB8"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B8DVB8"
FT                   /protein_id="ACL28419.1"
FT                   /translation="MKAAVFVEPEHVGVREVERPRIEKPTDAIVRVLKACVCGSDLWWF
FT                   RGISERPHNTLVGHEAIGIIDEVGADVHDMKPGDFVIVPFTHCCGHCEACEKGYDGNCF
FT                   NMEPGGNAGYQAEYMRATWAGTALIKIPGTPADYTDEQIASLLALSDVMATGYHAAWSS
FT                   RIEPGDTVVIYGDGAVGLCAVIGAKLLGAGRIIMMSRHEDRAALAREFGATDIVPERGD
FT                   EAVARIMEMTNGAGADRVLECVGSEQSIESAVRSGRPGAYVSRVGVPHDNSIDVNALFW
FT                   RNVSLTGGIASVATHDKSTLLKAVLDGEINPGKVFTASFDLDHVQQAYEAMDGRRAIKS
FT                   MIDIAEA"
FT   gene            140578..141477
FT                   /locus_tag="BLA_0117"
FT   CDS_pept        140578..141477
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0117"
FT                   /product="probable LysR-type transcriptional regulator"
FT                   /note="COG0583: Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28420"
FT                   /db_xref="GOA:B8DVB9"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B8DVB9"
FT                   /protein_id="ACL28420.1"
FT                   /translation="MDIRTLRHFVAVVQEEGISAAADVLRMSQPALSRQMKELENELGV
FT                   TLFERGNRGRSISLTKEGRVFYRRARQIIELADRARAEVHMHDEIAGTIHITAAESNLM
FT                   NIVALAIAQTRLLYPRITFDIHDDNGPNNVERLNNGIADFAVIMQPIDMTRFDHLSLPG
FT                   ANPLGIGMRADDPIAANETITNELIRDMPLITSTGANQRRDLSGWLTQGTTLNIVSHVN
FT                   LAYNAACLVRNGVGYMLTVNDLTEFSDPEHDLVWRPLDPPLDIRLSVIWRKDRDLSRVC
FT                   QLFLQQLRTVITQIRTAQ"
FT   gene            complement(141480..142607)
FT                   /locus_tag="BLA_0118"
FT   CDS_pept        complement(141480..142607)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0118"
FT                   /product="putative xylanase/chitin deacetylase"
FT                   /note="COG0726: Predicted xylanase/chitin deacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28421"
FT                   /db_xref="GOA:B8DVC0"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:B8DVC0"
FT                   /protein_id="ACL28421.1"
FT                   /translation="MLLVLALGAGAWYMWQYHWRTLSIEVDGTAYSAKADTTVAAFMRD
FT                   HRDFERKPGRLLSVEGKVLEPSGGNTVSVKFDGKQIEPADWDHTRFEKNGTLTVTPGTD
FT                   LTEEHTVEQRKVPFKTDINLNGGPVQIVTQQGEDGLQEFWVGRQSKKTAAKTVIRKQEP
FT                   LIVKSFAPRPEGKKVIALTFDDGPSIYSDKILDILKQNKVKATFFELGEQSLEFPKVEQ
FT                   RIVREGHQIASHSVSHPYFPNMSAQEQRQEIESSLSDIKKASDVSTRTFRAPYGAFGVD
FT                   EWKNNATLIDRNVLWDVDTLDWKRPGEKQITKEVVDYVHNGAVVLMHSGGGDRSQTVKA
FT                   LPEIIKQLKKKGYSFVTIDELCKMAGLPEAAEPSR"
FT   gene            142934..143998
FT                   /gene="fbaA"
FT                   /locus_tag="BLA_0119"
FT   CDS_pept        142934..143998
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fbaA"
FT                   /locus_tag="BLA_0119"
FT                   /product="fructose-bisphosphate aldolase, class II"
FT                   /EC_number="4.1.2.13"
FT                   /note="COG0191: Fructose/tagatose bisphosphate aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28422"
FT                   /db_xref="GOA:B8DVC1"
FT                   /db_xref="InterPro:IPR000771"
FT                   /db_xref="InterPro:IPR006411"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:B8DVC1"
FT                   /protein_id="ACL28422.1"
FT                   /translation="MSIATPEQYAHMLDAARAGGYAYPAINVTSSQTLNAALQGLADAE
FT                   SDGIIQVSVGGAAYFSGQRVNNRVTGSLAFAAFAHEVAKQYPNITVALHTDHCAKQYLD
FT                   EWVNPLLDIEIDEVKHGREPMFQSHMWDGSTVPLKENLDIAEKLLEKSRLAHTVLEIEI
FT                   GAVGGEEDGHSAEINEKLYSSVADGMAVADRLGLGERGKYMAAFTFGNVHGAYKPGVVK
FT                   LRPELLHEIQQGVWNAAKSGELNAVLNSDMPDGKPFELVFHGGSGSTAQEIAEAVSYGV
FT                   IKMNIDTDTQYAFTRAVAGHMFRDYDGVLKIDGEVGNKKQYDPRSWGREAEDSMAARVV
FT                   EACEELGSAGRALK"
FT   gene            144551..145837
FT                   /gene="purA"
FT                   /locus_tag="BLA_0120"
FT   CDS_pept        144551..145837
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purA"
FT                   /locus_tag="BLA_0120"
FT                   /product="adenylosuccinate synthetase"
FT                   /EC_number="6.3.4.4"
FT                   /note="COG0104: Adenylosuccinate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28423"
FT                   /db_xref="GOA:B8DVC2"
FT                   /db_xref="InterPro:IPR001114"
FT                   /db_xref="InterPro:IPR018220"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033128"
FT                   /db_xref="InterPro:IPR042109"
FT                   /db_xref="InterPro:IPR042110"
FT                   /db_xref="InterPro:IPR042111"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8DVC2"
FT                   /protein_id="ACL28423.1"
FT                   /translation="MPGIVLIGAQWGDEGKGKATDLIGTKVDYVARFNGGNNAGHTVVV
FT                   GDESYALHLLPSGIISPTATPVIGNGVVVDPEVLLEEIEGLESRGIDCSRLLVSESAHV
FT                   IAPYHRMIDKVTERFAGKKKIGTTGRGIGPAYADKINRVGIRIADLFHEDVLRDKVSNA
FT                   LHQKNQMLVKLYNRRAFDVEATVQELLEVGVKLKPYVANTSLILNNALDDGKTVLFEGG
FT                   QATMLDIDHGTYPFVTSSNPTAGGACTGTGVGPTKIDRVIGVSKAYVTRVGEGPFPTEL
FT                   FDENGEWLRAQGHEYGVTTGRPRRCGWFDAVVNRYATQVNGLTDIVLTKLDVLTGLDEI
FT                   PVCVAYDVNGVRYDDMPTDQSAFAAAKPIYGMMPGWSEDISQVHAFEDLPQTCQDYVKR
FT                   LEELSGCRISAIGTGPQRDHIIEVHSLLD"
FT   gene            145978..146910
FT                   /gene="crcB"
FT                   /locus_tag="BLA_0121"
FT   CDS_pept        145978..146910
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="crcB"
FT                   /locus_tag="BLA_0121"
FT                   /product="protein crcB-like protein"
FT                   /note="COG0239: Integral membrane protein possibly involved
FT                   in chromosome condensation"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28424"
FT                   /db_xref="GOA:B8DVC3"
FT                   /db_xref="InterPro:IPR003691"
FT                   /db_xref="UniProtKB/TrEMBL:B8DVC3"
FT                   /protein_id="ACL28424.1"
FT                   /translation="MTTRPEHLTHADATSPGDVDASSAAAEPGDSDAHLHLYDSQSFSP
FT                   ATGAPHEPVTPDFRKEMLQPHPTGAAAARRPPSIPLSPRKRMQAKFNPLADGMMYLVIF
FT                   IGGMLGTVLRYSLWLLWPQPLSKGGLLMAFHPATLIANLCACFIFAVLVSYMSQAVWVK
FT                   KRTRQLANGGFGMGMCGGFSTLSAMMVEDITSLHSHSYLGFFLYTLFTFVAAFAIAWFG
FT                   SWLGLRLARKRTGMHVRERMETVRKPAIGVRVPTANGVQMTPSAGDDPNPSTDELPIIS
FT                   EEEHLDLLADPHMVEPLQRTAGKRDGGAR"
FT   gene            146910..147284
FT                   /gene="crcB"
FT                   /locus_tag="BLA_0122"
FT   CDS_pept        146910..147284
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="crcB"
FT                   /locus_tag="BLA_0122"
FT                   /product="protein crcB-like protein"
FT                   /note="COG0239: Integral membrane protein possibly involved
FT                   in chromosome condensation"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28425"
FT                   /db_xref="GOA:B8DVC4"
FT                   /db_xref="InterPro:IPR003691"
FT                   /db_xref="UniProtKB/TrEMBL:B8DVC4"
FT                   /protein_id="ACL28425.1"
FT                   /translation="MGTFLLVCICGGLGAVARFMLNTSIQRWWHRAYPLSTFIINIIAA
FT                   LCAGTAAAAYFYQTVNYSTYLLFVAGFLGGFSTFSTAINEMVSLTRTRQLAVAAFYFLT
FT                   TLVVPFCAVVLGWFFGSIGH"
FT   gene            147882..149309
FT                   /locus_tag="BLA_0123"
FT   CDS_pept        147882..149309
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0123"
FT                   /product="branched-chain amino acid ABC-type transport
FT                   system permease components"
FT                   /note="COG0559: Branched-chain amino acid ABC-type
FT                   transport system, permease components"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28426"
FT                   /db_xref="GOA:B8DVC5"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="InterPro:IPR013784"
FT                   /db_xref="UniProtKB/TrEMBL:B8DVC5"
FT                   /protein_id="ACL28426.1"
FT                   /translation="MVSQPQRRAERGRRRKGLAIVCAGIAGLLLAMLASMIGVPNAVAA
FT                   EAVDKCVPNAEHGCVSGILQTQDKTPIPDVTVTLGGEEEATATTAEDGAWAFEVNADGE
FT                   YTVSIDKAVAEKYKLGESGATVEIAKKSFSKQRAVVRFDKAAAGSAAETESGNADSAKS
FT                   GEQTAANTAQAGDDGKGSGFWSRFWQQLYSGCIFGLMLGLMAVGMNLVYGTTGLSSFSH
FT                   GEQVTLGGLMAYVGTQMLHMPVVLSAIFAVAIGALAGWVQNQLVWAPLRHKRVGVMQQM
FT                   IVTIGLSMALQYIYQFFFGGDIKGIVKSVPEGIQLGPIVTNAPTLIAAAIALVTIVSVT
FT                   VFLYCTRLGRATRAVSDNAALAAASGINVDSVVRIVWILSCGLAALSGVLIGIHLNGIA
FT                   WNTGVTLLMLMFAAVTLGGLGTANGALVGALIVGIVADMSTLVIPSDMRYASALAILIL
FT                   VLLIRPQGIFGKQKRVG"
FT   gene            149313..150296
FT                   /locus_tag="BLA_0124"
FT   CDS_pept        149313..150296
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0124"
FT                   /product="branched-chain amino acid transport system
FT                   permease protein"
FT                   /note="COG4177: ABC-type branched-chain amino acid
FT                   transport system, permease component"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28427"
FT                   /db_xref="GOA:B8DVC6"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:B8DVC6"
FT                   /protein_id="ACL28427.1"
FT                   /translation="MDFMTILSNILGELFAPTTAAYALAAIGLNIHFGMSGLMNMGQAG
FT                   FMLLGAYGFAITQMNGCDLFTSVLTALVLAAIYGILLGIPTLKLGPDYLAMVTLAAAEI
FT                   IRIVGRSTSLTWLTGGSAGIAPQNFTEKFENASPLPNGSTKFLLWTYNNNIANSWWLRI
FT                   VAWVLVAIALLLCWRWFHSPWGRVLKGIREDENAIRSLGKSVTKYKMQALILGGLFGAI
FT                   AGIVFILPRSLNPDSLGRTVTFYTWTILLLGGAATIMGPVLGSCVLWVLLTAVKETMRV
FT                   TIPTTVVSSNQIEALGWVIVGVALMLLVIFRPQGILGNKKELAFNG"
FT   gene            150289..151296
FT                   /locus_tag="BLA_0125"
FT   CDS_pept        150289..151296
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0125"
FT                   /product="branched-chain amino acid transport system
FT                   ATP-binding protein"
FT                   /note="COG0411: ABC-type branched-chain amino acid
FT                   transport systems, ATPase component"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28428"
FT                   /db_xref="GOA:B8DVC7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032823"
FT                   /db_xref="UniProtKB/TrEMBL:B8DVC7"
FT                   /protein_id="ACL28428.1"
FT                   /translation="MADTTDKTSETTAAGSTATVKEPFYDIAKWATKAPEGEKLISTAY
FT                   GDKVTEDLRYVKNEPGVHKPDPILVADNVTRRFGGMTAVDVRHFEIERHGITALIGPNG
FT                   AGKTTFFNLMTGFDTPNTGTWQFDGKDMAHVNPEKVARGGMVRTFQLTKVMSRLTVLDN
FT                   MMLGAQSHPGEGMFRSLFPGAWKKQEKENREKAEALLDRFLLYKKKDDYAGALSGGQRK
FT                   LLEMARALMCDPKLVMLDEPMAGVNPALKQSLLDHIISLREDGTTVLFVEHDINMVRHI
FT                   ADWVTVMAEGKIVAEGQPKTVMDDPAVVDAYLGAHANIDLGDDSVLEGLEGGNA"
FT   gene            151289..152104
FT                   /gene="livF"
FT                   /locus_tag="BLA_0126"
FT   CDS_pept        151289..152104
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="livF"
FT                   /locus_tag="BLA_0126"
FT                   /product="ABC-type branched-chain amino acid transport
FT                   systems ATPase component"
FT                   /note="COG0410: ABC-type branched-chain amino acid
FT                   transport systems, ATPase component"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28429"
FT                   /db_xref="GOA:B8DVC8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B8DVC8"
FT                   /protein_id="ACL28429.1"
FT                   /translation="MPDTATLTPTEAPDVSTLDRSHIHAGEPLLDADNLVAGYLPGVNI
FT                   LNGASLTLHDGEIVGIIGPNGAGKSTLLKSLFGLVHIHSGKLTLKGQDITNLRADKLVS
FT                   RGVGFVPQTENVFPSLTIAENMHMGAYQAPKLFNERFDYVCSIFPKLGDRRNQLAGQLS
FT                   GGERQMVAMGRALMMQPSVLLLDEPSAGLSPMMQDETFIRVRQVNKAGVSVVIVEQNAR
FT                   RCLQICDRGYVLDQGRNAYSCRGRDLMNDPKVISLYLGNLEEEVEKENK"
FT   gene            152247..153512
FT                   /gene="livF"
FT                   /locus_tag="BLA_0127"
FT   CDS_pept        152247..153512
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="livF"
FT                   /locus_tag="BLA_0127"
FT                   /product="branched-chain amino acid transport system
FT                   substrate-binding protein"
FT                   /note="COG0683: ABC-type branched-chain amino acid
FT                   transport systems, periplasmic component"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28430"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:B8DVC9"
FT                   /protein_id="ACL28430.1"
FT                   /translation="MRLANKMKMLTAMTAAALLALSGCGSSGGASGGSSNSVASSGDGM
FT                   VIGALLPLTGTLAYLAPPEVAAIKLAISDINKAGGVLGKDVTEVEADTSDGEHADQNTS
FT                   AAQSVLSKHPSVVIGPAASGVVKNVYKSIVAEKIPVISMASTSMTLSGMDPYFFRTVAP
FT                   DAVQGAVMGDLIAQDGVKKLAIACFNDEYGTGMRDIILQKLKDAGVDVVYGEKDAFDPA
FT                   ETNYSSIATAIKNSGADATLIISYDQATPLIKALASAGVDTHKLYLVDGNTVDYSKTYD
FT                   AGLLKGSKGTIPGTHVDDKFKSDLKGTGTDISDTTYAAETYDAVILAALAAEQGGSTSG
FT                   ETVAKNLSSVSGADGGEKCESFEACKALIKDKKKIQYFGKTGIGPFNKNNDPSSANIGI
FT                   FEYDGNNVNVFQDMQSGDVPTE"
FT   gene            complement(153590..154618)
FT                   /gene="scrR"
FT                   /locus_tag="BLA_0128"
FT   CDS_pept        complement(153590..154618)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="scrR"
FT                   /locus_tag="BLA_0128"
FT                   /product="sucrose operon repressor ScrR"
FT                   /note="COG1609: Transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28431"
FT                   /db_xref="GOA:B8DVD0"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:B8DVD0"
FT                   /protein_id="ACL28431.1"
FT                   /translation="MVGMRDVAKRAGVSVSSVSLVINGTGYVSRDMREKVEQAMRELDY
FT                   VPNELARNFYHGKTDIIGVIVPTIQHPFFATLTAHLQHEFADRGLQTMLCSTADSANGE
FT                   AQYVDMLRRHSLDALVVAAHTTHDPQYWRAIDRPVVAFDRNLGAGITQVSSDHVHGGEL
FT                   IAELLVRTGAHHVVMVGGPRAQFTDLGDHSTFPTVRYVQTLEDRLSQARIAHTYIESGE
FT                   VFDIAGVRRAVREAFDTYPDMDAFVGADLAAAFAVQEAVSRSIAVPGDVQIIAYDGTLA
FT                   ADCAGMPLTTVAQDFRQIAHTIAACVEHGIESSPQRPDATDGDANMTIIPVTLHERATT
FT                   RR"
FT   gene            154925..156445
FT                   /gene="scrP"
FT                   /locus_tag="BLA_0129"
FT   CDS_pept        154925..156445
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="scrP"
FT                   /locus_tag="BLA_0129"
FT                   /product="sucrose phosphorylase"
FT                   /EC_number="2.4.1.7"
FT                   /note="COG0366: Glycosidases"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28432"
FT                   /db_xref="GOA:B8DVD1"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR015325"
FT                   /db_xref="InterPro:IPR016377"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR022527"
FT                   /db_xref="UniProtKB/TrEMBL:B8DVD1"
FT                   /protein_id="ACL28432.1"
FT                   /translation="MKNKVQLITYADRLGDGNLASMTDILRTRFDGVYEGVHILPFFTP
FT                   FDGADAGFDPIDHTKVDARLGDWDDIAELAKTHDIMVDAIVNHMSWQSKQFQDVLANGE
FT                   DSEYYPMFLTMSSVFPDGATEEELAGIYRPRPGLPFTHYSFAGKTRLVWVTFTPQQVDI
FT                   DTDSAKGWEYLMSIFDQMSKSHVKYIRLDAVGYGAKEAGTSCFMTPKTFELISRLREEG
FT                   AKRGLEILIEVHSYYKKQVEIAAKVDRVYDFALPPLLLHSLFTGKVDALAHWTEIRPNN
FT                   AVTVLDTHDGIGVIDIGSDQLDRSLKGLVPDADVDNMVETIAKNTHGESKAATGAAASN
FT                   LDLYQVNSTYYSALGCNDQHYIAARAVQFFLPGVPQVYYVGALAGENDMELLKRTNVGR
FT                   DINRHYYTTSEIDKNLERPVVKALNALARFRNELPAFDGDFSYSVGDDESIAFSWNGFG
FT                   SSATLTFTPSKGMGVENPQSVATLVWTDSTGEHRTDDLIANPPVMQAS"
FT   gene            156814..158115
FT                   /gene="scrT"
FT                   /locus_tag="BLA_0130"
FT   CDS_pept        156814..158115
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="scrT"
FT                   /locus_tag="BLA_0130"
FT                   /product="sucrose symporter"
FT                   /note="COG0477: Permeases of the major facilitator
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28433"
FT                   /db_xref="GOA:B8DVD2"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B8DVD2"
FT                   /protein_id="ACL28433.1"
FT                   /translation="MVSADGHRPTKAELVRLGIGFTVSAVACAIPWVALSTVILPRVFE
FT                   LIDNSSKEAMLGLVNSIGAIVALLANIIFGTLSDMTRSRFGKRTPWIVGGGIITGLAIG
FT                   AIAFTRNEALIIFLWCVAQMGYNMMLAPYVAVMSDRVPDKVRGTISGFYGAGIAVGQTL
FT                   GSVVGAAFLRQGQSGLFSAWMMGLGIFSLTGIFVVAMWPREKSSRFEEQSEHVTVKSVL
FT                   LNFRPPRHAPDFYYALVGRTLMMGGYWMITTYQLYIAQDYIYAGDPNAKDKAATIIATM
FT                   GVITLVVSLIAAVTAGPITDRLGRRKLPVALASCLFAVGAAMPLFFRSPMGMYLFAAVA
FT                   GLGYGVYNAIDQALNVAVLPNPKEAGKDLGILNLANTLSTVIGTAMTSLVVSIVKSSMH
FT                   VSTTPAVAYAWVFGVAIVIVLAAAALIMRIRNVK"
FT   gene            158381..159100
FT                   /gene="livF"
FT                   /locus_tag="BLA_0131"
FT   CDS_pept        158381..159100
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="livF"
FT                   /locus_tag="BLA_0131"
FT                   /product="branched-chain amino acid transport system
FT                   substrate-binding protein"
FT                   /note="COG0683: ABC-type branched-chain amino acid
FT                   transport systems, periplasmic component"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28434"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:B8DVD3"
FT                   /protein_id="ACL28434.1"
FT                   /translation="MNNAKIKSWMVTATAMAAAAMLTLSGCGSGAESKADADEATFTAA
FT                   GLLPLTGSMAYLGPANIATMKLAQNDINAAGGVLGKDIDIVSADTSDADHADQNTSSAQ
FT                   SVLAREPSVVVGPPSSSVVKNTFKQVTSSQVPMISSGATSTAFSGLNDYFFRTIPPDTV
FT                   QGVVLGQIIVQDGVKNLAIAVFNDEYGTSLRDVVAKTVGDAGVNVVYGEKETFDPTETS
FT                   FSSMVTNIKSTKPDALR"
FT   gene            159130..160434
FT                   /locus_tag="BLA_0132"
FT   CDS_pept        159130..160434
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0132"
FT                   /product="biotin carboxylase/biotin carboxyl carrier
FT                   protein"
FT                   /EC_number="6.3.4.14"
FT                   /note="COG4770: Acetyl/propionyl-CoA carboxylase, alpha
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28435"
FT                   /db_xref="GOA:B8DVD4"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005481"
FT                   /db_xref="InterPro:IPR005482"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR011764"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="UniProtKB/TrEMBL:B8DVD4"
FT                   /protein_id="ACL28435.1"
FT                   /translation="MFVRLADEAYALGAAETADTYLNIDAMASAAVRAHADAVHPGHGF
FT                   LAENADFAQAVIDAGMVWVGPKPETIRVLGSKVAARRIAAEVVEFAREHGLPIAIKAVY
FT                   GGGGRGLKVVHEPDEVAAAFESAMHEAEVAFGNGDCFVERFLARLWHVEVQVLGDQFGT
FT                   VLAVGTRDCSLQRRNQKLIEEAPAPFLAAETVRELERAAVAICSRAHYESAGTVGFLVD
FT                   DGTMSFMEVNTHIQVEHPVTEAVTGVDLVAAQLAIAEGAPVEAVPGLESGVTPEPRGGH
FT                   AMEFRINAEDPSLGFVPFPGVVESLQVPTGPGIRFDSGVAAGDSISSRYDSMIAELIVK
FT                   ASTRAECLRRAERALAELHIHGVPTVVPFDKAVLESADFGAGADWRADDDVSNANFRVY
FT                   TRWIEEELLPNLPSETLEDWRRAGERAMGERRRAG"
FT   gene            160783..161742
FT                   /locus_tag="BLA_0133"
FT   CDS_pept        160783..161742
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0133"
FT                   /product="putative C14orf159-like protein"
FT                   /note="similar to protein C14orf159 mitochondrial
FT                   precursor"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28436"
FT                   /db_xref="InterPro:IPR025504"
FT                   /db_xref="UniProtKB/TrEMBL:B8DVD5"
FT                   /protein_id="ACL28436.1"
FT                   /translation="MGSITDWSKYPRISRIATAAAADVGRGSETLMTYVRGDLFRSARH
FT                   LALGTEQPRRARRENRRKTKRPARALVVTGFYIPQAQQPAAETDGPLGALEVCMALRAV
FT                   GGDAWLISDEHCAPVICAAAGDLLPEDRVLIAPHAKPEFDAWFNMVIDLVKRHGIDTLV
FT                   FIERVGPARDGRPRNMRGVDIAEWTAPLSQLALLELHTIGVGDGGNEIGMGRVADYAIS
FT                   GVVAHGESIACTVAADQLVVAGTSNWGAHALVCAMRALGCPQVEPYLEPDWHRAVLDAI
FT                   VAAGGLDGVHMTNVPTVDGLDPARYFGTVAQLSAFARH"
FT   gene            161884..163437
FT                   /gene="scrT"
FT                   /locus_tag="BLA_0134"
FT   CDS_pept        161884..163437
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="scrT"
FT                   /locus_tag="BLA_0134"
FT                   /product="sucrose symporter"
FT                   /note="COG0477: Permeases of the major facilitator
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28437"
FT                   /db_xref="GOA:B8DVD6"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B8DVD6"
FT                   /protein_id="ACL28437.1"
FT                   /translation="MPQSQQSEPQTPRTFPKSNYIRPGIDDRPDLDKALSAEDKSAVAR
FT                   LAVRQKPVTAPPAATHPEVQAAALADAAGLSHPASDEPIPDVESAFFDLRDPMVDSTGY
FT                   RPTHTQVLRMKSGFAAASLLLSFAMVALTVVLVPLRLDEFGGAFDGTVNLAVLIGVGIV
FT                   VAMFMTAFASAMSDRTRASLGRRTPWLIGGTVVATLFAFALSACHTNVAMILVWVFMQL
FT                   GYAVMAMACSAMVGEMVPDKFRNAVATWRNVAMFAGSLAGAAFAAGMADHVEAAMDICA
FT                   GAILAAGVVVLFVPPREHSSEYLHVTPLDEDKLLVAFRAPQGVRHWGVIAVIRLLVSAT
FT                   LAVSITYVGFLVRYEHGVHAPNSLQYTAVTIAAMAVVAYVLAAISSVLLDPITSRFSSA
FT                   RAPLALASTVMLLASICGIAMPNRAGLILFAAFGGCALAMLDSLAQTQALHAIEDLQHT
FT                   GHVLAVLHSLDSVGRLLGVVVGAIVVVAADAFAPLFIVAGVLALALLVVVLCTSSRLAD
FT                   "
FT   gene            complement(163457..163969)
FT                   /locus_tag="BLA_0135"
FT   CDS_pept        complement(163457..163969)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0135"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="COG0454: Histone acetyltransferase HPA2 and related
FT                   acetyltransferases"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28438"
FT                   /db_xref="GOA:B8DVD7"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:B8DVD7"
FT                   /protein_id="ACL28438.1"
FT                   /translation="MGMTAMPFTRPERAQCPVDFTGFDCGEQQINDWLKHHANASNKNG
FT                   SAALYLSYDHETNELAGVYTLSSTTVARDETYAPWMRRNSPILVPAALLGQLAVANHFQ
FT                   HRGLAKALIRDAVDRTLQLSLTIGIRALVVDPLNSNLTMFYDSLGFEGFNGETRMYFRM
FT                   PNYPRTL"
FT   gene            complement(163960..164256)
FT                   /locus_tag="BLA_0136"
FT   CDS_pept        complement(163960..164256)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0136"
FT                   /product="conserved hypothetical protein"
FT                   /note="COG4453: Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28439"
FT                   /db_xref="GOA:B8DVD8"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="InterPro:IPR014795"
FT                   /db_xref="UniProtKB/TrEMBL:B8DVD8"
FT                   /protein_id="ACL28439.1"
FT                   /translation="MYGVMPYNIVMATMTRTARIDMRLTEEEKRLIEQASAATGSRLTT
FT                   WCINNLINDAKRDLHANAIIRLSDEAFDRFVENLDRPLTEKQQQFLAYQPEWA"
FT   gene            165253..166644
FT                   /gene="shiA"
FT                   /locus_tag="BLA_0137"
FT   CDS_pept        165253..166644
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="shiA"
FT                   /locus_tag="BLA_0137"
FT                   /product="transmembrane transport protein possibly for
FT                   shikimate"
FT                   /note="COG0477: Permeases of the major facilitator
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28440"
FT                   /db_xref="GOA:B8DVD9"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B8DVD9"
FT                   /protein_id="ACL28440.1"
FT                   /translation="MTAVETETEAGRRAPALAGERAHALRRAGKSSVGTIIAASMVGTT
FT                   IEFYDFYAYGTAAANYFPRVFFSDATNPTVALLLSLVTFAVAFLARPVGSLIFGHFGDS
FT                   IGRKATLVVSLMTMGVATFLIGCLPGYDMWGVWAVLALCVCRFVQGIGLGGEWSGAALV
FT                   ATENAPANKRALYGSFPELGAPIGFFLCNGTYVLLELFNDDAAMLAWGWRVPFLLSSLL
FT                   VVVGLLVRVHMEETPAFRAAKQDQRVVKAPALEVFRTSWRQVLQATFLVAVTYTLFYTL
FT                   ATWSLAWATKSDAQGGGGLGFSTKEYMTMLMVSVCVFALFIVLSCVFADRIGRRRVIIG
FT                   SSVALLAFAALFPLLMNRAVVGVHNTAAAMLFLCLGFALMGIAFGPIGALLPELFSVNV
FT                   RYTGSGIGYNIAAIVGAAFVPSVATWLSSHWGVGSVGLYLGVMALCCLVAILTCRETKN
FT                   VDYMQ"
FT   gene            167055..168107
FT                   /gene="ilvC"
FT                   /locus_tag="BLA_0138"
FT   CDS_pept        167055..168107
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ilvC"
FT                   /locus_tag="BLA_0138"
FT                   /product="ketol-acid reductoisomerase"
FT                   /EC_number="1.1.1.86"
FT                   /note="COG0059: Ketol-acid reductoisomerase"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28441"
FT                   /db_xref="GOA:B8DVE0"
FT                   /db_xref="InterPro:IPR000506"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013023"
FT                   /db_xref="InterPro:IPR013116"
FT                   /db_xref="InterPro:IPR014359"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8DVE0"
FT                   /protein_id="ACL28441.1"
FT                   /translation="MAAQIWYEDDGDLSVLDGKKVAIIGYGSQGHAHALNLRDSGVDVV
FT                   VGLRPNSKSVEFAKEQGLEVKSVPEAAAEADVIMILAPDQYQKGIWENDIEPNIKPGAA
FT                   LAFAHGFNIHYGYIKPSEDHPVFMVAPKGPGHIVRREYVAGRGVPVVTAVEQDPRGDGW
FT                   DLALAYAKALGALRAGAIKTTFKEETETDLFGEQNVLLGGVNKLVEMGFEVLTDAGYQP
FT                   EIAYFEVCHELKMIVDLMNEGGLNKDRWSCSDTAQYGDYVSTVIDEHTRERMQYHLQRI
FT                   QDGSFAKEFMDDQAAGAPKFKQLQEEYSNVRIEEVGPKLRAMFSWNNDAAKDADEANSF
FT                   TGKIARAQVQ"
FT   gene            complement(168742..170439)
FT                   /locus_tag="BLA_0139"
FT   CDS_pept        complement(168742..170439)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0139"
FT                   /product="sialic acid-specific 9-O-acetylesterase"
FT                   /EC_number="3.1.1.53"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28442"
FT                   /db_xref="GOA:B8DVE1"
FT                   /db_xref="InterPro:IPR005181"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="InterPro:IPR039329"
FT                   /db_xref="UniProtKB/TrEMBL:B8DVE1"
FT                   /protein_id="ACL28442.1"
FT                   /translation="MTTVTGIAPGASGMAEPTSDNDGAHDRTRSGNLRVDAIFSDHMVL
FT                   QRGKPIAVFGEAPAGEVVAAFLTDARGQEIAQSENHANGDGTFMLTLPALPAGGPLALR
FT                   VRCGADELVFHDVMVGEVWLAGGQSNIEFELHNSEFGKEAVADAHDPLLRFYNTPKSAR
FT                   VNLATESASGWQTAEAPQVAHMSAIGYYFGKQLRDALANGIAVGVVDCYIGGTSISAWM
FT                   SEHLLEQTGLGRKYLQAYRDAIAGKTDEEMLAAQTAWQQVFDKWNADVAAVKEEHPDYS
FT                   QPQIDAMLGPCPWPPPVTPFAERRPYALYEAMIRRVAPYTLAGILWYQGEEDELNAAGY
FT                   GELLRGLIAEWRTTWHDDALPFLVVQLPQWIAAANAEHDPLRWPVLRDEQFTVARETPH
FT                   TNIVCAMDCGEFDNIHPVDKRTLGMRLGDTALHDVYGLQIPCASPELVDLQVSEGGGEM
FT                   VATFNHAQGLHWHGTTPDSMRAIADIAESTERKAGESGFEIAASADSEFVPAHARIEPS
FT                   DDLGSDMRVVHLFSPEVPKPTHARYAWRSWGPAPLFNDDGLPAFPFAK"
FT   gene            complement(170618..171715)
FT                   /locus_tag="BLA_0140"
FT   CDS_pept        complement(170618..171715)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0140"
FT                   /product="endoglucanase E precursor"
FT                   /EC_number="3.2.1.4"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28443"
FT                   /db_xref="GOA:B8DVE2"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR013830"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="InterPro:IPR040794"
FT                   /db_xref="UniProtKB/TrEMBL:B8DVE2"
FT                   /protein_id="ACL28443.1"
FT                   /translation="MQFIDAFNPAFRTMGRIGESKNHLPLWVFPYTQARFRFTGTSLAV
FT                   RLRNFWNYGHTRIGVIIDNTQFSVRVPSPVEPEPDAAVSVGEDGMLTIRIASHLPNIEH
FT                   RAIVFKREDGGMHYMEFAGVEIDDDAQILAPAEPASTRRIEVYGDSVSCGERNEAVLCT
FT                   GKADPDEDLSAYSNSWFAYDAIAARALGADLRIISQGGAPLLDGIGWFNAPDYLGMESI
FT                   WDRVQYNPALGEPTDWDFRDDDPQVVIVALGQNDSHPYDFMAADYTGEQAANWRARYAE
FT                   FLGDLLERYPDAHIICTTTVLQHDRNWDRAIDEVVSELDNPQITHFDYSRAGTGTPGHP
FT                   RIAEDEEMARELVAYIDSFGAELWQ"
FT   gene            172239..173621
FT                   /locus_tag="BLA_0141"
FT   CDS_pept        172239..173621
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0141"
FT                   /product="beta-galactosidase"
FT                   /EC_number="3.2.1.21"
FT                   /note="COG2723:
FT                   Beta-glucosidase/6-phospho-beta-glucosidase/beta-
FT                   galactosidase"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28444"
FT                   /db_xref="GOA:B8DVE3"
FT                   /db_xref="InterPro:IPR001360"
FT                   /db_xref="InterPro:IPR017736"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR018120"
FT                   /db_xref="InterPro:IPR033132"
FT                   /db_xref="UniProtKB/TrEMBL:B8DVE3"
FT                   /protein_id="ACL28444.1"
FT                   /translation="MTMTFPKGFQFGTATAAYQIEGAVDEDGRTPSIWDVFSHAPGRVL
FT                   NGDTGDKADDFYHRWQDDLKLVRDLGVNAYRFSIGVPRVIPTPDGKPNEKGLDFYERIV
FT                   DQLLEYGIDPIVTLYHWDLPQYLNEDPYRDGWLNRETAFRMAEYAGIVAKRLGDRVHTY
FT                   TTLNEPWCSAHLSYGGTEHAPGLGAGPLAFRAAHHLNLAHGLMCEAVRAEAGAKPDLSV
FT                   TLNLQVNRGDADAVHRVDLIANRVFLDPMLRGYYPDELFAITKGICDWDFVHDGDLKLI
FT                   NQPIDVLGLNYYSTNLLAMSDRPQFPQSTEASTAPGASDIDWLPTDGPHTQMGWNIDPD
FT                   ALYNTLVRLNDDYDHIPLVVTENGMACPDEVEVGPDGVKMVHDDDRIDYLRRHLEAVHR
FT                   AIEEGANVIGYFVWSLMDNFEWAFGYDRRFGLTYVDYDTEERIRKDSYNWYRNFIAEHS
FT                   AK"
FT   gene            174036..174788
FT                   /locus_tag="BLA_0142"
FT   CDS_pept        174036..174788
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0142"
FT                   /product="beta-D-mannosidase"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28445"
FT                   /db_xref="UniProtKB/TrEMBL:B8DVE4"
FT                   /protein_id="ACL28445.1"
FT                   /translation="MRGRTMKVKKIAAIALASACAFSMAAVDFNGHRKPVWYASRDFFA
FT                   PRLATIQPRTSEEYRETHSWEGVKVDADHLELIVLNDTNEPYKGSWAVNRVDFDGNVLA
FT                   TQQIDDVELDAASHKGFPLNEEIVDFGDANNELIVAVPSDDSFARVIYNPAEILTQELD
FT                   APADAFTTKAKRTADGVELTVTANDYVRDLFCMVGKVDDKATVEEGLVSLLPGESVTFH
FT                   IGTDYAGDPADFAAANVLRSANDLKRDF"
FT   gene            175045..176073
FT                   /gene="lacI"
FT                   /locus_tag="BLA_0143"
FT   CDS_pept        175045..176073
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lacI"
FT                   /locus_tag="BLA_0143"
FT                   /product="putative transcriptional regulator"
FT                   /note="COG1609: Transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28446"
FT                   /db_xref="GOA:B8DVE5"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:B8DVE5"
FT                   /protein_id="ACL28446.1"
FT                   /translation="MVAQKAKVTIFDVAKASGVSSSAVSYALNGKPGVSDATREKVLQV
FT                   ARKLGWRPNGAAQSLAQSRTRRIGLVLGYDPQLLSAEPYIMRLISGLGSALEERDYSLL
FT                   VRMSMDDDDEVSILEDWIATGNVDALLLLNLEIGDPRIELMKNNPQMPCLALADSSLTS
FT                   GLPTLMSDDAAASGTMIRHLALFGHKNIARVAGPEELGHSYIRDAAFSEITTELGMRYR
FT                   CLHTDYTPESGAEATKRLLSVEPRPTAIIYDNDVMALAGESVASVKGVRVPEDLSIISW
FT                   GDSFMNVAAHPPITALSRNILESGRLAAQLMLKLIDGEDVENVEEPPYELIERASTAPA
FT                   AQ"
FT   gene            complement(176357..176992)
FT                   /locus_tag="BLA_0144"
FT   CDS_pept        complement(176357..176992)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0144"
FT                   /product="putative transferase"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28447"
FT                   /db_xref="GOA:B8DVE6"
FT                   /db_xref="InterPro:IPR006938"
FT                   /db_xref="UniProtKB/TrEMBL:B8DVE6"
FT                   /protein_id="ACL28447.1"
FT                   /translation="MIAGGIFRQDNPYNTVMNRIGDIAMLSVAWFVCCLPVVTIGVSTA
FT                   AACEVAREMQEDRDNGIFKGFWRAIKRRFGTGMLLTLFLGVLIALGAFDLWWISRSMAG
FT                   DMASVLYGVTLAVFIIVAMLFAFLLPLSGRSKLSAGEQIKQSAKLATMKPFIALVVAAI
FT                   YALPIVLLATLPSAVMWVPLVWCIFGGGASAWAQMWLIRRAFDLQPQD"
FT   gene            complement(177076..177807)
FT                   /locus_tag="BLA_0145"
FT   CDS_pept        complement(177076..177807)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0145"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28448"
FT                   /db_xref="GOA:B8DVE7"
FT                   /db_xref="UniProtKB/TrEMBL:B8DVE7"
FT                   /protein_id="ACL28448.1"
FT                   /translation="MEGKQPKLTPEQREAIDTLSSTPQYQGESKIKIFMKIPAKDKAAY
FT                   SRTHFLVPLLAAVIVIALGTFVIVRLVSPVPRPALYAAAVSGSTPMGEADKLKDDYAKK
FT                   LGKDVIIDDYFDMNKDGLSKLQTMIGNEQIDVVIAPHDVFAKLASFGYFDNLKTTLPAA
FT                   EYAKVGKYAMAFHGFDDSRVTDAIDESGSGQGKSEPYGLLLEHAPRWDRIEGADDDALV
FT                   GIAANTQQLDTAKNFIQYLYN"
FT   gene            178106..178267
FT                   /locus_tag="BLA_0146"
FT   CDS_pept        178106..178267
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0146"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28449"
FT                   /db_xref="UniProtKB/TrEMBL:B8DVE8"
FT                   /protein_id="ACL28449.1"
FT                   /translation="MYDEGPHIVLRRDGVCIVAKTPDGDMPQIEYWGRDFAFDTAGDAL
FT                   RQLDMRAI"
FT   gene            178581..179846
FT                   /locus_tag="BLA_0147"
FT   CDS_pept        178581..179846
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0147"
FT                   /product="N-acylglucosamine 2-epimerase"
FT                   /note="COG2942: N-acyl-D-glucosamine 2-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28450"
FT                   /db_xref="GOA:B8DVE9"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="UniProtKB/TrEMBL:B8DVE9"
FT                   /protein_id="ACL28450.1"
FT                   /translation="MANTDPKYQIGTPENKKFLDISRDNLIAFGRRFPAVDGSSYWLGD
FT                   DGTPWKDRNRATWITCRMTHVYSLATLLGVDGAAELVDDGIRGLRGVLHDEEHDGWYAE
FT                   ITPDICHMPTKQAYAHAFVLLAASSALLAGRPGAKELLEQAENVYLTKFWDDKIGLSVD
FT                   TWDTDFAELDTYRGLNANMHSVEACLAVADVTGDESWRTRAGRIIEHVLKWAEENNWRI
FT                   PEHFNSDWEPELEFNADKPDDQFKPYGATPGHGIEWARLITQYALSVYGKDGVLNGDGK
FT                   KYLDAAEHLFNRAVEDAWNADGAPGIVYTTDWDGKPVVHDRMHWTLAEGVNTAATLYHV
FT                   TGKKEYADWYATFLEYIDTYLMDHKNGSWFHQLNRENEVIDTVWPGKSDLYHATQAMMI
FT                   PLRDPALSIAPATKKGVEEGLN"
FT   gene            180383..181114
FT                   /locus_tag="BLA_0148"
FT   CDS_pept        180383..181114
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0148"
FT                   /product="ATP binding protein of ABC transporter"
FT                   /note="COG4619: ABC-type uncharacterized transport system,
FT                   ATPase component"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28451"
FT                   /db_xref="GOA:B8DVF0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B8DVF0"
FT                   /protein_id="ACL28451.1"
FT                   /translation="MSSAHDFHATGVTAVVNNDAGGTRTIFKDLSFAVHGGEIVDITGP
FT                   SGSGKSTLLTSFARLNVNTTGKFVLDGVDSDTLSPQQWRERVAYLPQTSVLIGDNVADA
FT                   IRLPWSLKIRVSQDHEAAEQKLPDSLIRSTLDSLGCDDIDLARAVQDLSGGQAARVSLT
FT                   RTLLTHPGVLLADEVDAGLDEENADKVADILRKAADNGTAVVRIRHRKPDGRANRIMVL
FT                   ANGTISPLKTAQSAPSTHTEV"
FT   gene            181116..181982
FT                   /locus_tag="BLA_0149"
FT   CDS_pept        181116..181982
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0149"
FT                   /product="putative ABC transporter, inner membrane subunit"
FT                   /note="COG0390: ABC-type uncharacterized transport system,
FT                   permease component"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28452"
FT                   /db_xref="GOA:B8DVF1"
FT                   /db_xref="InterPro:IPR005226"
FT                   /db_xref="UniProtKB/TrEMBL:B8DVF1"
FT                   /protein_id="ACL28452.1"
FT                   /translation="MQQYFAIDNWGLLIAVLMVCIAAGVSALMKLGVAKSLLWATARSL
FT                   VQLLAMGFILEYVIRAQNVWLVIGLIVVMLVAAAQITMSRAKGIPKGLVPLVLLSLAVT
FT                   MLLMLALVGELVIRPNPWYSPQLIIPLTGMLLGNTVSALALGLSRFFNSMRERYEEVNT
FT                   LLALGATPWEAAKPSITSSITLGLLPSIAMLASSGIVTIPGMMSGQIIAGQNPVNAAKY
FT                   QFVILAAVSALTLLADSIILALVYKRCFISYDRYFVPPARDSVSTLDRIRRQAAERANR
FT                   GPESAGE"
FT   gene            182135..183631
FT                   /gene="aroP"
FT                   /locus_tag="BLA_0150"
FT   CDS_pept        182135..183631
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroP"
FT                   /locus_tag="BLA_0150"
FT                   /product="aromatic amino acid transport protein AroP"
FT                   /note="COG1113: Gamma-aminobutyrate permease and related
FT                   permeases"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28453"
FT                   /db_xref="GOA:B8DVF2"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniProtKB/TrEMBL:B8DVF2"
FT                   /protein_id="ACL28453.1"
FT                   /translation="MSASHGAGERNADPQQLHKSLKNRHIQLIALGGAIGTGLFYGSSE
FT                   SIALAGPSILLAYVIGGAAIFVIVRAMSEMSVEEPKAGAFSYYASRYWSKRAGFISGWN
FT                   YWFNYVLVSMVELAVVGSFVNYWFPNIPQWASAAFFLVLITLLNLFGVSEFGEFEFWFA
FT                   LIKIVAVIAMIAGGLWVIVANLPTDSGVRASFANWFTVDGGFFPHGAMSRAADGHWDGL
FT                   LMALVVVMFSFGGTELIGVTAGEVENPSKTIPRATNGIIWRILVFYVAALGIIMAVVPW
FT                   DRIDGKMSPFVQIFDSVGVPVAAGILNFVCLTAVMSVYNSALYSNSRMLFSLARQGNAP
FT                   AYLGRVNKRGVPVAGVLTSAAVTVVAVVVVFLWPQFAFNYLMSIATIAAIINWTMIMIT
FT                   EMLFRRRVAAGDGPGELNGLRGAEALAKIRFKLPGWNWTPYVIIAFLAMVAVLMCFSPS
FT                   YRIALIAGVIWLAVLFAAYAITSRASAKRDAKTVLDSTRK"
FT   gene            184213..184914
FT                   /locus_tag="BLA_0151"
FT   CDS_pept        184213..184914
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0151"
FT                   /product="ATP binding protein of ABC transporter"
FT                   /note="COG1136: ABC-type antimicrobial peptide transport
FT                   system, ATPase component"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28454"
FT                   /db_xref="GOA:B8DVF3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B8DVF3"
FT                   /protein_id="ACL28454.1"
FT                   /translation="MAYIEFNDVVKEYPAGSSSIRALDGASFAADEGELSVILGQSGAG
FT                   KTTALNILGGMDTATSGRVIVGGRDITDLNHHDLVTYRRNDIGFVFQFYNLIPNLTALE
FT                   NVELASQICTDHFDPAQTLAKVGLADRLGNFPAQLSGGEQQRVSIARALAKKPKLLLCD
FT                   EPTGALDYETGKEVLQLLQDICRTERMTVLIVTHNSALAPMAHKVIRFRSGKVTSQETN
FT                   EHPVPISQIEW"
FT   gene            184904..187879
FT                   /locus_tag="BLA_0152"
FT   CDS_pept        184904..187879
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0152"
FT                   /product="large transmembrane protein possibly involved in
FT                   transport"
FT                   /note="COG0577: ABC-type antimicrobial peptide transport
FT                   system, permease component"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28455"
FT                   /db_xref="GOA:B8DVF4"
FT                   /db_xref="UniProtKB/TrEMBL:B8DVF4"
FT                   /protein_id="ACL28455.1"
FT                   /translation="MNGRGGEMARRKGVPVGDADVHAQIADSGSLHAEHGHARAVGSAF
FT                   LLDTMRSGLHAWKPFLSILIITMLGVAVLTGIYAGCRDTFAAANRFYRAQGLHDVQVIS
FT                   TMGLTDADVDALRQVEGVEQAQGMRMIRVKVADGDGKQLNATLEEPASGSPAALDRPYV
FT                   NEGWLPSKPGEVAVTAQFTHDTHKKLGDTVEVAADGEDDGTHGLKIVGIVTDPSDLTNP
FT                   GGYSGSAFRSSVTNDYTFYTAPDGIQRTFVKADGTPIAAADPKVYGSIVLRLDDAENED
FT                   AFTASYDDLVSGTVKRIENGVQAKREQARRNALVEEAQNKLDAEKKKAFDQIDAAQAKL
FT                   DAQRRQLDDQLKQLDAQTAQIPVGVPEPAQLAEAQRQWAAADTKLREAQQAIDTQRNEA
FT                   FSAFAAEQQKVDGIATPRWYVQSRSALAGFSSLKSDISSIESLGKAFPIVFLVVAVMMS
FT                   LTTMSRLVEEDRGLVGTYLGLGYGRIAITLRYALFALLACLIGGGLGLLIGFLGIPAFL
FT                   LVVIRGLYAIPDLRLEYDWLYGSLGVLLFVVGVLGAALIASVREMRQMPAALMRPKAPK
FT                   AGSRILLERVRPLWSRMSFLNKVTARNIFRFKARLIMTVGGVAGCTALILCGLAINDTV
FT                   AALGPNQYRGVDQYDMLAVANDGDEQALRKKLVSDGTTTAIMETRIENGEITNANDRGT
FT                   NVQLTVVPQRQLGELNTMFDLQPAQGDSLLGWVHGGNRNQPVRLDNSGIIVAQSAAQSL
FT                   GIKAGSEVTLRGDGTQPHKVKVAQVTRSLIGAEAFISEDLYHQLFPAQQAGDGGTEPAI
FT                   TWNAVYAKLKGSDSEQSEYVQHLKNEATVMSATSCAQQAEDFKFDLMGAVVALIVALAG
FT                   SLALVVLFTLAHTNVSERLREMATLKVLGFYGREVHHYVNREMMVLTVMGIVIGLPLGR
FT                   WVSGLLTNALNMPGIYFEVHISWWSYIITVVATLAFAWLVQLFVNPVLDRIDPVSSLKS
FT                   VE"
FT   gene            187934..189478
FT                   /gene="aapA"
FT                   /locus_tag="BLA_0153"
FT   CDS_pept        187934..189478
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aapA"
FT                   /locus_tag="BLA_0153"
FT                   /product="amino acid permease"
FT                   /note="COG1113: Gamma-aminobutyrate permease and related
FT                   permeases"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28456"
FT                   /db_xref="GOA:B8DVF5"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004840"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniProtKB/TrEMBL:B8DVF5"
FT                   /protein_id="ACL28456.1"
FT                   /translation="MSDVQQPAEPHETPHEEEVNASLETLDKDNEMERGLSNRHVQFIA
FT                   IGGAIGTGLFLGSGKSINLAGPNIIFVYILVGGIMFLMMRAIGELMYRDPSQHTFINFI
FT                   RFYLGDGWGKFALWSYWIVLILIGMTEITAVGQYCVTFFRTLGYDVSAWKGLIELGFLL
FT                   LLVMINLIAVKAFGEAEFWFSMIKITLIVAMIATAVIMLVCGFKYNAVQVPGQDHVSPA
FT                   GSVTLDNLTRGFSLAPNGWLAFLMSFQMVFFAYEMIEFMGVTVSETKNPRKVLPKAING
FT                   IIVRVLIFYVGALLAIMTIVPWRNFRPNKDGSFASPFIMVFEYAGANWAAALVFFVVVT
FT                   AAASSLNSLLYSAGRHLYEIAEDSPSPAIAKLGVVSKTKVPARAIIASAILVLLSPVIE
FT                   MIPRVSGAFVMFSSASSAVIIFIYILTMIAHYRYRNSPQFMANGFRMPAYRVLNPLTTA
FT                   FFVFIYCTLFIGADTRGPAIAGLVWLVVFGGYCVLHERFQNRDLKQSIDSAGDAHA"
FT   gene            complement(189490..191808)
FT                   /pseudo
FT                   /locus_tag="BLA_0154"
FT                   /note="frameshift: putative ABC transport system integral
FT                   membrane protein"
FT   gene            complement(191805..192296)
FT                   /locus_tag="BLA_0155"
FT   CDS_pept        complement(191805..192296)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0155"
FT                   /product="putative ABC transporter ATP-binding protein"
FT                   /note="COG1136: ABC-type antimicrobial peptide transport
FT                   system, ATPase component"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28457"
FT                   /db_xref="GOA:B8DVF6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B8DVF6"
FT                   /protein_id="ACL28457.1"
FT                   /translation="MVPTPTAKENILLPLQIAHRPIDMDWFDKVVSVVKLQNRLDHRPS
FT                   QLSGGQQQRVACARAIMERPSVIFADEPTGNLDSRSSHEVFEFLRMCVREYGQTIVMVT
FT                   HDPRAASFADRVLVLSDGSIVQDLDHPSYDDILAVFAQDDDPQNGPVEVESATARSAEQ
FT                   "
FT   gene            192922..193515
FT                   /locus_tag="BLA_0156"
FT   CDS_pept        192922..193515
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0156"
FT                   /product="possible MarR-type transcriptional regulator"
FT                   /note="COG1846: Transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28458"
FT                   /db_xref="GOA:B8DVF7"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B8DVF7"
FT                   /protein_id="ACL28458.1"
FT                   /translation="MDYQLEAVHELMFAMWASRSKATRSFERGAQGEMFVLRELSFQGA
FT                   RTPSQLAQAMGATSGRISSILASLTKKGWIVRTGDPQDRRSVVVELSDEGRRAVRQRSD
FT                   RLIENLSWVFSQMGERRTREFVGLLSEFMTYLSICEPDGSYPTVEQVEEAFERRARLHE
FT                   RMREMVRNGEQWHGSCRPHDAPSSNDADVDRPVQ"
FT   gene            193587..195506
FT                   /locus_tag="BLA_0157"
FT   CDS_pept        193587..195506
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0157"
FT                   /product="probable permease protein of ABC transporter
FT                   system"
FT                   /note="COG1132: ABC-type multidrug transport system, ATPase
FT                   and permease components"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28459"
FT                   /db_xref="GOA:B8DVF8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:B8DVF8"
FT                   /protein_id="ACL28459.1"
FT                   /translation="MIRIMKYLSKTEIGQLVLSLVTIVGQVYFDLELPSYMSQITRLVE
FT                   TPGSQMRDIWIAGGKMLLVSLGSLACAVITGYFAARVAASFGQRLRSLEFRKVESFGPS
FT                   EMHRFSTASLITRSTNDITQIQMFITMGLQMLIKAPIMAVWAVCKIAGEGFEWTLATGI
FT                   AVAILIISIAVLMVLVMPKFKAMQQLTDDINLVTRENLTGMRVVRAYNAQDYQEGKFER
FT                   ANSNLTNTQLFTNRAMSVMMPLMGTIMNGLSLAIYWIGAYLIQDAGLTDKLTLFSNMVV
FT                   FSSYAMQVVMSFLLMSMVFVLWPRADVSAHRVLEVLDTDPLVKSGTAERGLTVQEAKQR
FT                   GIITPAERARYADDLELAGEIEFRDVSFTYPDSREAMLEHISFTANRGDTVAIIGSTGS
FT                   GKSSLINLVPRFYDATDGEVLVDGVNVREYDLKTLRDKIGYVPQRSFLFKGTVESNVSY
FT                   GDRPDEPEDVPVIDVSRMSGRKAEREFLKAGEARELTAQEANRVREASDIAQATEFVSK
FT                   MPKGFQSPIAQGGTNVSGGQKQRLSIARAVYRDPEILIFDDSFSALDFKTDREVRDALK
FT                   ETAKDATKLIVAQRVGTIMDADCILVLEDGKVVGQGTHRELLETCEVYQEIAKSQLSEE
FT                   ELSA"
FT   gene            195566..197413
FT                   /locus_tag="BLA_0158"
FT   CDS_pept        195566..197413
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0158"
FT                   /product="probable permease protein of ABC transporter
FT                   system"
FT                   /note="COG1132: ABC-type multidrug transport system, ATPase
FT                   and permease components"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28460"
FT                   /db_xref="GOA:B8DVF9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="UniProtKB/TrEMBL:B8DVF9"
FT                   /protein_id="ACL28460.1"
FT                   /translation="MPGPMGHGRAGAPVEKADDFGGALKELMRFSKRYIPAIVIALILG
FT                   VGGAICQIIGPDYLGDMTDEITKGLPALVHGKPVLRSIDMTAVTRIGWTLVALYVGYAL
FT                   LSYVQSWMMATVTQRTAQRLRAAIDVKMNKLPLKYFDEHSTGDVMSRITNDVDAVGQTL
FT                   GQSLGTLISSVTLFVGSLVMMFANNWILALCAVGATLLGMVLMLVVMRFSQKYFVKQQM
FT                   ALGDVNGHVEEMYSGHTVVKAFGGEADAIRRFERYNNDLYDSGWKSQFISGLMMPMMNL
FT                   VGNLGYVVVCVVGAALAMNGSIEFGVIVAFMLYIRLFTQPLSQFAQAFQNLQRCAAGSE
FT                   RVFTFLDEPELADESDKQPLLGYGSNGEITPVEGRVSFEHVKFGYEPNKLVIHDFSADV
FT                   EPGQKVAIVGPTGAGKTTMVNLLMRFYEIAGGKISIDGIDTKSVPRWNVHDQFSMVLQD
FT                   TWVFNGTVRENVAYAKEDVTDEQVVAACRAVGLDRYIRSLPNGYDTVLDESATLSQGQK
FT                   QLLTIARAMVQDSPILILDEATSSVDTRTEELIQTAMDKLTEGRTSFVIAHRLSTIRDA
FT                   DMILVMRDGDIVERGTHEELLAKHGFYADIYNAQFTLAQ"
FT   gene            complement(197427..198953)
FT                   /locus_tag="BLA_0159"
FT   CDS_pept        complement(197427..198953)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0159"
FT                   /product="putative secreted polysaccharide deacetylase"
FT                   /note="COG0726: Predicted xylanase/chitin deacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28461"
FT                   /db_xref="GOA:B8DVG0"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:B8DVG0"
FT                   /protein_id="ACL28461.1"
FT                   /translation="MGGKSSGQGNDTPHDAAQHGTTQHSTAHADDFDTMHAEFADTATG
FT                   SAADSAAYEPTAPRKRRNAVIAIAVTALIIVGVLAAIIIPISRANHRHAEEEHSAALAD
FT                   CESAQREFATLNTTYTVTLANAGKLAKGDGKTISEDHATALASKIEHIDDTHTVSSLVK
FT                   SECDTRQSTDDLNELTRRFGAASTSMVNRMRDVQTDADTLRRLVEGARNSNRRGELQKQ
FT                   LTIAKAAYERSANKAAENLRAALQAQIANAGALLEPGSTATNPQVNDALGSLTDATNAV
FT                   INAMPLDCEFAACVALTFDDGPNKQITPQLLAALKQADAPATFFVQGQFVSGSNTQLLA
FT                   NMAAQGNEIGSMSWRHKQLHTLSPAELTKWFNDTDDVIESAGAGKPTLFRPPDGAWSED
FT                   VVDAAKRSGQSVILWNVDSRDWDAQASAADIAKTVLDGASSGAIIALHDGNERTVEAIP
FT                   QIVSGLRERGFTPVTVSTLLDGELEPGTVFYARGDTAQDSAPSDGVEVTQ"
FT   gene            complement(199172..199312)
FT                   /locus_tag="BLA_0160"
FT   CDS_pept        complement(199172..199312)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0160"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28462"
FT                   /db_xref="UniProtKB/TrEMBL:B8DVG1"
FT                   /protein_id="ACL28462.1"
FT                   /translation="MKSIADWPPRLGYLQSRHYLQARHPLGYRTLCRAPFSSLRRANLQ
FT                   Q"
FT   gene            complement(199328..200017)
FT                   /locus_tag="BLA_0161"
FT   CDS_pept        complement(199328..200017)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0161"
FT                   /product="type 2 phosphatidic acid phosphatase family
FT                   protein"
FT                   /note="COG0671: Membrane-associated phospholipid
FT                   phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28463"
FT                   /db_xref="GOA:B8DVG2"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="InterPro:IPR036938"
FT                   /db_xref="UniProtKB/TrEMBL:B8DVG2"
FT                   /protein_id="ACL28463.1"
FT                   /translation="MDSLFVRKHCWQIIGALSLIGALWFTIAVCRFHILGMDTAVYGWI
FT                   TAHVMTPGMTSVMRMLTQLSGSITVIVVAAVALAVLAVVKRWKIGVAVAVNLAGIYVLN
FT                   EIIKHIVRRPRPDFPHLVFEQGYSFPSGHAMVSTAFYGFIVYLLYRYWHTARDSGARVG
FT                   KIVAIVLLCLIPPVVMFTRVYLGVHYASDVCAGLLFAIAWLTLFYVPAMKRTLLKRASP
FT                   AASPTKR"
FT   gene            200093..200728
FT                   /gene="thgA"
FT                   /locus_tag="BLA_0162"
FT   CDS_pept        200093..200728
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thgA"
FT                   /locus_tag="BLA_0162"
FT                   /product="galactoside O-acetyltransferase"
FT                   /EC_number="2.3.1.18"
FT                   /note="COG0110: Acetyltransferase (isoleucine patch
FT                   superfamily)"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28464"
FT                   /db_xref="GOA:B8DVG3"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR024688"
FT                   /db_xref="InterPro:IPR039369"
FT                   /db_xref="UniProtKB/TrEMBL:B8DVG3"
FT                   /protein_id="ACL28464.1"
FT                   /translation="MSDMEDRMHTGEMYLPHDEQILARQFDCLERLYDFNQTRPHELDR
FT                   RAELLHDMFAEIGDACYIEPPFHANFGGAHVHFGSDIYVNFNLTCVDDTHIYVGSHTMI
FT                   GPNVTLATAGHPILPELRERGYQYNMPVRIGENCWIGAGVVVLPGVTIGDNVVVGAGSI
FT                   VTRDLPSNVVAVGNPCHVLREVGERDREYYFKDRRIDWNEMRADEAAH"
FT   gene            200819..201238
FT                   /locus_tag="BLA_0163"
FT   CDS_pept        200819..201238
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0163"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28465"
FT                   /db_xref="GOA:B8DVG4"
FT                   /db_xref="UniProtKB/TrEMBL:B8DVG4"
FT                   /protein_id="ACL28465.1"
FT                   /translation="MRALRRFYRRNRTLVTWAVLCAASMALVGHVTWLPGADSLFTPVS
FT                   GVSSFVLSPAAGGALLWRQRSRRAIRWYVVAVLLGASMPMLWGYFRNEWANLQMPTTLD
FT                   GVVATVSSLAPAILFALGAFCVYRYALGGRRRRRW"
FT   gene            complement(202229..203488)
FT                   /gene="livF"
FT                   /locus_tag="BLA_0164"
FT   CDS_pept        complement(202229..203488)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="livF"
FT                   /locus_tag="BLA_0164"
FT                   /product="branched-chain amino acid transport system
FT                   substrate-binding protein"
FT                   /note="COG0683: ABC-type branched-chain amino acid
FT                   transport systems, periplasmic component"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28466"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:B8DVG5"
FT                   /protein_id="ACL28466.1"
FT                   /translation="MNKPNRKTWRTTATAMAATAVLTLSGCGTGTADSSANAAEDTFVA
FT                   GGLFPLTGTAAYLGPSNVSTMKLAEQDIDEAGGVLGNKISTITADTSDAEHADQNATAV
FT                   QSVLSKNPSVVIGPPLSSVVKNTYKQVTTSKIPMISPGATSTAFSGLDDYFFRTIPPDT
FT                   VQGVVMGDLIAQDGIKNLAIAVFNDEYGISLRAEVLKTLKEGGVNVVYGETETFDPAEN
FT                   NFSSIATNIKATNPDAVLVIAADQTIPLVKELAAKGIDTHKLYMPDSNMVDHSKDFTSG
FT                   LLKGSKGTIPGAHPTSEFQNALKTIAPDTTIYTYNTETYDAMVLAALAAEKGGAADSET
FT                   VQKNLMAVSGTTKGEKCESYEDCVALMKSGKEIQYVGKTSIGVFNNAHDPSTASIGIYE
FT                   YDDSNVPVFLDSQEGAVPQN"
FT   gene            complement(204079..204732)
FT                   /locus_tag="BLA_0165"
FT   CDS_pept        complement(204079..204732)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0165"
FT                   /product="possible TetR-type transcriptional regulator"
FT                   /note="COG1309: Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28467"
FT                   /db_xref="GOA:B8DVG6"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:B8DVG6"
FT                   /protein_id="ACL28467.1"
FT                   /translation="MHSISSASSASASAARAASSARARAPRPALGIPRHGLRRERTDGK
FT                   ITRAVLELILAKGIGAVSIEAVAKRSGVAKTTIYRRYANTDDLLRHLSVAVGEPLDFSG
FT                   FDTTFDGLRGVLKCIVDCFDEELGLKAIGVVLSSSNDYLANLAERVVTPAQQRFADFIG
FT                   RGVSSGAFRGDVSVPFLFQTVIGSMMAAKALSDSSHDTWAHDMASLLWPTLAAR"
FT   gene            complement(204742..206940)
FT                   /locus_tag="BLA_0166"
FT   CDS_pept        complement(204742..206940)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0166"
FT                   /product="phage infection protein precursor"
FT                   /note="COG1511: Predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28468"
FT                   /db_xref="GOA:B8DVG7"
FT                   /db_xref="InterPro:IPR017500"
FT                   /db_xref="InterPro:IPR017501"
FT                   /db_xref="UniProtKB/TrEMBL:B8DVG7"
FT                   /protein_id="ACL28468.1"
FT                   /translation="MSMLAKIFADDVRHLTSNIVSIIITIGLIVIPGLFTWFNVAACWD
FT                   PFANTKNLQFAIANDDEGYKGDLLPMRINIGEQVVDTLRANSQLDWTFTKSSAEAIDGT
FT                   KSGKYYAAVVIPKNFSKNMMTFFTDDAYHATLDYYNNEKLNALAPKVTGQGADTIAATI
FT                   NQTFSKTLTDTALNLASSMLDMLDKPEYQQRLKSFNGNIADLAGMLNDSAAVLRTYSSL
FT                   TDSAKTLLASSNKLIADARASAKTGVDDLSAAKTGVSDLSGALGTSVNALGTAIDTSKT
FT                   SLGSLNDRVDELFSAVDKQAGDTSAAINNLAGNVRTEATAYATTRGRLQELLDKSDNLG
FT                   PVAKSAVQAFINRIGAVADDLNQTADRLTTAANDVDSKVGSSKETRQEIKDLAGKAQSS
FT                   VSSISKDFDETIKPDLTAMTNAFSDAANSLNGTVSTLDSSLDSLSGTASDANKQLDSVH
FT                   ELIDNAATQLTDAAKELTNFNTQFAKALDTGNMGTIKKLLSGNTATLSTALSTPVELKR
FT                   VALFPVDTFGAALTPFYTFLPLWVGALLLVVTLKIGISRKRQRELGNPKPWQIFLGHYG
FT                   VFVSIALLQSTFSCAGTLLFLRVQVVHPWLFMLVGWFSSIVYSFFTYTLVSTFANVGKA
FT                   IGVLFLVMQISGSNAAYPLSILPHFISDISPWLPVSYSVTAMRGAIAGIYENDYWIAMG
FT                   KLALFLVPLLFIGLVLRHALLGFNHWYEARVERTKLLG"
FT   gene            complement(206937..209705)
FT                   /locus_tag="BLA_0167"
FT   CDS_pept        complement(206937..209705)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0167"
FT                   /product="putative phage infection protein"
FT                   /note="COG1511: Predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28469"
FT                   /db_xref="GOA:B8DVG8"
FT                   /db_xref="InterPro:IPR017500"
FT                   /db_xref="InterPro:IPR017501"
FT                   /db_xref="UniProtKB/TrEMBL:B8DVG8"
FT                   /protein_id="ACL28469.1"
FT                   /translation="MRNIWFILRRDLKRLIINPAAWVIIFGLTFIPALYAWFNIIGFWN
FT                   PYGNTKGITVAVANEDAGADNAMMGKLELGDQIESTLKENHELGWTFLGKAKAMECVES
FT                   GHCYAAIVIPRNFSENMAAVITGSGQRPTLEYYVNEKVNAVAPKMTDVGANTVDRQVNS
FT                   AFVSTVSKAVTDTINTTNVQITQEGNATVAQTVAKLDATKANLSKSRTMIADLRKTLDG
FT                   VDEKTTAAKQALAGVDSAATSASQGLTSASGLLTKTQGGITSFSNDLSTELDQGGNLFL
FT                   QASGKASTSATRVANGVLTASGATGSALNELTSVNKTNAQILADLKALPDNPLSEQINE
FT                   IVTDLSAENEKVAQTLQTLTTLNDSTTAAANSTLGTVDQFSATSTTTVDALSGARNTIN
FT                   SSAIPQLNSGLATLSGTAGTLSGFLTGTQSLTGQTNLILDQLTQICQSTSSSLNSTDDL
FT                   LGKFITRIDTVTTDLKTLENTNVLSDLLGSKNGTLDASRIASFMLSPTVLDTHTLYPID
FT                   TYGSGMAPLFTSLALWVGVFMLMVLFKLEVDNEGLEGRHVTTNQTYMARYLLLAIVAGL
FT                   QGIVCAVGDLIIRVQCANRFVFILTAWLTSLAYLAIAYALSATFMHVGKALVVALVMLQ
FT                   IPGASGLYPIEMMPDFYRALYPFFPFTYSINAFRETIAGFYDGDWLTKMLMLALFTAIA
FT                   FFVGLVVRPWLGNFNHLFAREVHEGDMIVGERVYMPANRFDLAQALHVLADHGEYRRRI
FT                   ERRAKRFATLYPRLMRGALVAGFAVPIVLFIVFSFVGASDGSKLVALATWIAWILIIII
FT                   FLMTVESIRESLRRQTELGSLSEDSLRDMIMAQGVFGNNRHHITVPADELRPDAASNSR
FT                   ERAEKRREERDLNHREDTLDLNLNELRKPERQRKHRGSTSRRNHHDGRHSA"
FT   gene            210059..210640
FT                   /locus_tag="BLA_0168"
FT   CDS_pept        210059..210640
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0168"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28470"
FT                   /db_xref="GOA:B8DVG9"
FT                   /db_xref="InterPro:IPR011733"
FT                   /db_xref="UniProtKB/TrEMBL:B8DVG9"
FT                   /protein_id="ACL28470.1"
FT                   /translation="MTVADLINVGVFGAVYFALVGVAALASMAVFGVAGNILLPAIAAV
FT                   LAGPVFMLMVARVRRFGAITLMGLMLGLFLFVSGHFATSLVTAIVFPLAADCIARFGAW
FT                   RRPWALMLSYVVFSFGCTGPILPLWMMKDAYIASLERKGKDAAYIDALFGAVNGTTFVV
FT                   AMVAIVIGALVGGLFGMRLMRRHFLKAAVA"
FT   gene            210670..211377
FT                   /locus_tag="BLA_0169"
FT   CDS_pept        210670..211377
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0169"
FT                   /product="possible ABC transporter permease for cobalt"
FT                   /note="COG0619: ABC-type cobalt transport system, permease
FT                   component CbiQ and related transporters"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28471"
FT                   /db_xref="GOA:B8DVH0"
FT                   /db_xref="InterPro:IPR003339"
FT                   /db_xref="UniProtKB/TrEMBL:B8DVH0"
FT                   /protein_id="ACL28471.1"
FT                   /translation="MPIRATRGVLHFDPRVKLAMLVVANMMMFLHVGPYAGMMGVLLFS
FT                   LPMLCGGKIALGMGMLACYAMCLGVDWLAAAVADAAPWLHVPGALAAGGAMMLPCLIAG
FT                   MSAFATTPPGELVAALRRLHLPDAVVIPAIVLLRFFPTIARDYRMIRCSMRLRGINVGG
FT                   WAMLCHPMRSLEYVLVPLLMNAANAAHDLTVSALTKGLGRRRATSSSAMLHMQAIDWAM
FT                   LALCCLPLIPWQA"
FT   gene            211430..212917
FT                   /locus_tag="BLA_0170"
FT   CDS_pept        211430..212917
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0170"
FT                   /product="ATP binding protein of ABC transporter"
FT                   /note="COG1122: ABC-type cobalt transport system, ATPase
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28472"
FT                   /db_xref="GOA:B8DVH1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B8DVH1"
FT                   /protein_id="ACL28472.1"
FT                   /translation="MNGTRCALDGCSFRYASDESADGVERGVHAIDHVSLQARAGEVVM
FT                   LVGRSGCGKTTVTRLLNGLAPEYFRGSLHGEARVGGLHAGVAAVEDYATEVGSVFQNPK
FT                   TQYFHANSTDELAFPCENAGMEPSEIRRRIRERLRAFDVEHLHDRNIVDCSGGQQQQLA
FT                   VVAATMLDPGVLVLDEPTSNLDAEAMERLRNMVKRLKRDGIAIVIAEHRLAWVADLADR
FT                   YVVFDAGRVVGEYTAEQFHALPESQRRAWGLRALELSGPRGQVERIAQRAEPSGEKPVI
FT                   ATRGLKVGYERRRLFGRTKRGFVREVGDVNLFAGQIVGLIGRNGAGKSTFVKTVCGLVE
FT                   PVAGEILVDGRAAKPGRLSALCAMVMQDVNYQLFASSVREEMLLEAMQHVRTAEDAQRV
FT                   RERADGILRQLGLLDFAERHPMTLSGGQKQRLAIGVALMGEKRVVVLDEPTSGLDRHHM
FT                   LQVGALMRDLADRGVCVLVVTHDDELAAEVCDRIVRF"
FT   gene            complement(212967..214550)
FT                   /locus_tag="BLA_0171"
FT   CDS_pept        complement(212967..214550)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0171"
FT                   /product="periplasmic solute binding protein precursor"
FT                   /note="COG3443: Predicted periplasmic or secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28473"
FT                   /db_xref="GOA:B8DVH2"
FT                   /db_xref="InterPro:IPR006127"
FT                   /db_xref="InterPro:IPR012674"
FT                   /db_xref="InterPro:IPR015304"
FT                   /db_xref="UniProtKB/TrEMBL:B8DVH2"
FT                   /protein_id="ACL28473.1"
FT                   /translation="MTEQSTNQRSATHDEPRRRPITRTAIAFLAGLAVCGLAASTLSGC
FT                   GNNAGENRTSAAAARQTTDSCDTTINVVASVNQWGSLAQQLGGSCVNVTSIINSTAADP
FT                   HDHEATPADLTKLARADVVVLNGAGYDGWAQKAQLDEGRQRIVKASSLMGIADSQDDHD
FT                   HEEGEGHHHHHGTVNPHLWFSPAAVLKMSEAITSAYVTKSGEASETAATARRHSNTWNA
FT                   EYAEYTALVNRARAKNLQRRYVATESIIGHLLDYIGATDKTPDSYTNAMNNDAEPSASD
FT                   LKNALDTVGSSNVDMLIVNPQEMGGFAKKLDAAARESGKTIISVTEQLPENHKTLLGWL
FT                   TTITNQALADDPQHGWFLTQQVKDRTIADYAGQWRSVYPLLKNGKLRGVMEHKAATGDK
FT                   TADEYTAYYDAGYKTDTETITIEGDRMAFTTNGRKVTATYRYDGHRILDYAKGNRGVRY
FT                   LFTATGDVPQGAPKAVQFSDHGIAPGKAAHFHIFTGDSHDEVIKQMEHWPTYYPASMSD
FT                   DEIVKEMLAH"
FT   gene            complement(214746..215576)
FT                   /locus_tag="BLA_0172"
FT   CDS_pept        complement(214746..215576)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0172"
FT                   /product="patatin-like phospholipase"
FT                   /note="COG4667: Predicted esterase of the alpha-beta
FT                   hydrolase superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28474"
FT                   /db_xref="GOA:B8DVH3"
FT                   /db_xref="InterPro:IPR002641"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR037483"
FT                   /db_xref="UniProtKB/TrEMBL:B8DVH3"
FT                   /protein_id="ACL28474.1"
FT                   /translation="MGVIDVGGGLRSAYSTGVLDYCLDNGIHFDYGLGVSAGAANITSY
FT                   LAGQRGRPLRFYTKYCPRPEYMSLGNFLRDGSYLGLDYIYGTLMNEDGEDPLDYDALVA
FT                   GGVPYRITVTDALSGMPKYLGPESMSRNHYDALKATACLPVLDKPYPLDGRPYFDGTIS
FT                   DPIPFRQAFADGCTKLVVILTRPRDFYRNPDKDIASSMMLAVRYPEAARALANRAHTYN
FT                   VELNMCKRLEAQGKVRIIAPKSIDGVSTLTKDPDKIQNLYNRAYNDATALRNFL"
FT   gene            215775..216530
FT                   /locus_tag="BLA_0173"
FT   CDS_pept        215775..216530
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0173"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28475"
FT                   /db_xref="GOA:B8DVH4"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:B8DVH4"
FT                   /protein_id="ACL28475.1"
FT                   /translation="MNDVNPYAAAAHIEVLPLTPTRQSIERALVEWMTQTGRPASDLSV
FT                   SALCKKAFVARSTFYANYRHMGQVYESVENRLLRQLFECAVPMRVRADGTDETMRSFNA
FT                   FVKVLHAHENEFRLVLVRQPSSRFVALWKQSLEYHVWHRLFETERGGAAAVDAVAEWGD
FT                   GAAPGTSNGGSATSQEGLPAGTDADATNRNELPVRQGPATVNRALVFDMAATAFIAGVT
FT                   FWLRTPQAVSLPEIRASVVKLVNNIDEIW"
FT   gene            complement(216710..217420)
FT                   /locus_tag="BLA_0174"
FT   CDS_pept        complement(216710..217420)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0174"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28476"
FT                   /db_xref="GOA:B8DVH5"
FT                   /db_xref="UniProtKB/TrEMBL:B8DVH5"
FT                   /protein_id="ACL28476.1"
FT                   /translation="MAQHDNTNTEIIRPQGGSQTQAAADTAQIAHTQADAPTQPQGYAF
FT                   DFAQQQGEQIPPSQGYAPQNGEQPFTTAANTAQPNMGGNGVPNNPQGGQMPMNGGAPGN
FT                   RGTATLRGKPGGKTIGIIAAISLGCGLVAGIAGTAVTNAIYRSNEPSHSNMMMRGIGDR
FT                   GFGEGDGDGESMPDFGSGNGSRNRRSYRADGQMPGMQDSDGANGESNGDARNRSQSNDS
FT                   DSNADSGSSDSSKN"
FT   gene            complement(217582..217654)
FT                   /locus_tag="BLA_t0005"
FT   tRNA            complement(217582..217654)
FT                   /locus_tag="BLA_t0005"
FT                   /product="tRNA-Lys"
FT   gene            217751..219319
FT                   /gene="pepDB"
FT                   /locus_tag="BLA_0175"
FT   CDS_pept        217751..219319
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pepDB"
FT                   /locus_tag="BLA_0175"
FT                   /product="dipeptidase"
FT                   /note="COG4690: Dipeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28477"
FT                   /db_xref="GOA:B8DVH6"
FT                   /db_xref="InterPro:IPR005322"
FT                   /db_xref="UniProtKB/TrEMBL:B8DVH6"
FT                   /protein_id="ACL28477.1"
FT                   /translation="MSCTTLLVGKSASYDGSTIIARNDDSGSGTYDPKKFVAVRPEDQP
FT                   RHYRSVISHMEIDLPGDPCLYSIVPNVRPNRGVLAEAGVNEHNVAMSATETIAVNSRVL
FT                   AADPLVKLVPAHGEPGDADYREEVPGGFGEEDIITLVLPYVRTAREAVARIGELLATYG
FT                   TYESNGIIASDVDEIWYVETIGGHHWIARRVPDDCYAAIPNQLGIDLLDIDDAMSECRN
FT                   NMCSADLADFIEANHLDRAMPDPEFANHTAQHINPRTVFGTATPKDAIYNTPRAWYMQR
FT                   HLNPSDDWDSPAAQYRPDSQDMPWAREPESKVTIEDVAFLMGSHFQGTPFDPYGTTGTA
FT                   ESRHRYRPIGVNRTGQMVCMQIRPYAPAAYRSIMWVSYGSGAFTTPAPFYANVTDTPAY
FT                   LRDTDGENASTNSLYWTNRILAVMADAHYYDTDGEIEQYIEDVQAHGHRLVADTDASIR
FT                   ADADALASDSAHEGLKAVRLELETANKAMADWLQMRTQTLLNQVLYTTSNLMHNAFKMS
FT                   DHWMS"
FT   gene            complement(219505..220218)
FT                   /locus_tag="BLA_0176"
FT   CDS_pept        complement(219505..220218)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0176"
FT                   /product="probable TetR-type transcriptional regulator"
FT                   /note="COG1309: Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28478"
FT                   /db_xref="GOA:B8DVH7"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:B8DVH7"
FT                   /protein_id="ACL28478.1"
FT                   /translation="MANASRMSSYQRREQLLRIGRSLFAAKGFEAVSVEEIAATAKVSK
FT                   PIVYEHFGGKEGLYAVVVDREMRALNDTLVAALSAQDVHPRQIVERTALALLTYIEENA
FT                   EGFQVLVRDSPSTDPSSSFSSLLGDVSMRVGEILSEWFKKQKLPTKGVPYYAQMLVGMT
FT                   VFTGQYWADQRKVSKEQLAALIVNLAWNGLSRMKAKPELRFEGEKAKKAAQRAAENDGT
FT                   EETRTESPSAPAPSA"
FT   gene            220345..221745
FT                   /gene="ftsY"
FT                   /locus_tag="BLA_0177"
FT   CDS_pept        220345..221745
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsY"
FT                   /locus_tag="BLA_0177"
FT                   /product="signal recognition particle-docking protein FtsY"
FT                   /note="COG0552: Signal recognition particle GTPase"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28479"
FT                   /db_xref="GOA:B8DVH8"
FT                   /db_xref="InterPro:IPR000897"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004390"
FT                   /db_xref="InterPro:IPR013822"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036225"
FT                   /db_xref="InterPro:IPR042101"
FT                   /db_xref="UniProtKB/TrEMBL:B8DVH8"
FT                   /protein_id="ACL28479.1"
FT                   /translation="MDTNTIYAIVIIAVIAVALIIGSWLIGRSRRNAINKSTEHAKAAA
FT                   DARLAAERAQAEQEEREAHEQAKEPAESGARQSSGGKPAEPTNEEKIEAEEPAISRAEL
FT                   EAQERERLSQTPPKLAAAEEVPGEESAQAESVVEDLAVVDEVPTPPAEQIEKPAGKKSR
FT                   LQRLRERLSKSSNPFGKALFNILAKDQLSEADWEDVEDTLLLADVGAEASEELVDKLRT
FT                   DARVTGESDPRQLRDALRSELLALVGPDMDRTLEAEKPDAKKPSVIIMVGVNGTGKTTT
FT                   AGKLARLFVSEDKTVLLGAADTFRAAAADQLETWGAKVDVPVVRSDREGADPASVAFEA
FT                   SAKAKELGTDVLIIDTAGRLQNKANLMDELGKIRRVAEKNLPVDEVLLVLDATTGQNGM
FT                   AQAKVFAEAIGITGVVLTKLDGSAKGGIVISVQKELGVPVKLVGVGEGPDDLAPFDPES
FT                   FVDGILGE"
FT   gene            222005..223300
FT                   /gene="amt"
FT                   /locus_tag="BLA_0178"
FT   CDS_pept        222005..223300
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="amt"
FT                   /locus_tag="BLA_0178"
FT                   /product="ammonium transporter"
FT                   /note="COG0004: Ammonia permease"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28480"
FT                   /db_xref="GOA:B8DVH9"
FT                   /db_xref="InterPro:IPR001905"
FT                   /db_xref="InterPro:IPR002229"
FT                   /db_xref="InterPro:IPR018047"
FT                   /db_xref="InterPro:IPR024041"
FT                   /db_xref="InterPro:IPR029020"
FT                   /db_xref="UniProtKB/TrEMBL:B8DVH9"
FT                   /protein_id="ACL28480.1"
FT                   /translation="MSQLDSGNAAWILTSACLVFLMTPGVALFYGGMVRAKAVLNMLIM
FT                   EAAALSVTMIIWGLWGWSIAYAGNSIGGVFGDPATGFLLRDTMVAQDGVFTSASLNSNN
FT                   YPASVDVAFQAAFAMITVALICGAIAERVKYSTWMIFVALWITFDYAPMAHMVWNGGLL
FT                   SADGAISQALGAAAHDFAGGTVVHINAAVAALIIVLIIGKRKGFGVEPMRPHNVPFVML
FT                   GAFLLWFGWFGFNAGSAFAANGVAGYAWVSTSLAAAAAMLTWGFTEKIRTGHYTAMGAA
FT                   SGIVAGLVAITPAADVVSPIWAIVLGAIAGVVTCLACSLKFKLGYDDSLDVVGVHGVGG
FT                   LVGTVLLGFFMEGTGLFYSGKWNQLGVQLIIAIIAIAFSAVITTIIAFALEKTIGWRVT
FT                   QAQEVAGIDLADQGERAYDFAGTASSVIREMK"
FT   gene            223302..223640
FT                   /gene="glnB"
FT                   /locus_tag="BLA_0179"
FT   CDS_pept        223302..223640
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glnB"
FT                   /locus_tag="BLA_0179"
FT                   /product="nitrogen regulatory protein N-II"
FT                   /note="COG0347: Nitrogen regulatory protein PII"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28481"
FT                   /db_xref="GOA:B8DVI0"
FT                   /db_xref="InterPro:IPR002187"
FT                   /db_xref="InterPro:IPR002332"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="InterPro:IPR017918"
FT                   /db_xref="UniProtKB/TrEMBL:B8DVI0"
FT                   /protein_id="ACL28481.1"
FT                   /translation="MKLITAIIQPHKLDDVKEALASAGVHGLTVSEANGYGRQRGHTEI
FT                   YRGAEYTVDLIPKVRVEVLSDDADAETLVDVIVKSAGSGTIGDGKVWVAPLDMVVRVRT
FT                   GETGSAAI"
FT   gene            223933..225777
FT                   /gene="glnD"
FT                   /locus_tag="BLA_0180"
FT   CDS_pept        223933..225777
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glnD"
FT                   /locus_tag="BLA_0180"
FT                   /product="protein-pII uridylyltransferase"
FT                   /EC_number="2.7.7.59"
FT                   /note="COG2844: UTP:GlnB (protein PII) uridylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28482"
FT                   /db_xref="GOA:B8DVI1"
FT                   /db_xref="InterPro:IPR002934"
FT                   /db_xref="InterPro:IPR010043"
FT                   /db_xref="InterPro:IPR013546"
FT                   /db_xref="UniProtKB/TrEMBL:B8DVI1"
FT                   /protein_id="ACL28482.1"
FT                   /translation="MRRDENMAMSTLKQQFLELSEPDADGVYRNGSAKRMARTNLAMRE
FT                   LEALWNEAVHSVPFQIPDSGIGLAAVGSLARGQIGPASDLDLVLITADHVALSTTQLNE
FT                   FANKLWYPIWDSGLDLDHSVRTVSRCESVTDHDLPAAMGWLNVNPIAGDRHLIETTATA
FT                   ILERWRKAARKRLPELLESANVRNERFDRMSYVNQPDIKESRGGLRDTVLLSALAASWL
FT                   ADRPHGRYDDAVERLLDVRDAIHLITRKDADRLLTQYQAEVAAMLGLTDPTLPEGEREA
FT                   KSIDDLQTLLASLSRTIAFALDSTASRAQRTLVHDKPRFSFFQILSPRAGGKREAPKFE
FT                   MLAPGVAKHEQEIVLAPQADPLADPALPLRVAAAAGREGLPINTSTLVNLKRAPIHDKA
FT                   WSDEMRRLFVELLASGERLPQVWEELDFVGIPGRLMPEWDAIRNRPSVSAAHRYTIDRH
FT                   MLAVTAQLGRERPVNGGAFDDVHYTALLLAGILHDIGKRPGVADHAAEGARHAAVIVRR
FT                   MGFDDQMVDWVRLLVREHLTLSDFASSRNPNDPEVGAELASLVDGDPQLLDMLFALTKA
FT                   DMSSLGATAGETISNTVGWSKWRARLVTQMAALARASM"
FT   gene            226138..226410
FT                   /locus_tag="BLA_0181"
FT   CDS_pept        226138..226410
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0181"
FT                   /product="putative transcriptional regulator"
FT                   /note="COG1476: Predicted transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28483"
FT                   /db_xref="GOA:B8DVI2"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:B8DVI2"
FT                   /protein_id="ACL28483.1"
FT                   /translation="MRSFNSMLDEQMDDPEFATVFEAEIERLNAAVAVSRAREEARLTQ
FT                   EQLAERSGVSRVTINRIERGKLNPSMKTLSRLARAMGKQVRVSIS"
FT   gene            226469..227848
FT                   /gene="dnaB"
FT                   /locus_tag="BLA_0182"
FT   CDS_pept        226469..227848
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaB"
FT                   /locus_tag="BLA_0182"
FT                   /product="replicative DNA helicase"
FT                   /note="COG0305: Replicative DNA helicase"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28484"
FT                   /db_xref="GOA:B8DVI3"
FT                   /db_xref="InterPro:IPR007692"
FT                   /db_xref="InterPro:IPR007693"
FT                   /db_xref="InterPro:IPR007694"
FT                   /db_xref="InterPro:IPR016136"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036185"
FT                   /db_xref="UniProtKB/TrEMBL:B8DVI3"
FT                   /protein_id="ACL28484.1"
FT                   /translation="MADGFHNNTRTDTSANAAGLFDRVPPHDDNAEMATLGGMLMSKDA
FT                   IGEVSQIVSVDDFYEPKHQTIYEAIIGKFSASEPADAVTVANRLSDSGDLDKVGGIDYL
FT                   HSLIASVPTAANASYYAEIVHQRALLRRVIASGTKIAQLGYDAEGSQAQDVINMAQAEV
FT                   YEMSTGRVRQDYAPVQAAVHDALDQIDSIQKGELQAGVPTGFQEIDEVTKGLQPGQMVV
FT                   VAGRPAMGKSTLGVDFARSAAIHHHDTTILFSLEMSKVELAQRIISAETGVPLAALRNA
FT                   DDIDPNRWNTLNNFYARLQDAPLFIDDSPNMSLMEIRAKCRRLKQTNDLKLVVIDYLQL
FT                   MTSGKAVESRQQEVSEFSRALKLLAKELEVPVVALSQLNRGPEMRNDKKPQLSDLRESG
FT                   SIEQDADVVFLVHRPDFYDEEDRPGEADIIMAKHRNGPTRTFGLVFQGQYSRFSDMNRE
FT                   V"
FT   gene            227978..229453
FT                   /locus_tag="BLA_0183"
FT   CDS_pept        227978..229453
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0183"
FT                   /product="UDP-N-acetylmuramyl tripeptide synthase"
FT                   /EC_number="6.3.2.9"
FT                   /note="COG0769: UDP-N-acetylmuramyl tripeptide synthase"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28485"
FT                   /db_xref="GOA:B8DVI4"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR013564"
FT                   /db_xref="InterPro:IPR018109"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="UniProtKB/TrEMBL:B8DVI4"
FT                   /protein_id="ACL28485.1"
FT                   /translation="MRTHAPWYGFATPFVGKSVRWASRLLHHGGSAFPGKVVERFDPTF
FT                   LSRTLSTLPLGVVLVSGTNGKTTTTRMVATMLESLGLKVFTNPTGSNFTRGVVSSILTE
FT                   VPLNGRLDADIAVLELDEAYAVHFVEQVQPRYALLLNVMRDQLDRFGEIDNTARLLGHV
FT                   AAATRGTVVLNREDPRIARLRDVVKDGVRTRYFGLAEGLRHYFPADDDMTTTFQVQSAD
FT                   SAQAPEAADAQIVDVAHDVGTAHELHADVMLTKVGDHHAQMVIDGREYESDVKLEGVYN
FT                   LFNAAAALAVVRAVQADLRKPNAVGYAAAQLGRADSARARAFTARAHTFADADTDALFA
FT                   ALADVTPAFGRGEVIDVNGSPVELLLVKNPMGFRLALASFPPESADTMIAINDQYADGR
FT                   DMSWLWDVDFTSLRPTGVAMVSGVRAWDMALRLEYDQVPVARVEPDLNAAVREFVNANP
FT                   GTPKHIYCTYTAMLAIRAELATVADVADAGVGK"
FT   gene            229522..230271
FT                   /locus_tag="BLA_0184"
FT   CDS_pept        229522..230271
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0184"
FT                   /product="possible cobyric acid synthase CobQ"
FT                   /note="COG3442: Predicted glutamine amidotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28486"
FT                   /db_xref="GOA:B8DVI5"
FT                   /db_xref="InterPro:IPR011698"
FT                   /db_xref="InterPro:IPR017929"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR033949"
FT                   /db_xref="UniProtKB/TrEMBL:B8DVI5"
FT                   /protein_id="ACL28486.1"
FT                   /translation="MSKAIDVVSLYPKDMNIYGDSGNVLAVERRLALYGYEPHVHAVNQ
FT                   NDPWPEHADIILGGGGQDTGQKKIIEDLFRRADRLRDLAEHGVPMLMICGLYQLFGEYF
FT                   ETIDGTKLEGISIIRAYTVGRDVRMIGNLVEHSAQFGDVLGYENHSGQTFLREGVQPLG
FT                   TVDGDGTGNNGEDHTEGARVHNVIGTYMHGSLLPKNPKITDFMIRTAVERRYGAFDPEQ
FT                   TDAQRAELARIDEYAAHAREAAATRPR"
FT   gene            230427..230726
FT                   /locus_tag="BLA_0185"
FT   CDS_pept        230427..230726
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0185"
FT                   /product="conserved hypothetical protein"
FT                   /note="COG3937: Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28487"
FT                   /db_xref="InterPro:IPR008769"
FT                   /db_xref="UniProtKB/TrEMBL:B8DVI6"
FT                   /protein_id="ACL28487.1"
FT                   /translation="MPDFGEGLRKVFLAGVGAIAATAEKGQELVNDLVKRGELTVEQGK
FT                   KLNSELAHKAGEKSDSLKEKLADASNTVRNAAAGLSDQAEQTIKKATEKKSDEQ"
FT   gene            231165..232985
FT                   /locus_tag="BLA_0186"
FT   CDS_pept        231165..232985
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0186"
FT                   /product="ABC1 family protein kinase"
FT                   /note="COG0661: Predicted unusual protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28488"
FT                   /db_xref="GOA:B8DVI7"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR004147"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:B8DVI7"
FT                   /protein_id="ACL28488.1"
FT                   /translation="MQREEAEQSGGEASETAAQPETPAPQSAQSERPADAHTHDIPASI
FT                   ARRQQPQVEETIGLFGMHKRNFSSEYHLTRMSKAKRLKQIGKIALEYDALHGLTPVKMR
FT                   LMFEALGPTFVKVGQILSMRSEILPESFCAELSKLRADADPMPYAIVLGTLENEYQRPI
FT                   DEIFEHIDTTPLGSASLAQVHRATLKTGEDVAVKVQRPGVRETMAQDVSIMRSLAKGAT
FT                   KIMHSSQVVDFRGVVEELWETFDEETNFLNEARNLAEFKRFCSHYAYMDCPTPFTDLCT
FT                   EHVLVMQYIDGIPISHTRELIDDGYSLNEIGTKLVDNYAAQILDAGFFHADPHPGNIEI
FT                   RGGKIILLDLGMTGRLDARTRVALKQMLFAVAKQNSADLADALLRFAGTDVERADYPSL
FT                   LGDLDGIVEEFGTVDLADLDLAAFITSLTQMARRHGIEIPSSVTTVGRALVTLEGLLDE
FT                   FIPNVNMIEIISQHIESSKTPVEMVKSEVKRLGIESEQALHSGLKGIVDAQTALHMLTR
FT                   GELKMNLELVGSEEPLSQMSDMVNRLTMALIVVGLFIGSSIVYFAGMKPIIFGIPVVGF
FT                   LGYVAAFVLSVWIVIDILIKRHAAKHKARK"
FT   gene            233096..234133
FT                   /locus_tag="BLA_0187"
FT   CDS_pept        233096..234133
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0187"
FT                   /product="possible phosphodiesterase"
FT                   /note="COG0584: Glycerophosphoryl diester
FT                   phosphodiesterase"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28489"
FT                   /db_xref="GOA:B8DVI8"
FT                   /db_xref="InterPro:IPR017946"
FT                   /db_xref="InterPro:IPR030395"
FT                   /db_xref="UniProtKB/TrEMBL:B8DVI8"
FT                   /protein_id="ACL28489.1"
FT                   /translation="MANALKKALIGGAVAAGLGVWAVAPRTFNNKRKNFVPTLPDVLYA
FT                   HRGLHDAGSGLSQQHAGESGEYIALARRMALRAGYGSIDEPGPLAPENSLAAFAAAAEA
FT                   GYGIELDVQLTLDNKAVVCHDPDLLRVAGDPRNIRDLTYDELVRIPLFPTAAPGAEVSP
FT                   LLPGATENPPLVTTPSQAPAGYYQHVPLLEDVLRVVDGRVPIIVEFKFENYRTWDDRDE
FT                   ELMQTAAALLDAYQGLYVVESFNPAAMNWYKREHPDVCRGQLAEDTEFTKNPVLWMAGK
FT                   LMFNEISRPDFVAYDFRNGNGAMLRFVRRMGAMAVAWTVRTSDELAGAQPYFDRFIFEA
FT                   FVPKQ"
FT   gene            complement(234229..234870)
FT                   /gene="upp"
FT                   /locus_tag="BLA_0188"
FT   CDS_pept        complement(234229..234870)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="upp"
FT                   /locus_tag="BLA_0188"
FT                   /product="uracil phosphoribosyltransferase"
FT                   /EC_number="2.4.2.9"
FT                   /note="COG0035: Uracil phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28490"
FT                   /db_xref="GOA:B8DVI9"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005765"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR034332"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8DVI9"
FT                   /protein_id="ACL28490.1"
FT                   /translation="MELHVLNHPLIEHKLTVLRDKNTPSSTFRELVSELVSLEAYEATR
FT                   NLEVVDKPIETPVAPMVGKQIAKPRPIIVPVLRAGLGMLDGMTRMMPSAEVGFLGMKRD
FT                   EEHPTQQITYANRLPDDLSGRQCFLIDPMLATGGTLVTATHYLMDKGAKDVTAICIIAA
FT                   PEGIKFVEENIREDINFRVVVCGVDEGLNGKSYIVPGLGDAGDRLYGVID"
FT   gene            complement(235061..235192)
FT                   /locus_tag="BLA_0189"
FT   CDS_pept        complement(235061..235192)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0189"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28491"
FT                   /db_xref="UniProtKB/TrEMBL:B8DVJ0"
FT                   /protein_id="ACL28491.1"
FT                   /translation="MHRFVISADCPHDKPVHSRAYLPYEIADSSFGALQADTPWRRV"
FT   gene            complement(235296..236021)
FT                   /locus_tag="BLA_0190"
FT   CDS_pept        complement(235296..236021)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0190"
FT                   /product="thymidine phosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28492"
FT                   /db_xref="UniProtKB/TrEMBL:B8DVJ1"
FT                   /protein_id="ACL28492.1"
FT                   /translation="MHSGSGSIIASRSAFTHTGSPRPARPGQLDQAIAEGLASDVDPER
FT                   LREVAHTTAWALLSKVHKTDDPAIVERVLTLVDREGVDVIAELWSKAEPDSLPGVLWRL
FT                   YLLRSWMRKQRDTIARLWRLGEPIATSASAIAGVDSAPTEDDIARTADSILTGAFRGDF
FT                   AVALTRASVFVGIVALGLRVEARELTQQANLNPVGSAAEQSKRWRTQAAQLLHTAANLN
FT                   ITSKDFKHGAALWRQGKLE"
FT   gene            complement(236026..237087)
FT                   /gene="mutT"
FT                   /locus_tag="BLA_0191"
FT   CDS_pept        complement(236026..237087)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mutT"
FT                   /locus_tag="BLA_0191"
FT                   /product="probable MutT protein"
FT                   /note="COG0494: NTP pyrophosphohydrolases including
FT                   oxidative damage repair enzymes"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28493"
FT                   /db_xref="GOA:B8DVJ2"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:B8DVJ2"
FT                   /protein_id="ACL28493.1"
FT                   /translation="MSEKRTVEAAGGIVYRIVRSIGSMMAPLSANDVEVCLVHRPKYDD
FT                   WSWPKGKLEINESHRHAAVREIGEETGFPVALGPFLGEVEYPLSSEGKKTRHTGRGDGK
FT                   DATKHVLYWMATQISDDDNWHRREAFGPIHAVDLGEVSEIAWLSLDKARKRLTHSTDRD
FT                   MLALFVDRIEEDALKATPLLLVRHAKAEPRKQWDGTEPHRPITPEGAAAAYALDRELAC
FT                   YNPVELATSPWTRCEQTIEMLSWQTKRERRALPPLTEEAFERDPQAAWHCFAEQIKRVL
FT                   ETGNTMAICMHRPVIGGMFEHLRPLCATKSLAKRLVAKSPYMATANAFALFLVQTEDGP
FT                   RIIDIQKVTPIVY"
FT   gene            complement(237206..239440)
FT                   /gene="ppk"
FT                   /locus_tag="BLA_0192"
FT   CDS_pept        complement(237206..239440)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ppk"
FT                   /locus_tag="BLA_0192"
FT                   /product="polyphosphate kinase"
FT                   /EC_number="2.7.4.1"
FT                   /note="COG0855: Polyphosphate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28494"
FT                   /db_xref="GOA:B8DVJ3"
FT                   /db_xref="InterPro:IPR003414"
FT                   /db_xref="InterPro:IPR024953"
FT                   /db_xref="InterPro:IPR025198"
FT                   /db_xref="InterPro:IPR025200"
FT                   /db_xref="InterPro:IPR036830"
FT                   /db_xref="InterPro:IPR036832"
FT                   /db_xref="InterPro:IPR041108"
FT                   /db_xref="UniProtKB/TrEMBL:B8DVJ3"
FT                   /protein_id="ACL28494.1"
FT                   /translation="MSQIFNAPSKAILRSQIAEHIAETDKSDKRENMEGELPLPPDRFF
FT                   DRELSWLKFNKRVLELAQDETIPIIERASFAAIFASNLDEFFMVRVAGLKRRIDTGIAV
FT                   TSASGLSPRQQMRAISEQAHRLQDEHAHYVVDTILPELAKQNIQLLGWDKLTIAEQERL
FT                   SRYFRQQVFPVLTPLAVDPAHPFPYISGGSINLAVLVENPTSGKSHFARVKIPDNLDRL
FT                   VPVDDMTEDEAEDVRYGFITMENLIIAHLETLFPGMIIKEARSFRVTRNEDIEVEEDDA
FT                   ENLLNAIEKELLRRRFGPPIRLEISDETSPFLSQLLADQMGVTPDEVYRLPAPLDATVL
FT                   FELGGIDRPDLKFPPFVPTTNRQIAEVESSRAQDIFAAIRERDILLHHPYDSFSTSVQA
FT                   FLAQAAADPKVLAIKQTLYRTSSNSPIIDALIDAAQAGKQVLALVELKARFDEDANIAW
FT                   ARKLERAGVHVVYGIVGLKTHCKLSLVVRQEADGLTRYCHVGTGNYNPKTARQYTDLGL
FT                   LTCDPVVGQDMTKLFNQLSGYAPKSSFHRLLVAPRTVRSGLIQRIRREEEAARAGKEAW
FT                   IKIKVNSIVDEKTIDALYRASQAGVKIDIVERGICSLKPGVPGLSDNIRVRSILGRFLE
FT                   HSRIYAFANSDGPQIGEGPVSGPEVWIGSADLMHRNLDRRVEALVRITAPEQVQELIDY
FT                   VDLQMADTTSSWHMQPDGTYVRHSKDAEGKPLLDCQEYLIKKHMRKKATN"
FT   gene            complement(239450..239734)
FT                   /locus_tag="BLA_0193"
FT   CDS_pept        complement(239450..239734)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0193"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28495"
FT                   /db_xref="UniProtKB/TrEMBL:B8DVJ4"
FT                   /protein_id="ACL28495.1"
FT                   /translation="MFNHSNTAAILRRVAHCSPKISHFHEHTKSANVPWCFVVRRAIRM
FT                   AAIIQTISRAELNARRTETAARIGTAKRAHPWTYSEFFRELSDFSARSF"
FT   gene            240334..241341
FT                   /locus_tag="BLA_0194"
FT   CDS_pept        240334..241341
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0194"
FT                   /product="putative septum site determining protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28496"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B8DVJ5"
FT                   /protein_id="ACL28496.1"
FT                   /translation="MRDARARRPWQAESARRVPAYQPVHAMAEPACSPQLSPPARRTHA
FT                   GAQHARMPVCATQAPCENVITLSGASGGAGTTTLAAMLTRELAKRENECAIVDADVRAG
FT                   GGGLDVLLGIEHESGSRWHDIHAPLGELDGEALRRRLPHWDGVGVLAYNCWVQEEPAWF
FT                   EMQAALQSLAQVSDAVVVDAGHGLEIEHVPALVEASHIVVAELTVLGLARAKAHIEWLR
FT                   RNGERNMARAQEPPRPGEEWKPIVGVPGRVIGVLCVEPPAVAKGRGAVSLEEARKYLQM
FT                   EHMECELMGPVRSDARLCGDILEGLGIRRVHRRNARVLGDVAEMVERACGIGGR"
FT   gene            241533..242546
FT                   /locus_tag="BLA_0195"
FT   CDS_pept        241533..242546
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0195"
FT                   /product="type II secretion system protein E"
FT                   /note="COG4962: Flp pilus assembly protein, ATPase CpaF"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28497"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B8DVJ6"
FT                   /protein_id="ACL28497.1"
FT                   /translation="MNFGPLKRLAADPRVTDILVTCDGAVWVERGLGIELEHPSIPLDS
FT                   PAVVRRLAVQLCAQLGERLDDARPIADASGADGTRVHAVIAPVVPYGASISIRLPSRMS
FT                   ATMDALQQAGCWPAQWRPILDRLVLARANILITGSTGSGKTTLLKALLLNCRASERIVL
FT                   VEEVRELQGLGNLNTVSLCARAKNVEGAGEVTMGDLVRSTLRMYPTRVVVGECRGEEVI
FT                   DLMRVLNSGHCGGMSTLHASGVSRVPGRLISLGLLAHVEPNTMAGLADGAFDVVLHMER
FT                   RPGKRYLAQIGMLCMVEGRLVGRTVCSWDGRGEPVAGEAWRPFAERWGTKRVPERR"
FT   gene            242552..243286
FT                   /locus_tag="BLA_0196"
FT   CDS_pept        242552..243286
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0196"
FT                   /product="type II secretion system protein"
FT                   /note="COG4965: Flp pilus assembly protein TadB"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28498"
FT                   /db_xref="GOA:B8DVJ7"
FT                   /db_xref="UniProtKB/TrEMBL:B8DVJ7"
FT                   /protein_id="ACL28498.1"
FT                   /translation="MAFVAALAAALSVLLMIWAAPAAVSWRLQTVESGVADHACEPACG
FT                   ISVMLSSIIASLQAGAALEPALERAFDSVFPERRCGGARARHMRDPTTSGDGHAVGVYA
FT                   VCDGEGNVDVTQMARLFAACRLPHERASHCAQVACGVAVASAVSLELGCPAARCLEAVR
FT                   AGYLRARLQDDLRANAFAMPKSTARMLLALPAVVVFLGELLGADPLGMLFGSAQGRAML
FT                   CLGTICYVGGLLWMQRLLAADG"
FT   gene            243291..243920
FT                   /locus_tag="BLA_0197"
FT   CDS_pept        243291..243920
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0197"
FT                   /product="type II secretion system protein precursor"
FT                   /note="COG2064: Flp pilus assembly protein TadC"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28499"
FT                   /db_xref="GOA:B8DVJ8"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="UniProtKB/TrEMBL:B8DVJ8"
FT                   /protein_id="ACL28499.1"
FT                   /translation="MAGFWAWCAAICAALASYLHMVGNERIAARRLRELDGLARSQIAL
FT                   AGRGNALQRRLLEVCPGWEPSPTLLLQLLEAAIAQGVAIPRALECIGACCGGACAQVLG
FT                   HVSAALLRGVCWDEAWAVLEHDGSSPASSALGLACRTLRAAWEDGVSPLPQIHAAIEQM
FT                   DGSERARIEQRASRLSVRLLLPMGLCLLPAFLLIAVVPTIMSFMRM"
FT   gene            244052..244372
FT                   /locus_tag="BLA_0198"
FT   CDS_pept        244052..244372
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0198"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28500"
FT                   /db_xref="GOA:B8DVJ9"
FT                   /db_xref="InterPro:IPR025338"
FT                   /db_xref="UniProtKB/TrEMBL:B8DVJ9"
FT                   /protein_id="ACL28500.1"
FT                   /translation="MGNTTYRPTKQARRDMEHNEVILFEHRRHGVGERINAASDRLLRA
FT                   QVGLEARWRALMSQPEEGAATAEYAVVLVAATGFAAVLVALMKSDTVKTLLTNIVKKAL
FT                   NV"
FT   gene            244377..244760
FT                   /locus_tag="BLA_0199"
FT   CDS_pept        244377..244760
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0199"
FT                   /product="TadE family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28501"
FT                   /db_xref="GOA:B8DVK0"
FT                   /db_xref="InterPro:IPR012495"
FT                   /db_xref="UniProtKB/TrEMBL:B8DVK0"
FT                   /protein_id="ACL28501.1"
FT                   /translation="MGGHAFGQALRRLQCDDEGAATAEFAVVLPVIVMLAALMLYLGRA
FT                   SVVSVGCQDAAANAARALMVQGSGSGSQAMAQAAAGDGARIEVRPAGIGFEVIAHCAVV
FT                   ADPWGIVPRMVTGRAHGIWQERL"
FT   gene            244774..245247
FT                   /locus_tag="BLA_0200"
FT   CDS_pept        244774..245247
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0200"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28502"
FT                   /db_xref="GOA:B8DVK1"
FT                   /db_xref="InterPro:IPR021202"
FT                   /db_xref="InterPro:IPR028087"
FT                   /db_xref="UniProtKB/TrEMBL:B8DVK1"
FT                   /protein_id="ACL28502.1"
FT                   /translation="MGLRGSAPRRGMSAAARRVPTRSAPCIPHGLRAQDAGNASPSAVG
FT                   IVLVVAVLLCTIAAGARIAMARAQARTAADMSALAAADAYWNEAAADPCGIGSAVARNN
FT                   AGAVESCEVIDMDVAMEVSTATGVPFVERVSARARAGPRRCDEVDATRGASQP"
FT   gene            245396..247948
FT                   /gene="dnaX"
FT                   /locus_tag="BLA_0201"
FT   CDS_pept        245396..247948
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaX"
FT                   /locus_tag="BLA_0201"
FT                   /product="DNA polymerase III, subunits gamma and tau"
FT                   /EC_number="2.7.7.7"
FT                   /note="COG2812: DNA polymerase III, gamma/tau subunits"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28503"
FT                   /db_xref="GOA:B8DVK2"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR012763"
FT                   /db_xref="InterPro:IPR022754"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B8DVK2"
FT                   /protein_id="ACL28503.1"
FT                   /translation="MALALYRRYRPDTFEGVIGQDQVTVPLMHALDENKLTHAYLFSGP
FT                   RGCGKTSSARILARCINCVKGPTSHPCGECDSCRDLATGGPGSIDVVEIDAASHNSVDD
FT                   ARELRERAGFAPVRDRYKIFILDEAHMVTPQGFNALLKIVEEPPEHLMFIFATTEPDKV
FT                   IGTIRSRTHHYPFRLVPPEIMTPYLEHVCEQEHIETEPGVLRLVTRAGGGSVRDTLSVL
FT                   DQLMGGCVDNDITYDSTVALLGFTPDALLGEAIDAIIEQNGAKLYGIIQKVIVAGFDAR
FT                   RFVEDLLVRTRDLLVLTLGGDEAEHVLSDDAEAEDMSDLHRQADALGLQQLTAMAEIMD
FT                   DTLGHMAGAASPRMRLELLAAKLLAGRASGFAAEAPALAGAGARGSSAAPSATQGSARG
FT                   GFVDAQRPSGFNDGATAPQSGHDTPTQAAAPTATPQAIQAATTEHDAGSQPQAASNVPS
FT                   IPEDIQRNGTVDERWDAIVAALPLDVRAYINRERVPRVMLAMDRKSGRQRLWIKFETPL
FT                   DKYAFALAVSKEPIGGTTSVVSIVRTQVHNVFGPDVALAPTEKMANGESAPPLSKLPPE
FT                   EAQRIKAKLLQQSLQGIVAHPRESSDSAQQATTSDSSNDAEAHQAAGTTPTPTESFQQA
FT                   NGNGPQTLPDDDPWAQPVKPVGLRPQALDPEEQAHEEPNRQQPAPEHQHKHVAVPDVSD
FT                   GIDPWSMPVDEHPHIDFGKVQSIEQQHERLTPAPVHGDDPWSAMPNGPQGFGTASPVTG
FT                   GQAMSVEDAYGMSPQGMHAADAGSTGVAGGESQPSAPQVDADDDVYSMDDAHVQTHDVM
FT                   DLKAVEEFFDVTKVEHFAADDANNPLNVKPRRMEHGDS"
FT   gene            247979..248581
FT                   /gene="recR"
FT                   /locus_tag="BLA_0202"
FT   CDS_pept        247979..248581
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recR"
FT                   /locus_tag="BLA_0202"
FT                   /product="recombination protein RecR"
FT                   /note="COG0353: Recombinational DNA repair protein (RecF
FT                   pathway)"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28504"
FT                   /db_xref="GOA:B8DVK3"
FT                   /db_xref="InterPro:IPR000093"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR015967"
FT                   /db_xref="InterPro:IPR023627"
FT                   /db_xref="InterPro:IPR023628"
FT                   /db_xref="InterPro:IPR034137"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8DVK3"
FT                   /protein_id="ACL28504.1"
FT                   /translation="MALAYDGAIQRLIDSFASLPGIGPKGAQRIAFYLLQAPDAESQRL
FT                   VDAINEVKEKVRFCEVCGNVCESSPCTICSDPRRDHGTICVVEEPKDVMSIERTREYRG
FT                   LYQVLGGAINPMANVGPSDLNIAQLLNRLHDGEVKEIIVALNPNIEGEATTTYLSRLLA
FT                   PLDIKVTRLASGLPVGGDLEYADEITLSRALEGRREV"
FT   gene            248702..249466
FT                   /gene="askA"
FT                   /locus_tag="BLA_0203"
FT   CDS_pept        248702..249466
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="askA"
FT                   /locus_tag="BLA_0203"
FT                   /product="aspartokinase"
FT                   /EC_number="2.7.2.4"
FT                   /note="COG0527: Aspartokinases"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28505"
FT                   /db_xref="GOA:B8DVK4"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001341"
FT                   /db_xref="InterPro:IPR018042"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR041740"
FT                   /db_xref="UniProtKB/TrEMBL:B8DVK4"
FT                   /protein_id="ACL28505.1"
FT                   /translation="MALIVQKYGGSSVADADSIKRVARRIIETKNAGNDVAVVVSAMGD
FT                   TTDDLIDQAMSIDSNPPAREMDMLMTAGERISMSLLAMAIHAAGSHAYSFTGSQAGFMT
FT                   DAQFGAAHIRAVNPDRVRRALNKGSVAIVAGFQGQSERGDATTLGRGGSDTSAVALAVA
FT                   LGADVCEIYTDVDGVFTADPRIVPTARRIPAIGYDEILEMSSCGSKVLALRCVEYAQRF
FT                   KMPLHVRSSFSHRPGTLVLPDGVDPNSLPNVR"
FT   gene            249563..250105
FT                   /gene="askB"
FT                   /locus_tag="BLA_0204"
FT   CDS_pept        249563..250105
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="askB"
FT                   /locus_tag="BLA_0204"
FT                   /product="aspartokinase"
FT                   /EC_number="2.7.2.4"
FT                   /note="COG0527: Aspartokinases"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28506"
FT                   /db_xref="GOA:B8DVK5"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR027795"
FT                   /db_xref="UniProtKB/TrEMBL:B8DVK5"
FT                   /protein_id="ACL28506.1"
FT                   /translation="MGDLFPDLGQETPIISGVAHDNSESLVTVRGVTDEPGMAGRVFTR
FT                   LAELGVNVDMIVQAGASTGTADISFTIPGSDAARVETALTAAQDTLGYKSFDVNPNVGK
FT                   VAVVGVGMKTHSGLAARFFQALSEEGINVLMISTSEIRIAALVPLSQLNDAVRALHSAY
FT                   GLDADKVEAVVYGGTGR"
FT   gene            250162..251232
FT                   /gene="asd"
FT                   /locus_tag="BLA_0205"
FT   CDS_pept        250162..251232
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="asd"
FT                   /locus_tag="BLA_0205"
FT                   /product="aspartate-semialdehyde dehydrogenase"
FT                   /EC_number="1.2.1.11"
FT                   /note="COG0136: Aspartate-semialdehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28507"
FT                   /db_xref="GOA:B8DVK6"
FT                   /db_xref="InterPro:IPR000534"
FT                   /db_xref="InterPro:IPR005986"
FT                   /db_xref="InterPro:IPR012080"
FT                   /db_xref="InterPro:IPR012280"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B8DVK6"
FT                   /protein_id="ACL28507.1"
FT                   /translation="MVQINDRGVNVAVLGATGQVGMVMRRVLDERDFPVKDLRFLASAH
FT                   SAGKVLNWRGHDITVEDVATADLSGIDIAIFSAGGGTSKVWAPKFAEAGAYVIDNSSQW
FT                   RMHDDVPLVVAEVNPDDLDEIPTGIVANPNCTTMAIMPVLKPLADKFGLKRLIVSSYQA
FT                   VSGAGRAGVEQLMNEAKAAVDQGADKLVFGGDAIDFPEPTKVARTIAFNEVPFIGDIVD
FT                   DGSQETDEEQKLRNESRKILHLPDLKASCTCVRVGVFTAHGMSVNAEFENPVSVEEAKE
FT                   VLASAPAVELTDIPTAQLAAGKTPSFVGRIRVDQAVDDNKGLAFFVTNDNLRKGAALNA
FT                   VELAEIVARKHFADQL"
FT   gene            251411..252040
FT                   /locus_tag="BLA_0206"
FT   CDS_pept        251411..252040
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0206"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28508"
FT                   /db_xref="UniProtKB/TrEMBL:B8DVK7"
FT                   /protein_id="ACL28508.1"
FT                   /translation="MSMASIEANKQLERLVALGYPDVADMSEDAFRALARPLIRALERS
FT                   DLGADILLVPTRELVTPESLIARTSIDRMAGFTTMPPRDIVSFLPTDGFEPPEGPFYLV
FT                   IEPHTGTCYTNREPDVARKLIESDERLPLTLEEGLAIATQHPEWLLEKNGFNLLGSRSA
FT                   DGRVPSIWMSQSAPRLGAVWPNSRHTWLGNAYCIARRGVSLIEGRG"
FT   gene            252605..254518
FT                   /gene="leuA"
FT                   /locus_tag="BLA_0207"
FT   CDS_pept        252605..254518
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="leuA"
FT                   /locus_tag="BLA_0207"
FT                   /product="2-isopropylmalate synthase"
FT                   /EC_number="2.3.3.13"
FT                   /note="COG0119: Isopropylmalate/homocitrate/citramalate
FT                   synthases"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28509"
FT                   /db_xref="GOA:B8DVK8"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR002034"
FT                   /db_xref="InterPro:IPR005668"
FT                   /db_xref="InterPro:IPR013709"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR036230"
FT                   /db_xref="InterPro:IPR039371"
FT                   /db_xref="UniProtKB/TrEMBL:B8DVK8"
FT                   /protein_id="ACL28509.1"
FT                   /translation="MGQGQSSVFDLAAVAAASNGGNNDPLLPPARYIGAPQKPSDMPYT
FT                   KYVAYDKQVPFDYPERTWPGKRLHRAPRWCSVDLRDGNQALVNPMDSERKLRFWTMLVD
FT                   MGFKEIEVGFPSASETDYDFIRLLIERELIPDDVTIVVLTQAREHLIRKTYECLRGCKR
FT                   AIVHFYNSVSVLQREVVFRKDRAGIKKLATDAAHLCKELEGDAEGIDLYYEYSPESFTG
FT                   TEPEYAVEVCNAVIDVIKPTPGHPMIINLPATVEMTTPNVFADEVEYVSNNLRDRDAVV
FT                   LSLHPHNDEGMGVAAAELGMLAGADRIEGCLLGNGERTGNVDLVTLGLNLLTQGIDPQL
FT                   DLSDMPGIRKTVEYCNQIKISERHPYAGNFVFTAFSGSHQDAIKKGLEAREIAAEMAGV
FT                   DVENFVWLVPYLPIDPKDIGRSYEAIIRVNSQSGKGGMAYLLKANHNLDLPKKLQVEFE
FT                   KVVQQHADATKKEVKDGDIWHLFKDEYLPVEESGAIEAGEVVADTHDETLDQWGRLKLL
FT                   KVSMSSGEDGSDTRLTATVLDRGINVGREPEVTREIEGTGNGPIAAFLDALKSFGVVAS
FT                   VLDYAEHTMGVGSDARAASYVQCEVGQEDEEKRVVWGVGIDSSIITSSLKAIISAINRS
FT                   NR"
FT   gene            complement(254666..257083)
FT                   /locus_tag="BLA_0208"
FT   CDS_pept        complement(254666..257083)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0208"
FT                   /product="probable penicillin-binding protein"
FT                   /note="COG0744: Membrane carboxypeptidase
FT                   (penicillin-binding protein)"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28510"
FT                   /db_xref="GOA:B8DVK9"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/TrEMBL:B8DVK9"
FT                   /protein_id="ACL28510.1"
FT                   /translation="MERMVYQARTVSSSSSSPRAAHKASTSHRAPKRGQNAPKGPKKRT
FT                   NRKKGLWWKILLGVLGGLLAIGIGLFTYLYVTTDIPQPEKVAIAEKTTVYYNDGTTEIG
FT                   SFSEQNREIIDCSVLPDYVGNAIVASEDRSFYRNGGIDIMGMARALYNNLTTGSRQGGS
FT                   TITQQYAERYYLGDTTSYSGKIREAILAMKIANSQDKQQVLCNYMNTIYLGRGAYGIQA
FT                   AAKAYFGKEAKDLTVDEAAMIAGIIPAPSMWDPAVNEAQAKSRFTRVIGIMREDGYITG
FT                   QQASEAKFPETKPVSVSNDLAGPNGYLLTTVENELVASKAFTKDELETGGYKIVSTLDP
FT                   NMQKIMQTVGDDRPEGMPESIQVGGIALDQKTGSVKAIYGGSDYLKHQLNNATQANFQP
FT                   GSTMKPFGLLGAAMDDVNFNTMFNGNSPERFETTPGTWAEVPNALNMSWGTINLKQATA
FT                   NSVNTVFMNVNQHLTPKKFAQIAHDAGISGDIQEDTLYNILGINSLTVWDLAQGHSTIA
FT                   NDGTKNTLHIVDRVLKGDKEMYKPDLGTKQVFDANDCQLVQNAMLGTTQYGTAAGTAAR
FT                   LGRQVAGKSGTANDETAASFVGYTPSLMNVWAIWNPGENGESQIVPEFAGYGVSSTGYP
FT                   SHLFTEFMAQALAGQPAETFATPVDNGKIGGPNGDWGLGGQRYVPSTNNGTQQQQQNEQ
FT                   QQTAPENTKTPEQPQPGNDNTNGNGGGETGGNPSDNNGGSNSGDSGNSGNQNGNTSGNN
FT                   GSNNGSNNGSNNGSNNSGSNSGDSGNSGNQNGNTGGNNGSQNNTGNGEQTQR"
FT   gene            257376..258518
FT                   /locus_tag="BLA_0209"
FT   CDS_pept        257376..258518
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0209"
FT                   /product="inositol 1-phosphate synthase"
FT                   /note="COG1260: Myo-inositol-1-phosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28511"
FT                   /db_xref="GOA:B8DVL0"
FT                   /db_xref="InterPro:IPR002587"
FT                   /db_xref="InterPro:IPR013021"
FT                   /db_xref="InterPro:IPR017815"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B8DVL0"
FT                   /protein_id="ACL28511.1"
FT                   /translation="MSIRVAIAGVGNCASSLVQGVEYYKDTKDEDKIPGLMHNNFGGYR
FT                   VRDIEFVTAFDVDADKVGKDLSEAIGASQNNTIKFADVPNLGVEVLRGPTHDGLGEYYR
FT                   EMITESDEEPVDVAQVLRDKKVDVLVSYLPVGSEEADKAYAQAAMDAGVAFVNCLPVFI
FT                   ASDPEWAQKFRDAGVPIIGDDIKSQVGATITHRVLARLFEDRGVRLDRTYQLNVGGNMD
FT                   FMNMLQRSRLESKKISKTRAVTSVVPHEMDPHNVHIGPSDYVAWLDDRKFAFVRLEGTT
FT                   FGDVPLSLEYKLQVWDSPNSAGIVIDAVRAAKIALDRGLAGPVLAPSSYFMKSPAVQHE
FT                   DTEARQLVEAFIKGDVEANEEELNADVAAAKAAGKDVWKA"
FT   gene            258913..260133
FT                   /locus_tag="BLA_0210"
FT   CDS_pept        258913..260133
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0210"
FT                   /product="possible pre-pilin peptidase"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28512"
FT                   /db_xref="GOA:B8DVL1"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="InterPro:IPR036938"
FT                   /db_xref="UniProtKB/TrEMBL:B8DVL1"
FT                   /protein_id="ACL28512.1"
FT                   /translation="MSEHDETNTNAQRAPHSASPAPSAPTHSTPADDTQWSVLQERAEV
FT                   REDNLDSQTQDPRIAAQIDAARARGFVPLSESESERTAKNSPEDLQAQIEAGLTQVDPL
FT                   MVRPRISSRILCGVIALVFALLAFGSYRLGVHTLKGQGYEDLVIGNFANYTPQWLLRHN
FT                   LGLTDSVVVISVSISLGAIAVFVALLRRRWWLAGQLVAFAAVSFACARVLKPALPRPLL
FT                   MQIHSSTANSAPSGHTMLAITAGLMLVCAVPRAWRAACALFAAAYSMLVGVFVIADKWH
FT                   RPCDVLMAVFLVGALAMLMLLFTRRSGMDRPGKRVSSASVQIASTVLITLGICGFAYAG
FT                   YIIWQIFPGLEYGVAWSTGGACMSAGVLVIAVNALVVGAVLAVRQLTASPLTRLGQIGA
FT                   PPAPPRR"
FT   gene            260478..263438
FT                   /gene="topA"
FT                   /locus_tag="BLA_0211"
FT   CDS_pept        260478..263438
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="topA"
FT                   /locus_tag="BLA_0211"
FT                   /product="DNA topoisomerase I"
FT                   /EC_number="5.99.1.2"
FT                   /note="COG0550: Topoisomerase IA"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28513"
FT                   /db_xref="GOA:B8DVL2"
FT                   /db_xref="InterPro:IPR000380"
FT                   /db_xref="InterPro:IPR003601"
FT                   /db_xref="InterPro:IPR003602"
FT                   /db_xref="InterPro:IPR005733"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR013497"
FT                   /db_xref="InterPro:IPR013824"
FT                   /db_xref="InterPro:IPR013825"
FT                   /db_xref="InterPro:IPR013826"
FT                   /db_xref="InterPro:IPR023405"
FT                   /db_xref="InterPro:IPR023406"
FT                   /db_xref="InterPro:IPR025589"
FT                   /db_xref="InterPro:IPR028612"
FT                   /db_xref="InterPro:IPR034149"
FT                   /db_xref="UniProtKB/TrEMBL:B8DVL2"
FT                   /protein_id="ACL28513.1"
FT                   /translation="MTTGSKLVIVESPAKAKKIGGYLGDGYTVLASVGHIRDLAQPSQV
FT                   PADEKAKFGKFGVDVNDGFKPYYIVGPEKKKTVSELRSALRNASELYLATDEDREGEAI
FT                   AWHLVQTLKPKVPVKRMVFHEITPEAIRASLEHTREVDNNMVDAQETRRVLDRLYGYEL
FT                   SPVLWRKVGPGLSAGRVQSVATRLIVERERERMAFVRAPYWDVVATLCAPDALGEPTDF
FT                   ESRMIALNGTRLATSKDFKSDGTLTDAARTDGVVQLGESQAGDLADALADARFRVISVE
FT                   KKPYRRRPQPPFTTSTMQQAAGNRLGMSSRQTMRAAQSLYENGYITYMRTDSVTLSHEA
FT                   IEAARESVSKNFGSQYLSEKPKQYATKTAGAQEAHECIRPAGSHFRDPSQLATLPPDQL
FT                   KLYTLIWQRTLASQMADATGSTATARFAASAGGLGEATFQSSGTVIEFPGFMRVTGERG
FT                   GSGKKGEESASLPPLAESAELPAKSVLADGHETQPPARYTEASLVKTLEAKEIGRPSTY
FT                   ANIISTIIDRGYVYERGRALIPSWLAFAVTRLLETKFPKYVDYQFTADMENGLDQIAHG
FT                   NETGREWLTQFYFGSGADSARSADEAHEGLQRQVAQLGEIDAREINTIPIGDGIHVRVG
FT                   RYGPYLEDTKDLDAEGNPKRASIPDTIAPDELTVGEARKLIASNAGGPRVLGTDPATGG
FT                   TVEVRNGRFGPYVALVAPESAHESAPTGKKKAAEPKPKMASLFKSMKPETVTLDDALRL
FT                   LSLPRTVCTYDEVDAKTGETVSVTISASNGRYGPYLTKTRADGGASETRSLESEDAIFT
FT                   VDETHAQALFAQPKYGRGRGAAKPPLRTLGPDPESKREVSIKEGFYGAYITDGETNRSL
FT                   PKQYDPKTISAEDAFRLLAEKRAAGPSKRRGRKGKASAKSTGKGTAKGRKSAPKKSATE
FT                   TARDRRRKQVRELAEQGWANTRIAKEIGSSAATVKADVEYLEANEGFKRPPVVPAK"
FT   gene            264122..264742
FT                   /gene="tmk"
FT                   /locus_tag="BLA_0212"
FT   CDS_pept        264122..264742
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tmk"
FT                   /locus_tag="BLA_0212"
FT                   /product="thymidylate kinase"
FT                   /EC_number="2.7.4.9"
FT                   /note="COG0125: Thymidylate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28514"
FT                   /db_xref="GOA:B8DVL3"
FT                   /db_xref="InterPro:IPR018094"
FT                   /db_xref="InterPro:IPR018095"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR039430"
FT                   /db_xref="UniProtKB/TrEMBL:B8DVL3"
FT                   /protein_id="ACL28514.1"
FT                   /translation="MGAGLFISFEGVDGAGKTTQVNLLADYLRALGREVVVTREPGGTA
FT                   LGTQIRAMLLTTNPDEEISPRTEALLFAADRAQHVSEVIRPALERGAVVITDRYLDSSL
FT                   AYQSGGRELTADDIRTLSMWATNNLLPARTYLLDIDPRASHTRLEHAEDRMESAGDDFQ
FT                   QRTRTAFLELAAVQPQRFCVIDAQQSVGEIAALICDDVANLLE"
FT   gene            264748..266040
FT                   /locus_tag="BLA_0213"
FT   CDS_pept        264748..266040
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0213"
FT                   /product="possible DNA polymerase III delta prime subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="COG0470: ATPase involved in DNA replication"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28515"
FT                   /db_xref="GOA:B8DVL4"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B8DVL4"
FT                   /protein_id="ACL28515.1"
FT                   /translation="MSVWDAIVGQPKVVEELRRVAEGDGRGVAQSWLICGPAGSGTMQV
FT                   ARAFAAALESPDHGEGELPTKITSQILADRFPDVVTLSTDKVTIGIDEVRDLVTLSEQM
FT                   PSTAPWRIIIIENTERMLERTTNVLLKEIEEPSAHTIWLLCAPSAQDVLPTIRSRTRLV
FT                   TLGVPVADEIATWLEREVRVLEDPTKRERARAKAVGGRAGAKAARSGKSAKAPKPAPAP
FT                   EPRPVSHETAVRIARLCEGNLDIARLYARYPSVLRSRDQLVNNVLKMTRASQAVVFAGE
FT                   LYGSAQEQANERAEQAAGERQAEFRKLNGLSPDETVPADLRRAYTALAKKDDIKRHATR
FT                   MTRDVLDRAFTTIASIYRDVAVFQNDAEGSVGLINIENRDAIAELSAQLTREQTLARMD
FT                   AISTARRRIAGNGNALLDIEALFCALLPERR"
FT   gene            266213..266767
FT                   /locus_tag="BLA_0214"
FT   CDS_pept        266213..266767
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0214"
FT                   /product="phospholipid-binding protein"
FT                   /note="COG1881: Phospholipid-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28516"
FT                   /db_xref="InterPro:IPR005247"
FT                   /db_xref="InterPro:IPR008914"
FT                   /db_xref="InterPro:IPR036610"
FT                   /db_xref="UniProtKB/TrEMBL:B8DVL5"
FT                   /protein_id="ACL28516.1"
FT                   /translation="MLVSADFNTIPEQYAKNAPDDARVDGVPCVSFPFYIDHLNPAAKY
FT                   LHWEFSDPDSIPVCGFEWIHWTMANLPVAALMFDPSDAHALQIPPDFSRRVTAMIPEAV
FT                   QGRNSQASPLYGQDQRNLQLVAHYTGPQPPDKDHGYVLQIWGTTSPIAGLEQGFWLNEM
FT                   LHGLEHSQVVDGGGITLIGKC"
FT   gene            267440..269053
FT                   /gene="pepD"
FT                   /locus_tag="BLA_0215"
FT   CDS_pept        267440..269053
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pepD"
FT                   /locus_tag="BLA_0215"
FT                   /product="dipeptidase"
FT                   /note="COG4690: Dipeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28517"
FT                   /db_xref="GOA:B8DVL6"
FT                   /db_xref="InterPro:IPR005322"
FT                   /db_xref="UniProtKB/TrEMBL:B8DVL6"
FT                   /protein_id="ACL28517.1"
FT                   /translation="MACTTILVGRGASYDGSTIIARNEDDEPGSFNNKKLIIVRPEDQP
FT                   RTYTSVNGHLTIELPDDPLQYSETPNSFTSDGVWGEAGINEANVAMTATETITSNARAL
FT                   GADPLVPYTPAIGKPGDANYVPAVAGGIGEEDLVTIVLPYIHTAREGVERLGSLLEEYG
FT                   TYESNGIGFSDSHEVWWIETVGGHHWIARRVPDDCYVVNPNRLGIDEFDFEDAFGEQRD
FT                   YMCSADLREFMRMHHLDVDYALEGQFDPRDAFGSHSDMDHVYNTPRAWMIERYFNPLDE
FT                   TWEGPDADLTPSSDDIPWCRQPDHKITIEDVDYALAMHYQGTKFDPYGKLGTEATRHLY
FT                   RPAGINRTCERSIMQIRPYAPQADRAIHWITFAATPFNATVPFFANVDAMPDYVSNTTP
FT                   EVTLDSYYWASRFLAVLGDSDYSGTAEPIAHYKQTVAALGHQMVFATDEQLARLGGKDT
FT                   RDAAAREREDEQEALPADVEPMKPADVVKATRDEKTREVLAAANENMAKQLKAQTQTIL
FT                   AQCLQATSVNMKDAFSMADF"
FT   gene            269573..271198
FT                   /gene="pepD"
FT                   /locus_tag="BLA_0216"
FT   CDS_pept        269573..271198
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pepD"
FT                   /locus_tag="BLA_0216"
FT                   /product="dipeptidase"
FT                   /note="COG4690: Dipeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28518"
FT                   /db_xref="GOA:B8DVL7"
FT                   /db_xref="InterPro:IPR005322"
FT                   /db_xref="UniProtKB/TrEMBL:B8DVL7"
FT                   /protein_id="ACL28518.1"
FT                   /translation="MGCTTLLVGRDASYDGSTIIARNEDSCNGEFDPKQFIIVKPQDQP
FT                   RNYRAVISHVQIELPDDPLQYSSVPNADRKQGIWGEAGVNEANVAMSATETLTTNERVL
FT                   GADPLVEYVPAQGKPGDADYEPEVAGGIGEEDFLTIVLPYVKTAREGVARLGALLEEYG
FT                   TYEMNGVAFSDANEIWWLETVGGHHWIARRVPDDCYVTMPNQLGIDEFDVEDGIGEQVN
FT                   YMCSADMRDFIERNHLDLAVEGSMPFSPRDAFGSHSDSDHVYNTPRAWYMQRYFNPFDE
FT                   VWDGPDADHKPNSDDIPWCRQPDRKISMEDVKYILSSHYQETPFDPYGSLGDAASRTRF
FT                   RPIGINRTNHLAVMQIRPYRPQVNRAVQWLAYGSNPFNAMVPFFPNVDDTPAYLRDTTT
FT                   RVTSENFYWANRLIGVLCDAQFAETANAVETYQQKVGALGHAMVRAADEQVNRLGGTAV
FT                   LEAASREREANAEFAEDELVEDVQPMSPDEIITAVRNPEVREVLATANDDLARKLKKET
FT                   EKLLDSALFTSSLAMKNHFAMSDN"
FT   gene            271549..272718
FT                   /locus_tag="BLA_0217"
FT   CDS_pept        271549..272718
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0217"
FT                   /product="ATPase (AAA+ superfamily)-like protein"
FT                   /note="COG1373: Predicted ATPase (AAA+ superfamily)"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28519"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR025420"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041682"
FT                   /db_xref="UniProtKB/TrEMBL:B8DVL8"
FT                   /protein_id="ACL28519.1"
FT                   /translation="MPLIPRELEPMLLERARAYPAVTLTGPRQSGKSTLVREAFPDYDY
FT                   VSLEDIDMRELAHDDPRSFLQRYSNHVILDEVQRVPELFSYMQRVMDERNEPGQFILSG
FT                   SQNFLLLNSISQSLAGRVAILHLLPLSYTELTHAGETPSNDEFVFRGGYPRLYSSLATP
FT                   ADFYPGYVATYIDRDVRAELGVKKIDSFNRFLTLAALRIGEVMNVSHLADEADVDSATI
FT                   RNWLSILNASFIAFQLQPYYRNYGKRLVKSAKLYFYDTGLAANLLGIESADQLFASQCR
FT                   GALFENAVVLEIVKQYQAQGKEPKLYYWRDSGQKEVDLIIERGGNPYFVIEIKSSATYR
FT                   PKYFETLDDIAEAMGVPTERRFVVYGGEETIPTRHGTVIGLRDIGRLVR"
FT   gene            272825..274342
FT                   /gene="fhs"
FT                   /locus_tag="BLA_0218"
FT   CDS_pept        272825..274342
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fhs"
FT                   /locus_tag="BLA_0218"
FT                   /product="formate-tetrahydrofolate ligase"
FT                   /EC_number="6.3.4.3"
FT                   /note="COG2759: Formyltetrahydrofolate synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28520"
FT                   /db_xref="GOA:B8DVL9"
FT                   /db_xref="InterPro:IPR000559"
FT                   /db_xref="InterPro:IPR020628"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B8DVL9"
FT                   /protein_id="ACL28520.1"
FT                   /translation="MTLIENFTKPYGLVDKIDAFGYLDSLKNNPDAPRKQGKVVLVTAD
FT                   TPLKASRGEGKTTTTIALIDALNERGIDAAAVLRQPSMGITAAGSKGGASGGGKASLTH
FT                   PELIDWGLCGEMGSIEAAQNLLVSFAEKAIDDGLLDTVLVPRVSEVPSRSLRQITVDRG
FT                   KGNVPERVVLTPTCELMQIVVLSRSMEEIADRVAHMIAGTKDGKPVTFGEFIDLWRITN
FT                   ILTDAVKPAKTETVNGSPVYVHGGPFANVSIGIPTLVSVEMACALHDVVIVEAGYGADA
FT                   GAQKWLDIACREYGAQWPSAAVVVTRATTWRDDPALQWRYPFHVDRLEKLGIPTFPLIN
FT                   LWEGEDDQIPALRETAEELGFRDPIVGNLFRDGGEALAPQLDAFVEAVSDEALPERPKS
FT                   FKGESLREKIEFVCGNAYGVPADRVIDKAGFAESEAEAERLCADAGIDFADLALVAVKS
FT                   PATMTDNDAAPADERTVTLKKVEVHSGAGLVQVNLTTSLTTPMPKIV"
FT   gene            complement(274457..274804)
FT                   /locus_tag="BLA_0219"
FT   CDS_pept        complement(274457..274804)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0219"
FT                   /product="MifH/DopD protein family-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28521"
FT                   /db_xref="InterPro:IPR001398"
FT                   /db_xref="InterPro:IPR014347"
FT                   /db_xref="UniProtKB/TrEMBL:B8DVM0"
FT                   /protein_id="ACL28521.1"
FT                   /translation="MPVIHTHVSVPTTAEQRDALKTAFGQAIPAVPGKSEGWLMCLFES
FT                   DVPMYFGGTNDAPAAYVEVNVFGSSVPKSAWQKLTPAIMDALQDTLQIPADRTYIRYTA
FT                   TPDWGWNGGNF"
FT   gene            275393..276415
FT                   /locus_tag="BLA_0220"
FT   CDS_pept        275393..276415
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0220"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28522"
FT                   /db_xref="InterPro:IPR007569"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="UniProtKB/TrEMBL:B8DVM1"
FT                   /protein_id="ACL28522.1"
FT                   /translation="MITNEINKKPHGMMADVEQTQIRMSGRCSAFLNERKMDATFGLLT
FT                   ALELLGITTPWLRAAYSRWEKDRYLQIIADSRGMRYAEKHRYGVAYYTMNVPIHRVEVS
FT                   PGIYCTDPVCTWFMMARFVSLDYLVALGDAILGPNNRLSELGLHYELEDFISYIEEVEQ
FT                   WTADPSHSRKRAPRGIGECRLAIELMRQRVESPQESIVRIDVLMKHGLPEPKINYVVNL
FT                   ENGHTARLDMAYPQWKIAIEYDGKQHEESWEEDNLRRNKLAELGWAIIVVTRADVATPE
FT                   AQLACAYRIAARIEERTHEPMPVFADGYTTEELAMVVSGKPVRPRKWRRKRGMGKREVA
FT                   "
FT   gene            complement(276433..276990)
FT                   /locus_tag="BLA_0221"
FT   CDS_pept        complement(276433..276990)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0221"
FT                   /product="GtrA-like protein"
FT                   /note="COG2246: Predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28523"
FT                   /db_xref="GOA:B8DVM2"
FT                   /db_xref="InterPro:IPR007267"
FT                   /db_xref="UniProtKB/TrEMBL:B8DVM2"
FT                   /protein_id="ACL28523.1"
FT                   /translation="MRKLIEQILKFGVVGAIAFIIDWGILNLLVGVFHMHNVIAGTISF
FT                   FISLVFNYFASMKYVFKHRPDMARWMEMAIFLFSSLVGLFLNALIIWLSTYGMNRDAFI
FT                   TQHAEYLLRTNMGKLVATVIVAIWNFIIRKWLLDDTHTNAMNRLRRKGNVLSEEELEAK
FT                   WEKSFSHRLGMWSIEHTPKGWE"
FT   gene            complement(277216..278160)
FT                   /locus_tag="BLA_0222"
FT   CDS_pept        complement(277216..278160)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0222"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28524"
FT                   /db_xref="UniProtKB/TrEMBL:B8DVM3"
FT                   /protein_id="ACL28524.1"
FT                   /translation="MTFNDEHAVEQVASLPAMKTAVRSGTDLTELWPLTTAERMDNDAK
FT                   YAENLQVRLTLTMARVLVGTTEVTLPDAEFVYEGADAIPGRPQEVVDALLAANDAYEQL
FT                   NPYSDSHDFSLLFEAAETLTAGWSEATQKQLGEILDDCTAYIHDTDQKRVTGLDHRFAV
FT                   VLVTFAQMLRVLRSQIIANLGSDSPHTGGASSDRVRHLERVALPLLPFINEFAETLGVP
FT                   RICVTADQWHGLLAAFATPNGDDDSADSARVLAESLLPLAAAEWRKHREDILWDPAEAK
FT                   RAAKEEDERKNKEALAAKFAHIKDDPSKPEVEL"
FT   gene            complement(278693..279352)
FT                   /locus_tag="BLA_0223"
FT   CDS_pept        complement(278693..279352)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0223"
FT                   /product="phosphoglycerate mutase"
FT                   /note="COG0406: Fructose-2,6-bisphosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28525"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:B8DVM4"
FT                   /protein_id="ACL28525.1"
FT                   /translation="MPATTINFVRHGKVYNPDHLLYERLPDFHLSERGRRMAQATGRYI
FT                   AQSPQLNTAVAVYSSPLDRTRETANEILLELNKVRAERGQEALGLLTDERIIEAGNEFR
FT                   GTRIGHGEGALWKPRNLKLVRNLWTPSWGESYRSIAARVQDFALEKVHEYPGEQIVVVT
FT                   HESPIWSYRHMLETGHPEHNMLLRKTALASVTSITYDSETGKVLSITYADPAKHID"
FT   gene            279759..281177
FT                   /locus_tag="BLA_0224"
FT   CDS_pept        279759..281177
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0224"
FT                   /product="permeases of the major facilitator superfamily"
FT                   /note="COG0477: Permeases of the major facilitator
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28526"
FT                   /db_xref="GOA:B8DVM5"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B8DVM5"
FT                   /protein_id="ACL28526.1"
FT                   /translation="MSLLQGVKDVNHRIFGGYAELLRIPHAARFTVGSVIACMPFPMVG
FT                   MTMTIMTQQYYGNYSLAGALTAVQAIAGAVVGPLLGTLVDRFGQRQVSIPTIVIWMLAA
FT                   VSFVTCVRAQVTPWILFCIVPFFAAVPPWGAMSRARWTYLMGNDRAGVNRALSLSGVFD
FT                   EAMWVVGNPLASTLAVISGFLAMSFTGICVLIGALMFLTEMTTCPPSQSDLAREAGVSR
FT                   KEFREREAEKAKELRAQTAAEDARVHAKSQGLSDAEVEAAGKAAYERSMSGIKDSIWGP
FT                   GLIAVCATWFGLGAFQSAAGISIIAFATEANMKQYTGFVFACFSISSLTGALLYGAKNW
FT                   TIPLWKRFYVCLAVLNIGIGSFLFARHLWVIMVIYLIIGVCQSPTWINGNQLMLHLVPQ
FT                   TRFTEGMAWMGAMNSIGASAGSAVAGVFIDRAGSHGGFAVVTALAFVSLAIALLGFKQI
FT                   KTSTETPVLTEISA"
FT   gene            complement(281584..282915)
FT                   /locus_tag="BLA_0225"
FT   CDS_pept        complement(281584..282915)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0225"
FT                   /product="transposase"
FT                   /note="COG3464: Transposase and inactivated derivatives"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28527"
FT                   /db_xref="InterPro:IPR002560"
FT                   /db_xref="InterPro:IPR029261"
FT                   /db_xref="UniProtKB/TrEMBL:B8DVM6"
FT                   /protein_id="ACL28527.1"
FT                   /translation="MNEETRPEPEFSVFDPQRFLGLDEMGLRVLSWRRLGRPDGPGLRQ
FT                   IRCEPDSHDARWCPSCGAYARVRSSWLRTLAHVPYGDDAVHLLVRVRRYECVPCSRSWS
FT                   DDLEAVGAGRGVLSVPAVMWALRRVCLDSMTVSACARLLHVAWAVVDRAVRERGMLLLE
FT                   QADRFSSVRAIGVDEHVWRHGAFGDRYVTVIVDLTPRCDGRPARLLDMVPGRSAQVLRE
FT                   WMQARGGEFTRRVGVVAMDAFAGWKQAVESVVPHAVEVIDPFHVVQLAAARVTKVRCRL
FT                   QRDATGRRGVKGDRLYDCRRALLTSDEYLGARGRARLMALFAIQANRDLMLAHDAYQRV
FT                   IHAYRCDDRRRGERMMRELIDDLTGPGRYKGCRELASLGRVLKRRMRDILALFRHPRSS
FT                   NGPTEAINGRLETLRGNAMGFANTTSYIQRCLIHSSQLKDILTH"
FT   gene            283021..284571
FT                   /gene="gltX"
FT                   /locus_tag="BLA_0226"
FT   CDS_pept        283021..284571
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gltX"
FT                   /locus_tag="BLA_0226"
FT                   /product="glutamyl-tRNA synthetase"
FT                   /EC_number="6.1.1.17"
FT                   /note="COG0008: Glutamyl- and glutaminyl-tRNA synthetases"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28528"
FT                   /db_xref="GOA:B8DVM7"
FT                   /db_xref="InterPro:IPR000924"
FT                   /db_xref="InterPro:IPR004527"
FT                   /db_xref="InterPro:IPR008925"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020058"
FT                   /db_xref="InterPro:IPR020061"
FT                   /db_xref="InterPro:IPR020751"
FT                   /db_xref="InterPro:IPR033910"
FT                   /db_xref="UniProtKB/TrEMBL:B8DVM7"
FT                   /protein_id="ACL28528.1"
FT                   /translation="MSESENNESNHVKPALPENVRVRFCPSPTGIPHVGMVRTALFNWA
FT                   EARHTGGTFVFRIEDTDAQRDSEESFNQIIEALQWLGIDWDEGVGVGGPDGPYRQSERG
FT                   QIYADVAQKLLDAGYAYESYSTPEEIEARNEAAGRPKAFGYDGYDRNLSEEQKAAFRAE
FT                   GRKPALRIKMPDEDITFNDLIRGEITFKAGSVPDYVIVRPNGDPLYTLTNPVDDALMRI
FT                   NVVLRGEDLLSSTPRQIVLYRYLMELGIAKEMPLFGHLPYVMGQGNKKLSKRDPESNLF
FT                   LHREHGFIKEGLLNYLALLGWSIAPDRDIFSMDEMVEKFDVRDVKANPARFDIDKAISI
FT                   NAEHIRMLEPADFLERSVPYLFRDGVVSADSWDALNERERDILAAAAPLVQPRVRLLGE
FT                   VAGMVGSLLSDADYIPPADDAKKQLKDSAGAVLDLAIAALDSVPESSWRTDTLHETLNK
FT                   ALVEDGGYKPRLAFGPVRVAMSGRRVSPPLFESMEIVGKKITLERLRGLREHLAEIQG"
FT   gene            284921..284996
FT                   /locus_tag="BLA_t0006"
FT   tRNA            284921..284996
FT                   /locus_tag="BLA_t0006"
FT                   /product="tRNA-Glu"
FT   gene            285029..285103
FT                   /locus_tag="BLA_t0007"
FT   tRNA            285029..285103
FT                   /locus_tag="BLA_t0007"
FT                   /product="tRNA-Gln"
FT   gene            285217..286494
FT                   /locus_tag="BLA_0227"
FT   CDS_pept        285217..286494
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0227"
FT                   /product="predicted phosphohydrolase"
FT                   /note="COG1409: Predicted phosphohydrolases"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28529"
FT                   /db_xref="GOA:B8DVM8"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="UniProtKB/TrEMBL:B8DVM8"
FT                   /protein_id="ACL28529.1"
FT                   /translation="MSEQSAEMSEAKPVSVSRRLGRLQFHKSGKFRVLQLADVQDGPKI
FT                   SKDTIALITAAIRDARPDLVVFSGNQIAGYDPAFAATFTKRRWKTAVGAAPKSADLAHT
FT                   RELVRGQIEQMVQPMVDAGVPWAVTYGNHDFQCGLTNAELDGIFREFPLCVNPSTRAKF
FT                   GAETWSRALPKERVIASGEPGTFSMPVCDESGNTVFGIVLVDSGDYSETGGYGAPSQTA
FT                   LRFLRTVPQWFGEGVESIVFQHMPLPQYYRVLKPVPRTTDRSVEGYRNYSGSYFVLDDA
FT                   KTERGGYLGEGVSCPDLDSGEFDILRDSHAYFAVAAGHDHRNAFAGEYAGVQMIATPTC
FT                   GFDSYGPIPERRAARLFEFDERHPFSPRTQLLQFGELVGKPSSKKAYVYGMSSASKPKS
FT                   EGVNLLHKPSTVSRLWHSVGNWLFNH"
FT   gene            complement(287260..288078)
FT                   /locus_tag="BLA_0228"
FT   CDS_pept        complement(287260..288078)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0228"
FT                   /product="IclR-type transcriptional regulator"
FT                   /note="COG1414: Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28530"
FT                   /db_xref="GOA:B8DVM9"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B8DVM9"
FT                   /protein_id="ACL28530.1"
FT                   /translation="MTSDTLAAKSAPSAETSTNNPSNHNDVPADDNEIHSGVGVLDKTV
FT                   KILDALESGPATLGQLVAATHLARPTAHRLAIALERHRFVVRDQHGRFVLGSRFTELAA
FT                   AAGEDRLLAAAGPILQTLLDRTGESAQIYRRQGEQRVCIAAVERASGLRDSIPVGAMLS
FT                   MEAGSAAQILLAWEDTELLHQGLRHAKFSAAKLATVRKRGWADSINERDEGVCSISAPI
FT                   RNASGQVIAAISISGPSGRMGSNPGHRFAPLVMGAGKYLSDALIKASISR"
FT   gene            288374..289777
FT                   /gene="leuC"
FT                   /locus_tag="BLA_0229"
FT   CDS_pept        288374..289777
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="leuC"
FT                   /locus_tag="BLA_0229"
FT                   /product="3-isopropylmalate dehydratase large subunit"
FT                   /EC_number="4.2.1.33"
FT                   /note="COG0065: 3-isopropylmalate dehydratase large
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28531"
FT                   /db_xref="GOA:B8DVN0"
FT                   /db_xref="InterPro:IPR001030"
FT                   /db_xref="InterPro:IPR004430"
FT                   /db_xref="InterPro:IPR015931"
FT                   /db_xref="InterPro:IPR018136"
FT                   /db_xref="InterPro:IPR033941"
FT                   /db_xref="InterPro:IPR036008"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8DVN0"
FT                   /protein_id="ACL28531.1"
FT                   /translation="MGMTLAEKVWADHLVRKGSDGAPDLLYIDLMLMHEVTSPQAFEGL
FT                   RLAGRTPRHLDQLIATEDHNTPTVDIDKPNPDETSATQLTTLEKNCREFGVRLHPLGDA
FT                   DQGIVHAFAPMLGLTQPGMTIVCGDSHTSTHGAFGALAFGIGTSEVEHVMATQTLSLKP
FT                   FKTMAINIEGDLPAGVSAKDIILAIIAKIGTGGGQGYVLEYRGRAIEQLSMDARMTICN
FT                   MSIEAGARAGMIAPDETTFAYLKGRPHAPKGEMWDQAVEYWKTLRTDDDAVFDAEVTLR
FT                   AEDLEPFVTWGTNPGQGVAISGVVPAPDDFADATERSAAERALDYMGLEPGTPIRDIPV
FT                   DTVFIGSCTNGRIEDLRIAAEIMKGHKKADSIHRVLVVPASSRIRLQAEREGLDRIFKD
FT                   FGAEWRNAGCSMCLGMNPDKLVAHERSISTSNRNFEGRQGKGSRTHLASPAVAAATAIR
FT                   GTISTPADL"
FT   gene            289815..290495
FT                   /gene="leuD"
FT                   /locus_tag="BLA_0230"
FT   CDS_pept        289815..290495
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="leuD"
FT                   /locus_tag="BLA_0230"
FT                   /product="3-isopropylmalate dehydratase small subunit"
FT                   /EC_number="4.2.1.33"
FT                   /note="COG0066: 3-isopropylmalate dehydratase small
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28532"
FT                   /db_xref="GOA:B8DVN1"
FT                   /db_xref="InterPro:IPR000573"
FT                   /db_xref="InterPro:IPR004431"
FT                   /db_xref="InterPro:IPR015928"
FT                   /db_xref="InterPro:IPR033940"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8DVN1"
FT                   /protein_id="ACL28532.1"
FT                   /translation="MEKLTTITATGVPLRRSNVDTDQIIPAVFLKRVTRTGFDDALFYA
FT                   WRRDPNFVLNQPEYRDGRILVAGPDFGIGSSREHAVWALHDYGFRVVIASRFADIFYGN
FT                   TAKNGVLAAIMPQESIELIWKMLEEEPGRQMTVDLETRTVTIDDVVLPFEVNDYVRWRL
FT                   MNGYDDIDLTLQHEDDIAAYERMRAEKFPFKPKTLPAITEEAETVESAREPEAVEWAGP
FT                   LADR"
FT   gene            290750..291028
FT                   /locus_tag="BLA_0231"
FT   CDS_pept        290750..291028
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0231"
FT                   /product="putative transcriptional regulator, AsnC family
FT                   protein"
FT                   /note="COG1522: Transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28533"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="UniProtKB/TrEMBL:B8DVN2"
FT                   /protein_id="ACL28533.1"
FT                   /translation="MADAIVLITTQADKVSEAAKKIVEIPGVKDVYSVAGDVDLVAIVS
FT                   ADDFDDLSTIIPDGIAKVPGVAGTQTLMAFRTYSREDDLAAFDLGGD"
FT   gene            complement(291919..293265)
FT                   /gene="nox"
FT                   /locus_tag="BLA_0232"
FT   CDS_pept        complement(291919..293265)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nox"
FT                   /locus_tag="BLA_0232"
FT                   /product="NADH oxidase"
FT                   /EC_number="1.6.99.3"
FT                   /note="COG0446: Uncharacterized NAD(FAD)-dependent
FT                   dehydrogenases"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28534"
FT                   /db_xref="GOA:B8DVN3"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B8DVN3"
FT                   /protein_id="ACL28534.1"
FT                   /translation="MTTTVAVVGCTHAGVFAANSILREHPDWQVHVFERNETVSFLSCG
FT                   IALWVGGHVSDPKKMFYSSPQALEQAGATVHMHTDVTDVDVAAKTLEFRDLQTGDTQTL
FT                   PYDKLVVTTGSRPIVPPLPGIDSKRVQLCKNWDDAVQIKERAHDLKNVIVIGAGYIGAE
FT                   LAEQFSTRGTQVTLIDAADRVLANNFDRFITDQVEAKYREHGVTLALGEAVKAFRDNGD
FT                   SITVVTTKGEYTAPYAVLAVGFRPNTDLVRGQVETLDNGAIVVDEFMRASVPDVFAAGD
FT                   SATVLFNPTGKLDYIPLATNAVRQGELVGLNIEKPTRKYMGTQATSAVQLYDLSLAASG
FT                   MTQTYANNHGLDIRSTELLEDYRPAFMLSTAPVSCMLTWDPQTRLVKGAQFCSTTDEVA
FT                   GAANVVSVAIQAKFTIDMLANVDFLFQPNFDQPVYYVGAVAAKAAAEQR"
FT   gene            293519..294847
FT                   /gene="murA"
FT                   /locus_tag="BLA_0233"
FT   CDS_pept        293519..294847
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murA"
FT                   /locus_tag="BLA_0233"
FT                   /product="UDP-N-acetylglucosamine
FT                   1-carboxyvinyltransferase"
FT                   /EC_number="2.5.1.7"
FT                   /note="COG0766: UDP-N-acetylglucosamine enolpyruvyl
FT                   transferase"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28535"
FT                   /db_xref="GOA:B8DVN4"
FT                   /db_xref="InterPro:IPR001986"
FT                   /db_xref="InterPro:IPR005750"
FT                   /db_xref="InterPro:IPR013792"
FT                   /db_xref="InterPro:IPR036968"
FT                   /db_xref="UniProtKB/TrEMBL:B8DVN4"
FT                   /protein_id="ACL28535.1"
FT                   /translation="MDVEKTDDVLHVVGGKPLNGTIKVRGAKNFVSKAMVAALLAPGTS
FT                   VLKNVPEIRDVHVVSDLLRLHGVNVDVNGDEGIVTIDAKNVQLADVADVDTLSGSSRIP
FT                   ILFSGPLLHRLGEAFIPALGGCNIGGRPIDFHLETLRKLGATVDKEHKDGIHITAPNGL
FT                   HGAKIHLPYPSVGATEQTLLAAVLADGKTELSGAATEPEIMDLVAVLQKMGAIISVDVD
FT                   RTFRIEGVKELKGYTHTALTDRIEAASWASAALATHGDVFVKGATQPEMMTFLNVFRKI
FT                   GGEFDITDRGIRFWHPGGDLKPVAIETDVHPGFMTDWQQPLVVALTQANGLSIVHETVY
FT                   ENRFGFTKPLVEMGATVQLYRECLGSLPCRFQQRNYKHSAVIFGPTPLEGRDIDVPDLR
FT                   GGFSHLIAALAAKGPSDVRGISLIDRGYADFRGKLTALGAQID"
FT   gene            295345..296334
FT                   /locus_tag="BLA_0234"
FT   CDS_pept        295345..296334
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0234"
FT                   /product="phospholipid/glycerol acyltransferase precursor"
FT                   /note="COG0204: 1-acyl-sn-glycerol-3-phosphate
FT                   acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28536"
FT                   /db_xref="GOA:B8DVN5"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="UniProtKB/TrEMBL:B8DVN5"
FT                   /protein_id="ACL28536.1"
FT                   /translation="MVSKGKPSPRRAVKPLSDAQVRKLAAEYALVDPTRPFPIGRMEPN
FT                   QREIDELNPKITHRLVEGAAKVLRASCKVRAWGLENVPVEGAYITCATHVTQFDVFVPM
FT                   VAMFQMGRRPRYMAKAEMGKWPVIGKWFRAVGMQPVPRRSGKAREIEEASVQILTSNHA
FT                   LTIWPEGTVTRDPKKWPMSMKNGAGFIALEASRRVGHQIPLFCAVTWGAASINHWWPWP
FT                   RKNVVMCYDTQLDYSDLLANMDSWGDDPPTELANELVRRVRVRMKEVMANIRGTAAPDT
FT                   FYDYRIEKEVPEVPPFSDPHEIDRRAEEAEVRVGESVESADSASSHAR"
FT   gene            296690..297688
FT                   /locus_tag="BLA_0235"
FT   CDS_pept        296690..297688
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0235"
FT                   /product="glycerol-3-phosphate dehydrogenase"
FT                   /EC_number="1.1.1.94"
FT                   /note="COG0240: Glycerol-3-phosphate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28537"
FT                   /db_xref="GOA:B8DVN6"
FT                   /db_xref="InterPro:IPR006109"
FT                   /db_xref="InterPro:IPR006168"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR011128"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B8DVN6"
FT                   /protein_id="ACL28537.1"
FT                   /translation="MANVTVLGAGAWGTAFGQVLADAGNDVMMWAIEPEIVKAIQTEHR
FT                   NPVRLPSVEKLPDNMKATGDRAEAVAHADVVVVAIAAQYARGALEEFKGLIPDSALIVS
FT                   LMKGIEKSTGKRMDQVVCEALDLPTQRFAAVSGPNLSKQIAARQPAATVIGCTDIDNAR
FT                   MMANLCTTDYFKAFITADVIGLELCGSLKNVVALAVGMSHGAGYGENTAAMIETRGLAE
FT                   LTAVGTAAGALPETFHGLAGVGDLIATCGSPLSRNYTFGFNLGKGMSVAEATKASDGVA
FT                   EGVATASAVVELGEKYHVDTPLAKAVTRVLDDGISFSQMVSEMFPQGITVE"
FT   gene            298050..299186
FT                   /gene="ddlA"
FT                   /locus_tag="BLA_0236"
FT   CDS_pept        298050..299186
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ddlA"
FT                   /locus_tag="BLA_0236"
FT                   /product="D-alanine-D-alanine ligase"
FT                   /EC_number="6.3.2.4"
FT                   /note="COG1181: D-alanine-D-alanine ligase and related
FT                   ATP-grasp enzymes"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28538"
FT                   /db_xref="GOA:B8DVN7"
FT                   /db_xref="InterPro:IPR000291"
FT                   /db_xref="InterPro:IPR005905"
FT                   /db_xref="InterPro:IPR011095"
FT                   /db_xref="InterPro:IPR011127"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8DVN7"
FT                   /protein_id="ACL28538.1"
FT                   /translation="MAKTRVAVLYGGKADEHSISCISAASFMRALDPELFEAVPIGITK
FT                   TGTWFVDGQDPLGWNLAEGLPEAVETPDSREVVLTIGDGGDGFHARNADGSLDSLGHID
FT                   VVLPALHGPFGEDGTIQGLFEMMGVPYVGCGVLASAACMDKHYTKVLLRAAGIPVAPGI
FT                   TLDTRHYDASDEFATDGEEFLRQVNEAGLQYPLFVKPSRAGSSFGVTKVEQIGDAAALA
FT                   AAVFEASRHDWRVLVEQGIDAREIECAVVRIHPTDPTRAALPGEVVLDRRSEGDDQFYD
FT                   FDSKYMDSQASHTEIPAKIGDDLIARVRETAVRAFDAVDGMGLSRVDTFVTADGDVLVN
FT                   EINTLPGCTSISMFPQAWEAMGIPFRTVVTDLIEGALA"
FT   gene            299452..300588
FT                   /locus_tag="BLA_0237"
FT   CDS_pept        299452..300588
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0237"
FT                   /product="putative integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28539"
FT                   /db_xref="GOA:B8DVN8"
FT                   /db_xref="InterPro:IPR032327"
FT                   /db_xref="UniProtKB/TrEMBL:B8DVN8"
FT                   /protein_id="ACL28539.1"
FT                   /translation="MTQPENPYTGGEQPAQPITPPADPYGLNPNANPNPYTQPQEPAQP
FT                   YVQNAAPEQGREAYGNSNYGHAESAPQFTGNEPAQQPYGTPYEPVGTQPTTQINYGAPQ
FT                   NAAPQYGEQPAYGAPTGGAPVYGEPGGPAYGGPAQFPPQGGYDQYPPQGPTDKYNTMAI
FT                   VGLILAILFPLIGLIVSIIAMVNINKHGGSKASKNLSLAGTIVGGVLTVVSIIVSIIVF
FT                   NSVLAATNEIVSDSKSPSATHSQTQSTTDPDEDIDEDIDEDIDNDIDDIGGQLTGGSIT
FT                   LEEALKNPTVKSELEKQIQGLPDGMKGSVSAEGNTLILTFDLDSSLAEYSDSLAESLNS
FT                   VGKSAASQLNEDGGNTYSVRIVITSEGKTLYDKTSTND"
FT   gene            300968..301939
FT                   /locus_tag="BLA_0238"
FT   CDS_pept        300968..301939
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0238"
FT                   /product="putative metal-dependent membrane protease"
FT                   /note="COG1266: Predicted metal-dependent membrane
FT                   protease"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28540"
FT                   /db_xref="GOA:B8DVN9"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="UniProtKB/TrEMBL:B8DVN9"
FT                   /protein_id="ACL28540.1"
FT                   /translation="MGERNAVESARRSYSRIGASFSVMIVVWMALVFVLGIGISMLHRE
FT                   AAHWMWVSLLVSDCSFYLVAVPLAYLMLRSVPEEPTRKFGMTFGELFEWFLVSLAIVFV
FT                   GGLLGNALAALFSGGMAQNRLDNIVGGIPAWLNILAVVVVGPIVEEWLCRKQIIARVRR
FT                   YGERLAIVVSALVFALFHLNLYQFFYAFGLGLVLGYIYMRTSQLKYTIGLHMAINFLGS
FT                   VVGPFFSDWSDAHSAALDAGDVSGPELVVGVAAMLYILLYLVAVVAGVVLLIVKCRRLE
FT                   FYVTPAQLPKGTACSCAFVNAGMGVFITLTVFGMVLALMNVM"
FT   gene            complement(301923..302747)
FT                   /locus_tag="BLA_0239"
FT   CDS_pept        complement(301923..302747)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0239"
FT                   /product="putative integral membrane protein"
FT                   /note="COG0668: Small-conductance mechanosensitive channel"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28541"
FT                   /db_xref="GOA:B8DVP0"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR011014"
FT                   /db_xref="InterPro:IPR023408"
FT                   /db_xref="UniProtKB/TrEMBL:B8DVP0"
FT                   /protein_id="ACL28541.1"
FT                   /translation="MEHVLDWLKANSGRIIFLAIVIALAFVVTRLLSRGLRKVLEHNKI
FT                   PQASIFINIARVLVWVVALTIVLHPVFGVSPASLFTALGIGGLAISLGLKDSIANTIGG
FT                   FTLMFSHVIQPGDTVSINDTTGVVQDINWRQTVVRERNGNLMMIPNSVLNTTALEKLDP
FT                   ANECLVTIPFTAKPDVDTAKLAQDLLSTVNTHARSLMNPKYKAVVRYTGFTSDGVSGNI
FT                   VAYAKHGVALTALSDAIARAVHSSKLNLNFTASSLVGIDESGALTGKSTSRS"
FT   gene            complement(302795..303412)
FT                   /locus_tag="BLA_0240"
FT   CDS_pept        complement(302795..303412)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0240"
FT                   /product="conserved hypothetical protein"
FT                   /note="COG1309: Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28542"
FT                   /db_xref="GOA:B8DVP1"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:B8DVP1"
FT                   /protein_id="ACL28542.1"
FT                   /translation="MPRPRRDPEVLPAQQRLENAFWALLRERPYGKITVTDIVREAGVN
FT                   RNSFYYHFSGLPELADATIMHAVESIPIMDHATTAENLWQEWQRTCIVAFNDPQMRKQF
FT                   DHLALLAGPHSTIELTEALRDFIRLTLLGNFDLDYDRIDLSTRILLDFTVGGIVGVLRD
FT                   WPNIEHRLSPNDLTNPDIATVAANLRTALDSSEQRRPVQSLR"
FT   gene            complement(303586..304782)
FT                   /locus_tag="BLA_0241"
FT   CDS_pept        complement(303586..304782)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0241"
FT                   /product="predicted hydrolases or acyltransferases
FT                   (alpha/beta hydrolase superfamily)"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28543"
FT                   /db_xref="GOA:B8DVP2"
FT                   /db_xref="InterPro:IPR024499"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B8DVP2"
FT                   /protein_id="ACL28543.1"
FT                   /translation="MATIIDYVAQETRDFSEYPFHVADALVYAILSYDKIPQEAPQLSS
FT                   LLECFGSISSKLRNFNLKHPSRSLAALWRTPFPGPTLREVEERLHEYELTHPYWEHHSG
FT                   FSDDDETPHRFYRSIKRNPRFAVTRMSAAEERFDISQQTQYAAETFQLPDGTLLVAFRG
FT                   TDDSLTGWREDFNMAFTYPVPAQKQAADYLEKVGRLWPNARIMLTGHSKGGNIAIYAAM
FT                   NARDQIKDRIERIYAFDSPGFNQDVVSSYEYGTIVDRITKLVPEFSIIGMLLQSSPREH
FT                   MIVVKSNADGLMQHSCYTWLMDGDRFDTVPALSESSRDFRGALNTWLNGMTQRQREHGV
FT                   EALFRVLSSGGHSTITQLRTDGMKALPGLFSSYVGLDSEDRHYINQAIMLLAGTRFTH"
FT   gene            304897..305763
FT                   /locus_tag="BLA_0242"
FT   CDS_pept        304897..305763
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0242"
FT                   /product="predicted membrane protein"
FT                   /note="COG4905: Predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28544"
FT                   /db_xref="GOA:B8DVP3"
FT                   /db_xref="InterPro:IPR010540"
FT                   /db_xref="UniProtKB/TrEMBL:B8DVP3"
FT                   /protein_id="ACL28544.1"
FT                   /translation="MWLAAVEKTFVWFLLYSFVGWVWETGLNIVMKRRFVDRGILNGPI
FT                   CPIYGFGAALAIFVLHDEHSLIAVFLSSGVLACTLEYITSWGIEKLFHMRLWDYSNKPF
FT                   NINGRVYLNGFLFFAAGCTVVKEWVQPAVMRMLDRLDPLWLNIVSITLFVILMADVAVT
FT                   LAGLISMNGKLGRAEEYIKSVKKEQIAKMDVHITAADERIEQIEQHAEGVASRVKESVY
FT                   EHVGVHVDGARERMRDGELAEKLHGTFNWQQRRLLDAYPEMKPEHGRSVIGEIRAQLAK
FT                   YGRKHNA"
FT   gene            305827..307023
FT                   /locus_tag="BLA_0243"
FT   CDS_pept        305827..307023
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0243"
FT                   /product="probable aminotransferase"
FT                   /note="COG0436: Aspartate/tyrosine/aromatic
FT                   aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28545"
FT                   /db_xref="GOA:B8DVP4"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:B8DVP4"
FT                   /protein_id="ACL28545.1"
FT                   /translation="MINEKYKAMLGEKSVIRMISERAAARRAEIGADEVFDFSIGNPSV
FT                   PCTPAFTNAVIDLYENEAPSALHGYSPSVGITSFRGAVADSLNRRFGMDYTEQHIFPTS
FT                   GATGSLAHAFRAVTKPGDEVLTFAPFFPEYIPYVEGTGATLTVVPPDTTAFQIDFEAFE
FT                   RALNPNVAVVLINTPNNPSGAAYSAATLERLAGILRDKQTEYGHDIFIVSDEPYREIMF
FT                   DGAAQAYPAKFYDNTLTCYSFSKSLSLPGERIGYVAVNPRATDADVLVPMFAQISRTIG
FT                   HNCPSSTMQLAVERVIDDTSDLSIYEANMNLLYDALVDLGFEVVRPSGTFYIFPKALEE
FT                   DANEFARKAMEYDLFMVPSDSFGMPGYLRLSYCVETEHLRKAIVRLRQFVTEVYGERE"
FT   gene            complement(307278..310016)
FT                   /locus_tag="BLA_0244"
FT   CDS_pept        complement(307278..310016)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0244"
FT                   /product="TPR repeat protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28546"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:B8DVP5"
FT                   /protein_id="ACL28546.1"
FT                   /translation="MQEPLGNPYQNPESTQSAQSAAGLGTDPFSPVTPVSVGGQGQSAP
FT                   TNQSVQTYQLPFLAKVSRLAPIPGDPTNSRYGIVMRLKDVSQPQNGLGYIVRFADDPAT
FT                   GKQNNKQVQIIAWISKSLKVYPTTVPLTNDPSTNDVEGELHFDAWTDQKNLGAVRIQSN
FT                   DGLNRTITIGELQLDFSGSGYSTGSLNGIATASSVDLGPYGPAATNSAAPAHATNTGSA
FT                   RHPLNSLLAAFWLAAAHFPKLRGEQLGMGAGRIVEIFQNMQNKPLADALDEIIWRGTTN
FT                   SNTASPFERFAARQLIEAGAGQIREITAEHNLDVVQLDSTGQFWMRFNRNEITGLQRDI
FT                   VLSVEGALNRLAAASRIAAKYDNGMGLVTTLTEAQDYRAGFDELHEWDTHTSFIQSRAD
FT                   ARNSNLTVRGATAARGGMWDVMSRFVDICERLILPYRVEYRCDANPDTGEMVVNFTVPT
FT                   SLMMPASVLTDSGWVGIREQRAAQAASYALRLAGIIAQAAFTAGTNITSLTVNGTLGSV
FT                   TGAPVLSLAFTRTPFMMGTVPAFMAGQFNDPALDSDPAAVLQMLRPSAQVISFGPDRGL
FT                   TPITALPIPQAILAHRVPLWRDDRELPDDLKALLGADFGRDLDVMYDGASIKGGEIFQI
FT                   AEQNEDSPMSASLEIESALMGLQSEMPDLGERKPLYCEHPLMRLLVANLPDHTPQTRYV
FT                   KAPDALYNSHIALARIHRDSGDLDGSLAQLQQALALAPTTAQPFVDESITYVDIAGDHA
FT                   KGADVLTRGLAVAVMPGDVNFMYYRLAYSLWQTNNREAALACYAFMLGMGFHAQYEEAA
FT                   EVEVRELMQEMGVDSLPDMDAVTHTLNKHGIPVAPLTSQTELLAKAAIRLVDAGFPLAA
FT                   DEAVWALGALSNDDRLGALRQSLRFGVLDEDAVLASERPAN"
FT   gene            310514..312166
FT                   /locus_tag="BLA_0245"
FT   CDS_pept        310514..312166
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0245"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28547"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="UniProtKB/TrEMBL:B8DVP6"
FT                   /protein_id="ACL28547.1"
FT                   /translation="MAEQESALDFIEATHLWSQHAQFVGRAEGAPNPFRTIYGVEAQPG
FT                   GVWDVMTRFHTICERLQLPFHVSTSVEVNPATGDMAVAFGAPEPTQFPTAVPDSHGRAR
FT                   DCTGKRAQWTAAYALRLAALLANIGFAVNTGIIGVTVIARAGEPDGQTLFSLGFNRVDF
FT                   HFTTAKLFADGTIDDAQFDVDPAQLLAAFDVDSARVEFDADGWFAPTEDPELPESLCEL
FT                   RTPLGEDARELPDSLKSLLRADRVCDLDIADQASLSIRDIHQIAQENADSPVTAVVELG
FT                   GALTTLKQELSVSTSIRQPLYCEREALRLLVSEAAGDAATRYRTVPGAIAAVRSELARF
FT                   DMKLGQLDDALRELQELQRISPTSVQGGIAEAMAYSMAGDTARAVDAIRQALKLAVVPD
FT                   EVAFLYCLLGQMFAMAGETDTAIDAYYVASTVAAQTAYTGVARQAMEALLAQIGSADDD
FT                   GERDERSFTATVDARPTAPSRGHALGSLQAAGIPISPTQPVIQTLTRAAMLLADAGVPL
FT                   AAYDGVEILAEYSAEPTLLWMCRALQEGAGCAR"
FT   gene            complement(312173..313228)
FT                   /locus_tag="BLA_0246"
FT   CDS_pept        complement(312173..313228)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0246"
FT                   /product="probable PfkB family carbohydrate (Sugar) kinase"
FT                   /note="COG0524: Sugar kinases, ribokinase family"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28548"
FT                   /db_xref="GOA:B8DVP7"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:B8DVP7"
FT                   /protein_id="ACL28548.1"
FT                   /translation="MLSDILHSIQAKRDHEPTVISLGQVWVDSMIKVPEFPAPGSFMNA
FT                   ESIARSVNGSFAVLEAASRMGAQTELAGILGTGPWSDMIRRALKRVNVRHTGITNKGLD
FT                   NGLRLVINDGQERSFISAPGAEVRTDAHTFDDMHPKSGDVVHISGASLMNTGAVAVGSF
FT                   ISRPECAPDVRDFRIVLTPTSMMSTVNERLLEDIVLLHPIWVLNRQQGRAIADRLGIEV
FT                   DETATMRVDGGFDDSMSALCDGLADVLRAPVVLRAGSRGAWVRRHGEPVQHIDGFETKA
FT                   THIRSAGPTHTGALCALLANGWNLESAVQIANAAASIAITKGINGVPQCPTYDEAVALV
FT                   TKALKDAEHAD"
FT   gene            313492..313689
FT                   /gene="rpmB"
FT                   /locus_tag="BLA_0247"
FT   CDS_pept        313492..313689
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmB"
FT                   /locus_tag="BLA_0247"
FT                   /product="ribosomal protein L28"
FT                   /note="COG0227: Ribosomal protein L28"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28549"
FT                   /db_xref="GOA:B8DVP8"
FT                   /db_xref="InterPro:IPR001383"
FT                   /db_xref="InterPro:IPR026569"
FT                   /db_xref="InterPro:IPR034704"
FT                   /db_xref="InterPro:IPR037147"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8DVP8"
FT                   /protein_id="ACL28549.1"
FT                   /translation="MAARCAVCGKGPQTGYTVSHSHIRNKRRFLPNLQPVRTTVDGQNV
FT                   RLRVCTKCLKAGKVQRVKVA"
FT   gene            313930..316302
FT                   /gene="recG"
FT                   /locus_tag="BLA_0248"
FT   CDS_pept        313930..316302
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recG"
FT                   /locus_tag="BLA_0248"
FT                   /product="ATP-dependent DNA helicase"
FT                   /note="COG1200: RecG-like helicase"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28550"
FT                   /db_xref="GOA:B8DVP9"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B8DVP9"
FT                   /protein_id="ACL28550.1"
FT                   /translation="MARQDGTRDVTLETPLHALLANKRRVSALKKLGVLDVRDALTYYP
FT                   FRVTDPVPVRALVQAQPGLKEKMACAVRVRSVRVSPMNARAGYRVEVLVDDDEFAATLH
FT                   VRGSLATLVFFSHRKSYVDWLAGRLRVDGHVVIAGDPTMYMDRLQFTHPELLTVGGANL
FT                   RADVSTVAEGLQRVCRPRPVYHANSRISSEHIHDTILYVLRLLAGEDPATAMHADDETA
FT                   QPHMRTLYAENPQIREHLDAAIPDILPGNLLAELNLMHRAQAFSQIHDPDSVGAFTQAI
FT                   TTMRYEEAFVCQTALIRARHDAREHNAYVCSDVQLRDEYIDTLPFVLTKGQREVVDEIS
FT                   HDMCQDHPMQRLLQGEVGSGKTVVAVSAMLQAVGSGHQAVLVAPTQVLAEQHYQSISNV
FT                   FNRAPVLLLTGGMKLAERRKVLGTAASGEPCIVVATHAAFSKSFQAPNLALAVIDEQHR
FT                   FGVEQRETLRSKSDVDPHLLVMTATPIPRTAAMTWFGDLDISWLTELPGGRKPIQTVVI
FT                   PEENAPLMAEMFWHIRHRIDAGERAYIVCPRIEESTEDAEGGESGGDARADSDDGMLLS
FT                   DEDLGETNARAPLHSVHEISERLQSLPQFQGVRFCELTGRDDDETKERVMAEFASGQTP
FT                   VMVATTVIEVGVDVPQASCIVIFDADRYGLSQLHQLRGRVGRGGTHSWAFLVSQAEPNS
FT                   IAEQRLDVIAHSLDGALIAQKDLELRGAGDVLGDTQSGGRSSLKLLRVVKDAAMITDAR
FT                   KRAELLLDADPTLEHHTQLAGAVLDFSRGNEKFLTSN"
FT   gene            316742..324490
FT                   /locus_tag="BLA_0249"
FT   CDS_pept        316742..324490
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0249"
FT                   /product="Rhs family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28551"
FT                   /db_xref="GOA:B8DVQ0"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR022464"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="InterPro:IPR038174"
FT                   /db_xref="UniProtKB/TrEMBL:B8DVQ0"
FT                   /protein_id="ACL28551.1"
FT                   /translation="MLFFSGRCEKKGIAMDIRQLREWGKRLFGSISANTKKAIAGVISA
FT                   AMIVTVALVAIPAQAAGNMIADPTTFTQWEQGIGEPTDPRSTGRVWTDKSVSTQEVTLK
FT                   TYDDNHVTVAPKDGSFLVGLSAMSSAQKLIGVSNVTKPLDIVLVLDTSGSMAWGMDGDD
FT                   EYAYDPVYAADITTSKRYYVRVSGSMTRVYSSANGWYYDAGGSRHYVTPKTSAADSDAA
FT                   HTQFYSRRRLTTQDTRMYALKQAVNGFIDQTIAANAKVSDPNKKNRIGLVTYASDVNTR
FT                   SGLTDSLSGLKSTVDDLKASGATRADLGMQTANTVLGNARADASKIVIFFTDGQPTKSN
FT                   GFENDVANDAIGAAKTMKTNGASVYSVGIFTGANPDANVSSVTGKSDIELKSNAFMQGV
FT                   SSNYPNATTYTNLGAKAPNSNYYLAASDADTLNAVFNTIWSEVSSNPTSPIQAESQDGT
FT                   TGERKGAVTFTDQLGDYMTVTSMNSVIFAGTKFAFDPDAENAVVKNGNTTTYTFHGEVA
FT                   GNEVYKAANLQDLKITVTDNGEKTGDTVRVEVPADLLPLRLYTAKVDKDGNVTTSIART
FT                   HPIRLFYDVALKDGVRDKVAKPDAAMSQYIAQHTDASGDVYFLTNAYDTSAQPAAANGT
FT                   TTAVFTPATTNDFYYFTQDTPLYNSKNLEDPAKSIENSVTKTYYYQRTYYANNAKHEQW
FT                   IDVLGSNAYGKAVADSKGNYYAPAGTERTGLSRLYTAPKKPNTTNTASNAIAPEWQMNN
FT                   VTVRLGNNGKQTLAGVGTLHVTEKVVWPQGAKRDPNKSFPFTLQLEGTGADGEFQAVIA
FT                   GEGMTVTNGQTFELKDGESVTVYGLTPGLKATVEQTNHGGAGWSVNHANDSGTIEKNKT
FT                   TNLDFVNTYALTPTTLATGSIKGEKVLANRDWQPGEEFTFTISPLGENSKNPLPNPATV
FT                   SVKNNGSYKAGQPYPFSFGGIEYSNPGTYQYVISENPGDKAGMQYSGASYTATVTVEDN
FT                   GNGTMTASVNMKKTYNDQYEAVNPAEPTDYARFTNRFLGKNESAPIVNGYKNYTDQTGG
FT                   NPNEDGKFKVIITAGNNPDNGPAVPTQPVDVKADGTWSWNPTFTNAALNGQTSQTFTYH
FT                   VREDVPTGASPTLNGMTYDLNTYDVTITVSRDSNQDLITTVGYPNGAKRIEFTNTYKAT
FT                   PTQPQTLQVEKKVTGRDAEARKFTFEAKLDSGDANNVKINNNDTLTNWDTMTVKTPEIK
FT                   NGNTTDINFEGIVFTKPGTYTFGISEQIPNPVPAGWTYDTHTHTVTYEVTDNNGQLEAR
FT                   RNTDGNDLFTNAYAASVDYGAEGTADGFRIGKTLTGRSMNAGEFGFIIEPQNGAPMPGG
FT                   AAHATTTNPFSAVSGQELVWPANGTLLAGLRFTQDDAGKTYEYTVREVPPEDVTQESPT
FT                   KNGVTYDFAAHKVSIKVIDNNGDGTMSTETTVDGSTDAIAHFTNEYAAAAGSQSFKLAK
FT                   TVTGRDWKDGESFTFDLTANPDQSNVPEDVLTKAMPERKSVTVGKPENGNTAQFHFDDF
FT                   TFSQAGTYVYNVRERNAGTTTDGMTHDGRTAIASFTVVDNGLGRYVAGKPLITGIGESN
FT                   TFTNAYEAQSFDGVPDGMEFSKQLTGVEWTADREFEFTLTGKDGAPMPEGAKDGVLTKA
FT                   VHKPAEGDTADVIFGDITYDKVGTYEYTVKETKGDMPGVAYDGHTAKITVTVTDNGRGN
FT                   LQAEAKVSESQFVNKYSAQPATGVPTDFTLHKRVDGMAWNENQQFEFTIQGQDGAPMPK
FT                   NATVTVGKPTDGDTASFDFGEIVYTRSGVYRYTVTEIAGNQPGMAYDGHTATITVEVAD
FT                   DGQGHLVTATTVENGLFTNKYTTQNVAYPGVDVTEELTGRAQAQGEFQFVVRGSDEDMQ
FT                   RAGYTARARAVSGVYEFDAAASGETVTVPGLFTGLELTHDDVRSGRKFNFEVDQIGAQS
FT                   GNGLTVDEQVYAVQIWATDNGDGTMRVHTSVNGTETSEKTPVLPFHNVYATAPVTIGGE
FT                   APVRINAHKTLHGRDLADGEFHFAVRDAKGNVIATASNDANGNVDFTPIEFTAERLAND
FT                   VQNGIAIRNVDYTKTPPVTTYSYEATVTEDEPDPTSGVTVLNGEFSIKLIVTDEGNGTL
FT                   SARVEYPAGTDRLGFSNQYGASSKLSKPIIGAKKLDVKSGDNAPEIAGKYTFTISGSEG
FT                   APMPKNMQTTNDEAGNVNFGDIEYTMENVFGTDKVREKTFTYTVTEEGNVPGVTNDSAK
FT                   TFNVKVRDNGDGTLAVEDSEGMPFTFTNIYAVSPTDPVSPTDPDREGVVTGGVPMTKTI
FT                   AGRDLKDGEFEFALTKADGTLVGTAKNAADGSVKLPAVTFDAPGNYAYLVRENAADADN
FT                   GVTYDNRTYAVVAQVTDKGDGTLAVQWQIADSDGNAVKAMAFENTYAAVPTAVQFGVGK
FT                   LLDGRAPREGEFRFSLRGADESTPMPLAAVDGVQTVTNDATGSALFGTIGYEKAGEYHY
FT                   VVNEVKGDDKTITYDDHEYDVTVRVTDDLKGSLVAAVEYPEGVEGIVFHNVYTKPVEPS
FT                   KPAEPAQPAKPGAKPEAKEPAKEVQQVADTGADIALAVAAAAALILAGAGLLIARRRNE
FT                   "
FT   gene            324576..324842
FT                   /locus_tag="BLA_0250"
FT   CDS_pept        324576..324842
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0250"
FT                   /product="ATP-dependent DNA helicase"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28552"
FT                   /db_xref="GOA:B8DVQ1"
FT                   /db_xref="UniProtKB/TrEMBL:B8DVQ1"
FT                   /protein_id="ACL28552.1"
FT                   /translation="MGSIGLPSWFGMVARAGSGTRACFALLVALWRSGCLVVVARSGMH
FT                   SLMLATSWDELLLDADPMLDHHAQFAGAVLDFSRGNERFLTSN"
FT   gene            325139..325714
FT                   /locus_tag="BLA_0251"
FT   CDS_pept        325139..325714
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0251"
FT                   /product="DNA methyltransferase"
FT                   /note="COG0742: N6-adenine-specific methylase"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28553"
FT                   /db_xref="GOA:B8DVQ2"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR004398"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B8DVQ2"
FT                   /protein_id="ACL28553.1"
FT                   /translation="MRVITGRFKGVPLTTPRSETRPTTDRTKEAMFSRLDSTGILSGAR
FT                   VLDLFGGTGALGIEALSRGANELVVVEASGPAAKLIAHTLTALRHNPAWEESMNARIVH
FT                   AKAERYAAKAKVGEPFDVVLIDPPYAFSTADCERLLGDLTARGLVARDGMIVLERSVRT
FT                   ERPEAPVGWQITDARDYGETAVYTYRAQ"
FT   gene            complement(325741..326568)
FT                   /gene="trmD"
FT                   /locus_tag="BLA_0252"
FT   CDS_pept        complement(325741..326568)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trmD"
FT                   /locus_tag="BLA_0252"
FT                   /product="tRNA (guanine-N1)-methyltransferase"
FT                   /note="COG0336: tRNA-(guanine-N1)-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28554"
FT                   /db_xref="GOA:B8DVQ3"
FT                   /db_xref="InterPro:IPR002649"
FT                   /db_xref="InterPro:IPR016009"
FT                   /db_xref="InterPro:IPR023148"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8DVQ3"
FT                   /protein_id="ACL28554.1"
FT                   /translation="MDIDIVSVFPEYFDVLNLSLLGKAQERGLLAVRSHNLRQWTHDVH
FT                   QSVDDTPVGGGAGMVMKPEVWAECLDELLGIPADAPANAHAAPAADSPVLIFPNPSAPL
FT                   FTQQDATALSHAEHLVFGCGRYEGYDARIPQYYRERGVDVREYSIGDYVLNGGEVAVSV
FT                   MLEAITRLLPGFMGNADSIVEESYTGENALLEHNQYTKPASWRGIDVPPVLISGDHGRV
FT                   NRFRRDEALEKTSRLRPDLIARLDCHALDKQDRKTLMSLGWEVSGEHPRKLED"
FT   gene            complement(326724..327377)
FT                   /gene="rimM"
FT                   /locus_tag="BLA_0253"
FT   CDS_pept        complement(326724..327377)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rimM"
FT                   /locus_tag="BLA_0253"
FT                   /product="16S rRNA processing protein RimM"
FT                   /note="COG0806: RimM protein, required for 16S rRNA
FT                   processing"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28555"
FT                   /db_xref="GOA:B8DVQ4"
FT                   /db_xref="InterPro:IPR002676"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR011033"
FT                   /db_xref="InterPro:IPR011961"
FT                   /db_xref="InterPro:IPR027275"
FT                   /db_xref="InterPro:IPR036976"
FT                   /db_xref="UniProtKB/TrEMBL:B8DVQ4"
FT                   /protein_id="ACL28555.1"
FT                   /translation="MHTNSVPDPQQPQELLRVCRIGKAQGLKGEVSVELYTDDPHARFA
FT                   PGEVLYARESAADALRPYTVAAARTFKNRWYVRFEGVDDRNAAEALRNTVLYGEPQELD
FT                   DDEFYPKDLLGLEVYLESEVSAANADDAPEGAEFEFTDLGKVVDVIEGAQWLLKIRMPN
FT                   REAFLLPFVEALVPEVNLEEGYLTVDPPGGLVPGIGEPDIADTADSVGAAPPSA"
FT   gene            complement(327380..327613)
FT                   /locus_tag="BLA_0254"
FT   CDS_pept        complement(327380..327613)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0254"
FT                   /product="conserved hypothetical protein"
FT                   /note="COG1837: Predicted RNA-binding protein (contains KH
FT                   domain)"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28556"
FT                   /db_xref="GOA:B8DVQ5"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR020627"
FT                   /db_xref="UniProtKB/TrEMBL:B8DVQ5"
FT                   /protein_id="ACL28556.1"
FT                   /translation="MLAQAVEHLIKNIVDFPDDVSVKSHENARGELIRVRVNPEDIGRV
FT                   IGRNGRTANAVRTVIQAISDHKVRVDIMDVRK"
FT   gene            complement(327618..328088)
FT                   /gene="rpsP"
FT                   /locus_tag="BLA_0255"
FT   CDS_pept        complement(327618..328088)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsP"
FT                   /locus_tag="BLA_0255"
FT                   /product="ribosomal protein S16"
FT                   /note="COG0228: Ribosomal protein S16"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28557"
FT                   /db_xref="GOA:B8DVQ6"
FT                   /db_xref="InterPro:IPR000307"
FT                   /db_xref="InterPro:IPR020592"
FT                   /db_xref="InterPro:IPR023803"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8DVQ6"
FT                   /protein_id="ACL28557.1"
FT                   /translation="MATKIRLKRMGKKFYAVYRVVVMDSRTKRDGRAIEEIGLYNPNTQ
FT                   PSTIEIKSDRAQYWLGVGAQPTDQVLNLLKITGDWQKFKGLKGAEGTLKTAAAKPEAAV
FT                   LVEEAENKAQKLKAAKAEAAAKAAEAETPAEVQHDDEKVELADVEESAPESV"
FT   gene            328318..331776
FT                   /locus_tag="BLA_0256"
FT   CDS_pept        328318..331776
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0256"
FT                   /product="beta-galactosidase P1"
FT                   /EC_number="3.2.1.23"
FT                   /note="COG3250: Beta-galactosidase/beta-glucuronidase"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28558"
FT                   /db_xref="GOA:B8DVQ7"
FT                   /db_xref="InterPro:IPR004199"
FT                   /db_xref="InterPro:IPR006101"
FT                   /db_xref="InterPro:IPR006103"
FT                   /db_xref="InterPro:IPR006104"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014718"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR023230"
FT                   /db_xref="InterPro:IPR023933"
FT                   /db_xref="InterPro:IPR036156"
FT                   /db_xref="UniProtKB/TrEMBL:B8DVQ7"
FT                   /protein_id="ACL28558.1"
FT                   /translation="MFIPRYFEDLDTLHVGCEPNRAYFVPASAPTDTRFAAREQSDRFR
FT                   LLNGEWDFKYYASVYDLDAEVDASAQAHEPVFTEPMFDADSYDQIAVPSVWQTHGYDHN
FT                   QYTNTRYPFPLDPPFVPHDNPCAVYRTTFGYDVDPACPRAFLNFEGVDSCFYVWLNGDF
FT                   VGYSQVSHSTSEFEVTDALDDGENTLVVLVLKWCDGSYLEDQDKFRMSGIFRDVYLLTR
FT                   PEHAIRDFYVRTDIRFADSGTRAAAAPQAVSADVTVDFDFLDGVPVEGIDVVIGDAAGN
FT                   VVAQGVTEAVQSETGTVGESAHRRQAVENGSAFPAKARVKLTVEQPVLWNPEVPTCYTL
FT                   MILSDGESITQPLALRDIAVVAPDGRHQTVLLNRRPIVIHGMNRHDSDPVTGYTISPEQ
FT                   FRTDLLLMKSHNVNGVRTSHYPNAPHYYDLFDELGFLVIDEADIEAHGVADAVLPKPGA
FT                   ESANMEEWQRAQLMWNGLIANNPRFVPAILDRIQRLVERDKNRGCVIFWSMGNESAYGI
FT                   GFEKALEWVKTLDSQRLTHYESARYVEEGGTLQHDYGNIDVHSRMYPSIAEIDAYFSES
FT                   GPNGDGANGEDGTAENGQVKPYIMCEYCHAMGNGPGDLEDYFQCIERHEGLLGGYIWEW
FT                   CDHAIYAGRNARGRQEYLYGGDFGEWPNDGNFCVDGMVSPDRTPHSGLDEFKNVFRPAR
FT                   VVSVDAERGVVNLRNHYDFRELGEAVIVMWEVYVDGVMQTYSLVEPGTFAIEPHAVGEV
FT                   RLSGWESVWPVAQPGRVTLVLRYLAREAQWGQEQLFELGFDEVELPNPTGDNSSQWVRH
FT                   QVEDMLAGDEIGESVTLEESDARIVINGANWRYVFDKCTGLFSELVYANRTILATPMTL
FT                   DIWRAPTDNDRNVRHEWERCGYDRAYARAYDVQTRTVVSSGIGEAALGVDGGAYGEETA
FT                   VEDAEGPMAVNAVEIKCSMGAVAPTVQPIARMDTTWTVHADGSVALHMNVRKDPAFPFL
FT                   PRFGIHMQLLKSMSNVTYCGLGPNESYVDKRRASWHGVFSASVSQMGEREIKPQENGNH
FT                   HDCSWARVQGDGVALMIVQGDGSQPESPAELLRGFDFQALEYTAAEMTRARHDFELQPS
FT                   GFTEVSVDYMQSGIGSNSCGPELLPQYRLDAPEFDFAITLRPQLA"
FT   gene            complement(332056..333225)
FT                   /locus_tag="BLA_0257"
FT   CDS_pept        complement(332056..333225)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0257"
FT                   /product="endonuclease/exonuclease/phosphatase precursor"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28559"
FT                   /db_xref="GOA:B8DVQ8"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:B8DVQ8"
FT                   /protein_id="ACL28559.1"
FT                   /translation="MIIALWVILVLLLVWISLSELPAGWDGHAPLPYLIALSPFAWIGI
FT                   TAVAIWSGCLREWPLMACAIVGLIASLLRKTAYYMNDLKTPNTGELIARKLAEKRESEN
FT                   LTISSNSAAVENLANGHFNVFTLNCRYGEANAHEIVNTVRTNDIAVLALQEMSPDLVTE
FT                   LHDAGLDDLLPFHQFGDPSSSDNGGFNGLWLRVEPAEQTPTGVPIPAADVPTVTLPVTS
FT                   TFNITFASAHPKSPQRSCKDWSAGIIGLGALAKSANKDRDRNADDSCNNREIAVLMGDL
FT                   NSSIVHPSFRELLASGFHDAALVEARGEHPTYPSWLKWPRIVIDHILFTDFMTASNVRA
FT                   VFIDGTDHLGLTATLTIRDTRTQANAAARESWPSSLPPLPAKSRRKTAD"
FT   gene            complement(333688..334593)
FT                   /locus_tag="BLA_0258"
FT   CDS_pept        complement(333688..334593)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0258"
FT                   /product="cation efflux protein"
FT                   /note="COG3965: Predicted Co/Zn/Cd cation transporters"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28560"
FT                   /db_xref="GOA:B8DVQ9"
FT                   /db_xref="InterPro:IPR002524"
FT                   /db_xref="InterPro:IPR027469"
FT                   /db_xref="UniProtKB/TrEMBL:B8DVQ9"
FT                   /protein_id="ACL28560.1"
FT                   /translation="MHQKKIEQQALKVGIVVNIVMVLAGFFVFFLTGLKSMFLDASFTV
FT                   ISVISGGVAAYLSKKTVRVSDRFPNGMFALEPIYAICKSIFTICLLLFSFLDVAQIAIA
FT                   YFVHGEGERLEFGPVIIYQILAVAVCIALVAYYRARNRTLGNASLMLKAEANGTWIDGM
FT                   ISLGIGIVAVLLYFLPNGTPLDFLHYTGDFFITTIIVALTIKEPVTVLRDAFVELIGGT
FT                   HDDEEVSELVSREASAHLPAGVKVQTIHVFKTGMNFDIDIIVNGTGDVVRVEDLVEARK
FT                   RMERALEPKLHLVNVDFVFD"
FT   gene            334592..336364
FT                   /gene="ffh"
FT                   /locus_tag="BLA_0259"
FT   CDS_pept        334592..336364
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ffh"
FT                   /locus_tag="BLA_0259"
FT                   /product="signal recognition particle protein"
FT                   /note="COG0541: Signal recognition particle GTPase"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28561"
FT                   /db_xref="GOA:B8DVR0"
FT                   /db_xref="InterPro:IPR000897"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004125"
FT                   /db_xref="InterPro:IPR004780"
FT                   /db_xref="InterPro:IPR013822"
FT                   /db_xref="InterPro:IPR022941"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036891"
FT                   /db_xref="InterPro:IPR042101"
FT                   /db_xref="UniProtKB/TrEMBL:B8DVR0"
FT                   /protein_id="ACL28561.1"
FT                   /translation="MLPPVAQTVCVFPDSSLSNLRSGVASVWPSSTISPLQARIVDIMA
FT                   AFSSLTDRLSNAFKHLKSKGKLSDADIDGTIREIRRALLDADVSLDVVRSFTARVRDRA
FT                   LSTEVSEALNPAQQVVRIVNDELTDILGQGVDRPLNFAKNPPTIIMLAGLQGAGKTTLA
FT                   GKLGYWLKDSGHTPLLVAADLQRPNAVTQLEVVGERAGVPVYAPEKGVQSAGGDAVSAP
FT                   GETTGDPVKVARDSIEYARQKMYDTVIIDTAGRLGVDETLMQQARDIRDAVQPNEVLFV
FT                   IDAMTGQDAVRTAQAFDEGVNFTGVVLSKLDGDTRGGAALSVASVTGKPILFASNGEGL
FT                   KDFEVFHPDRMASRILDMGDILTLIEQAQREFDEEETRKAAAKMAEGEFGLDDFLAQLQ
FT                   QVRKLGSMKSLLGMIPGMAQHRKELEMFDEREVDRTEAIIRSMTPEERRNPKIIDGSRR
FT                   ARIAYGSGVSVSAVNALLQRFEQASKMMKRMTNRAGMGGGMAGGFGGFGGPGGSKKGKK
FT                   GKKGKKGGKSGNPMKREAEEKALRAKLAGKSNPGGSAFAKKPQANELPAGLQDMLGGAD
FT                   VPSNLGGGLSGLLG"
FT   gene            complement(337508..339145)
FT                   /gene="cysS"
FT                   /locus_tag="BLA_0260"
FT   CDS_pept        complement(337508..339145)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysS"
FT                   /locus_tag="BLA_0260"
FT                   /product="cysteinyl-tRNA synthetase"
FT                   /EC_number="6.1.1.16"
FT                   /note="COG0215: Cysteinyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28562"
FT                   /db_xref="GOA:B8DVR1"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015273"
FT                   /db_xref="InterPro:IPR015803"
FT                   /db_xref="InterPro:IPR024909"
FT                   /db_xref="InterPro:IPR032678"
FT                   /db_xref="UniProtKB/TrEMBL:B8DVR1"
FT                   /protein_id="ACL28562.1"
FT                   /translation="MTHAQSHTTDQFDETLAAGNHGVANAAVDLKLYDTATHAVSRFEP
FT                   IKPGEVGMYVCGATVQSAPHIGHIRAAVAFDIIRRWFERLGYKVTFIRNVTDIDDKILD
FT                   KAAAAGEDWWARAYHYEREFTHAYNELGVLAPTYEPRATGHIIDMVHLIERIIDNGHAY
FT                   VIRDEHGELTGDVYFDVASWPHYGELTHQKQTAEVDEAAAVADRMGPSVDASGDDKYNP
FT                   ADPADLSENKRDPRDFALWKRPKSTDPADARWKTPFGTGRPGWHIECSAMSYRYLDGMF
FT                   DIHGGGLDLRFPHHENEMAQTRAAGYRTANRWMHSAWVTAKGEKMSKSLGNGLSVPVVL
FT                   AEHSAWVVRYALGSVQYRSMLEWSDQTLAEAEAAYERIMNFIGHAADALGEQPSRDEIT
FT                   GVSADNLPVDFVAAMNDDVNVSRATAAIFTQIREGNTLLARLAGNADDADRTALRAALV
FT                   NVRAMLDTLGLDPLASPWIDGGDEAGGDSSALKTLGELVDAQLAARAEARKNKDFAKAD
FT                   QIRDALAAAGITIEDGPTGSTWTLAPSR"
FT   gene            complement(339194..341395)
FT                   /locus_tag="BLA_0261"
FT   CDS_pept        complement(339194..341395)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0261"
FT                   /product="ATP binding protein of ABC transporter"
FT                   /note="COG0488: ATPase components of ABC transporters with
FT                   duplicated ATPase domains"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28563"
FT                   /db_xref="GOA:B8DVR2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032524"
FT                   /db_xref="InterPro:IPR032781"
FT                   /db_xref="UniProtKB/TrEMBL:B8DVR2"
FT                   /protein_id="ACL28563.1"
FT                   /translation="MPTFDLGLEHVSLDFATKTIFTDVTQGVFEGDRIGIVGRNGDGKS
FT                   TLLHLLEGTQAPDSGRVTTRNGLTFGMLDQRDQLDDDATIREAALEGREDYEWAAQTES
FT                   REIVEALLGGLNLNARIGTLSGGQRRRADLARLLLKDWDVLALDEPTNHLDVVTIHWLA
FT                   EHLKNRWAKGTGALLIVTHDRWFLDEVCESMWEVHDGQIEPFEGGYSAYMLQRVERDRQ
FT                   ADVRETKRRNLARKELAWLSRGARARSTKQKFHVKAARELIADVPPMRNTLELKQMATS
FT                   RLGKQVVDLVDVTQIFDREQGAVADIDPDIADMERMGTDSESSAGTQIDIVTPMVQEPQ
FT                   AFGSVTMDVDDADDPRLISAFGSRAAQIAAEHGLKAREAVTGYNALRGMTENELAANEA
FT                   ANTGADATSAAAHIEVSGREILDDVTWLIGPGDRFGIVGANGAGKSTLLKILDGSLAPT
FT                   AGRVNIGKTVKFAVLSQRLDELEKLGNYKVKEVLSRYKPTYIVDGKEVTPGQLMERLGF
FT                   EGAQLMTPIRDLSGGQKRRMQLLLILLDEPNVLIMDEPGNDLDTDMLAVMEDLLDTWPG
FT                   TLIVVSHDRYLLERVTDEQFALIGGKVRHLPGGVQDYLDMVDDLKRGKALPQADSADAA
FT                   QSAHTAQSENVRTADEQSADQPKLSGKEYAQASRRVSAIERKLEKIEQQKGELESQMNA
FT                   HDPTDYEGLGKLSAQIAELETQQGELETEWFDLSEQLGK"
FT   gene            complement(341561..342298)
FT                   /locus_tag="BLA_0262"
FT   CDS_pept        complement(341561..342298)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0262"
FT                   /product="possible amidotransferase"
FT                   /note="COG0518: GMP synthase - Glutamine amidotransferase
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28564"
FT                   /db_xref="GOA:B8DVR3"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:B8DVR3"
FT                   /protein_id="ACL28564.1"
FT                   /translation="MTKPEVLILQHAEWEKPGLILSDLEEINLPTQTLNISKQKKPDLP
FT                   DFDEVAGLVVMGGPMGAADFDDYPGLKAEMKLIRAAIGTGKPVLGVCLGHQLIGAALGA
FT                   RVKKASAPEIGIAPIKRVAKHDFFSMWSKELNVLQWHGDCISLPDSAELLARSSDTRVQ
FT                   AFRFGSALGMQFHLEVTPQLLEEWLDEPSMVKQLKASGGSKSQLREAFAASYPQIQPLG
FT                   EQVFSGFAARCSTYSFSLTSRKS"
FT   gene            complement(342475..343029)
FT                   /gene="ilvN"
FT                   /locus_tag="BLA_0263"
FT   CDS_pept        complement(342475..343029)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ilvN"
FT                   /locus_tag="BLA_0263"
FT                   /product="acetolactate synthase, small subunit"
FT                   /EC_number="2.2.1.6"
FT                   /note="COG0440: Acetolactate synthase, small (regulatory)
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28565"
FT                   /db_xref="GOA:B8DVR4"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR004789"
FT                   /db_xref="InterPro:IPR019455"
FT                   /db_xref="InterPro:IPR027271"
FT                   /db_xref="InterPro:IPR039557"
FT                   /db_xref="UniProtKB/TrEMBL:B8DVR4"
FT                   /protein_id="ACL28565.1"
FT                   /translation="MASYPASKPGSQRHTLSVLVENRPGVLARIAGLFARRAFNINSLS
FT                   VSPTERPDISRITVTADVEEVPLEQIIKQLNKLLHVLKIVDLDESTTVERELVLIKVAA
FT                   DQSNRSDVLEIVRLFRVRVVDVNPESLTIEATGAGGKIDALLGLLDHYGIIELVRSGAV
FT                   AMTRGPRALSEKVVGSEITGR"
FT   gene            complement(343045..344973)
FT                   /gene="ilvB"
FT                   /locus_tag="BLA_0264"
FT   CDS_pept        complement(343045..344973)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ilvB"
FT                   /locus_tag="BLA_0264"
FT                   /product="acetolactate synthase, large subunit,
FT                   biosynthetic type"
FT                   /EC_number="2.2.1.6"
FT                   /note="COG0028: Thiamine pyrophosphate-requiring enzymes
FT                   acetolactate synthase, pyruvate dehydrogenase (cytochrome)"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28566"
FT                   /db_xref="GOA:B8DVR5"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR012846"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR039368"
FT                   /db_xref="UniProtKB/TrEMBL:B8DVR5"
FT                   /protein_id="ACL28566.1"
FT                   /translation="MSPTPLQAFSGVAKANANQHTHKRTIVDGEKMTGAQALVRSLEDL
FT                   GVKVVFGIPGGAILPVYDAIDEHTKFRFVLMRHEQAAGHAAEGYAVATGEVGVCIVTSG
FT                   PGATNVITAIADANMDSIPMIVVTGQVGVNAIGTDAFQEADIVGATYPVAKHSYLVTDA
FT                   QDIPRVLSEAHYIARSGRPGPVVVDLTKTAQNGTMYYSWPQRMILPGYNPTTEAHGRVL
FT                   DDAARLFQHAFRPVLYVGGGAVRSDAGAEVKALSDLTGAPIVTTLPARGIVPDDDPAVL
FT                   GMLGMHGTIAATGAVQRSDLLVAIGARFDDRVTGKLEAFAPGARVIHIDIDPAEIGKNR
FT                   TPDVPIVGDVKTVLSALMPRIERQHAIHGKPNLTTWWGLINSWVEKYPLTYQEPTDGTL
FT                   APQWVVEELSHAANPETIWVSGVGQHQMWATQFINFSHPHQWISSGGLGTMGFGLPAAI
FT                   GASIGSQRYFDGKKPVWLIDGDGSFQMTSEELAAAFLEGAPVKIALLNNSVYGMVRQWQ
FT                   TLFYNNHYSATILHEEEKTGLEGVPDFVKLADAYGCVALRARTKDEAVEAIRRANEIND
FT                   RPVLVDFRVWKDAMVWPMVAAGDSNDNVTYLPGIKPLHQADGLAAMPVDSDAQADEATA
FT                   IITEEQD"
FT   gene            complement(345349..346125)
FT                   /gene="rnc"
FT                   /locus_tag="BLA_0265"
FT   CDS_pept        complement(345349..346125)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rnc"
FT                   /locus_tag="BLA_0265"
FT                   /product="ribonuclease III"
FT                   /EC_number="3.1.26.3"
FT                   /note="COG0571: dsRNA-specific ribonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28567"
FT                   /db_xref="GOA:B8DVR6"
FT                   /db_xref="InterPro:IPR000999"
FT                   /db_xref="InterPro:IPR011907"
FT                   /db_xref="InterPro:IPR014720"
FT                   /db_xref="InterPro:IPR036389"
FT                   /db_xref="UniProtKB/TrEMBL:B8DVR6"
FT                   /protein_id="ACL28567.1"
FT                   /translation="MSVRVSTQEIGESAMQELFTALGTTLETDLLVEALTHRSFSHEHE
FT                   GVKNYERLEFLGDAVLEFVVTETLFKQYPDKSEGQLAKIRAKAVSEESLSAIARDRLHV
FT                   GPYILLGHGESEQGGAEKSSILCDIVESLIGATFVQYGVDKAREVVHHLVDDTLAEVAT
FT                   EGPALDWKTSLTVKAHEMGLPEPRYQMSVGGPEYALEFTAFAMLGDSKEVLGVGNGSSK
FT                   RKAQLAAAEQAWHVLDEREHAPKPERKRERRPLTDA"
FT   gene            complement(346450..346644)
FT                   /gene="rpmF"
FT                   /locus_tag="BLA_0266"
FT   CDS_pept        complement(346450..346644)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmF"
FT                   /locus_tag="BLA_0266"
FT                   /product="ribosomal protein L32"
FT                   /note="COG0333: Ribosomal protein L32"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28568"
FT                   /db_xref="GOA:B8DVR7"
FT                   /db_xref="InterPro:IPR002677"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8DVR7"
FT                   /protein_id="ACL28568.1"
FT                   /translation="MALPKYKMSRANTRTRRSTWKAKAAQTITCPNCGAPTLAHVACPS
FT                   CGSYRGRVYREAIRSAHTK"
FT   gene            complement(346723..347319)
FT                   /locus_tag="BLA_0267"
FT   CDS_pept        complement(346723..347319)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0267"
FT                   /product="predicted metal-binding, possibly nucleic
FT                   acid-binding protein"
FT                   /note="COG1399: Predicted metal-binding, possibly nucleic
FT                   acid-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28569"
FT                   /db_xref="InterPro:IPR003772"
FT                   /db_xref="UniProtKB/TrEMBL:B8DVR8"
FT                   /protein_id="ACL28569.1"
FT                   /translation="MARIEYTDWTVPVAQVGSRAGQTMQVDRDFPAPGGIGDSIVGVKE
FT                   GEPIHVNGQFDSIIDGLIFTGTFTAPVTAVCARCDRDLSGDWSEQVTAFFPYEDADAGK
FT                   TKNEDVEIIAGEEESGDTYPLIDNGAFANIEPLLRDTFVSALPLNPLCKPDCKGLCPQC
FT                   GLDLNESPEHVHEVTDLRFADLEALKEQLEREQGE"
FT   gene            complement(347404..347934)
FT                   /locus_tag="BLA_0268"
FT   CDS_pept        complement(347404..347934)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0268"
FT                   /product="conserved hypothetical protein"
FT                   /note="COG3599: Cell division initiation protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28570"
FT                   /db_xref="UniProtKB/TrEMBL:B8DVR9"
FT                   /protein_id="ACL28570.1"
FT                   /translation="MYDIIDSLEEMITSAKGSMFSPSSVKIDRDDFLDKLEDLKTKLPV
FT                   QLERASALMREAEGRLANANSQANVIISTAQARAANIIRDANERADYLASQEKVTEIAR
FT                   QKAKTMIDKAQAASDRLTSGADQYCIKIMNELHSQLGKMTRDVEGGLNVLEEREAKARE
FT                   ELPHAEESDYPQD"
FT   gene            complement(348156..348635)
FT                   /gene="coaD"
FT                   /locus_tag="BLA_0269"
FT   CDS_pept        complement(348156..348635)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="coaD"
FT                   /locus_tag="BLA_0269"
FT                   /product="pantetheine-phosphate adenylyltransferase"
FT                   /EC_number="2.7.7.3"
FT                   /note="COG0669: Phosphopantetheine adenylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28571"
FT                   /db_xref="GOA:B8DVS0"
FT                   /db_xref="InterPro:IPR001980"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8DVS0"
FT                   /protein_id="ACL28571.1"
FT                   /translation="MTIAVCPGSFDPVTNGHIDVITRCCRLFDEVHVVVAVNAMKKPLF
FT                   TETERVDIIKHALADSGMTNYVVAWTDGLITDYCRKVDSPVIVKGLRQNGDYEAELGMA
FT                   LVNRHLAYVETMFLPANPVLEHISSSVVKDVARHGGDITGMVPDYVVPLLEKALR"
FT   gene            348811..349104
FT                   /locus_tag="BLA_0270"
FT   CDS_pept        348811..349104
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0270"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28572"
FT                   /db_xref="InterPro:IPR021400"
FT                   /db_xref="UniProtKB/TrEMBL:B8DVS1"
FT                   /protein_id="ACL28572.1"
FT                   /translation="MSFAYNDALDDNTTAATEPSSDTGTAVLERPKAQERRADDGDADR
FT                   FAHYVSRDRIAESRLTGRPVVALCGKVWVPKRNPKDYPICPECKRIYEEMTK"
FT   gene            complement(349240..350247)
FT                   /locus_tag="BLA_0271"
FT   CDS_pept        complement(349240..350247)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0271"
FT                   /product="possible reductase"
FT                   /note="COG0667: Predicted oxidoreductases (related to
FT                   aryl-alcohol dehydrogenases)"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28573"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:B8DVS2"
FT                   /protein_id="ACL28573.1"
FT                   /translation="MPDFITHYSPAPDRYDRMQYAHVGTSGLQLPRIALGLWHNFGDLT
FT                   PYGQMQQIVFTAFDHGIFHFDLANNYGPMYGAAERNFGHIMRESLRPYRDELIISTKAG
FT                   FDMWAGPNGVGGSRKYLLSSLDQSLERLGLDYVDIFYHHCPDPNTPLEETVGALETAVT
FT                   SGRALYVGLSNYDGPLLEQAAQMLAERHVPFIINQNRYNIFDRTIERNGLKEATSKLGK
FT                   GLITFSPLEQGLLTNRYLNGIPADSRIGHDDRFLNKSALTESRLTQIRELNDLALSRGQ
FT                   TLAEMSLAWLLNDPAVTTVLVGASKPQQILDDIAALNNTHFTPEELARIDSISL"
FT   gene            complement(350324..351784)
FT                   /locus_tag="BLA_0272"
FT   CDS_pept        complement(350324..351784)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0272"
FT                   /product="putative nicotinate phosphoribosyltransferase"
FT                   /note="COG1488: Nicotinic acid phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28574"
FT                   /db_xref="GOA:B8DVS3"
FT                   /db_xref="InterPro:IPR006405"
FT                   /db_xref="InterPro:IPR007229"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR036068"
FT                   /db_xref="InterPro:IPR040727"
FT                   /db_xref="InterPro:IPR041525"
FT                   /db_xref="UniProtKB/TrEMBL:B8DVS3"
FT                   /protein_id="ACL28574.1"
FT                   /translation="MTSAHICALIRLGWGTTTSARGESTAAPANREEITQEKRTANTGD
FT                   TMVVYDPSLMTDMYEYTMLDATLQDGTANRPCVFEVFTRHLPEGRRYGVVAGIGRLLDA
FT                   LEDFHLDDADLKFLSDRHIVSRGTVKWLENYHFTGSIRGYREGEVYFPNSPILQVRGSF
FT                   GECTLLETLILSILNYDSAVAAAASRMVTAAKNRPCMDMGGRRTNEWAAVAAARASIVG
FT                   GFKGTANLLAAKLYDLPAIGTAAHCFTLVHDSERQAFESQIAALGTNTTLLVDTYNIEE
FT                   AVKTAVEVAGPNLGGVRIDSGDLAALAQRVRNQLDALGATNTKITVTNDLDEYAIASLQ
FT                   TAPVDSYGVGTQLVTGSGAPTCAMVYKLTERANNAGHMEPVAKKSVDKATAPGAKLAFR
FT                   SYEYSLADCEHVISGSESALENFVPGEGWEDLLTDFVVNGTVDPQFQGHDGLMAAQDYH
FT                   AKALAKLPITAQSLMRGEPVIPTKLEVL"
FT   gene            351952..352572
FT                   /locus_tag="BLA_0273"
FT   CDS_pept        351952..352572
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0273"
FT                   /product="permeases of the major facilitator superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28575"
FT                   /db_xref="GOA:B8DVS4"
FT                   /db_xref="UniProtKB/TrEMBL:B8DVS4"
FT                   /protein_id="ACL28575.1"
FT                   /translation="MRYLAGIWRLAIAALCFIGTSPAWHAVSLWAFLMYQIGFIAGIVM
FT                   LWSGCASILRGVQPPALLRGFVLTYAFSLAAVHFFVTPAAEFGVPAQQVIPLSAQVLAL
FT                   IVVGMLAVDFFAFEPHRAFKPVYPLVWLVYLPLYAAFAIARAYWFPHSGPTANAYPYDY
FT                   LIITQFTWGGAGVACLKIVAIYLAVGVVLCLFDRALPAKSAAE"
FT   gene            352782..353522
FT                   /gene="rph"
FT                   /locus_tag="BLA_0274"
FT   CDS_pept        352782..353522
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rph"
FT                   /locus_tag="BLA_0274"
FT                   /product="ribonuclease PH"
FT                   /EC_number="2.7.7.56"
FT                   /note="COG0689: RNase PH"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28576"
FT                   /db_xref="GOA:B8DVS5"
FT                   /db_xref="InterPro:IPR001247"
FT                   /db_xref="InterPro:IPR002381"
FT                   /db_xref="InterPro:IPR015847"
FT                   /db_xref="InterPro:IPR018336"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027408"
FT                   /db_xref="InterPro:IPR036345"
FT                   /db_xref="UniProtKB/TrEMBL:B8DVS5"
FT                   /protein_id="ACL28576.1"
FT                   /translation="MTVTRADGRAYDELRPVRITRAFTDVPEGSVLIECGNTRVMCTAT
FT                   FTDTVPRWRKDSGLGWVTAEYSMLPRATAQRTDRESVRGKVGGRTHEISRLIGRCLRGV
FT                   IDMKALGENTIQMDCDVLQADGGTRTASITGAHVALVDALNWAKQNGKIKSVKNVLLDS
FT                   VSAVSVGVIDGEPMLDLPYVEDSRAMTDMNVAMTGSGKFVEIQGTAEHRPFSRNELGVL
FT                   LDLATKGNRELQAAQQAALDADLR"
FT   gene            353551..354270
FT                   /locus_tag="BLA_0275"
FT   CDS_pept        353551..354270
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0275"
FT                   /product="HAM1-like protein"
FT                   /note="COG0127: Xanthosine triphosphate pyrophosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28577"
FT                   /db_xref="GOA:B8DVS6"
FT                   /db_xref="InterPro:IPR002637"
FT                   /db_xref="InterPro:IPR020922"
FT                   /db_xref="InterPro:IPR029001"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8DVS6"
FT                   /protein_id="ACL28577.1"
FT                   /translation="MNIVVATHNEGKLVEIRDILAEEFGDGAHDIELVSAGSLGLPDPV
FT                   ETGITFEANALLKARFVARLTGLPAIADDSGLIVDVMGNAPGILSARWAGEHGNDAANI
FT                   DLLLAQIEDIPDDDRTARFRCAAALVVPIAAEEDVADFEADPSDGMDDGDGLVDARETV
FT                   VLGEMPGTIVRHPHGSNGFGYDPIFMPDEQPAGAEESGELLTSAEMTPEQKNAISHRGK
FT                   ALRALMPAIRELVETGE"
FT   gene            354312..355595
FT                   /locus_tag="BLA_0276"
FT   CDS_pept        354312..355595
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0276"
FT                   /product="FemAB-like protein possibly involved in
FT                   interpeptide bridge formation in peptidoglycan"
FT                   /note="COG2348: Uncharacterized protein involved in
FT                   methicillin resistance"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28578"
FT                   /db_xref="GOA:B8DVS7"
FT                   /db_xref="InterPro:IPR003447"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:B8DVS7"
FT                   /protein_id="ACL28578.1"
FT                   /translation="MRKFSFEVLNEQEFRAFAEASPQSNFQQTVEMANLRRMHGMDVDF
FT                   VGMREDGEIKAGAVFATHHAPMATFCSVISGPLCDYDDDELVAEFLRALARFAKKKGAV
FT                   HLDIAPNQRYRVRDDHGEALPESEGGAPDKRMIRNIEQAGYEHGGFVRGYTSTVRWRFA
FT                   KDMTGIGDESELLKSYSKRTQWSIKRARSMGVHVREIGVDELDTFARIEQQTAERRHFE
FT                   FRGPQYFKQFAQCFGERARFVLAEIDTAEYQRSMQRKADDLRALVDGLEAKIAQRETTK
FT                   LRRRLNEESSNLAAANKRLAEANELVEKGDLIPAAASMFVLGPREVVYLFSGSVEEYKP
FT                   FYASALIQHEAMLRYCVQGVEPFGHVNLYDFYGIDGIFDDPDDEGRGVLEFKQGFNGYV
FT                   VEMPGDFMKVLRPVTYRAQRLAHKLLGR"
FT   gene            complement(355625..356632)
FT                   /locus_tag="BLA_0277"
FT   CDS_pept        complement(355625..356632)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0277"
FT                   /product="permease"
FT                   /note="COG0679: Predicted permeases"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28579"
FT                   /db_xref="GOA:B8DVS8"
FT                   /db_xref="UniProtKB/TrEMBL:B8DVS8"
FT                   /protein_id="ACL28579.1"
FT                   /translation="MTLLQPIALLAIIIAGYLFKRCRLFGQRDYRIIQVMLFDLVLPGA
FT                   IVYSFATNPHDPSLLWLSAFGFVVALVPVLVIFSATRHSPVTQRAFLMLNATGLNIGCF
FT                   CFPVVQAFLGEQAIVPAAMFDIGNCIMVAAGTNVMTQTLLHIQPGRPLTEQGAGDAPTL
FT                   PYTRPTDRDAKRLARRSLLHTVLKGFVGSIPFDTYVIMIVLMVCGLSLPAWFADLFRPL
FT                   SNANACVAMLMVGMMMDLPANRSDTFAVLKVLAWRLPFGLAFAAVAWFLLPFDAGIREA
FT                   TMMCCLAPVAVFSTLFTDEVLGNARLAGFTLSVSAVISLGMMTGAHAMIAAGII"
FT   gene            complement(356750..356834)
FT                   /locus_tag="BLA_t0008"
FT   tRNA            complement(356750..356834)
FT                   /locus_tag="BLA_t0008"
FT                   /product="tRNA-Leu"
FT   gene            complement(356892..356967)
FT                   /locus_tag="BLA_t0009"
FT   tRNA            complement(356892..356967)
FT                   /locus_tag="BLA_t0009"
FT                   /product="tRNA-Thr"
FT   gene            357084..358295
FT                   /locus_tag="BLA_0278"
FT   CDS_pept        357084..358295
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0278"
FT                   /product="mannose-1-phosphate guanylyltransferase"
FT                   /EC_number="2.7.7.22"
FT                   /EC_number="5.3.1.8"
FT                   /note="COG0836: Mannose-1-phosphate guanylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28580"
FT                   /db_xref="GOA:B8DVS9"
FT                   /db_xref="InterPro:IPR001538"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:B8DVS9"
FT                   /protein_id="ACL28580.1"
FT                   /translation="MSNGFDDFYAIIPAGGTGTRLWPLSREAKPKFLFDLLGSGRTLIQ
FT                   STFDRLAAIAGMDHVCISTGERHVDAVEEQMPEVAPEHIFAEPAPRDSTAAIALATAVL
FT                   ARRHGNDIVVGSFAADHVIRGKVAFVDAVRQAVATARAGYVTTIGIAASRPSTAFGYIH
FT                   EGESLAARVPDAPDAVLVERFVEKPNAATAQAYLNTGEYRWNAGMFVMRADVLLDHLHR
FT                   VKPQLARAIDAIADAVIEDDRDLARAQAEAHERGENVRETVNPDDFHAHRDEAMRKYWQ
FT                   GIEKIAFDYAVAEPLSVEGGVAMIPGDFGWDDIGDFNSVAALLPSVDERNLKILGNTEQ
FT                   VVTLDSAGDIVVPNSERTVALLGVNDMVVVDTPDALLITPRARSQEVKSMVKTLAESGC
FT                   DELL"
FT   gene            358585..360282
FT                   /gene="pgi"
FT                   /locus_tag="BLA_0279"
FT   CDS_pept        358585..360282
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pgi"
FT                   /locus_tag="BLA_0279"
FT                   /product="glucose-6-phosphate isomerase"
FT                   /EC_number="5.3.1.9"
FT                   /note="COG0166: Glucose-6-phosphate isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28581"
FT                   /db_xref="GOA:B8DVT0"
FT                   /db_xref="InterPro:IPR001672"
FT                   /db_xref="InterPro:IPR018189"
FT                   /db_xref="InterPro:IPR023096"
FT                   /db_xref="InterPro:IPR035476"
FT                   /db_xref="InterPro:IPR035482"
FT                   /db_xref="UniProtKB/TrEMBL:B8DVT0"
FT                   /protein_id="ACL28581.1"
FT                   /translation="MAINPPVDATGTAAWKKLQQHYDELQAQGIDLKQWFEDDPTRVDS
FT                   LSFDVGTLRFDFSKNLIKPETLALFAELADEVNLKQRTKDMYSGVHINNTEDRAVLHTA
FT                   LRRDASDEGKLIVDGQDVVKDVRETLDRMYAFADKVRSGEWKGVTGKEIETVVNIGIGG
FT                   SDLGPVMVYEALKPYADAGIKARYISNIDPNDLAEKTRDLDPETTLFVVVSKTFGTLET
FT                   LTNARQARAWLLEQLQASGAIDGTAEQKAEAVEKHFVAVSTNLERVKDFGIDPANAFGF
FT                   WDWVGGRYSVDSAVGLTLAIVFGPARFEEFLAGFRQVDQYFAETPFEKNAVVIMGMINV
FT                   WYRNFFKVASHAVLPYDQYLHRFPAYLQQLTMESNGKSVRWDGTPVTTETGEIFWGEPG
FT                   TNGQHAFYQLIHQGTQLIPADFIAFANTPNPLKDGDQDMHELLLGNYFAQTKALAFGKT
FT                   ADEVRAEGTPEDIVPARVFSGNRPTTSIFGVRLDAFTLGELISLYEMVTFVEGTVWGID
FT                   SYDQWGVELGKQLAKQITPAISQNDEALAAQDASTRSLINFYRKVREF"
FT   gene            360606..360971
FT                   /gene="rplS"
FT                   /locus_tag="BLA_0280"
FT   CDS_pept        360606..360971
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplS"
FT                   /locus_tag="BLA_0280"
FT                   /product="ribosomal protein L19"
FT                   /note="COG0335: Ribosomal protein L19"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28582"
FT                   /db_xref="GOA:B8DVT1"
FT                   /db_xref="InterPro:IPR001857"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR018257"
FT                   /db_xref="InterPro:IPR038657"
FT                   /db_xref="UniProtKB/TrEMBL:B8DVT1"
FT                   /protein_id="ACL28582.1"
FT                   /translation="MVNAIEAFDAKHMKPADEIPAFRPGDTVDVNVKIQEGNNSRIQTF
FT                   TGVVIGRQGAGVRETFIVRKISFGTGVERRFPLHSPSIDSIKVVRRGRVRRAKLYYLRN
FT                   LRGKAARIVERRDNSAK"
FT   gene            361185..361910
FT                   /gene="lepB"
FT                   /locus_tag="BLA_0281"
FT   CDS_pept        361185..361910
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lepB"
FT                   /locus_tag="BLA_0281"
FT                   /product="signal peptidase I"
FT                   /EC_number="3.4.21.89"
FT                   /note="COG0681: Signal peptidase I"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28583"
FT                   /db_xref="GOA:B8DVT2"
FT                   /db_xref="InterPro:IPR000223"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR019758"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="UniProtKB/TrEMBL:B8DVT2"
FT                   /protein_id="ACL28583.1"
FT                   /translation="MDSSNEPMPQSPAPMETHGNRDAGAGNLDSAGTEQQLASTRGTAI
FT                   RDFFLWCAIPVAIVVLLRIFVFGMYVIPSRSMENTIMPGDRVITTKLSPRPVALKRGDI
FT                   VVFKDPSNWLASEETTYHSDYLIKRLIGMPGDTVECEGAGQPVKINGVAIDESAYVKPG
FT                   DQPSTFPFKVTVSEGHVFVMGDNRSNSADSRFHLNDAQHGQVPIRDIAGVAFARYWPLN
FT                   RISWLSNYSDVFANVPDAG"
FT   gene            361955..362731
FT                   /locus_tag="BLA_0282"
FT   CDS_pept        361955..362731
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0282"
FT                   /product="ribonuclease"
FT                   /EC_number="3.1.26.4"
FT                   /note="COG0164: Ribonuclease HII"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28584"
FT                   /db_xref="GOA:B8DVT3"
FT                   /db_xref="InterPro:IPR001352"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR022898"
FT                   /db_xref="InterPro:IPR024567"
FT                   /db_xref="UniProtKB/TrEMBL:B8DVT3"
FT                   /protein_id="ACL28584.1"
FT                   /translation="MAPSFALERQIAADGFDVIVGFDEVGRGSLAGPVMVGAAAFLARN
FT                   LDEAQTAMPQYLADSKTLTEHRRESLYEPLQAWVDGFAIGSASNAEIDAWGISHALGIA
FT                   ALRALDGVERALGMGSPGDSEIRGFDERCKYSGTWAYTKHSPQQHADGLHVGAILDGPN
FT                   DYISKALGTFEAPAVPMPAQVRTLVKADAQCASVAAAAVLAKVTRDRLMEQLARDHAEY
FT                   ARYGWERNKGYGSKAHREAIAQCGPSDLHRVSWHLA"
FT   gene            362979..363824
FT                   /locus_tag="BLA_0283"
FT   CDS_pept        362979..363824
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0283"
FT                   /product="ATP-binding protein of ABC transporter system"
FT                   /note="COG1136: ABC-type antimicrobial peptide transport
FT                   system, ATPase component"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28585"
FT                   /db_xref="GOA:B8DVT4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B8DVT4"
FT                   /protein_id="ACL28585.1"
FT                   /translation="MPYPDGAPMGGQSLALQGIDLVMDYNTSASGNPAATQPAAWQMGQ
FT                   PLALNHANFQLGEGERVAIMGPSGSGKSTLLHVLAGIMKPTAGQVLFRGANIDRIPDAE
FT                   RTRMRRQAFGFVFQSGQLLPELPAIENVALPLMLGGMAYSQATDQAAMWLERMGLRNLM
FT                   RNRPGQMSGGQMQRVAIARALCVNPAIIFADEPTGALDQNTGHEVMNLLMQAAAANNAA
FT                   VVLVTHDPNIAAYCDRTVSMRDGMILDAANRRAGMQRQPQNDAPAQAVQMGAQPQGALQ
FT                   "
FT   gene            363821..365245
FT                   /locus_tag="BLA_0284"
FT   CDS_pept        363821..365245
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0284"
FT                   /product="ABC-type antimicrobial peptide transport system,
FT                   permease component"
FT                   /note="COG0577: ABC-type antimicrobial peptide transport
FT                   system, permease component"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28586"
FT                   /db_xref="GOA:B8DVT5"
FT                   /db_xref="UniProtKB/TrEMBL:B8DVT5"
FT                   /protein_id="ACL28586.1"
FT                   /translation="MNTFALWRLFHRHMFHHDDEPDAPRDHTGLLAVIAFAAATAIFLT
FT                   VLGGLHGFIWRASPDHTVGCFFNDSACSTHANVSVNGEFYVVLAMFACVLLVVPFTTLA
FT                   GSAARLAATRRDERLAVLRLAGATTSQVVRLIALEAVGQAVIGSVLGIAGYFAVMPLIM
FT                   MLHFENHTFDFEQLWVGPWALIGTVVGVAALALVSALLTLRKVAITPLGVTARQGAAMP
FT                   GKWRVALFVVALVFGFAMLNNMNLVAGAGVAVAYGVVFAIIGGCFMLLNVIGSWVIAAV
FT                   AKSRAHRPKSAATMIAMRRILDNPKRAWRNVSGIALAVFIAGITAVCGALGTASGDADA
FT                   ETLMMMHDISLGGTLTLVFAAVLAAVSSGIMQSASVFDQADEYHMLMLEGTDALTLRKA
FT                   RFSEVLTPLNTVIVISAGCSLLLMLPLVGSMLSNPAVLLRCLFGIVLCYALVTVGAVSA
FT                   NHTATRLDSISRRRDD"
FT   gene            complement(365429..366370)
FT                   /locus_tag="BLA_0285"
FT   CDS_pept        complement(365429..366370)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0285"
FT                   /product="predicted permease"
FT                   /note="COG0679: Predicted permeases"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28587"
FT                   /db_xref="GOA:B8DVT6"
FT                   /db_xref="InterPro:IPR004776"
FT                   /db_xref="UniProtKB/TrEMBL:B8DVT6"
FT                   /protein_id="ACL28587.1"
FT                   /translation="MGGLISAMEGFCVIGIVIAAGYAAARLQIGGAQAQYVFNRLSFFI
FT                   ASPCLMFAILAQENITHLFDSTIIVAFCSAVGVGLVFLVLNRLFFHLKAPDATIGVLNS
FT                   LYLNSNNIGLPIATYILGNPALVAPILVMQQALFTPVGLTVLDVTTKGKFSVKQVLKQP
FT                   LHQPLLIGTVLGIIVSVVSSKVGHFIVPNFLFDPIDMIGDSAVPMILMAFGMSLHGTKP
FT                   MQNKSNLPAIWTVAALKNIVMPLIAFGIAFAMGFRGPTLYGCVVLAALPTGQNVYNYAA
FT                   RYNVGMTFARDGILISTMTSPIVIAIIAALLS"
FT   gene            366593..367804
FT                   /gene="dapE"
FT                   /locus_tag="BLA_0286"
FT   CDS_pept        366593..367804
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dapE"
FT                   /locus_tag="BLA_0286"
FT                   /product="succinyl-diaminopimelate desuccinylase"
FT                   /EC_number="3.5.1.18"
FT                   /note="COG0624: Acetylornithine
FT                   deacetylase/Succinyl-diaminopimelate desuccinylase and
FT                   related deacylases"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28588"
FT                   /db_xref="GOA:B8DVT7"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR010174"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:B8DVT7"
FT                   /protein_id="ACL28588.1"
FT                   /translation="MIDRAGEPLKLTVDAGVGEQAALTDLCMQVMRVYSVSDDETHLTD
FT                   MTEAFLRTLPHLDVQRHGDTLVARTNLGRDRRVVLAGHLDVVPVIDNFPPKLLEPGDPL
FT                   ILPGVAEAHPGERVVWGRGATDMKSSDAVLLYLAATLTNPKYDLTYVFYDHEEVAAEKN
FT                   GLRKVAEAHPDWIAGDFAIIGEPTSCGIEGGCNGTIRFDVVTHGIAAHSARAWMGHNAI
FT                   HDAAEILRRLNEHTDATVSVDGLVYREGLNATLISGGKGTNVIPDECRVHVNYRFAPDK
FT                   SLAEAKALMMGADCGAELGNGEHQATGGVFEGFGIEMKDESPSARPGMDSELTRSLAAL
FT                   AKARTGKDPEAKLGWTDVARFSQLGVPAVNFGAGSPLLAHKHDEQVAEGELTLMAGILR
FT                   DWLS"
FT   gene            368367..371453
FT                   /gene="rne"
FT                   /locus_tag="BLA_0287"
FT   CDS_pept        368367..371453
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rne"
FT                   /locus_tag="BLA_0287"
FT                   /product="ribonuclease G"
FT                   /note="COG1530: Ribonucleases G and E"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28589"
FT                   /db_xref="GOA:B8DVT8"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004659"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019307"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/TrEMBL:B8DVT8"
FT                   /protein_id="ACL28589.1"
FT                   /translation="MPDLTENGLGSPEFDNTDTTNTTNDSTPTRRRRGRRVVRGAGEAG
FT                   AQMQLEVHDRVPLFQEPSAAIEAGKPTKALPAGSHEEESAESGDSNEPTATRRRSRRAS
FT                   TSTRSRSTRTTNDEAEEPTTTRSRRGRGAAQNDDEEPTVHTRRRSRAQADEAEEPRSTH
FT                   SRRSRRTVSDESEQTNDDSYESRTQHVLDALDESFDDDAETHETGRGRSRSRSRSTSRS
FT                   RTSRREVLEDADQHESADVENDEEESSARGNRRAGRPMTSLLFQEPVLPARSRSTHDEE
FT                   NDEGSDDEPLHDLDLNEGSTRSRKRSRNRRLNAQERRAAAEVEQIEEDLVLDDIVYAPI
FT                   DDETGKSGDESDSEESGIHTRRRRRRKSQENANAEREESENEEGTRTRRRSRAEDEEEN
FT                   DESTVTRRRRRRRNSKGGEEEEQPRRSRKQQYIDEITDVEGSTRLEAKKQRRRDNRRER
FT                   SRQNQLLEQDFLARRENVDRLMVVRERGRHTQISVIEDNVLVEHYVSDIQEVATVGNIY
FT                   LGRVQNVLPSMEAAFVDIGQARNGVLYAGEVNWDATRLEGQPRRIELAFKSGDPVLVQV
FT                   TKDPIGHKGARLTSQVTLAGRFLVLVPSGGMTGVSRKLSDRERNRLKSIVSKIAPKDMG
FT                   VIIRTAAEGASEEAIAKDLEGLTNQWAEIQRKREEFLHGKRPKLLQGEPDVAIRVVRDI
FT                   FNDDFNKMIVEGDGVYHRIEEYLDHMAPDLHNKLERWDPEEHGGKDVFDRWQIDSQLRK
FT                   GMERQVYLPSGGSIVIDRTEAMTTIDVNTGRFIGKGKSLEETVTRCNLEASEEIARQLR
FT                   LRDIGGMVMIDYVDMVMPANRDLVLRRLVECLARDRTKHQVAEVTSLGLVQMTRKRIGQ
FT                   GLVEAFSEECPECKGRGFIVHDEPTISAEFDDPYAMKGGDPFVRTNKHGHGTPEVHAPK
FT                   GSSAAVKAKLAQIAAAAVAANVAAEAEESVEAPAADTTEETAKVDVAVESTVESAAESA
FT                   GNAGDTERVEQVEGEVIDDAEQSADDAAAVTVEDAAEES"
FT   gene            372441..372749
FT                   /gene="rplU"
FT                   /locus_tag="BLA_0288"
FT   CDS_pept        372441..372749
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplU"
FT                   /locus_tag="BLA_0288"
FT                   /product="ribosomal protein L21"
FT                   /note="COG0261: Ribosomal protein L21"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28590"
FT                   /db_xref="GOA:B8DVT9"
FT                   /db_xref="InterPro:IPR001787"
FT                   /db_xref="InterPro:IPR018258"
FT                   /db_xref="InterPro:IPR028909"
FT                   /db_xref="InterPro:IPR036164"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8DVT9"
FT                   /protein_id="ACL28590.1"
FT                   /translation="MYAIVKAGGHQEKVEVGDTILVNRLDAKNGETVEFPVALVVDGEK
FT                   VIIAAADLAKISVKAEVVNDDAKGPKIRIQKFKNKTGVARRKGHRQKLTQLKITAIA"
FT   gene            372789..373040
FT                   /gene="rpmA"
FT                   /locus_tag="BLA_0289"
FT   CDS_pept        372789..373040
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmA"
FT                   /locus_tag="BLA_0289"
FT                   /product="ribosomal protein L27"
FT                   /note="COG0211: Ribosomal protein L27"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28591"
FT                   /db_xref="GOA:B8DVU0"
FT                   /db_xref="InterPro:IPR001684"
FT                   /db_xref="InterPro:IPR018261"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8DVU0"
FT                   /protein_id="ACL28591.1"
FT                   /translation="MAHKKGASSSRNGRDSNPQYLGVKKFGGEAVVAGNIIVRQRGTKF
FT                   HAGKNVGVGKDHTLFALADGNVQFGVRRDRKVVDVVTE"
FT   gene            373225..374937
FT                   /locus_tag="BLA_0290"
FT   CDS_pept        373225..374937
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0290"
FT                   /product="GTP-binding protein Obg/CgtA"
FT                   /note="COG0536: Predicted GTPase"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28592"
FT                   /db_xref="GOA:B8DVU1"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR006074"
FT                   /db_xref="InterPro:IPR006169"
FT                   /db_xref="InterPro:IPR014100"
FT                   /db_xref="InterPro:IPR015349"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031167"
FT                   /db_xref="InterPro:IPR036346"
FT                   /db_xref="InterPro:IPR036726"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8DVU1"
FT                   /protein_id="ACL28592.1"
FT                   /translation="MSDFVDRVTVHVKGGDGGNGSAGIRREKYKPLAGPNGGNGGKGGS
FT                   VILKADQNATSLLDFRFMPHRTADSGTMGLGDTKDGSNGADLVLPVPVGTVVFEARGAQ
FT                   GFPKKPGAVLADLRHAGDTYVAAAGGAGGLGNAALANRTRRAPGFALLGEPGDERDIIL
FT                   ELKSIADVALVGFPSAGKSSLIAAMSAAKPKIADYPFTTLVPNLGVVQAGDMRYTIADV
FT                   PGLIPGASQGKGLGLTFLRHIERTEIIAHVIDCVTIDPDRDPLSDYYALEKELGEYADD
FT                   LDLPLGAIPIPERPRVIILNKIDVPDAKELADFVRPEFEKLDLPVYEISTASHAGLKEL
FT                   NFALAKLVKEMRAQIAEREESVDEERVVIKPLEEPGTQRRNGRNAQVREFEIEREDDGH
FT                   GNFWFTVTGVKPERWVRQTNFDNDEAVGYLADRLAKLGVEDSLRKHGAHAGDEVRIGRG
FT                   ERAVAFDWDPTIAAGAEMLDGTQLGSRGKDLRLEEEDGRKRRRTNSERRREYHEMMDAR
FT                   AAVRAAMQAERAAGHWADPSIDDDRHDEQSLFGRGEVEEYEDEPGADGSRQLD"
FT   gene            374998..376131
FT                   /gene="proB"
FT                   /locus_tag="BLA_0291"
FT   CDS_pept        374998..376131
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="proB"
FT                   /locus_tag="BLA_0291"
FT                   /product="glutamate 5-kinase"
FT                   /EC_number="2.7.2.11"
FT                   /note="COG0263: Glutamate 5-kinase"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28593"
FT                   /db_xref="GOA:B8DVU2"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001057"
FT                   /db_xref="InterPro:IPR002478"
FT                   /db_xref="InterPro:IPR005715"
FT                   /db_xref="InterPro:IPR011529"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR019797"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR036974"
FT                   /db_xref="InterPro:IPR041739"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8DVU2"
FT                   /protein_id="ACL28593.1"
FT                   /translation="MQTPSQEEVRRAVAAARTVVVKVGSSSLTQPSGHLDVDKLNALVG
FT                   AIAQVRMLGGNIVLVSSGAIAAGFGPLGFESRPTDVATQQATASVGQGLLMAQYEMAFG
FT                   RYGIRVGQLLITAEDTMQPRQYRNARRTMAKLLELGVVPIVNENDALASNEIRFGDNDR
FT                   LSALIANMVRADALILLTDVDALYTAPPSEPGSHRIGFVPNITELLDQVRVGGSESGVG
FT                   TGGMVTKLEAARMAAVSGIPAVLTAARNAGPALMGDEVGTAFAPVKQRGSARRLWIKFA
FT                   AHPRGVLVADSGAAKAVRGGRASLLAAGVLESRGDFAAGDPVWIDDEAGNHLARGLAGY
FT                   DSEEIPNMLGRNTAQLRRLLGEEYAHPLVHRDNLVLV"
FT   gene            376245..377462
FT                   /gene="aspC"
FT                   /locus_tag="BLA_0292"
FT   CDS_pept        376245..377462
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aspC"
FT                   /locus_tag="BLA_0292"
FT                   /product="aspartate aminotransferase"
FT                   /EC_number="2.6.1.1"
FT                   /note="COG0436: Aspartate/tyrosine/aromatic
FT                   aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28594"
FT                   /db_xref="GOA:B8DVU3"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:B8DVU3"
FT                   /protein_id="ACL28594.1"
FT                   /translation="MPTDQTRLPLSNRIDKVAPSATLAVDMKAKAMKAQGIDIIGFGVG
FT                   EPNFATPEAIVEAAAAAVVNPANYKYSPTPGLPELRQAIASKTLRDSGYEVEPEQVVVT
FT                   NGGKQAVYEAFQLIVNDGDEVIIPSPYWTSYPEMVKLAGGKPVEVFAGADVNYEPNLDD
FT                   IEAARTDRTKAIIVTSPNNPTGAVWSERTIRDIAEWALDHNIWVISDEIYEHLTYDGVK
FT                   TTHIGAAVPQIREQLIVLDGVAKTYAMPGWRVGWMVAPLAVAKAASKLQGHMTSNVNNI
FT                   AQRAAIEAVSGPLDAVAMMRDAFNVRRLAIVAALNDINGVHCPMPEGAFYAFPNVEGLL
FT                   NRPMGPNGTTFTTSAELAEALLEEGHVAAVPGEAFGAPGYMRFSYAVADEEITEGMRRF
FT                   KEWAEA"
FT   gene            377609..377684
FT                   /locus_tag="BLA_t0010"
FT   tRNA            377609..377684
FT                   /locus_tag="BLA_t0010"
FT                   /product="tRNA-Trp"
FT   gene            377725..377955
FT                   /gene="secE"
FT                   /locus_tag="BLA_0293"
FT   CDS_pept        377725..377955
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secE"
FT                   /locus_tag="BLA_0293"
FT                   /product="preprotein translocase, SecE subunit"
FT                   /note="COG0690: Preprotein translocase subunit SecE"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28595"
FT                   /db_xref="GOA:B8DVU4"
FT                   /db_xref="InterPro:IPR001901"
FT                   /db_xref="InterPro:IPR005807"
FT                   /db_xref="InterPro:IPR038379"
FT                   /db_xref="UniProtKB/TrEMBL:B8DVU4"
FT                   /protein_id="ACL28595.1"
FT                   /translation="MARKTDHGEEVIKPNVFMRIGLFIKQIIDELRKVVTPTRKQLFYW
FT                   SLAVFIFVALLMVFVTAMDFGLGKLSFLIFG"
FT   gene            378086..379078
FT                   /gene="nusG"
FT                   /locus_tag="BLA_0294"
FT   CDS_pept        378086..379078
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nusG"
FT                   /locus_tag="BLA_0294"
FT                   /product="transcription termination/antitermination factor
FT                   NusG"
FT                   /note="COG0250: Transcription antiterminator"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28596"
FT                   /db_xref="GOA:B8DVU5"
FT                   /db_xref="InterPro:IPR001062"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR006645"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR015869"
FT                   /db_xref="InterPro:IPR036735"
FT                   /db_xref="UniProtKB/TrEMBL:B8DVU5"
FT                   /protein_id="ACL28596.1"
FT                   /translation="MTDEVNLENIDDLPINLDAVSADDNTADAQEVQIDQVEAASESED
FT                   IAEGMAYDAVSAGDDAQPSDQAAAQEDSLTDSVDDSAAVDSDAHSEGTADEDTQHADAE
FT                   EAAADEAPEAAAEAEEEAEEDAGSKAVKEFSKSLRTLEGKWYVLHTYSGYEKRVKSNIE
FT                   SRVQSFGLEDTIFQVEVPMEEVEKHTEKGKKVVTRVRVPGYVLIRMYPDENARRIVRET
FT                   EGVTGFVGPSREPAPLSRKEVVSMMAPMIASHALKEAGDKPAAAKKRTLEVSYKVGDQV
FT                   TVTDGPFTSMSAVVSDVEPATQKLTVLVSIFGRDTPVELGFDQVQRLDA"
FT   gene            379474..379752
FT                   /gene="rplK"
FT                   /locus_tag="BLA_0295"
FT   CDS_pept        379474..379752
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplK"
FT                   /locus_tag="BLA_0295"
FT                   /product="50S ribosomal protein L11"
FT                   /note="COG0080: Ribosomal protein L11"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28597"
FT                   /db_xref="GOA:B8DVU6"
FT                   /db_xref="InterPro:IPR000911"
FT                   /db_xref="InterPro:IPR020783"
FT                   /db_xref="InterPro:IPR020785"
FT                   /db_xref="InterPro:IPR036769"
FT                   /db_xref="InterPro:IPR036796"
FT                   /db_xref="UniProtKB/TrEMBL:B8DVU6"
FT                   /protein_id="ACL28597.1"
FT                   /translation="MGQVIPVEITVYEDRSFDFVLKTPPASDLLKKAAGVAKGASNPLT
FT                   DKVGSVTKAQVKEIAETKMADLSARDIDAAMKIIEGSARSMGITVND"
FT   gene            379772..380461
FT                   /gene="rplA"
FT                   /locus_tag="BLA_0296"
FT   CDS_pept        379772..380461
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplA"
FT                   /locus_tag="BLA_0296"
FT                   /product="ribosomal protein L1"
FT                   /note="COG0081: Ribosomal protein L1"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28598"
FT                   /db_xref="GOA:B8DVU7"
FT                   /db_xref="InterPro:IPR002143"
FT                   /db_xref="InterPro:IPR005878"
FT                   /db_xref="InterPro:IPR016095"
FT                   /db_xref="InterPro:IPR023673"
FT                   /db_xref="InterPro:IPR023674"
FT                   /db_xref="InterPro:IPR028364"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8DVU7"
FT                   /protein_id="ACL28598.1"
FT                   /translation="MAKHSKKYREAAERIDRNNLYTPEEAIALLKSMPAYNFDQTVEAV
FT                   LRLNVDPRKADQLVRGSVNLPNGTGKTAKVLVFARGPKATEALEAGADIVGDDDLVEKV
FT                   ANGFLDFDSVVATPDMMGKVGRLGRVLGPRGLMPNPKTGTVTMDVTKAIKDIKGGKVDF
FT                   RVDKNGNLSFLFGKLSFSAEALDQNFRAVADEVKRLKPATVKGRYITKATISSTMNPGI
FT                   PVDPASI"
FT   gene            380584..381375
FT                   /locus_tag="BLA_0297"
FT   CDS_pept        380584..381375
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0297"
FT                   /product="putative regulator of polyketide synthase
FT                   expression"
FT                   /note="COG2508: Regulator of polyketide synthase
FT                   expression"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28599"
FT                   /db_xref="InterPro:IPR025736"
FT                   /db_xref="InterPro:IPR042070"
FT                   /db_xref="UniProtKB/TrEMBL:B8DVU8"
FT                   /protein_id="ACL28599.1"
FT                   /translation="MTKFEHADILDLLGGDIDDNAVMRLVFECLISGIDDDRVVSLMNL
FT                   IGWRGSFSCFALGGTPADSMGATFTQISSAVRDFGGSHAIFGMYGRFVIACIELEAAVS
FT                   PEIVCTAALPAFAQSEAVYLSPVREGVPGASHAVRETLFSLQAAPSLSTQSRPLRADEL
FT                   LPERALLGDEVAREELYRNVYLVLHGDNEDDPSYITVSTFLRHGGSLEATAKELNVHPN
FT                   TVRYRLKKAAETTGWDATNPRDAFVLNTAIALGRMREAGVR"
FT   gene            381433..382329
FT                   /locus_tag="BLA_0298"
FT   CDS_pept        381433..382329
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0298"
FT                   /product="biotin acetyl-CoA-carboxylase synthetase"
FT                   /EC_number="6.3.4.15"
FT                   /note="COG0340: Biotin-(acetyl-CoA carboxylase) ligase"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28600"
FT                   /db_xref="GOA:B8DVU9"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="InterPro:IPR004408"
FT                   /db_xref="UniProtKB/TrEMBL:B8DVU9"
FT                   /protein_id="ACL28600.1"
FT                   /translation="MTTELNGDYRRAREKAHVISLDTVTSTNDYAAQLVADGRLDRNGM
FT                   TIVLAREQTQGRGRLDHTWVSVPGKSFIASVICIVNADTAKDPQVNGWLQMIAGMSVID
FT                   ALRETVMSANMDWLDHTRGNPSMRSELQLKWPNDIVYQGMKLGGILAQLVQIPGDENSV
FT                   AIIFGVGLNLDLAPDQLPTAQSTSLQLIASCVNGAACVPADQLADMIAAGLVNALSKRL
FT                   WYFGENPAGYAQNLHRRIAEECWTLGKPVLVHRTDGTTLTGEAVAINEDASLSVRDDSG
FT                   QVHVVRTGDVGVLPVED"
FT   gene            complement(382351..382968)
FT                   /locus_tag="BLA_0299"
FT   CDS_pept        complement(382351..382968)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0299"
FT                   /product="BioY family protein"
FT                   /note="COG1268: Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28601"
FT                   /db_xref="GOA:B8DVV0"
FT                   /db_xref="InterPro:IPR003784"
FT                   /db_xref="UniProtKB/TrEMBL:B8DVV0"
FT                   /protein_id="ACL28601.1"
FT                   /translation="MHSVTRVNLRSLVRTLAPSLIVALLLCGSTMAGKIPVPGTPVPIT
FT                   LQTFVLMTAALTLGWRRATAGTVLYLGLGAAGLPVFSGGGSTLSLIGPSGGFLFGFVPS
FT                   VMLTAVLAGTANRAITSLRTKHDMHPALAGAARFIACFMACAFGFLIAGYGFGAAFQST
FT                   VTGMPLGITAASTLVFVPGDLIKIAVASLLALPVLASADSAR"
FT   gene            383276..385150
FT                   /gene="jadJ"
FT                   /locus_tag="BLA_0300"
FT   CDS_pept        383276..385150
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="jadJ"
FT                   /locus_tag="BLA_0300"
FT                   /product="JadJ"
FT                   /EC_number="6.3.4.14"
FT                   /note="COG4770: Acetyl/propionyl-CoA carboxylase, alpha
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28602"
FT                   /db_xref="GOA:B8DVV1"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005481"
FT                   /db_xref="InterPro:IPR005482"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR011764"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:B8DVV1"
FT                   /protein_id="ACL28602.1"
FT                   /translation="MTDTVSKLLIVNRGEIALRVVRTAREMGIPTVVVYAEQDRHSQYV
FT                   KMADEAFLLSGDTYADTYLNEDLLIDILRRSGADAVHPGYGFLSEVPSFADKVIEAGAT
FT                   WVGPSSRALTDLGDKISARRVAVYAKVPPVPGISHSLGDMRVLLDFAHTHGYPLMLKRA
FT                   DGGGGRGITLVRDDDELRGFYLNHNAVQGGDLDEYFVERFIDHGRHVETQCGRDSHGNF
FT                   TVYSTRDCSVQRRNQKLIEEAPAPFLGDDVVEQLHAYSHRLFDAVDYVGLGTCEFMVTD
FT                   AGKVYFLEVNPRLQVEHTVSEEVSGLDLVREQLQIAAGGKVSPEPTARGHSFELRITSE
FT                   DPKTNLTPSSGTLERVQWPAGPGVRVDSGVVEGDTISPKFDSMMGKLIVTAHSRQAAVA
FT                   RVRRALDELRIEGVPTPVELYRQVFGDDEFTAEHGHGFDVSTKWLERKYLNHEPATVHG
FT                   GQPASLDAGAGAAEPELDHSEQFVIEMNNRRVVLNVPSDMFANLTGAARSHGERRPTQP
FT                   LRGQGSHHVDRGNARTAERPGVISAPMQALVTRINVSEGQQVAKGDLLVVLESMKMENY
FT                   VYSPANGTVKEIFASPATGVEAGETLLTMEVAGTSKPANPTTDTTEEA"
FT   gene            385152..386783
FT                   /gene="pccB"
FT                   /locus_tag="BLA_0301"
FT   CDS_pept        385152..386783
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pccB"
FT                   /locus_tag="BLA_0301"
FT                   /product="propionyl-CoA carboxylase beta chain"
FT                   /EC_number="6.4.1.3"
FT                   /note="COG4799: Acetyl-CoA carboxylase, carboxyltransferase
FT                   component (subunits alpha and beta)"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28603"
FT                   /db_xref="GOA:B8DVV2"
FT                   /db_xref="InterPro:IPR011762"
FT                   /db_xref="InterPro:IPR011763"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR034733"
FT                   /db_xref="UniProtKB/TrEMBL:B8DVV2"
FT                   /protein_id="ACL28603.1"
FT                   /translation="MIDSIDANLAAVEAADAAAANGADAQGAMRQPIRPAVTKAAELAR
FT                   DAENRARDRQHVKGKFTARERLDLLLDSGTFEEIGRFRGGDINKGVAGSAVITGFGEVW
FT                   GRKVAVYAQDFSVRGGSLGVAEGRKICHLMDQALALRVPIIALIDSGGARIQEGVAALT
FT                   EYGNIFRKTCEASGFVPQLSLILGPCAGGAVYCPALTDLIIMTRENSNMFVTGPDVIKA
FT                   STGESISMDDLGGGIVHNVKSGVAHYLGADEADAIDYARTVLAYLPANSGQTAPRYAYM
FT                   ATRADRDIAERLGTVVPGNERQPYDVLDVIRCLVDYGEFVQVHELFAQSAVVGFACMDG
FT                   QPVGIVANQPNVNAGALDVDSSEKVARFVRLCDAFNLPIITLVDTPGYKPGAEQEHAGI
FT                   IRRGAKVIYAYANAQVPLVTVIMRKAYGGAYIVMGSKAIGADLNYAWPTSQIAVLGAAG
FT                   AVNIIHRKDLQKAKDAGRDVEAVRAKYIAEYEETTVNANLSMEIGQVDAMIDPEQTREV
FT                   LVDSLKTLASKRRVSRTGKHHGNQPL"
FT   gene            386917..396234
FT                   /gene="fas"
FT                   /locus_tag="BLA_0302"
FT   CDS_pept        386917..396234
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fas"
FT                   /locus_tag="BLA_0302"
FT                   /product="probable fatty acid synthase Fas"
FT                   /note="COG4982: 3-oxoacyl-acyl-carrier protein reductase"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28604"
FT                   /db_xref="GOA:B8DVV3"
FT                   /db_xref="InterPro:IPR001227"
FT                   /db_xref="InterPro:IPR002539"
FT                   /db_xref="InterPro:IPR003965"
FT                   /db_xref="InterPro:IPR013565"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR014043"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR018201"
FT                   /db_xref="InterPro:IPR020801"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="InterPro:IPR032088"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B8DVV3"
FT                   /protein_id="ACL28604.1"
FT                   /translation="MSTPEFFVNRLNSEPHALMFAGQSTPWVVAVKQLMDDPELAQRLI
FT                   DHVAAAHDLLTPVSAQLLATTGRETDLFSFEANPAKLGPAADATASIEGIALAQLGALL
FT                   DLDQLGYTLASANPVALLGHSQGILGVHMAQAIIDAGSIEAARPQIDEILAIAALIGAA
FT                   GTREARAHGLVRKYGDATPMLSVKGILPAQADELIRRVDDARGPIAVAVINSANHVVLS
FT                   GHPQDLASFAVEVAKEHKHQAQLRAEKVRGGSVFDPVLEYLEVTLPFHSPIMEQAVEQT
FT                   VAWAEECGIDVARARVLAGEVLVNQVDWSAQVANLFKENDPRTLWAVDLGPGTTLAKLF
FT                   GTVAEGTGVGVVEAANVADRAKLATETDAPARMQDWTQYVPQVVRTLQGERIETAFTRL
FT                   TGKPPVLLAGMTPTTVDPEIVAAAANAGYWAELAGGGQVTADVFDRHVAELEEQLDEGR
FT                   TVEFNAMFMDRYLWNLQFGTSRIVPKKRASGAPIDGVVISAGIPEPDEAVALVKELNAE
FT                   GFPYVCFKPGTVDQIRQVVRIAKAVAPANILVQVEGGSAGGHHSWESLDDLLLNTYAQV
FT                   REQSNLVLVVGGGIGTPERAADYISGEWSTRYDHPLMPVDGVLVGTAVMTAKEAHTSPE
FT                   VKQLLVATPGIADAGSDAAADVFAPLGEAWVPSGKAVGGVSSGLSHLHADIYELENASA
FT                   RCGRLLVRVMKHPEELESRRQEIIDALNETAKPYFGDLSGMTYEDWARRFAELSFPWAD
FT                   GTYADRYLHLLQRIEARVIDLEQGEFTPMFSTRADVESDPFAALAALVEAYPQMGELKV
FT                   VPTDEAWFIELVREYPKPMPFVPAIDNDLLRWWGQDQLWQSEDPRYSADSVRIIPGPIS
FT                   VAGITTVDEPVADILGRFSDAMTARVASNAASRTDRFALLADCEDAEDFIRRSPNISWI
FT                   GHQMANPAFGTARGDANYELKHLGRDEQAGVEQFDLDIHLDTFWDDDPDGGLSKHAVRD
FT                   IVIPLNVTLDATGMIPVVDRERLPEHVYRMLADTAGIGNTAITGDKLEAMPQITEVADT
FT                   ETFPFGQAHAGYTLSANLGFDHEAATGGALPMDLTPSRIAPDALVGPAWPAIYAALGSV
FT                   MVDGYPVIEGLLNAVHLDHLIELEVSEDELLAHTGEEISLTGWAEPYFESASGRVVTIH
FT                   VRHTAADGTVLANETERFAIRGRAYNDALPAAAPDFGGIDEQIVSTPRRMLRRVNVRAP
FT                   HEMTAFARTSGDFNPIHTSHRGAAISGLTQPLVHGMWLSATAQHAVQALDEQGAHYEIA
FT                   GWTYNMYGMVQLDDEVEISIERIGRVAHAGLVLEVTCRIDGSIVSRATAIARAPISAFV
FT                   YPGQGIQQQGMVLDERAKSPAARDVWERADRLTRERLGFSILAVVRDNPKELTANGVTY
FT                   RHPEGLLNLTQFTQVALATVAFAQTARMQEAGADIRPSYFAGHSLGEYNALSSFAHVIP
FT                   LETVLELVFHRGSTMHHLIDRDAQGRSNYRMGALRPNQFGVDDAHVKEYVESVAKASGE
FT                   FLEIVNYNLAGQQYAIAGTIAGLKALQADSARRVAEYGGKPAFILVPGIDVPFHSTLLR
FT                   KGVPEFRDKLDALLPAEIDYRGALEGLYIPNLVAAPFEMTKEFAQKILDVVPSERIAAA
FT                   LADDAVWDSYAADDQKLGRLLLTELLSWQFASPVRWIETQALLFGSAEQGGLGVEEIVE
FT                   VGLGNAPTLANLASKTLRLPEFSRRHVTVYNVGRDEGRVYMTDSDSLVPEVDDVRTPAA
FT                   DPAAPAQAVAAANASASVVVETAEPVAPVAPAGGVSGANVPDLDYRAHDAIEMLLSYAA
FT                   KVRPEQIGENDTTDTLTNGVSSRRNQLLMDISSELGVASVDGAAEASIRDLNALVDKVA
FT                   PNYKAFGPVLSDIVRDRVRSLFGAAGVKLPQITKRVTETWQLGEGWANHVVGQLVLATR
FT                   EGTSSRGGDLATLGTDAASNAAAANALIDAAVQAVAAAHSVQVAMPSAGGASGGVVDSA
FT                   ALDAYAQSVTGSDGVLAATARFVLGQLGLAEPNAVEAEDENAAIVATVEAELGSDWPAQ
FT                   VAPRFDERQAILFDDRWASAREDLARAYYNGETDAIAGDFTGAGAAVARQAAWYAQQSA
FT                   GSALAEQYERIAQQAMESTQSAHLEYDGEVAVVTGVAPNSIAAQVVNGLLAEGATVIAT
FT                   SHSFKPSVKAWAQRTYREHAQGDAKLWLVPANLSSYRDVDALVNWVGHVQKKTSGATTT
FT                   VLKPAYEPSLFFPFAAPPVHGSLADSGALFESQARLMLWGVERAIAGFAAIGADTDVQH
FT                   KLHVVLPGSPNRGVFGGDGAYGEVKSAFDAIVNRARSEQVWSNRVTFAHPKIGWVRGTG
FT                   LMGGNDPLVEVVERHGLKTYSTEQIAEELLKLTTAAAREQAQVAPLDVDLTGGLGSEPI
FT                   DIKALRAQALADAAPDAAEETSETEADAPIKALPSPRVPHQAAVDLAEWERVSAKPEDE
FT                   IVIVSIGELGPWGSGRTRAEAELGIHADGEVDLSAGAVLELAWNMGLLSWQDSPKPGWY
FT                   DTDGNLVPETDIAERYHDEVVAKSGVRPFETGMGSDYRSGTDEEEAEVYLDHDVTFGVP
FT                   TRQIADEYVAMDPEHTSLAQDGESGEWNVTRHAGSMIRVPRRAAMTRTVGGQFPDGFDP
FT                   LKWGIPASMVGDVDEIALWNIVTTVDAYLSAGFTPAEILEAVHPSMVASTQGTGFGGMS
FT                   SMRKLYLDRFLNHEIPTDILQEALPNVVAAHVMQSYIGGYGNMVQPVSACATAAVSLEE
FT                   GADKIALGKADFVVTGAIDDIGVESVIGFGNMNATANSQEMLDKGIAPRFFSRANDRRR
FT                   GGFVESQGGGTILLTRGDIALRLGLPVAGVVGFVHSYADGAHTSIPAPGLGALAAGMGG
FT                   RSSKLVRDLARLGVDPDDITVVSKHDTSTNANDPNESELHNTLAHAIGREDGNPLFVIS
FT                   QKSLTGHAKGGACIFQVNGITQLFKSGVIPANASLECVDPKLERDDLMVWLREPLHIGS
FT                   RHTVKAALATSLGFGHVSGFTAIVHPGAFEAAVEHTAGVEALKAWRARANERLAAGRRH
FT                   FEEGMMGRAALYEPIDNRRFHEDGRGYDAHEVEKAMLLDPDARLGADGYFA"
FT   gene            396470..396913
FT                   /locus_tag="BLA_0303"
FT   CDS_pept        396470..396913
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0303"
FT                   /product="holo-[acyl-carrier protein] synthase-like
FT                   protein"
FT                   /EC_number="2.7.8.7"
FT                   /note="COG0736: Phosphopantetheinyl transferase (holo-ACP
FT                   synthase)"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28605"
FT                   /db_xref="GOA:B8DVV4"
FT                   /db_xref="InterPro:IPR002582"
FT                   /db_xref="InterPro:IPR004568"
FT                   /db_xref="InterPro:IPR008278"
FT                   /db_xref="InterPro:IPR037143"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8DVV4"
FT                   /protein_id="ACL28605.1"
FT                   /translation="MLGLGHDVVDVGAFAEQLEMPGTRMTRLFSARECRQASLRASIKH
FT                   DGEALHLAAKWAAKESVVKAWCEALVGRGITERPYTVDDTPWSRIEIVDDATGCPRVVM
FT                   AAEVHVELCRSLAVTESAEPVWHVSISHDGGIASAVAVLDMRE"
FT   gene            396974..397047
FT                   /locus_tag="BLA_t0011"
FT   tRNA            396974..397047
FT                   /locus_tag="BLA_t0011"
FT                   /product="tRNA-Gly"
FT   gene            397126..397836
FT                   /locus_tag="BLA_0304"
FT   CDS_pept        397126..397836
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0304"
FT                   /product="membrane protein involved in the export of
FT                   O-antigen and teichoic acid"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28606"
FT                   /db_xref="GOA:B8DVV5"
FT                   /db_xref="UniProtKB/TrEMBL:B8DVV5"
FT                   /protein_id="ACL28606.1"
FT                   /translation="MPDSEQQEIARLRSEPAATPTTPSSAGVMAQNIVSKHPEATIPES
FT                   DISLADIERKQSNPVKWTVSIVLVLAALIAPFWVGRSFAVHSTARVIEQLGHFTSYGIA
FT                   LVSWGVTTMIFVSLIMMIVDNRRMAWFGSFIVFLSLEQFIGGLSLFKLNFWSSTYVIYG
FT                   SHAYVANAANLGVIASALALAVFAIVWVGLLVMIRKDSPLNVLTHVWVSFIMFLVFELA
FT                   ALAILFCGGFMAVA"
FT   gene            complement(397912..398883)
FT                   /gene="ldh"
FT                   /locus_tag="BLA_0305"
FT   CDS_pept        complement(397912..398883)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ldh"
FT                   /locus_tag="BLA_0305"
FT                   /product="L-lactate dehydrogenase"
FT                   /EC_number="1.1.1.27"
FT                   /note="COG0039: Malate/lactate dehydrogenases"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28607"
FT                   /db_xref="GOA:B8DVV6"
FT                   /db_xref="InterPro:IPR001236"
FT                   /db_xref="InterPro:IPR001557"
FT                   /db_xref="InterPro:IPR015955"
FT                   /db_xref="InterPro:IPR018177"
FT                   /db_xref="InterPro:IPR022383"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B8DVV6"
FT                   /protein_id="ACL28607.1"
FT                   /translation="MGICTKIGIVGMGHVGAHVANSLVLQGIADELYMTEICSGERDRS
FT                   KKLAAEVQDLGDSLAFCPHNVALHNCGDDYAQLAQCDVIVNCAGDVSLSSKDRDGELFF
FT                   TTDTAKTFIKTIADAGFHGIWITIANPCDVVATEIWKESGMDPRRIIGTGTALDSSRLK
FT                   YVLSRVTGYDQHSITAYMLGEHGNSQFAAWSNVYFGGKPLSQLAMEQPERFAFDYAELE
FT                   AEARKGGYVTYAGKHCTEFAVADAACRLVRAVISNEHYITACSTLLTGEYGEEGFFISL
FT                   PCVVGADGVEEVMRLDLSDAEIDEFRKSCAHVKENLARTHIL"
FT   gene            399191..399460
FT                   /gene="rpsO"
FT                   /locus_tag="BLA_0306"
FT   CDS_pept        399191..399460
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsO"
FT                   /locus_tag="BLA_0306"
FT                   /product="ribosomal protein S15"
FT                   /note="COG0184: Ribosomal protein S15P/S13E"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28608"
FT                   /db_xref="GOA:B8DVV7"
FT                   /db_xref="InterPro:IPR000589"
FT                   /db_xref="InterPro:IPR005290"
FT                   /db_xref="InterPro:IPR009068"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8DVV7"
FT                   /protein_id="ACL28608.1"
FT                   /translation="MALTAEEKQDIIAKYATHEGDTGSPEVQIALLTKRIADLTEHLKF
FT                   HKHDHHSRRGLLLMVGDRRRLLDYLKKVDIERYRSLIERLGLRR"
FT   gene            399802..402423
FT                   /gene="gpsI"
FT                   /locus_tag="BLA_0307"
FT   CDS_pept        399802..402423
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gpsI"
FT                   /locus_tag="BLA_0307"
FT                   /product="guanosine pentaphosphate synthetase
FT                   I/polyribonucleotide nucleotidyltransferase"
FT                   /EC_number="2.7.7.8"
FT                   /note="COG1185: Polyribonucleotide nucleotidyltransferase
FT                   (polynucleotide phosphorylase)"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28609"
FT                   /db_xref="GOA:B8DVV8"
FT                   /db_xref="InterPro:IPR001247"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR004088"
FT                   /db_xref="InterPro:IPR012162"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014069"
FT                   /db_xref="InterPro:IPR015848"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR027408"
FT                   /db_xref="InterPro:IPR036345"
FT                   /db_xref="InterPro:IPR036456"
FT                   /db_xref="InterPro:IPR036612"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8DVV8"
FT                   /protein_id="ACL28609.1"
FT                   /translation="MEGPEIKAVEAVIDNGSFGRRTVRFETGRLARQADGAVAAYLDDD
FT                   SMVLSTTTAGSSPKENYDFFPLTVDVEEKMYAAGKIPGSFFRREGRPSSEAILACRIID
FT                   RPLRPLFPHTLRNEVQVVETVLAVNPEDSYDVLALNAASASTLISGLPFTGPVGGVRLA
FT                   LIDGQWVAFPRWSERERAVFEIVVAGRVVESGDVAIAMIEAGAGKNAWNLIYDEGQQKP
FT                   DEEVVAGGLEAAKPFIKVLCDAQNELKRLAAKETREFTLFPEYTDDLYNRIDEIAHADL
FT                   DEALSIAEKLPRQERIAEIKQRVKDTLSVEFTDMDEMEKDKEIGNAFKELQRQIVRRRI
FT                   LTQDYRIDGRGLRDIRTLSAEIDVVPRVHGSALFQRGETQILGITTLNMLKMEQQIDAL
FT                   SGPTTKRYMHNYEMPPYSTGETGRVGSPKRREIGHGALAEKAIVPVLPSREEFPYAIRQ
FT                   VSEAIGSNGSTSMGSVCASTLSLLAAGVPLKAPVAGIAMGLVSGDVDGQHIYKTLTDIL
FT                   GAEDAFGDMDFKVAGTADFITALQLDTKLDGIPADVLAGALKQAHEARKTILEVINECI
FT                   DGPAEMSPFAPRIITTTVPVDKIGEVIGPKGKMINQIQEDTGAEIAIEDDGTVYISSEG
FT                   GEAAEKAKQIIDEIANPHVPQAGETYKGTVVKTTSFGAFVNLTPGIDGLLHISQIRNLA
FT                   DGQRIDAVEDVLKEGDSVEVVVQGVDDRGKISLAIPGFENQENNAGGRRSDDRPRRDDR
FT                   RHSDDRRRDDRPRRRSDDRDRDYDDRPRRRRDYDDDRDYDDRPRRRSHRDYDDDRDYDD
FT                   RPRRSDRRRDYDDDRPRRRRNDDRNPRYVADENYDEYREGREVRHERPRRRVRRDFDPF
FT                   DD"
FT   gene            402712..403287
FT                   /gene="lemA"
FT                   /locus_tag="BLA_0308"
FT   CDS_pept        402712..403287
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lemA"
FT                   /locus_tag="BLA_0308"
FT                   /product="LemA-like protein"
FT                   /note="COG1704: Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28610"
FT                   /db_xref="GOA:B8DVV9"
FT                   /db_xref="InterPro:IPR007156"
FT                   /db_xref="InterPro:IPR023353"
FT                   /db_xref="UniProtKB/TrEMBL:B8DVV9"
FT                   /protein_id="ACL28610.1"
FT                   /translation="MSGWIIALIVIAIILVLTIWVIGMYNSLIGMRNRVGNSWAQVDVL
FT                   LKQRADLIPNLVEVVKGYATHESTVFEQVTKARAGVVEVANNPNSTLEQRAAAEQALTN
FT                   AMVNLRAIVEAYPDLKANQNFLDLQGRLASLEDKIAYGRQFYNDTVLKYNNRIMQVPTN
FT                   IIAGMFHFQPAQYFAADEADRSVPQVKF"
FT   gene            403874..405589
FT                   /locus_tag="BLA_0309"
FT   CDS_pept        403874..405589
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0309"
FT                   /product="predicted membrane protein"
FT                   /note="COG4907: Predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28611"
FT                   /db_xref="GOA:B8DVW0"
FT                   /db_xref="InterPro:IPR018702"
FT                   /db_xref="UniProtKB/TrEMBL:B8DVW0"
FT                   /protein_id="ACL28611.1"
FT                   /translation="MEIGWNIPATQSSSSKRFQIDMTWEGVTTAYNDVAKFQWEPFGAK
FT                   NQTPIGVMTTTVEFPAGVTRSDSWAWLHYSGNSSTERTANGLKFTAYNVRSGQYLDLVA
FT                   MIGANHMHGVTRHVDEDTKQWTLDDEARQEREWHERQRRNAQLRIVLWVAIAVAGALLA
FT                   FFGIRSAIRSVDAAKYKGNIEYWREPPNMSPAAAAQLYDIVMGVRNGGVTLANREMAST
FT                   MMSLVSKGAIAVYPGKAELYRGIDMSRANSAGLAQMLSSNGASEKELMKTSTIVIMPRA
FT                   LAEHHEELNLCGSEERLLGILMEAYKRIHSPVFDLRQMNKAFRKWTNGYKAIEKFNAAC
FT                   KAELESLHATRSVGTAAVTCGILGIIVGIASAFYFIAAEHNFALALCISLPITVLCLFA
FT                   LVYCTTTGITDSGQQYAGQVRGLAKYLEDFSEFSDRGVLDLTLWDRYLVYATAFGISKK
FT                   ALRQLAAAYPQVADQDWLDSNASNLGLLYWSTRPSTIVGSGIGNALANGTGSFGGFAGG
FT                   FVDIGTQLNSGFSSIQSTIRSAAPSSSSGSGGSFGGGGFGGSGGGSGGGSFGGR"
FT   gene            complement(405586..406551)
FT                   /gene="nrdF"
FT                   /locus_tag="BLA_0310"
FT   CDS_pept        complement(405586..406551)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nrdF"
FT                   /locus_tag="BLA_0310"
FT                   /product="ribonucleoside-diphosphate reductase 2 beta
FT                   chain"
FT                   /EC_number="1.17.4.1"
FT                   /note="COG0208: Ribonucleotide reductase, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28612"
FT                   /db_xref="GOA:B8DVW1"
FT                   /db_xref="InterPro:IPR000358"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012348"
FT                   /db_xref="InterPro:IPR026494"
FT                   /db_xref="InterPro:IPR030475"
FT                   /db_xref="InterPro:IPR033909"
FT                   /db_xref="UniProtKB/TrEMBL:B8DVW1"
FT                   /protein_id="ACL28612.1"
FT                   /translation="MPKLIDRVTAINWNRLDDEKDLEVWDRLTGNFWLPEKVPVSNDIP
FT                   DWRQMSDAEHTLTMRVFTGLTLLDTIQGTVGAVSLIPDALTPHEEAVYTNIAFMESVHA
FT                   KSYSSIFSTLCSTREIDEAFDWSEKNPHLQRKAQIVLDYYEGDDPLKRKVASTLLESFL
FT                   FYSGFYLPMYFSSHAKLTNTADVIRLIIRDEAVHGYYIGYKYQKGLEMASDAKRAEMET
FT                   YTYDLLNELYENEVEYTHSLYDEVGLSDDVEKFLHYNANKALMNLGYPALFPSEICDVN
FT                   PAILAALSPNADENHDFFSGSGSSYVMGRAEETDDDDWDF"
FT   gene            complement(406591..408717)
FT                   /locus_tag="BLA_0311"
FT   CDS_pept        complement(406591..408717)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0311"
FT                   /product="ribonucleoside-diphosphate reductase, alpha
FT                   subunit"
FT                   /EC_number="1.17.4.1"
FT                   /note="COG0209: Ribonucleotide reductase, alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28613"
FT                   /db_xref="GOA:B8DVW2"
FT                   /db_xref="InterPro:IPR000788"
FT                   /db_xref="InterPro:IPR008926"
FT                   /db_xref="InterPro:IPR013346"
FT                   /db_xref="InterPro:IPR013509"
FT                   /db_xref="InterPro:IPR013554"
FT                   /db_xref="InterPro:IPR026459"
FT                   /db_xref="InterPro:IPR039718"
FT                   /db_xref="UniProtKB/TrEMBL:B8DVW2"
FT                   /protein_id="ACL28613.1"
FT                   /translation="MTADYHSLNAMLNLYDEDGNIQFDKDHEAVDAFLAEHVAPRMIRF
FT                   ESTRERLRYLVDHHYYEYDVFSKYSPEFLDAFYAHADALPHRFETFLGAFKFYRSYALK
FT                   TFDGEHYLEDFPQRAAAVSLALADGDEPMAMRTLDEIVLGRFQPATPTFLNLGKAQRGE
FT                   PVSCFLVRIEDNMESISRGINAALQLSKRGGGVALLLSNLREEGAPIKHIENQSSGVVP
FT                   VMKLLEDSFSYANQLGARQGAGAVYLHAHHPDILKFLDTKRENADEKIRIKSLALGVVI
FT                   PDITFELAKRREKMALFSPYDVERVYGVPFADVNVTAKYEEMLADDRIRKTFIDAREFF
FT                   TTLAEIQFESGYPYLLFEDTANAANPIDGRITMSNLCSEILQVQEPSTYYEDLSYAHVG
FT                   RDVSCNLGSLNIARAMDAGLAGPVETAIRALTAVSQHTHIGAVPSIARANEEGHAIGLG
FT                   QMNLHGFLAREGIRYGSPEALDFTNMYFETVAFHAYRASHALAVENGHAFARFADSAYA
FT                   RQPSDGNYFDKYLDGSLDTEPRTGTVRALFERFGVRIPTARDWRELQGEILRDGIYNQY
FT                   LQAVPPTGSISYINHATSSIHPIASKIEIRKEGKIGRMYYPAPYMTNDNLDLYDDAYEI
FT                   GWKAIVDTYAEATPHVDQGLSLTLFFPDTVTTRDLNKAQIYAWRKGIKTLYYIRIRQQA
FT                   LEGTEVAGCVSCML"
FT   gene            complement(408727..409152)
FT                   /gene="nrdI"
FT                   /locus_tag="BLA_0312"
FT   CDS_pept        complement(408727..409152)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nrdI"
FT                   /locus_tag="BLA_0312"
FT                   /product="nrdI protein"
FT                   /note="COG1780: Protein involved in ribonucleotide
FT                   reduction"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28614"
FT                   /db_xref="GOA:B8DVW3"
FT                   /db_xref="InterPro:IPR004465"
FT                   /db_xref="InterPro:IPR020852"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8DVW3"
FT                   /protein_id="ACL28614.1"
FT                   /translation="MSAVVYFSSASRNTERFVEHCDFPSCGVNVFRIPLQPNAAPLNVR
FT                   EPYIIIVPTYGGGDARKAVPPQVKRFLNDPANREWIRGVIASGNTNFGEAYAAAGPIIS
FT                   RKCHVPLMYRFELMGTREDVHAVREGVRRFFSDTPTD"
FT   gene            complement(409149..409412)
FT                   /gene="nrdH"
FT                   /locus_tag="BLA_0313"
FT   CDS_pept        complement(409149..409412)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nrdH"
FT                   /locus_tag="BLA_0313"
FT                   /product="glutaredoxin-like protein NrdH"
FT                   /note="COG0695: Glutaredoxin and related proteins"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28615"
FT                   /db_xref="GOA:B8DVW4"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B8DVW4"
FT                   /protein_id="ACL28615.1"
FT                   /translation="MHITIYSKPNCPQCAATKRAFDRLGAPYTVVDITTDPVALATLQE
FT                   AGFRQAPVVFVDSDFWTGYRPDRIRDVARRLQTVSSASGVLA"
FT   gene            409721..410584
FT                   /locus_tag="BLA_0314"
FT   CDS_pept        409721..410584
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0314"
FT                   /product="possible oxidoreductase of the aldo/keto
FT                   reductase family"
FT                   /note="COG0667: Predicted oxidoreductases (related to
FT                   aryl-alcohol dehydrogenases)"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28616"
FT                   /db_xref="GOA:B8DVW5"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:B8DVW5"
FT                   /protein_id="ACL28616.1"
FT                   /translation="MVLHRNLGPFDTTAIGLGEMPLTIENNLGPKMGVETIHAALDAGC
FT                   RQIDTAWAYYCSGGEEQTGEKLVREALASWDGPRDEVLVATKVGHFRNFTDGKPTWDVD
FT                   GSPENLIKRAKQSAFELGVDMIDLLYFHRPDPKIPYGESCEAMKEIRSMGIAREIGISN
FT                   ASIEQIDIAREILGDSLIAVQNQFSPIYTETADTLDYCGKVGLSFVCWSPLGGFRKPKD
FT                   ESKFDPFREVAEAHGVSYQQVVLAWELAKGSHVFVIPGAHRPATILDSLKAGDLELTPE
FT                   ELAKLG"
FT   gene            410895..412430
FT                   /locus_tag="BLA_0315"
FT   CDS_pept        410895..412430
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0315"
FT                   /product="possible protease"
FT                   /note="COG0826: Collagenase and related proteases"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28617"
FT                   /db_xref="GOA:B8DVW6"
FT                   /db_xref="InterPro:IPR001539"
FT                   /db_xref="InterPro:IPR032525"
FT                   /db_xref="UniProtKB/TrEMBL:B8DVW6"
FT                   /protein_id="ACL28617.1"
FT                   /translation="MKRRGKPEVLAPAGNLRGLKTAVDYGADAVYCGGKSFGMRSAPRN
FT                   LSLDDFREGAAYAHERGARVYVTLNILPRNNEITAIERYIEDLRTTGVDALIVTDIGVM
FT                   MLAHRIAPELELHVSTQAGVTNYLAANALHDLGARRVVLAREMDLQAVRDIRANIPDDL
FT                   DIETFVHGSMCMAFSGRCLISNYLTGRDGNHGECAQPCRWKYSLVEEKRPGQVFPVEET
FT                   AQGTYLFNSQDMNMMAHLDDLIDSGATSLKIEGRSKSAYYVAAMTNAYKTAVNEYMVQR
FT                   GFEDEAGNELKPFHDRVVRAGEEGFADSARDTIMLNADAAFAGMPNWDSANDEGEAGGI
FT                   SNRQARRTGLKRQGQLVEESDDGWRHAPVRPAPHVELPQWLMEEPYKVAHRDYSTGFYY
FT                   PEQKVTQNTDRSAYFRDWLVVGEVLSWSPEEGGRVTIMSRNKMEPGQLVEFLLPGRAPL
FT                   EYVVPDGGIRDADGNEVPMVNNPAHVFSLPLGVEVPVNAALRSRTKKPTLKAE"
FT   gene            412873..413964
FT                   /locus_tag="BLA_0316"
FT   CDS_pept        412873..413964
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0316"
FT                   /product="conserved hypothetical protein"
FT                   /note="COG1496: Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28618"
FT                   /db_xref="InterPro:IPR003730"
FT                   /db_xref="InterPro:IPR011324"
FT                   /db_xref="InterPro:IPR038371"
FT                   /db_xref="UniProtKB/TrEMBL:B8DVW7"
FT                   /protein_id="ACL28618.1"
FT                   /translation="MEQEDKAAREGGKDADGKTYDDAILDSSAIEPTDDEGNPIPVTIP
FT                   VVLSPGITVIYTTRLGGVSAEEWAHFNLGGKSGDDPVAVERNREALADELHVKLSLIDQ
FT                   VHSGKSVDIDEVYTENKPFGFDASGSHTEAQAKAKRAGEPVVDDVESENAEVQVIEGDA
FT                   QVTCRKDIAIGVFAADCLPVLFADPQAGVVAAAHCGRKGLQRNVIAATVDMMVKKGASK
FT                   ENIVATLGPAICGDCYEVGDQIADEFDAQFPGTFTLTRFGGPGIDLNKAALMELHQAGI
FT                   KDDRIFSSQPRVNAATQYLSQDAELEELCREDNEGDPALEERIKGIRYSMCTLENPLWF
FT                   SHRRAELAHKRHEGRMLALIVRS"
FT   gene            413991..414818
FT                   /gene="ispD"
FT                   /locus_tag="BLA_0317"
FT   CDS_pept        413991..414818
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ispD"
FT                   /locus_tag="BLA_0317"
FT                   /product="2-C-methyl-D-erythritol 4-phosphate
FT                   cytidylyltransferase"
FT                   /EC_number="2.7.7.60"
FT                   /note="COG1211: 4-diphosphocytidyl-2-methyl-D-erithritol
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28619"
FT                   /db_xref="GOA:B8DVW8"
FT                   /db_xref="InterPro:IPR001228"
FT                   /db_xref="InterPro:IPR018294"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR034683"
FT                   /db_xref="UniProtKB/TrEMBL:B8DVW8"
FT                   /protein_id="ACL28619.1"
FT                   /translation="MTQQTKVPVVAVVLAAGSGVRFDPAKPKQLVALNGKPIVAWSIEA
FT                   FENDEHVDDIVVVVNNTVREAVEQLIDDASYAKVRAIITGGAERSDSTEAALTTLADAG
FT                   IPQDAKILIHDAVRPFVSRQEIDGCIDALDEFTAATVACPSTDTILLTQDLGDREVIQS
FT                   VPERRHSFRAQTPQAFRFGTIRDAYAKAAGDPDFRPTDDTRVVVDYLPDQPVAIVGGSP
FT                   RNMKVTTQDDMPLARALANALAGAPRGPQNERQRAAKEQLHAMFGKAFGVEGE"
FT   gene            414820..415497
FT                   /gene="pcp"
FT                   /locus_tag="BLA_0318"
FT   CDS_pept        414820..415497
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pcp"
FT                   /locus_tag="BLA_0318"
FT                   /product="pyrrolidone-carboxylate peptidase"
FT                   /EC_number="3.4.19.3"
FT                   /note="COG2039: Pyrrolidone-carboxylate peptidase
FT                   (N-terminal pyroglutamyl peptidase)"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28620"
FT                   /db_xref="GOA:B8DVW9"
FT                   /db_xref="InterPro:IPR000816"
FT                   /db_xref="InterPro:IPR016125"
FT                   /db_xref="InterPro:IPR036440"
FT                   /db_xref="UniProtKB/TrEMBL:B8DVW9"
FT                   /protein_id="ACL28620.1"
FT                   /translation="MQELSVVMSGFDPYEDVTANPALIVPDTLAEQGMGGAMDSDDDLK
FT                   DVAITVHAVHMPVSFSKAWPILEAALEEHRPQIVVATGLKRASRGILLERCAINVKDTN
FT                   RPDADNKVPSHHVINAAGPAAYWTGLPLNAILGAFAADEIPASLSSNAGTFVCNALFYK
FT                   LQDWASRQGRTLSGFVNLPPVDEREHSQHGLTLDQQIRAGRDVIRETARYYVKPIGVNT
FT                   LIA"
FT   gene            415656..417374
FT                   /locus_tag="BLA_0319"
FT   CDS_pept        415656..417374
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0319"
FT                   /product="large Ala/Glu-rich protein"
FT                   /note="COG3468: Type V secretory pathway, adhesin AidA"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28621"
FT                   /db_xref="UniProtKB/TrEMBL:B8DVX0"
FT                   /protein_id="ACL28621.1"
FT                   /translation="MVDRFPVVLRGYDKERVDEAMLAAQNSIDRLREQVKAGDDTVLQL
FT                   QAQLQEEKNRKANTDNSFASLGANAQQMLASAEQTSTELLERAKKDAASARTEAQSQSQ
FT                   TLVNNAKLDAQHLVDDAQAKADTILKNAQSEANTIVTNARQEAEQLRASTAKTVSDQRQ
FT                   ALDLELTNSREEHKKRLASERAQQERELADLSAQTAKTISEQRKSANEEMARLKSETND
FT                   QIETALADANKKLADVREQVSKLMTEAQRKAGEITDAAKAHAQEITDAAEVNRTQTMSQ
FT                   VNAEVEQIRADIAAQQDEATKKVQELLQSLEESRKSAKEEAEKEIGQAKQAREEADAYA
FT                   AEKRESADTEAREIVRKAGEEASKQIEDRRKAAQSELDGLRKRIGELQTREADITQRVS
FT                   ELRSMFANAFAGFGFGIDKHSTDTMSVVNTVAGDNDSSDTPQAPADNGSVRSDLANTML
FT                   INPSDSAQHEASHPMSHVTVPVAPALHDHAAQANAADDDNAGTNDEAQVPAVDIPADPN
FT                   TPSPEAPEAPAASAAEVMEAIDGDEPISDDTHVTGDADSLFDSSDNMPVAPNNEQ"
FT   gene            417555..418895
FT                   /gene="pepC"
FT                   /locus_tag="BLA_0320"
FT   CDS_pept        417555..418895
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pepC"
FT                   /locus_tag="BLA_0320"
FT                   /product="aminopeptidase C"
FT                   /EC_number="3.4.22.40"
FT                   /note="COG3579: Aminopeptidase C"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28622"
FT                   /db_xref="GOA:B8DVX1"
FT                   /db_xref="InterPro:IPR000169"
FT                   /db_xref="InterPro:IPR004134"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:B8DVX1"
FT                   /protein_id="ACL28622.1"
FT                   /translation="MSDKISPLSSHDLDDLTSEFEGSKSNVMAMNAVTAAGINKVARNY
FT                   DRARLLQRRFSTSLDNGEATHQDRSGRCWLFSSLNVARYVAKKTMNIKEFEFSQNYAMY
FT                   FDKLERVNYFLQDIANLIREGEPTDSRLFQHMLHDVMGDGGQWTMAMNVYKKYGAVPKD
FT                   LYPETESSKNTGELDTQLRRMLHTAVSQMEKSPEHIDEIILQATKAGHRILTIHLGEPP
FT                   KSFDWEWTDKDGEFHRVGEITPVEFWNRYVGDADLESYVCLVDDPRHEHAKGKKIGIEH
FT                   LNNVAGGDPTEYLNVPIQFMKDCARDVLVEQGIPVWFGADCHPMMDREDGAWATDLFEY
FT                   GKVYDYDFTMDKEERVRFADSAMNHAMAFVGVDVADDNKTTRRWRVENSWGTKIADKGY
FT                   FTMGDDWFDQYVFEVAVPKALLPDEYLKALDEPAQMLPAWDPMGALA"
FT   gene            419180..420310
FT                   /locus_tag="BLA_0321"
FT   CDS_pept        419180..420310
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0321"
FT                   /product="3-deoxy-7-phosphoheptulonate synthase"
FT                   /EC_number="2.5.1.54"
FT                   /note="COG0722: 3-deoxy-D-arabino-heptulosonate 7-phosphate
FT                   (DAHP) synthase"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28623"
FT                   /db_xref="GOA:B8DVX2"
FT                   /db_xref="InterPro:IPR006218"
FT                   /db_xref="InterPro:IPR006219"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:B8DVX2"
FT                   /protein_id="ACL28623.1"
FT                   /translation="MAAMRGPDSSQDSVLDANAVVPETVDVNIRQLDPIPAPRYFIKEL
FT                   PLTEQMGKQVLEQRAQIRDILHGRDDRMLAIVGPCSIHDPKAAHEYATRLAELADELKR
FT                   DLLIVMRVYFQKPRTTIGWKGLINDPDIDGEFDIRKGMWLARKVLCDVVGMGLPAATEW
FT                   LDPITPQYLCDLVSWGAIGARNTESQVHRELASGLSMPIGFKNATDGSVKPAADSCYTA
FT                   AFEHHFLSINLDGHVIAAETKGNPDCHLVLRGSNHGPNYDAESVAAALRDLHESKAEGP
FT                   SKHGLIIDAAHGNCGKNEVVEAAVVENIAERIAGGERGILGIMMESFLKGGHQAPAPLA
FT                   QLEYGQSITDSCVPWARSEEVLRKLAQAVNARRAAR"
FT   gene            420651..422528
FT                   /locus_tag="BLA_0322"
FT   CDS_pept        420651..422528
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0322"
FT                   /product="predicted acyltransferase"
FT                   /note="COG1835: Predicted acyltransferases"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28624"
FT                   /db_xref="GOA:B8DVX3"
FT                   /db_xref="InterPro:IPR002656"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="UniProtKB/TrEMBL:B8DVX3"
FT                   /protein_id="ACL28624.1"
FT                   /translation="MLLKGGFLGVTLFLVVSGFFITRSLMNAVDGHRFLLFDYLRRRVK
FT                   RLWPAVISTIGLTAVLVYACAPPLILKMRGDAVPSALFYSNWSFIFRKLSYFDAAGLPS
FT                   PLTHLWYTSLIMQFYLLWPLLFIPLFLHCRRHWVRVGVLGALIAAGTLEMMMLYRPEAD
FT                   TSRLYYGLDTRAAEILVGVLLAMLVHDSASRSDQERRAADGRIVFDRQIGRYHAVLRRG
FT                   DLGVVAAGICALALALGFLLVDARAAWMYHGGFLFFAVVSAVLLYASMQDARVGRILGV
FT                   KALRYLGSRSFSLYLVHYPLLEVMNPATRTTGIPWYEWIGQFLVILMAGEAFYQIVEAL
FT                   TGTPWLPWMRCRITSVGAGRLRTSAWILTIVGVVMTFVMALPLDWRAIAHARSVKARPE
FT                   LALTAEQARERLAQQQKRESETSKENGKEHKDSSGKPNAQAKPKVAPPVVKALKVPANL
FT                   EPQRWACDRKAMVCQAKVLMIGDSVTEGVSDTLREHFPNATIDGAVSRQFDQGVQILRD
FT                   DLARGMDPQVIVFALGTNGPVSEQMAQQVIDLAGGRPLYFATTRAPVDWVPGNNATFIG
FT                   MAERNPNVGIIDWSGTSQGRDDYLYDDGIHPNQLGMQAYLQMFLNAFCA"
FT   gene            422601..423848
FT                   /locus_tag="BLA_0323"
FT   CDS_pept        422601..423848
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0323"
FT                   /product="3-deoxy-7-phosphoheptulonate synthase"
FT                   /EC_number="2.5.1.54"
FT                   /note="COG0722: 3-deoxy-D-arabino-heptulosonate 7-phosphate
FT                   (DAHP) synthase"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28625"
FT                   /db_xref="GOA:B8DVX4"
FT                   /db_xref="InterPro:IPR006218"
FT                   /db_xref="InterPro:IPR006219"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:B8DVX4"
FT                   /protein_id="ACL28625.1"
FT                   /translation="MSENPYEPMSKEQKDAIVQGNGLTYTHEQMRQVQHAIAAGKNPLV
FT                   VLENVPRWEDMAGVDRIINRRVLELDPLPTPAQVLAELPLTRQMQDIVAYSRDEVRACL
FT                   YGQDDRLLVIVGPCSVHDPKAALDYAHRLRTLKDELGEDLLIVMRVYFEKPRTTVGWKG
FT                   LINDPDIDGSHNIQKGLLLARRTLLDVLGAGVATATEFLEPTSPQYIADAVSWGAIGAR
FT                   NTESQVHRQLASGMSMPIGFKNATDGSVKAAVNSCIAAEDQHTFFGIDHRGRACAVETL
FT                   GNPDCHVVLRGSSSGPNYDAESVAQALASIRDKMGDEAAASHGLVIDCSHGNSGKDDVR
FT                   QAQVVREIAERIAGGERGISGVMMESFIVGGNQAPAPLAELTYGQSITDKCLSWPVTDE
FT                   LLHTLADAVRTRRWNR"
FT   gene            423927..424619
FT                   /gene="mtnN"
FT                   /locus_tag="BLA_0324"
FT   CDS_pept        423927..424619
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mtnN"
FT                   /locus_tag="BLA_0324"
FT                   /product="MTA/SAH nucleosidase"
FT                   /EC_number="3.2.2.9"
FT                   /note="COG0775: Nucleoside phosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28626"
FT                   /db_xref="GOA:B8DVX5"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR010049"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="UniProtKB/TrEMBL:B8DVX5"
FT                   /protein_id="ACL28626.1"
FT                   /translation="MQTVAIISALDEEAAHIADSLDNMTVTERASLSVARGTLTTDAGE
FT                   ELDVAVTVGGMGLVNAAATTQFLIDLVHPEAVIFSGIAGNLNKSLHINDIVLGKTLRYL
FT                   DTDMRLVGQWKPGTSEFHSDPALLQIAEGALDEMGINHIQGTIASGNYFVDTPQKVSQV
FT                   IEQTHADAVEMEGAAVAHVAARNDVPALVIRAMSDSADTDYEEFKDFDISEYADTAARL
FT                   VVRILRGM"
FT   gene            424651..425874
FT                   /locus_tag="BLA_0325"
FT   CDS_pept        424651..425874
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0325"
FT                   /product="sensor protein"
FT                   /EC_number="2.7.13.3"
FT                   /note="COG0642: Signal transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28627"
FT                   /db_xref="GOA:B8DVX6"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B8DVX6"
FT                   /protein_id="ACL28627.1"
FT                   /translation="MTPGEIAMAIAMGVLLIAGGYAIAYRAGRNREREREPSEAALFAG
FT                   HADADAVDGERRMLAMLEEAVIVTDSSANVLVANEAAIERGLSVDGLIVDAGIRDLVQE
FT                   AAQSDAAVERELELARDSQRLHVAVTAQCTADDRVTVVCADTGYRRSVDRVRRDFVTNV
FT                   SHELKTPVGAIMLLAETIDDAGDDVDMIRHFAARIGVEAKRLDGLVRRLIELGRMHGDR
FT                   ATTRRTVDARELVRQAIIDTEVTAGARHTMVRMRDDAGENHPLPVTVDAAAVHIALKNL
FT                   VENAINYSPEHAEVTVEVSRGEDQARIRVVDHGIGIPRQLQGRIFERFYRVDPARSRLT
FT                   GGTGLGLSIASHHILANQGKLEVWSKPGEGSTFTVMLPLAMRDDDTPCNRDADAEGDPD
FT                   GTGKEADR"
FT   gene            425871..426578
FT                   /locus_tag="BLA_0326"
FT   CDS_pept        425871..426578
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0326"
FT                   /product="response regulator of two-component system"
FT                   /note="COG0745: Response regulators consisting of a
FT                   CheY-like receiver domain and a winged-helix DNA-binding
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28628"
FT                   /db_xref="GOA:B8DVX7"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:B8DVX7"
FT                   /protein_id="ACL28628.1"
FT                   /translation="MTRILVVEDEPSYLDPLLYQLTREGYEAHGAATGEEAWELYEEME
FT                   FDLVLLDLMLPGISGTTLCRRMHELRRVPIIMVTAKSTENDVIVGLEIGADDYVTKPYS
FT                   FRELLARIHAVLRRSLEPRASGTPGGNDETLTCGPIEMSVASHEVRIHGELTQFPLKEF
FT                   EVLEYLMRNKGRVLTRQQLIGRVWGSDYVGDTKTLDVHVKRIRAKIEADPSNPALLTTV
FT                   RGLGYRICDERSR"
FT   gene            426665..427780
FT                   /gene="pstS"
FT                   /locus_tag="BLA_0327"
FT   CDS_pept        426665..427780
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pstS"
FT                   /locus_tag="BLA_0327"
FT                   /product="phosphate-binding transport protein of ABC
FT                   transporter system"
FT                   /note="COG0226: ABC-type phosphate transport system,
FT                   periplasmic component"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28629"
FT                   /db_xref="GOA:B8DVX8"
FT                   /db_xref="InterPro:IPR005673"
FT                   /db_xref="InterPro:IPR024370"
FT                   /db_xref="UniProtKB/TrEMBL:B8DVX8"
FT                   /protein_id="ACL28629.1"
FT                   /translation="MRSNLARRVLAALCGMAFIATTTACGDNTDPANRPVANASSISGS
FT                   FAGAGASSQQTAVEAWVAGYQKTNPDARISYNPSGSGAGVATFLTGATVWAASDKPLDA
FT                   KQVEESTSVCAGASAFDVPVYISPLAIVFNLQGVSDAGKHINMDAATIAKVFDGRITRW
FT                   NDAELTAQNPGLSLPDLPITVVHRSDKSGTTLNFLEYIKAAAPADWPYELSENWPNDVG
FT                   QGAKGTSGVISTIDQANGTIGYADFSQAGGMGTVAVQVGDTPTVISAEAASKAVADSTL
FT                   DKSVPGKHRVVLDINHTTRVTGAYPIVLVSYDIACPAYTDANTARFAKSWLSYVTSEEG
FT                   QAQAMNATGSAPLPANIAKYVRESIDAMEVK"
FT   gene            427785..428765
FT                   /gene="pstC"
FT                   /locus_tag="BLA_0328"
FT   CDS_pept        427785..428765
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pstC"
FT                   /locus_tag="BLA_0328"
FT                   /product="phosphate ABC transporter, permease protein PstC"
FT                   /note="COG0573: ABC-type phosphate transport system,
FT                   permease component"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28630"
FT                   /db_xref="GOA:B8DVX9"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR011864"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B8DVX9"
FT                   /protein_id="ACL28630.1"
FT                   /translation="MSSAPKPPAQPAADSSLTKPVSGEKADRIFRGIAYACGILILVVL
FT                   AAVALFLLFRAWPLIGGDQRTNSDVISSFTGGKATSFWGYVGPLLFGTVLVAALALIIA
FT                   FFVSIGIALFISHYAPKRLAAMLSYIVDILAAIPSVIYGLWGGLVLVPAIYPFWNWIAE
FT                   HLGWIPIFAGPASNPPRTVATVALVLAIMILPIITSITRDIFLQTPKLLEEAALGLGAT
FT                   KWEMIKMSVLPFARSGIISASMLGLGRALGETMAVLMILSPGLKYSFKLLQASQNQTIA
FT                   ANIAAQYPEADSIGVSVLIGTGLVLFVITFLVNLLARRITEKASK"
FT   gene            428762..429754
FT                   /gene="pstA"
FT                   /locus_tag="BLA_0329"
FT   CDS_pept        428762..429754
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pstA"
FT                   /locus_tag="BLA_0329"
FT                   /product="phosphate ABC transporter, permease protein PstA"
FT                   /note="COG0581: ABC-type phosphate transport system,
FT                   permease component"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28631"
FT                   /db_xref="GOA:B8DVY0"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR005672"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B8DVY0"
FT                   /protein_id="ACL28631.1"
FT                   /translation="MMSEPQSTPHADAAPVIDFDKFKPTRSYTAARKRKDMVMRALIIL
FT                   AFVVALIPLISVLWTTLAHGIRRLNWDFLSHNMTNVIGGNQTPSGGYGGILHAIIGTLE
FT                   ITLGAMVISIPIGVMCAVYLIEYAGKSKLARTIHLLVDVMSGIPSIVAGLFAYSMFAIL
FT                   VGPGTLNGFEGSVALSLLMIPTVVKTTEEMLKIVPNDLREASLALGVTKQRTITKVVLR
FT                   TALSGIVSGSILAIARVIGETAPLLMTAGYIVSTNANLFLGEMTTLPVYVYQEYSKYHA
FT                   NCPADAGSGCVTAIPMERAWSAALVLIVIVLILNLIGRIVAKVFAPKKK"
FT   gene            429791..430570
FT                   /gene="pstB"
FT                   /locus_tag="BLA_0330"
FT   CDS_pept        429791..430570
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pstB"
FT                   /locus_tag="BLA_0330"
FT                   /product="phosphate ABC transporter, ATP-binding protein"
FT                   /EC_number="3.6.3.27"
FT                   /note="COG1117: ABC-type phosphate transport system, ATPase
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28632"
FT                   /db_xref="GOA:B8DVY1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005670"
FT                   /db_xref="InterPro:IPR015850"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B8DVY1"
FT                   /protein_id="ACL28632.1"
FT                   /translation="MGQQIDIRHLNIYYGSFLAVEDVNLHIAANKVTAFIGPSGCGKST
FT                   VLRTLDRMHEITPGAHVKGDVLLEGKNLYAKDVDPVAVRRDVGMVFQRPNPFPTMSIRE
FT                   NVLAGVSLNNRKISKSDADDLVEWALRGANLWNEVKDRLDNPGIGLSGGQQQRLCIARA
FT                   VAVHPQVLLMDEPCSALDPISTLAVEDLIEELKQDYTIVIVTHNMQQAARIADYTAFFN
FT                   LKAVGQPGHLEYFADTSTMFNNPQNEEAERYVSGRFG"
FT   gene            430808..432202
FT                   /locus_tag="BLA_0331"
FT   CDS_pept        430808..432202
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0331"
FT                   /product="xanthine/uracil permease family protein"
FT                   /note="COG2252: Permeases"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28633"
FT                   /db_xref="GOA:B8DVY2"
FT                   /db_xref="InterPro:IPR006043"
FT                   /db_xref="InterPro:IPR026033"
FT                   /db_xref="UniProtKB/TrEMBL:B8DVY2"
FT                   /protein_id="ACL28633.1"
FT                   /translation="MEKFFHLKENGTSVSTEVMAGLTTFFAMSYIIVVNPQILSQTGMP
FT                   WGGVFLATIIAAIIGTLVMGLFANVPYAQAPGMGLNAFFTYTVCFGLGFTWQETLAMVF
FT                   LCGLINILITVTKVRKMIIKAIPEPLQQAIGGGIGLFVAYVGLLNVNFITFTPKDTKAA
FT                   GQGLATGATPGMATLNSPVLWLFLIGLLLAIVFTILKVKGGLLITIIITAVIGIPMGLT
FT                   TMSNSVSLGETFSQLPQTFGALFTGEGFGSLFSDPAKLPLVLVTIFAFSMSDTFDTLGT
FT                   FIGTGRRTGIFSKADEESLENGHGFSSKMDKALFADSIATSIGAICGTSNTTTYVESSA
FT                   GIAAGGRTGLTSVIVAACFAVSAFFAPVISAVPSAATAGVLVIVGCLMAASLKEVKWDD
FT                   ITEAIPAFFAAVFMAFSYSISYGIAGGFITYCIVKVCKKKANEVHPIVWIVSALFILDF
FT                   ICMAVL"
FT   gene            complement(432537..433445)
FT                   /locus_tag="BLA_0332"
FT   CDS_pept        complement(432537..433445)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0332"
FT                   /product="probable solute binding protein of ABC
FT                   transporter system"
FT                   /note="COG0803: ABC-type metal ion transport system,
FT                   periplasmic component/surface adhesin"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28634"
FT                   /db_xref="GOA:B8DVY3"
FT                   /db_xref="InterPro:IPR006127"
FT                   /db_xref="UniProtKB/TrEMBL:B8DVY3"
FT                   /protein_id="ACL28634.1"
FT                   /translation="MKRLLRTLTILLAALATIFAVAGCSNSKAGDTQIDKEKVITVIAS
FT                   TNVWGSVAKQLGGQYVDVTSILNNTGTDAHDYEPSTNDISKFQHAQVAILNGAGYDEWA
FT                   AKAAGQSKAIVIDAAAAGGKKTGDNPHVWFSAAVRNKTADEITAAYIKLMPSEKAEFEK
FT                   LNKDWHTEEDDLEAQLQTVAQADGKMPYGAIESVGDYLAQDMGMTDVTPKGYKNATSNE
FT                   SEPTASDIKSFTEALKKGDMKMLIANSQEKSQLSDQLTDAADSGNIPVVDITEQMPSQY
FT                   KTLNEWLKAIAEQIQATQKKK"
FT   gene            433813..434334
FT                   /gene="rplJ"
FT                   /locus_tag="BLA_0333"
FT   CDS_pept        433813..434334
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplJ"
FT                   /locus_tag="BLA_0333"
FT                   /product="50S ribosomal protein L10"
FT                   /note="COG0244: Ribosomal protein L10"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28635"
FT                   /db_xref="GOA:B8DVY4"
FT                   /db_xref="InterPro:IPR001790"
FT                   /db_xref="InterPro:IPR002363"
FT                   /db_xref="InterPro:IPR022973"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8DVY4"
FT                   /protein_id="ACL28635.1"
FT                   /translation="MKRPEKEAVVAELTEQFRNASAVYLTEYRGLTVPQISDLREKLGR
FT                   DTSYTVAKNTLFRIAAKEAGIEGLDEMLKGPSAVVFVDGDFIEAAKVLRDFAKTNKALI
FT                   VKGGFADGTVYDAEGAKQLADLKSRPELLAELAGALKGTMSKAAYLFNALPTKVVRTID
FT                   ALRDKQEKAA"
FT   gene            434445..434825
FT                   /gene="rplL"
FT                   /locus_tag="BLA_0334"
FT   CDS_pept        434445..434825
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplL"
FT                   /locus_tag="BLA_0334"
FT                   /product="ribosomal protein L7/L12"
FT                   /note="COG0222: Ribosomal protein L7/L12"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28636"
FT                   /db_xref="GOA:B8DVY5"
FT                   /db_xref="InterPro:IPR000206"
FT                   /db_xref="InterPro:IPR008932"
FT                   /db_xref="InterPro:IPR013823"
FT                   /db_xref="InterPro:IPR014719"
FT                   /db_xref="InterPro:IPR036235"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8DVY5"
FT                   /protein_id="ACL28636.1"
FT                   /translation="MAKFTQDELLEAFGEMTLVELSDFVKAFEEKFDVEAAAPVAAVAA
FT                   AAPGAAPAEEEKDEFTVVLSAVGDKKIQVIKAVRAITNLGLAEAKALVDGAPKPVLENA
FT                   KKEDAEKAKAQLEEAGATVELK"
FT   gene            435051..436682
FT                   /locus_tag="BLA_0335"
FT   CDS_pept        435051..436682
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0335"
FT                   /product="PT repeat family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28637"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="UniProtKB/TrEMBL:B8DVY6"
FT                   /protein_id="ACL28637.1"
FT                   /translation="MSSEQGATTRWVILVDGTQLASVEPGTTVEIGRKPLRPLPDDGKR
FT                   RVEILDDSRSVSKRHAQLMVALDGRAFLRDLNSTNGTFVVRAGDELVRLQSGVDYPLQS
FT                   DSVHVQFGDVPVDFTKFIEDDDSTKDDAPVVNLFDYAVEGSSNEPEAADMSVDDILNLR
FT                   AGEPTDIFNASMVRARAKRMHDAEQQSFVPFTQPINPLPMQDLDDSDAGDAAPRDLFAD
FT                   AKDVAEGKISEPAAAQEHPYIPKMSDKPKHAGAPADRLISVSELASAHPRSMPQPQENM
FT                   PEPAAEVDAASESIVVEQTSVTEETTQEEPAEPVAAEPAAQGIGEHGESVQPSANAPAV
FT                   EEPDGNAEESAAASEQAPVSDEESRQNEEPSGSAGTTSDEAASETEVNGDIASLAAQDV
FT                   SQDEQELRGDNAPEVATVTVDAADVDYSRFQRHDEPQTDESAEGEYEPAFEPGSVFEKV
FT                   ANGDFAKSEPLVSVAGFTSDDARRSDDFSEQFEMARHPELLPFLAMNPSLYDDLYTWLA
FT                   AQGNADIDEALSKNAGYEDYRKAMGK"
FT   gene            436688..440326
FT                   /locus_tag="BLA_0336"
FT   CDS_pept        436688..440326
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0336"
FT                   /product="superfamily I DNA and RNA helicases and helicase
FT                   subunits"
FT                   /note="COG1112: Superfamily I DNA and RNA helicases and
FT                   helicase subunits"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28638"
FT                   /db_xref="GOA:B8DVY7"
FT                   /db_xref="UniProtKB/TrEMBL:B8DVY7"
FT                   /protein_id="ACL28638.1"
FT                   /translation="MSNTDTPETKAPTSGSIDKLRRWRDEYRASLMASPLEDVNQLSAK
FT                   LDLTHAHPSGISQLFASGSAPLHSLFRDSGMLRAAARRTERVLDDQSAKKRISGVAELS
FT                   LVVGVATWKGNKMPVLLYPVEVVRDGTPVENHTTITFTGHVRLNSAFLNAMRENGVNLD
FT                   ERALFDGSNYASGTPETAAVFAVITKAAQQVFADFSIERQIILGCFVDPSTQILMESRM
FT                   IIERLARGPINNVMLNALAGYPEAIEQLSRITLPPYSPFDGDPHSEYEVGDVDNTVRYA
FT                   ANVAAAGHSLFVDGTLGNDTAEQAASIASRCIMAGRSVLYVPCVTSQKRTFAMLMKANE
FT                   LGEQLLDVANPNANAAIDHQLISAVGYQQGVATSRFEQLADELVGVRSRLTRYLGDLHG
FT                   VNQTWGVSAYQTIQNLASISELPAHPMTRVRLTKECALAIGKSLDEWAKKLERAGELGE
FT                   YSVGPDDTAWYGASLYSEEEAIDAYQRVVNVLRSLLPATREQVTTTVKVCGFSIPQTAD
FT                   EWSKQVTVLKNLRRVLDVFQPEIFERDIDAMIEATESKQERKTSDSQMGFWDRRRHIKE
FT                   AKSMLRVGAQVEDLHEALLVVKRQGEQWRLFVPHGGWPVLPPKLDDIIATQEQLMSNLT
FT                   ALDTVLATTPAGAELQQQDFNALEERLKALFDDRKALDTLPERCVIERELKRAGLGELV
FT                   DDLRERKVKVDAVSNELRLAWWTTVFDDIVHSSAIISNQDGSALQAASDRFVQVDVEHV
FT                   RSIGPMIMQESMRRLCDLLFSRTQEANMMHTALAGASSISLSRIHQDHPEILAAAKPVI
FT                   MATPATLAAVTNPTPIADVVIIDAAAHLPSVLLLSILCRARQVVILAHRSTVTSEGIGM
FT                   LMSMLPNISVASHPTRRDPRVNRFLEEQGYGKVNTDVVREPMQGHIRFHKIEAAGVPLM
FT                   ASGLVESSQQEIAEVVRLITQRAQTFTLVPPSYLLTVVCLTSTFRTRLGAELRSLAAKS
FT                   EAMGRFLRHVRIVDIADVAGARATDVILSMSYAKTTHGRLLQQFGVLENNGGRGMLLDA
FT                   LALCDHHLDIVSAFGASDLDDDRLHQDGPKMLKVLLQWAEDLDEANVVRPAIKQTDENV
FT                   LFNDLATRIRERGLNVAVDYGYDGGMKLPMVVGLKDKPFALAVFTDDAQFMGMQSTRER
FT                   HRILPQEIESLGWSVMTIWSVGAFVNPEKEVDRVVARLGEIYQDKQ"
FT   gene            440361..440603
FT                   /locus_tag="BLA_0337"
FT   CDS_pept        440361..440603
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0337"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28639"
FT                   /db_xref="UniProtKB/TrEMBL:B8DVY8"
FT                   /protein_id="ACL28639.1"
FT                   /translation="MTNKNEEPTSSHDAARPYSATRRTPRVHRRVVHQGTERFDADGVK
FT                   PEPSEMQTAQQRQADDDKRILGELPPHWAVFEERQ"
FT   gene            complement(440622..441200)
FT                   /locus_tag="BLA_0338"
FT   CDS_pept        complement(440622..441200)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0338"
FT                   /product="cation transport ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28640"
FT                   /db_xref="InterPro:IPR013974"
FT                   /db_xref="UniProtKB/TrEMBL:B8DVY9"
FT                   /protein_id="ACL28640.1"
FT                   /translation="MLWQLRHMLLALSVGVALFCTLQCVALATATRQAVVAARDLDAGL
FT                   VIATGDVEMVEMPDHDALRHALGCPDDAVGLVTQTRIEKGDILLTTDVGELPQVPEHHT
FT                   VIDVRLGLGQHSFPIGTVVELRSTQACADDARASPEGCVVSSHAVVMAQPRLDDTGSTV
FT                   TQMAMSAVEALQVLAAQEHGTLIAARGAS"
FT   gene            complement(441418..441609)
FT                   /locus_tag="BLA_0339"
FT   CDS_pept        complement(441418..441609)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0339"
FT                   /product="putative regulatory protein, FmdB family protein"
FT                   /note="COG2331: Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28641"
FT                   /db_xref="InterPro:IPR013429"
FT                   /db_xref="UniProtKB/TrEMBL:B8DVZ0"
FT                   /protein_id="ACL28641.1"
FT                   /translation="MPIYHYRCKKCGYDFTKEQSFSDDPIKVCPQCGAEQVHKVYAAVP
FT                   ITFKGSGFYRTDSHSSSK"
FT   gene            complement(441741..442448)
FT                   /locus_tag="BLA_0340"
FT   CDS_pept        complement(441741..442448)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0340"
FT                   /product="5-formyltetrahydrofolate cyclo-ligase"
FT                   /EC_number="6.3.3.2"
FT                   /note="COG0212: 5-formyltetrahydrofolate cyclo-ligase"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28642"
FT                   /db_xref="GOA:B8DVZ1"
FT                   /db_xref="InterPro:IPR002698"
FT                   /db_xref="InterPro:IPR024185"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:B8DVZ1"
FT                   /protein_id="ACL28642.1"
FT                   /translation="MAEAKRMLRHEVFVRRRGTSLSMSMQAGEQCAQIACEAGLFQSPS
FT                   RIIACHVSMGTEISTIPLLSIALGCGYTVLVPKMGVDLDLGWGVLRSLDDLLRLHVPDE
FT                   VAVDQMEPSLFPHAQTRRPGEPEGQTYPPEALQMCSTVIVPALLVNPAGVRLGRGAAWY
FT                   DRALRFAGPQADLMAMCWPWEFVDAPLPCEEHDVRMNAVLTPRGFTRLGSTGPTRAHTD
FT                   DPSCDSPAGEPDE"
FT   gene            442635..443318
FT                   /locus_tag="BLA_0341"
FT   CDS_pept        442635..443318
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0341"
FT                   /product="possible acetytransferase"
FT                   /EC_number="2.3.1.128"
FT                   /note="COG1670: Acetyltransferases, including N-acetylases
FT                   of ribosomal proteins"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28643"
FT                   /db_xref="GOA:B8DVZ2"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:B8DVZ2"
FT                   /protein_id="ACL28643.1"
FT                   /translation="MSVFQALHDVMKRRRNSAFTAPLTLKSPAGSPDLTLRTMDAADQE
FT                   EWGRLRSVNERWLAPWESSDPHGTEPLTFKSWVNRQREEEREGTSIIFLMEHEGEIVGQ
FT                   ISLGAIYPGPMRTGIIGYWIDEDHAGRGLTPLAVAMLADWALLDPTGPQLHRLEIDIVP
FT                   ENERSRRVVQKVGAKYEGVRRQYMYVHGEWRDHESYSLLDTDVPQGFVHRLLGDTPGES
FT                   LHNLS"
FT   gene            443340..444563
FT                   /locus_tag="BLA_0342"
FT   CDS_pept        443340..444563
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0342"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28644"
FT                   /db_xref="GOA:B8DVZ3"
FT                   /db_xref="UniProtKB/TrEMBL:B8DVZ3"
FT                   /protein_id="ACL28644.1"
FT                   /translation="MDYESLSTIVLVVIVAILMVSWLPRRTVQGMKQVIKHQSDRYSAS
FT                   LHLIDEGDGTRFSDARTVELKGTPMASPHTVRDREYVAQVRDLRRAAARRRKILVGALL
FT                   GISVLVFVLAVILVFSPYFTLIPIALMCVVLALGAHASRQAREWEDRHAQRQRELKERK
FT                   VRENKRVVEERTRAAHPEPSARRQMQDGSQTDVMEAREIHQALQRAREEQARAIARRKA
FT                   QDTRDHHADEASLRSGMRAEHADVDAAVQAAEEATHNPGHLTIREERAAQMSDETNELA
FT                   QINASSAPDAFDMAVNQDLISFSLGSDPFDGPEVVQSMEIKSTRQVSKAVPKDSSSAKP
FT                   ADAGAAESRDAAADNADVKEAQTVSAVSVNDSVAFHNSEAQANVEAPDASSDSLGVDLQ
FT                   SILARRGN"
FT   gene            444785..445081
FT                   /gene="groES"
FT                   /locus_tag="BLA_0343"
FT   CDS_pept        444785..445081
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="groES"
FT                   /locus_tag="BLA_0343"
FT                   /product="HSP10"
FT                   /note="COG0234: Co-chaperonin GroES (HSP10)"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28645"
FT                   /db_xref="GOA:B8DVZ4"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR018369"
FT                   /db_xref="InterPro:IPR020818"
FT                   /db_xref="InterPro:IPR037124"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8DVZ4"
FT                   /protein_id="ACL28645.1"
FT                   /translation="MSFPLTPLEDKIIVKQAEAETQTASGLIIPDNAKEKPQQGEVLAV
FT                   GPGRRDDEGKRVPMDVKVGDKVLYSKYGGTEVHFKGEEYLIVSARDLLAVVND"
FT   gene            445471..445552
FT                   /locus_tag="BLA_t0012"
FT   tRNA            445471..445552
FT                   /locus_tag="BLA_t0012"
FT                   /product="tRNA-Tyr"
FT   gene            445554..445628
FT                   /locus_tag="BLA_t0013"
FT   tRNA            445554..445628
FT                   /locus_tag="BLA_t0013"
FT                   /product="tRNA-Thr"
FT   gene            445630..445706
FT                   /locus_tag="BLA_t0014"
FT   tRNA            445630..445706
FT                   /locus_tag="BLA_t0014"
FT                   /product="tRNA-Met"
FT   gene            445788..445919
FT                   /gene="rpmG"
FT                   /locus_tag="BLA_0344"
FT   CDS_pept        445788..445919
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmG"
FT                   /locus_tag="BLA_0344"
FT                   /product="ribosomal protein L33"
FT                   /note="COG0267: Ribosomal protein L33"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28646"
FT                   /db_xref="GOA:B8DVZ5"
FT                   /db_xref="InterPro:IPR001705"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="InterPro:IPR018264"
FT                   /db_xref="InterPro:IPR038584"
FT                   /db_xref="UniProtKB/TrEMBL:B8DVZ5"
FT                   /protein_id="ACL28646.1"
FT                   /translation="MACTVCKERNYITTKNRRNTPDRLELKKFCPKCGKQTLHRETR"
FT   gene            446115..447233
FT                   /gene="murB"
FT                   /locus_tag="BLA_0345"
FT   CDS_pept        446115..447233
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murB"
FT                   /locus_tag="BLA_0345"
FT                   /product="UDP-N-acetylenolpyruvoylglucosamine reductase"
FT                   /EC_number="1.3.1.98"
FT                   /note="COG0812: UDP-N-acetylmuramate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28647"
FT                   /db_xref="GOA:B8DVZ6"
FT                   /db_xref="InterPro:IPR003170"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR011601"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="InterPro:IPR036635"
FT                   /db_xref="UniProtKB/TrEMBL:B8DVZ6"
FT                   /protein_id="ACL28647.1"
FT                   /translation="MIGGGSNMLASDDEFHGVVIRDARRNIIVPDEAAPVEGGDYTVHV
FT                   NAEAGVNWDDLVQFCVERGLEGLEGLSGIPGTVGASVVQNIGAYGQEVASAVESVEVWD
FT                   REEKKTLDMSNVDMQFGYRFSLLKRSMYKAPGVPNAQYYPTPRYIVLSVTFALVHTGTG
FT                   TVNYPQLASALNVNLHDRMPIDRIRAAVLEVRASKGMLEDATRYREPIMMGTKRADQVE
FT                   AAIAAQHAFREQHDGAARDMIIDIASDTGTNSDPNRRSCGSFFMNPIISEADAARLPED
FT                   APRFPATLPDGSTGVKTSAAWLIDHAGFHKGYKLSDDARAGLSTLHTLSITNRGGATCN
FT                   DIVKLADAIRDGVRKQFGVTLIPEPVLVNVTL"
FT   gene            447491..449095
FT                   /locus_tag="BLA_0346"
FT   CDS_pept        447491..449095
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0346"
FT                   /product="possible cationic amino acid transporter"
FT                   /note="COG0531: Amino acid transporters"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28648"
FT                   /db_xref="GOA:B8DVZ7"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:B8DVZ7"
FT                   /protein_id="ACL28648.1"
FT                   /translation="MQIFRTKSVEQTLAETEEEGHSLKRNLGWWDLAVMGVAVAVGAGI
FT                   FSVGAQAAAFHAGPAVIISFIIAGIVCGAAVMCYAEFASVMPVAGSAYTFTYATLGEIF
FT                   AWIIGWDLILEMLMAGSVISKFWGVYLNDFLRLMGVNFNTNIMIGSFHLDIAPIVIVAF
FT                   FTTLLVLGTKIGARVDGAMTVLKIAVVLFVVIVGFFYVKASNYTPFIPPAEPSADVANA
FT                   TTVHGTLGQPLFQWLTHMSPTIYGVPGIISGAALVFFAFIGFDVVATASEETRNPKRNV
FT                   PLGIGVGMSLIIVMYVLVAIVTTGMVSYKQLASVESPSLATAFELVGADWAAKIISFGI
FT                   CLGLATVVMVLLLGLTRVVFAMSRDGLLPRTLSTTGKHGTPARLQIVVGVVVAIIAACF
FT                   NIDVLSDMVNIGTLSAFTLVALAIPIMRKRRPDLKRSFRMPGNPWVPLLVALANFYLML
FT                   NLTVLTWIRFLIWLVVGFIIYFAYGYNHARVGTGELDAEVVKYEKQRQLKAQRAKQSGS
FT                   VGRGNDAAVTKVEAGKD"
FT   gene            449261..449584
FT                   /gene="fdxC"
FT                   /locus_tag="BLA_0347"
FT   CDS_pept        449261..449584
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fdxC"
FT                   /locus_tag="BLA_0347"
FT                   /product="ferredoxin"
FT                   /note="COG1146: Ferredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28649"
FT                   /db_xref="GOA:B8DVZ8"
FT                   /db_xref="InterPro:IPR000813"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:B8DVZ8"
FT                   /protein_id="ACL28649.1"
FT                   /translation="MAYVIAQPCVDVKDKACVDECPVDCIYEGKRSLYINPNECVDCGA
FT                   CEPVCPTEAIFYEDDLPPEWEWYKDAAVEFFAEVGDLGGAQAAGPIGKDPQRVADLPPQ
FT                   NAA"
FT   gene            449679..450836
FT                   /locus_tag="BLA_0348"
FT   CDS_pept        449679..450836
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0348"
FT                   /product="probable aminotransferase"
FT                   /note="COG0436: Aspartate/tyrosine/aromatic
FT                   aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28650"
FT                   /db_xref="GOA:B8DVZ9"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR019880"
FT                   /db_xref="UniProtKB/TrEMBL:B8DVZ9"
FT                   /protein_id="ACL28650.1"
FT                   /translation="MGFKDFSTPYDWSRVGRYKRIAQAVPGGMVDLSVGSPVDAVPDSV
FT                   RKALAVSANDANACGYPVTGGTADLRRAICEWFRGCRDVEIEAIGADVVPTVGSKEGVA
FT                   MMASLLQLSSGDVVVQPRVSYPTYEIGTQVAGATVVKVDDVAAVDSWRNIPGVKAIWVN
FT                   SPSNPTGAVLSAAQLHDIVNAAREIGAVVLSDECYALMNWTKANDDEGNREAAIESSPC
FT                   ALRADVCDGRADGVVVLYSLSKQSNMAGYRTALLAGDAQIISRMTAFRKQLGLIMPGPV
FT                   QAAMAAGLRDAASVRAQHNRYHDRLGELVCALRGYGYRVNMPQGALYVWTKAKSADCWT
FT                   DMKALASIGIIASPGEFYGAPEYLRFSATATDEQIHRACERLAQA"
FT   gene            complement(450874..452190)
FT                   /locus_tag="BLA_0349"
FT   CDS_pept        complement(450874..452190)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0349"
FT                   /product="DNA-damage-inducible protein P"
FT                   /EC_number="2.7.7.7"
FT                   /note="COG0389: Nucleotidyltransferase/DNA polymerase
FT                   involved in DNA repair"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28651"
FT                   /db_xref="GOA:B8DW00"
FT                   /db_xref="InterPro:IPR001126"
FT                   /db_xref="InterPro:IPR017961"
FT                   /db_xref="InterPro:IPR022880"
FT                   /db_xref="InterPro:IPR036775"
FT                   /db_xref="UniProtKB/TrEMBL:B8DW00"
FT                   /protein_id="ACL28651.1"
FT                   /translation="MSTAPRIEAAKRDWGHDETGCTILHIDMDAFFASLEIARHPEFRG
FT                   KPVIVGTGNRAVVSAASYEARKYGINSAMPAARAHQLCPNGIFLPVDHHYYSAVSHEIF
FT                   HTVFREVTDRIEQVSVDECYMDVSGALLAWHSPTRIAQWLRAQVAERFGITCSVGIAGN
FT                   KLVAKMASTNAKPNGMLLIPLDKHAQFVQLMPLRGIPGLGPAQEKRLNAWGINSVSQLA
FT                   RCSVEELIQATGSKAAATHLWEASHGIDPCTLTLHAPEKSIGQERTFDTDCNDLATAST
FT                   LIKQCCDKVASILRAKGLMARTLTVKLRFPDLAYSTKQMQLEQPTDAASTLYPHAIDLL
FT                   LRMMGMPADCRGTEVKLTRPIRLAGISTSTLTKREETVIQPTLDELLEENERVAPMPQA
FT                   SSSIPSPANGTRSTRLRCAEEAVDQIRRKFGQDSAHLGA"
FT   gene            452359..452449
FT                   /locus_tag="BLA_t0015"
FT   tRNA            452359..452449
FT                   /locus_tag="BLA_t0015"
FT                   /product="tRNA-Ser"
FT   gene            452810..453817
FT                   /locus_tag="BLA_0350"
FT   CDS_pept        452810..453817
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0350"
FT                   /product="possible 2-hydroxyacid dehydrogenase"
FT                   /EC_number="1.1.1.95"
FT                   /note="COG0111: Phosphoglycerate dehydrogenase and related
FT                   dehydrogenases"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28652"
FT                   /db_xref="GOA:B8DW01"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B8DW01"
FT                   /protein_id="ACL28652.1"
FT                   /translation="MTQILETQPERTDLPLTVMPCVVADMIEPFKANFEVLRDVTRLRM
FT                   YTDTTLDPDEIVRRCEGADAVIVIGVHIDDNLYTRLTHTQGHAKCFAFGGTGVASYIDL
FT                   ARARQDGVRVCNVRRYGDAAVAELAIALMMELARHVGELDTQVREGSWHGVFGTELAGK
FT                   TLGLVGFGGIGQHVARIANGFGMRIQVWNSHVHADALAANPEIALVDGIDDLMATSDIV
FT                   SLHLPLTDETRGGITFENLNHLRPGSMLINTARAEIIAPGALERRLERGDLLAGLDVFD
FT                   KEPLPQDSPLRSVPGVVLTPHVAWRADGAYASLTRQVMEAIVSFYEGGDFNVVV"
FT   gene            453874..454509
FT                   /locus_tag="BLA_0351"
FT   CDS_pept        453874..454509
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0351"
FT                   /product="thymidylate synthase"
FT                   /note="COG1739: Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28653"
FT                   /db_xref="InterPro:IPR001498"
FT                   /db_xref="InterPro:IPR015269"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR023582"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR036956"
FT                   /db_xref="UniProtKB/TrEMBL:B8DW02"
FT                   /protein_id="ACL28653.1"
FT                   /translation="MRTLLNPADEPAHDAFVEKKSEFIGDACHVDSLEDALAFVETVRE
FT                   RHPKARHVAYAAIVTGDDGRVMERMSDDGEPSGTAGKPILDVLRANELTDCVIAVTRYF
FT                   GGILLGSGGLIRAYSTGASIAVKAADVAQIVVCARYAVPLDYSQLGPMRHLVEVMGAVE
FT                   ESADFSDHVVLIVLVRDDARESFEHRVREQFSATVTPEYVGRCHRAMR"
FT   gene            454620..455306
FT                   /locus_tag="BLA_0352"
FT   CDS_pept        454620..455306
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0352"
FT                   /product="AbrB family trancriptional regulator fused to LRR
FT                   containing domain"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28654"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:B8DW03"
FT                   /protein_id="ACL28654.1"
FT                   /translation="MADGEQTAQTARNTQADGVQDAAGNQGEASEAQTPQFEPLTVTYE
FT                   RLRHSTDPQELHEFARRPLPDRAKQAAFSRATALLEAVAGNQHTPLEDRVFLAETMPFP
FT                   NVLVKLSEDPSPEVRRAVAANRDDKNWLVGRLTKDEVPEVRDEALRNPQTSWKMRMEGA
FT                   QNPEVDAQTLDFLSRLGVELEPDAPRILSTMVRRGVALNPNAGAETIERLKEDPVPEVA
FT                   KAAQRR"
FT   gene            455415..457583
FT                   /gene="malQ"
FT                   /locus_tag="BLA_0353"
FT   CDS_pept        455415..457583
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="malQ"
FT                   /locus_tag="BLA_0353"
FT                   /product="4-alpha-glucanotransferase"
FT                   /EC_number="2.4.1.25"
FT                   /note="COG1640: 4-alpha-glucanotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28655"
FT                   /db_xref="GOA:B8DW04"
FT                   /db_xref="InterPro:IPR003385"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:B8DW04"
FT                   /protein_id="ACL28655.1"
FT                   /translation="MAELNEESPERLARPLIRLAQSLGVATSYVGMSRDFHEIPDDVLV
FT                   AVLKALNVDASSEETIEVSLEHVNNQRAMRLIEPTVLHIVGEQSHVPIHLAITEAPKVT
FT                   ITLEDGTIYQHDIAVEPLPDVKVHEVNGKFFSTAQIALPADLPEGYHTLHIAAGQREAD
FT                   ATLISAPQRIPLLDPLKNGSLWGWMAQLYSIRSADSWGVGDFADLRTLLIDSKRYTNAD
FT                   FMLINPVHAGEPVSPLTPSPYLPVSRRFINYTYIHPEDIPEYYALDDAAKQSVKDAHAK
FT                   MEAYNADPNLIDRDAMWLEKEKALRTIFNTGLQSVRQQAFDDYKARCGEDLEAYATWCV
FT                   CYAKWGKPENTPDNWINKYTKDSPEVKQLREQNSDLLEFYRWLEWIAVEQMHAAQQAAR
FT                   QAGMKIGIMSDMAVGVHPDGSEVWWNPERFANGATVGAPPDMFNQQGQNWSQPPLSPLS
FT                   LKETGYKAYREMVRGMFDCAGAVRIDHILGLFRLWWIPEGQPASNGTYVYYDHNTMLGI
FT                   LAIEADRVGGLIVGEDLGVVPSYVQQSLADYAIFGCAVEWFEQMDGVFIPPKDWRPYAL
FT                   ASVDNHDMPPAAGYLEYEHVRVREQLGLLGEDSSAFERSARAEHQAMLQMLVDNGYLDV
FT                   NVMKDESGRWEEIVEALYRALNSSPCKLKAVSFVDAVGERRTQNQPGTDNEYPNWRVPL
FT                   ADYHGDNVPLEHLFDSDLLQRIAKIMNS"
FT   gene            457865..458314
FT                   /gene="rplM"
FT                   /locus_tag="BLA_0354"
FT   CDS_pept        457865..458314
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplM"
FT                   /locus_tag="BLA_0354"
FT                   /product="ribosomal protein L13"
FT                   /note="COG0102: Ribosomal protein L13"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28656"
FT                   /db_xref="GOA:B8DW05"
FT                   /db_xref="InterPro:IPR005822"
FT                   /db_xref="InterPro:IPR005823"
FT                   /db_xref="InterPro:IPR036899"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8DW05"
FT                   /protein_id="ACL28656.1"
FT                   /translation="MKTFTPKPADLTHDWYIIDAKDVVLGRLSVAAANLLRGKNKPSFA
FT                   PHADSGNYVIIINADKIALTGDKMDKELYSHSGRPGGLRRDSYAELLKNKPERIIMHAV
FT                   KGMLPKNKLAKVQLTRLRVFAGEEHPHVGQNPQVYEIEQISQQAK"
FT   gene            458334..458825
FT                   /gene="rpsI"
FT                   /locus_tag="BLA_0355"
FT   CDS_pept        458334..458825
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsI"
FT                   /locus_tag="BLA_0355"
FT                   /product="30S ribosomal protein S9"
FT                   /note="COG0103: Ribosomal protein S9"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28657"
FT                   /db_xref="GOA:B8DW06"
FT                   /db_xref="InterPro:IPR000754"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020574"
FT                   /db_xref="InterPro:IPR023035"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8DW06"
FT                   /protein_id="ACL28657.1"
FT                   /translation="MAENTNNSAVTETEETTAAFTTETNSGAGTGTSTIAPGYGTGRRK
FT                   EAVARVRLVPGTGEWKINGRTLEEYFPSKLLQREVNSPIVLLKLEGKFDAIVLVDGGGT
FT                   TGQAGAIRLGVARALNAIDRDANRAALKKAGFLTRDARVVERKKAGLHKARRAPQFSKR
FT                   "
FT   gene            complement(458933..461629)
FT                   /gene="glgX"
FT                   /locus_tag="BLA_0356"
FT   CDS_pept        complement(458933..461629)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glgX"
FT                   /locus_tag="BLA_0356"
FT                   /product="glycogen debranching enzyme GlgX"
FT                   /note="COG1523: Type II secretory pathway, pullulanase PulA
FT                   and related glycosidases"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28658"
FT                   /db_xref="GOA:B8DW07"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR011837"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:B8DW07"
FT                   /protein_id="ACL28658.1"
FT                   /translation="MQLQKLQRYATRPGFFYTDDGGADVVVRSETAEQLWLSVLEPVDK
FT                   PSAFYNQAVRLPDDAADRLLDYMRHYPICSRIVPALGLRETLFKMTGPNYGLWNLHLDK
FT                   AWDGLQYGFRADGTWDPHHGLRFNPYKFLIDPYAKGIERAMQLDPSMFAYQCTIGDDGK
FT                   VEGDSWGEMSTLDSLGHCPVSVAIDDRDARKHDGDPEHPHVPWSKTVIYELHVKGFTKN
FT                   APWLPEELRGTYAGLAHPTTLAYLQDLGVTSIELLPIMAKQPEVFLQERVRTNYWGYST
FT                   LNFFSPEPGYATKKAQQAGAAAVRREVIDMVRALHESGFEVIMDVVYNHTCEGGNAGPS
FT                   VCWRGLDNLSFYRQQTQHAGELEDTTGCGNTVDFTDTHNITFAVDSLRYWAKRIGIDGF
FT                   RFDLAVSLARLKGMFTPYHPFLYALRSDQLLGNLKLIMEPWDLGFQGWRTGQFLSPFGE
FT                   WNDRFRDASRQFWLSDINQTAGHGVTTMQEMATRLCGSADLFATDPGRGATSSINYISA
FT                   HDGFTLADLTSYDHKHNEANGENNNDGTNVNHSANFGVEGPTDDLSIESARERSRMNML
FT                   GTLILSLGTPMLLAGDEFGNTQYGNNNAYCQDNEIAWLDWDWINCTEETAESRQLEATA
FT                   NLIAVRKSLDIYNHEDFFTRLSQLGLLKPSSRVQWSLPDGTMPMDSDWRDPSVRSFMMH
FT                   LYFKDEPDALIVVNGDETDRRMHLPSDSTFNLLWSSAQTTGEQPAPGTSVTKILRSAAV
FT                   SPLAETLRFKRATSPLHDLDAHGAVGADAEENAARQEIGTTKPTAKLTAHETQLLESIL
FT                   DRKIKDTLDQQMPPMTAGAHSGTGDPTRISMADSDPTTTAFDVEHDAPTPEDTAPAAGS
FT                   PNAVPSNVWTFPALSISLLLQSERRSW"
FT   gene            complement(461688..462779)
FT                   /locus_tag="BLA_0357"
FT   CDS_pept        complement(461688..462779)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0357"
FT                   /product="probable repressor in the Rok (NagC/XylR) family"
FT                   /note="COG1940: Transcriptional regulator/sugar kinase"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28659"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B8DW08"
FT                   /protein_id="ACL28659.1"
FT                   /translation="MESTTVKRHNRELILRELFAAPSMTKRQIADATRLSMPTITENLR
FT                   ELAADGLIVPAEARASTGGRKAQTWQFNARHRTAIGVALRPTEVVCMAVDLRGNVIAEH
FT                   KVTMARRNDNAYYERAAHTISTFAQSLPSPIGVCFALPSSAARHCICVAEDWNAATESY
FT                   QGISRILTLPCSRIARNVAYATVELHNHPLLRNAVCLYLGEYINSAIVMDGVAREGNLE
FT                   HMQLDASGDICRCGSRGCLEVLCSSRQLTEEGESLPGFFGVLEQGERNHHVRMDRWLGS
FT                   LAHAVNNIRTFVPADVILCGPIADYLDDSEIAQLERLTTCAEHVNPSARNPQVMRGCCV
FT                   EYQDAVGAAQSLIPASHDGIPSD"
FT   gene            463186..465933
FT                   /gene="adh"
FT                   /locus_tag="BLA_0358"
FT   CDS_pept        463186..465933
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="adh"
FT                   /locus_tag="BLA_0358"
FT                   /product="putative alcohol dehydrogenase"
FT                   /EC_number="1.1.1.1"
FT                   /EC_number="1.2.1.10"
FT                   /note="COG1012: NAD-dependent aldehyde dehydrogenases"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28660"
FT                   /db_xref="GOA:B8DW09"
FT                   /db_xref="InterPro:IPR001670"
FT                   /db_xref="InterPro:IPR012079"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR018211"
FT                   /db_xref="InterPro:IPR034789"
FT                   /db_xref="InterPro:IPR039697"
FT                   /db_xref="UniProtKB/TrEMBL:B8DW09"
FT                   /protein_id="ACL28660.1"
FT                   /translation="MADKNSAETATKAAKLAVNVEDKKAAAQAEVDALVRKAQKALAEF
FT                   EKLDQQAVDRIVAKASVAALNKHLVLAKLAVDETGRGLVEDKATKNIFACEHVTNYMAG
FT                   QKTVGIIREDDVLGIDEVAEPVGVVAGVTPVTNPTSTAIFKSLIALKTRCPIVFGFHPG
FT                   AQKSSVEAARIVRDAAIEAGAPENCVQWIEHPSIEATGALMQHPGVATILATGGPGMVK
FT                   AAYSSGKPALGVGAGNAPAYVDNNVDVQRVANDLILSKHFDYGMICATEQAIIAHKDIY
FT                   APLVKELKRRKAYFVNDEEKAKLEKYMFGCTAFSGETPKLNSVVPGKSPQYIAHEAGFE
FT                   IPEDATILAAECSEVGENEPLTMEKLAPVHAVLKFSDKEQGFEMCEEMLKHGAGHTAAI
FT                   HTNNDDLVREYGLRMHACRIIWNQPSSLGGIGDIYNSIAPSLTLGCGSYGGNSVSGNVQ
FT                   AINLLNIKRIARRNNNMQWFKIPAKTYFEPNAIKYLRDMYGIERAVIVCDKVMEQLGIV
FT                   DKVIDQLRARSNRVTFRIVDYVEPEPSVETVERGAAMMRDEFEPDTIIAVGGGSPMDAA
FT                   KIMWLLYEHPEIAFSDVREKFFDIRKRAFKIPPLGTKAKLVCIPTSSGTGSEVTPFAVI
FT                   TDHKTGYKYPITDYALTPSVAIVDPVLARTQPRRLASDAGFDALTHSMEAYVSVYANDF
FT                   TDGMALHACKLIWDNLAESVNSEPGETKKKAQEKMHNAATMAGMAFGSAFLGMCHAMAH
FT                   TIGALCHIAHGRTNSILLPYVIRYNGQVPEEPTSWPKYSKYIAPERYQELASLLGVDPG
FT                   KTPAEGVENLAKAVEDYRDNKLGMNKSFKDCGVDEDYFWSILEQIGMRAYEDQCAPANP
FT                   RIPQIQDMMDIAIAAYYGVSQAEGHAMRVEREGVGATEEASERV"
FT   gene            complement(466249..467223)
FT                   /locus_tag="BLA_0359"
FT   CDS_pept        complement(466249..467223)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0359"
FT                   /product="CTP synthase (UTP-ammonia lyase)"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28661"
FT                   /db_xref="GOA:B8DW10"
FT                   /db_xref="UniProtKB/TrEMBL:B8DW10"
FT                   /protein_id="ACL28661.1"
FT                   /translation="MTELDCEARRQQRCICASDSRQAKMLARRCAGGELVRVYRGMYAH
FT                   AQFWRTLPPPVQIVYLARALAKSHPDWVFNGETAACVRNLQIPWHALTHRVTIACTAGP
FT                   QKSDGPRLQRIRHPNMRAEIIDGIPVTPLVCTASDCVLTMEPCAAITALDGCFKTGLST
FT                   RELLRECAANGTDAVVTLLPHVNPASENGGEAYAHAVMTARYGFRKPQQQVPLTDPQTG
FT                   HIYRADYYWVCDDGTVIVAELDGAQKYIDPQMTGSRSVHAVVADEREREKALERAGVHR
FT                   TVRFTFDDVIHSERLHAKLHSAGVPTHFLGSTDINGYRVAIIG"
FT   gene            467383..468168
FT                   /locus_tag="BLA_0360"
FT   CDS_pept        467383..468168
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0360"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28662"
FT                   /db_xref="GOA:B8DW11"
FT                   /db_xref="InterPro:IPR025576"
FT                   /db_xref="UniProtKB/TrEMBL:B8DW11"
FT                   /protein_id="ACL28662.1"
FT                   /translation="MRDWRSNEPGAWVIVLMPALSAFLVSGPTWNSVWLLVLWCLCYCV
FT                   QFSAARWAKSHGRARYRMPMLVYAALLVCAGLPFVFRFPGMLWWAPIYCVLCAGSLICA
FT                   WRRREHSIPANICAVLASSTMAIPVASLGTHGGDAPALAHLLPFGQSILPPLGVEIAGA
FT                   YALTLFGSVLYVKTMIREQGNTRYLAASWIWHILVMAIGFLYSPIYGWLGAILLARAVV
FT                   MPVATRNMRKTAKIAGIGECVTSLVSFVMITYAATVLIP"
FT   gene            468446..468754
FT                   /gene="rpsJ"
FT                   /locus_tag="BLA_0361"
FT   CDS_pept        468446..468754
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsJ"
FT                   /locus_tag="BLA_0361"
FT                   /product="ribosomal protein S10"
FT                   /note="COG0051: Ribosomal protein S10"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28663"
FT                   /db_xref="GOA:B8DW12"
FT                   /db_xref="InterPro:IPR001848"
FT                   /db_xref="InterPro:IPR018268"
FT                   /db_xref="InterPro:IPR027486"
FT                   /db_xref="InterPro:IPR036838"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8DW12"
FT                   /protein_id="ACL28663.1"
FT                   /translation="MAGQKIRIRLKSYDHEVIDQSAKKIVETVTNAGATVVGPVPLPTE
FT                   KNVYCVIRSPHKYKDSREHFEMRTHKRLIDIVDPTPKAVDSLMHIDLPADVNIEIKL"
FT   gene            468772..469422
FT                   /gene="rplC"
FT                   /locus_tag="BLA_0362"
FT   CDS_pept        468772..469422
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplC"
FT                   /locus_tag="BLA_0362"
FT                   /product="50S ribosomal protein L3"
FT                   /note="COG0087: Ribosomal protein L3"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28664"
FT                   /db_xref="GOA:B8DW13"
FT                   /db_xref="InterPro:IPR000597"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR019926"
FT                   /db_xref="InterPro:IPR019927"
FT                   /db_xref="UniProtKB/TrEMBL:B8DW13"
FT                   /protein_id="ACL28664.1"
FT                   /translation="MSQNKNRNALLGKKLGMSQVWDENGFFVPVTLVEVSTNVVTAVKN
FT                   EETDGYKAVQLGYGQVDPRKVTKPMAGHFAKAGVTPRRHLAEVRTENVEDFEPGQELTA
FT                   EVFPEGVQVDVTGTTKGKGFAGTIKRWGFKSYRRTHGSHKNERRPGSVGACATPSRILK
FT                   GKRMAGRMGHVTNTVQNLTVVSSDVENGILAIKGAIPGPKGGIVLVRSAVKGA"
FT   gene            469428..470084
FT                   /gene="rplD"
FT                   /locus_tag="BLA_0363"
FT   CDS_pept        469428..470084
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplD"
FT                   /locus_tag="BLA_0363"
FT                   /product="50S ribosomal protein L4"
FT                   /note="COG0088: Ribosomal protein L4"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28665"
FT                   /db_xref="GOA:B8DW14"
FT                   /db_xref="InterPro:IPR002136"
FT                   /db_xref="InterPro:IPR013005"
FT                   /db_xref="InterPro:IPR023574"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8DW14"
FT                   /protein_id="ACL28665.1"
FT                   /translation="MANVTLNVTDNNGKEAGTLEAPEALFGFTAEEVQAHVPLIHQVVV
FT                   AQRAAARQGTHAVKNRGAVSGGGRKPWKQKGTGRARQGSIRAPQWYHGGVAHGPVPRDY
FT                   SQRTPKKMKAAALRYALSDRANNGRVAVVDFQLDAPSTKKAIAALAPVVADNFTTVVLS
FT                   RDNVNEWLSVRNIPTVYPIFADQLNTYDVITAQYVVFSKDGLEAFVAAKTAAKEA"
FT   gene            470089..470385
FT                   /gene="rplW"
FT                   /locus_tag="BLA_0364"
FT   CDS_pept        470089..470385
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplW"
FT                   /locus_tag="BLA_0364"
FT                   /product="50S ribosomal protein L23"
FT                   /note="COG0089: Ribosomal protein L23"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28666"
FT                   /db_xref="GOA:B8DW15"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR012678"
FT                   /db_xref="InterPro:IPR013025"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8DW15"
FT                   /protein_id="ACL28666.1"
FT                   /translation="MVAIHKPAHDIILKPVVSEKSYALSDMGQYTFVVAPNANKVQIKQ
FT                   AIEEIFKVKVTNVNTLNRAGKRTRTRTGYGRRVNQKRAIVTVAEGQSIDIFGN"
FT   gene            470423..471253
FT                   /gene="rplB"
FT                   /locus_tag="BLA_0365"
FT   CDS_pept        470423..471253
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplB"
FT                   /locus_tag="BLA_0365"
FT                   /product="ribosomal protein L2"
FT                   /note="COG0090: Ribosomal protein L2"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28667"
FT                   /db_xref="GOA:B8DW16"
FT                   /db_xref="InterPro:IPR002171"
FT                   /db_xref="InterPro:IPR005880"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR014726"
FT                   /db_xref="InterPro:IPR022666"
FT                   /db_xref="InterPro:IPR022669"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8DW16"
FT                   /protein_id="ACL28667.1"
FT                   /translation="MAIRVYKPTTPGRRNASVSDFSDLTRSTPEKSLIRKNSKTGGRNN
FT                   YGRMTSRHRGGGHKRQYRLIDFRRWDKDGVPATVAQIEYDPNRSARIALLHYADGEKRY
FT                   IIAPEGIKQGDRIETGANADIKPGNNLPLRNIPTGTVVHAIELRPLGGAKIARSAGAAV
FT                   QLVAKDGAYAQLRMPSGEIRNVDARCRATVGEVGNSDHANIQLGKAGRARWMGKRPITR
FT                   GESMNPVDHPHGGRTRGGKPPVSPWGKGEVRTRRPKKASNKMIVRRRPNGKNRK"
FT   gene            471269..471547
FT                   /gene="rpsS"
FT                   /locus_tag="BLA_0366"
FT   CDS_pept        471269..471547
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsS"
FT                   /locus_tag="BLA_0366"
FT                   /product="ribosomal protein S19"
FT                   /note="COG0185: Ribosomal protein S19"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28668"
FT                   /db_xref="GOA:B8DW17"
FT                   /db_xref="InterPro:IPR002222"
FT                   /db_xref="InterPro:IPR005732"
FT                   /db_xref="InterPro:IPR020934"
FT                   /db_xref="InterPro:IPR023575"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8DW17"
FT                   /protein_id="ACL28668.1"
FT                   /translation="MTRSIKKGPFVDAHLQKKVDEQNAKGTHNVIKTWSRRSMITPDFI
FT                   GHTFAVHDGRKHVPVFVTESMVGHKLGEFAPTRTFKGHVKDDKKSRR"
FT   gene            471569..471928
FT                   /gene="rplV"
FT                   /locus_tag="BLA_0367"
FT   CDS_pept        471569..471928
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplV"
FT                   /locus_tag="BLA_0367"
FT                   /product="ribosomal protein L22"
FT                   /note="COG0091: Ribosomal protein L22"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28669"
FT                   /db_xref="GOA:B8DW18"
FT                   /db_xref="InterPro:IPR001063"
FT                   /db_xref="InterPro:IPR005727"
FT                   /db_xref="InterPro:IPR018260"
FT                   /db_xref="InterPro:IPR036394"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8DW18"
FT                   /protein_id="ACL28669.1"
FT                   /translation="MEAKAIARHVRVTPRKARRMVDLIRGKKATEAITILKFAPQDAST
FT                   PVLKVLQSAIANARVKADKAGEPFRENDLYIKETYVDEGVTLKRFRARAQGRAARINKR
FT                   TSHITVVVASKEGDR"
FT   gene            471931..472764
FT                   /gene="rpsC"
FT                   /locus_tag="BLA_0368"
FT   CDS_pept        471931..472764
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsC"
FT                   /locus_tag="BLA_0368"
FT                   /product="ribosomal protein S3"
FT                   /note="COG0092: Ribosomal protein S3"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28670"
FT                   /db_xref="GOA:B8DW19"
FT                   /db_xref="InterPro:IPR001351"
FT                   /db_xref="InterPro:IPR004044"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR005704"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR018280"
FT                   /db_xref="InterPro:IPR036419"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8DW19"
FT                   /protein_id="ACL28670.1"
FT                   /translation="MGQKINPFGYRLGITESHRSKWFSDSNKVGERYRDFVLEDDAIRK
FT                   VMNKDLERAGVSRIIIERTRDRVRVDIHTARPGIVIGRRGAEAERVRAKLEKLTGKQVQ
FT                   LNIFEVKNPAIDAQLVAQGIAEQLTNRVTFRRAMRKAQQDAMRAGAKGIRIKLSGRLGG
FT                   AEMSRSEFYREGRVPLQTLRALIDYGFFEAKTTYGRIGVKVWIYKGDMTEREFEEQQAQ
FT                   QGNNRPGRRGGDRRPRRGQRAGQRPTGQNQVKTGPDQQMEAEVSKEAAVEPETKE"
FT   gene            472772..473191
FT                   /gene="rplP"
FT                   /locus_tag="BLA_0369"
FT   CDS_pept        472772..473191
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplP"
FT                   /locus_tag="BLA_0369"
FT                   /product="ribosomal protein L16"
FT                   /note="COG0197: Ribosomal protein L16/L10E"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28671"
FT                   /db_xref="GOA:B8DW20"
FT                   /db_xref="InterPro:IPR000114"
FT                   /db_xref="InterPro:IPR016180"
FT                   /db_xref="InterPro:IPR020798"
FT                   /db_xref="InterPro:IPR036920"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8DW20"
FT                   /protein_id="ACL28671.1"
FT                   /translation="MLIPKRTKYRKQHRPDRHGMSKGGNEINFGDFAIQALAPAYVTNR
FT                   QIEAARIAMTRYIKRGGKVWITIFPDRPLTKHPLGARMGSGKGTPEFWIANVHPGRVMF
FT                   EIGGVSEDVAREALRRAIDKLPMKCRVIAREGGDI"
FT   gene            473191..473439
FT                   /gene="rpmC"
FT                   /locus_tag="BLA_0370"
FT   CDS_pept        473191..473439
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmC"
FT                   /locus_tag="BLA_0370"
FT                   /product="ribosomal protein L29"
FT                   /note="COG0255: Ribosomal protein L29"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28672"
FT                   /db_xref="GOA:B8DW21"
FT                   /db_xref="InterPro:IPR001854"
FT                   /db_xref="InterPro:IPR018254"
FT                   /db_xref="InterPro:IPR036049"
FT                   /db_xref="UniProtKB/TrEMBL:B8DW21"
FT                   /protein_id="ACL28672.1"
FT                   /translation="MPVGSEEYTIKNLNEKTNAEIEGFIKKSKEELFNLRFQHATGQLE
FT                   NTARLKAVKRDIARMYTVLRERELGISQAPAATETKA"
FT   gene            473449..473709
FT                   /gene="rpsQ"
FT                   /locus_tag="BLA_0371"
FT   CDS_pept        473449..473709
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsQ"
FT                   /locus_tag="BLA_0371"
FT                   /product="30S ribosomal protein S17"
FT                   /note="COG0186: Ribosomal protein S17"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28673"
FT                   /db_xref="GOA:B8DW22"
FT                   /db_xref="InterPro:IPR000266"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019979"
FT                   /db_xref="InterPro:IPR019984"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8DW22"
FT                   /protein_id="ACL28673.1"
FT                   /translation="MAEERNFRKVRRGYVVSDKMDKTISVELELRTTHPLYGKVVRSTR
FT                   TVKAHDENNQAHVGDLVSIMETRPLSKTKRWRLDSIIERAK"
FT   gene            473798..474166
FT                   /gene="rplN"
FT                   /locus_tag="BLA_0372"
FT   CDS_pept        473798..474166
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplN"
FT                   /locus_tag="BLA_0372"
FT                   /product="ribosomal protein L14"
FT                   /note="COG0093: Ribosomal protein L14"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28674"
FT                   /db_xref="GOA:B8DW23"
FT                   /db_xref="InterPro:IPR000218"
FT                   /db_xref="InterPro:IPR005745"
FT                   /db_xref="InterPro:IPR019972"
FT                   /db_xref="InterPro:IPR036853"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8DW23"
FT                   /protein_id="ACL28674.1"
FT                   /translation="MIQQETRLHVADNTGAKELLAIRVLGGSKRRYAGIGDVIVASVKD
FT                   AIPGGSVKKGDVVKAVVVRTVKERRRADGSYIKFDENAAVILGSGREPKGTRIFGPVGR
FT                   ELRDKRFMRIVSLAPEVI"
FT   gene            474168..474503
FT                   /gene="rplX"
FT                   /locus_tag="BLA_0373"
FT   CDS_pept        474168..474503
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplX"
FT                   /locus_tag="BLA_0373"
FT                   /product="ribosomal protein L24"
FT                   /note="COG0198: Ribosomal protein L24"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28675"
FT                   /db_xref="GOA:B8DW24"
FT                   /db_xref="InterPro:IPR003256"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR005825"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR041988"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8DW24"
FT                   /protein_id="ACL28675.1"
FT                   /translation="MVAKIKSGDLVKVIRGKDRGKEGTVKRVLKDDRLIVEGVQIVKKH
FT                   VRATQQGQQAGIVSVEAPIHRSNVMVIDPETKQPTRVGVVIKEEARDGKVKTVRVRVAK
FT                   KSGKELA"
FT   gene            474500..475084
FT                   /gene="rplE"
FT                   /locus_tag="BLA_0374"
FT   CDS_pept        474500..475084
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplE"
FT                   /locus_tag="BLA_0374"
FT                   /product="50S ribosomal protein L5"
FT                   /note="COG0094: Ribosomal protein L5"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28676"
FT                   /db_xref="GOA:B8DW25"
FT                   /db_xref="InterPro:IPR002132"
FT                   /db_xref="InterPro:IPR020930"
FT                   /db_xref="InterPro:IPR022803"
FT                   /db_xref="InterPro:IPR031309"
FT                   /db_xref="InterPro:IPR031310"
FT                   /db_xref="UniProtKB/TrEMBL:B8DW25"
FT                   /protein_id="ACL28676.1"
FT                   /translation="MSEVVDEVIIEEPVTPRLKTMYKEEILPELEKEFHHDNPMQIPRI
FT                   EKVVVSMGVGAAARDSKLIEGAVRDLTAITGQKPKITKAKKSVAQFHLREGQAIGAYVT
FT                   LRGDRMWEFLDRLLTLALPRIRDFRGINGHQFDGQGNYNFGLTEQSMFHEIDPDEIDHQ
FT                   RGMDITVVTTTKDDDEAYALLKLLGFPFKEN"
FT   gene            475086..475271
FT                   /gene="rpsZ"
FT                   /locus_tag="BLA_0375"
FT   CDS_pept        475086..475271
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsZ"
FT                   /locus_tag="BLA_0375"
FT                   /product="30S ribosomal protein S14 type Z"
FT                   /note="COG0199: Ribosomal protein S14"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28677"
FT                   /db_xref="GOA:B8DW26"
FT                   /db_xref="InterPro:IPR001209"
FT                   /db_xref="InterPro:IPR018271"
FT                   /db_xref="InterPro:IPR023053"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8DW26"
FT                   /protein_id="ACL28677.1"
FT                   /translation="MAKTCLKVKALRKPKFKVRAYTRCMVCGRPHSVYRKFGLCRICLR
FT                   EKAHRGELPGVTKSSW"
FT   gene            475359..475757
FT                   /gene="rpsH"
FT                   /locus_tag="BLA_0376"
FT   CDS_pept        475359..475757
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsH"
FT                   /locus_tag="BLA_0376"
FT                   /product="30S ribosomal protein S8"
FT                   /note="COG0096: Ribosomal protein S8"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28678"
FT                   /db_xref="GOA:B8DW27"
FT                   /db_xref="InterPro:IPR000630"
FT                   /db_xref="InterPro:IPR035987"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8DW27"
FT                   /protein_id="ACL28678.1"
FT                   /translation="MTMTDPIADMLTRLRNASAAKHETVDMPYSKFKKNIAEILKREGY
FT                   IADFTAKEARVGQTLEVTLKYGPHGERSIQGIKRVSKPGLRRYAKSDALPMPLGGLGIA
FT                   IISTSSGLLTQKECLDRGIGGEIVAYVW"
FT   gene            475774..476313
FT                   /gene="rplF"
FT                   /locus_tag="BLA_0377"
FT   CDS_pept        475774..476313
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplF"
FT                   /locus_tag="BLA_0377"
FT                   /product="50S ribosomal protein L6"
FT                   /note="COG0097: Ribosomal protein L6P/L9E"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28679"
FT                   /db_xref="GOA:B8DW28"
FT                   /db_xref="InterPro:IPR000702"
FT                   /db_xref="InterPro:IPR002358"
FT                   /db_xref="InterPro:IPR019906"
FT                   /db_xref="InterPro:IPR020040"
FT                   /db_xref="InterPro:IPR036789"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8DW28"
FT                   /protein_id="ACL28679.1"
FT                   /translation="MASHIGKLPIEIPAGVEVTINGQEFAAKGAKGSDSYTIPEGVTAK
FT                   VEGNEIIVTANDDLRPTRAKHGLARSIVASMVKGVHDGYSKSLDIVGTGYRAQMKGKGI
FT                   EFSLGYSHTITVNPPEGITLELPNPNQVIVKGTDKQAVGQVAANIRKLRAPEPYKGKGI
FT                   KYSDEVIRRKAGKAGK"
FT   gene            476315..476686
FT                   /gene="rplR"
FT                   /locus_tag="BLA_0378"
FT   CDS_pept        476315..476686
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplR"
FT                   /locus_tag="BLA_0378"
FT                   /product="ribosomal protein L18"
FT                   /note="COG0256: Ribosomal protein L18"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28680"
FT                   /db_xref="GOA:B8DW29"
FT                   /db_xref="InterPro:IPR004389"
FT                   /db_xref="InterPro:IPR005484"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8DW29"
FT                   /protein_id="ACL28680.1"
FT                   /translation="MSVKIFGKGKKAALKRRHARIRKRISGTAERPRLVVTRSNRHMVA
FT                   QIVDDNAGKTLVSESTLMADFADFQGTKTEAAKKVGELLAKKAKDAGITTVVFDRGGNM
FT                   YHGRVAAVAEGAREGGLAL"
FT   gene            476683..477414
FT                   /gene="rpsE"
FT                   /locus_tag="BLA_0379"
FT   CDS_pept        476683..477414
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsE"
FT                   /locus_tag="BLA_0379"
FT                   /product="ribosomal protein S5"
FT                   /note="COG0098: Ribosomal protein S5"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28681"
FT                   /db_xref="GOA:B8DW30"
FT                   /db_xref="InterPro:IPR000851"
FT                   /db_xref="InterPro:IPR005324"
FT                   /db_xref="InterPro:IPR005712"
FT                   /db_xref="InterPro:IPR013810"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018192"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8DW30"
FT                   /protein_id="ACL28681.1"
FT                   /translation="MSDNEKETQVAEETQNTQATAESSNNDERRGRRNNRGGEGRRGDR
FT                   RGRREDNHENEMLDRVVTINRVSKTHKGGRTFSFAALVVVGDGNGTVGVGYGKSREVPA
FT                   AIAKGQLDAKKHLFNVPRIRGTVTHPVTGHDHAGTVMLRPAAPGTGVIAGSAVRAVMEC
FT                   AGITDILTKSMGSATAVNVVRATVDALKQLEEPEEIAARRGLSVQEVAPDQLLRERAAG
FT                   IAEARKAREEAKAEAAAKDGE"
FT   gene            477414..477596
FT                   /gene="rpmD"
FT                   /locus_tag="BLA_0380"
FT   CDS_pept        477414..477596
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmD"
FT                   /locus_tag="BLA_0380"
FT                   /product="ribosomal protein L30"
FT                   /note="COG1841: Ribosomal protein L30/L7E"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28682"
FT                   /db_xref="GOA:B8DW31"
FT                   /db_xref="InterPro:IPR005996"
FT                   /db_xref="InterPro:IPR016082"
FT                   /db_xref="InterPro:IPR018038"
FT                   /db_xref="InterPro:IPR036919"
FT                   /db_xref="UniProtKB/TrEMBL:B8DW31"
FT                   /protein_id="ACL28682.1"
FT                   /translation="MAKLKITLVHGVAHANKKQKATVQTLALRKIGQSTVLEDNSSTRG
FT                   MIAVVRHLVNVEEAE"
FT   gene            477599..478057
FT                   /gene="rplO"
FT                   /locus_tag="BLA_0381"
FT   CDS_pept        477599..478057
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplO"
FT                   /locus_tag="BLA_0381"
FT                   /product="ribosomal protein L15"
FT                   /note="COG0200: Ribosomal protein L15"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28683"
FT                   /db_xref="GOA:B8DW32"
FT                   /db_xref="InterPro:IPR001196"
FT                   /db_xref="InterPro:IPR005749"
FT                   /db_xref="InterPro:IPR021131"
FT                   /db_xref="InterPro:IPR030878"
FT                   /db_xref="InterPro:IPR036227"
FT                   /db_xref="UniProtKB/TrEMBL:B8DW32"
FT                   /protein_id="ACL28683.1"
FT                   /translation="MANEETTILQMHDLKPAPGARKDRIRVGRGEGSKGKTSGRGDKGT
FT                   KKRYQVRPGFEGGQLPLYMRLPKLRGFRSPFKTEYQVVNIAALNDLFPQGGEITVADLV
FT                   AKGAVRANRPVKVLGEGEATAAFTLKGVKASASAKSKIEAAGGSISED"
FT   gene            478295..479644
FT                   /gene="secY"
FT                   /locus_tag="BLA_0382"
FT   CDS_pept        478295..479644
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secY"
FT                   /locus_tag="BLA_0382"
FT                   /product="preprotein translocase SecY subunit"
FT                   /note="COG0201: Preprotein translocase subunit SecY"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28684"
FT                   /db_xref="GOA:B8DW33"
FT                   /db_xref="InterPro:IPR002208"
FT                   /db_xref="InterPro:IPR023201"
FT                   /db_xref="InterPro:IPR026593"
FT                   /db_xref="InterPro:IPR030659"
FT                   /db_xref="UniProtKB/TrEMBL:B8DW33"
FT                   /protein_id="ACL28684.1"
FT                   /translation="MRTLIQAFRTKELRNKILFVLGIIIIYRIGSFIPTPGVDYKVVND
FT                   CVANTTNNAENFIGLVNLFSGGAMLQLSIFALGVMPYITASIVVQLLRAVIPRFEALHK
FT                   EGQSGEAKLTQYTRYLTIGLAVLQSTTILVTARSGALFNYQCNNVIPDASIWNMVVMIM
FT                   VMTGGTGLIMWMAELITEKGIGQGMSILIFLSICSGFLPQLWQIGWGTNGTDGNWTKFA
FT                   IVTVVLLVIMIFVNYVELSQRRIPVQYTRRMIGRKMYGGSSTYLPLKINMSGVIPPIFA
FT                   SSILAIPTLFAQFGNSQQSWVQWVNKYLANTTSVWYICLYALMIVFFTFFYTEITFNPD
FT                   ETADNMKQFGGFIPGIRAGSATSRYLKYVINRLNTVGAIYLLFVALLPTVLIMALKLNT
FT                   QLPFGGTTLLIIAGVGLDTLRQAKAQTEQYQYAGFLFENTDHTEGKAIAK"
FT   gene            479817..480389
FT                   /gene="adk"
FT                   /locus_tag="BLA_0383"
FT   CDS_pept        479817..480389
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="adk"
FT                   /locus_tag="BLA_0383"
FT                   /product="adenylate kinase"
FT                   /EC_number="2.7.4.3"
FT                   /note="COG0563: Adenylate kinase and related kinases"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28685"
FT                   /db_xref="GOA:B8DW34"
FT                   /db_xref="InterPro:IPR000850"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033690"
FT                   /db_xref="UniProtKB/TrEMBL:B8DW34"
FT                   /protein_id="ACL28685.1"
FT                   /translation="MRLLIMGPQGVGKGTQAKLLAEHYGIPTISTGDIFRANIKNKTEL
FT                   GKKVLEYTSQGFLVPDELTNEIVRDRLAQDDAKNGWILDGYPRNVAQVSALDEILEGLG
FT                   EQLDAVVALTAPTNVLLERMAKRAKEEGRADDTPEAIQNRLNTYDKETTPVLDIYQQRG
FT                   KLVTVNGVGEIDAISEEIVKALDAKLG"
FT   gene            480638..480856
FT                   /gene="infA"
FT                   /locus_tag="BLA_0384"
FT   CDS_pept        480638..480856
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="infA"
FT                   /locus_tag="BLA_0384"
FT                   /product="translation initiation factor IF-1"
FT                   /note="COG0361: Translation initiation factor 1 (IF-1)"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28686"
FT                   /db_xref="GOA:B8DW35"
FT                   /db_xref="InterPro:IPR004368"
FT                   /db_xref="InterPro:IPR006196"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:B8DW35"
FT                   /protein_id="ACL28686.1"
FT                   /translation="MAKDGVIEVEGRVVEALPNAMFRVELENKHIVLATISGKMRKNYI
FT                   RILPQDRVVLEMSPYDLNRGRITYRYK"
FT   gene            481114..481524
FT                   /gene="rpsM"
FT                   /locus_tag="BLA_0385"
FT   CDS_pept        481114..481524
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsM"
FT                   /locus_tag="BLA_0385"
FT                   /product="30S ribosomal protein S13"
FT                   /note="COG0099: Ribosomal protein S13"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28687"
FT                   /db_xref="GOA:B8DW36"
FT                   /db_xref="InterPro:IPR001892"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR018269"
FT                   /db_xref="InterPro:IPR019980"
FT                   /db_xref="InterPro:IPR027437"
FT                   /db_xref="UniProtKB/TrEMBL:B8DW36"
FT                   /protein_id="ACL28687.1"
FT                   /translation="MRDLRQTEGIAMARLAGVDIPNDKRIEVALTYIFGVGRTRAKETL
FT                   EATGINPDTRVKDLTDEQLITLRDYLESNYKIEGDLRREVDADIRRKIQINSYQGMRHR
FT                   KGLPVRGQRTKTNARTRKGPKRTVAGKKKATK"
FT   gene            481601..481999
FT                   /gene="rpsK"
FT                   /locus_tag="BLA_0386"
FT   CDS_pept        481601..481999
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsK"
FT                   /locus_tag="BLA_0386"
FT                   /product="30S ribosomal protein S11"
FT                   /note="COG0100: Ribosomal protein S11"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28688"
FT                   /db_xref="GOA:B8DW37"
FT                   /db_xref="InterPro:IPR001971"
FT                   /db_xref="InterPro:IPR018102"
FT                   /db_xref="InterPro:IPR019981"
FT                   /db_xref="InterPro:IPR036967"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8DW37"
FT                   /protein_id="ACL28688.1"
FT                   /translation="MAAQKQAARKTRRRDRKSIPVGQAHIKSTFNNTIISITDPSGAVV
FT                   SWASGGDVGFKGSRKSTPYAAGMAAESAARKAMEHGVKKVDVFVKGPGSGRETAIRSLQ
FT                   SAGLEVGSITDVTPQAFNGVRPPKRRRV"
FT   gene            482078..483073
FT                   /gene="rpoA"
FT                   /locus_tag="BLA_0387"
FT   CDS_pept        482078..483073
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoA"
FT                   /locus_tag="BLA_0387"
FT                   /product="DNA-directed RNA polymerase, alpha subunit"
FT                   /EC_number="2.7.7.6"
FT                   /note="COG0202: DNA-directed RNA polymerase, alpha
FT                   subunit/40 kD subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28689"
FT                   /db_xref="GOA:B8DW38"
FT                   /db_xref="InterPro:IPR011260"
FT                   /db_xref="InterPro:IPR011262"
FT                   /db_xref="InterPro:IPR011263"
FT                   /db_xref="InterPro:IPR011773"
FT                   /db_xref="InterPro:IPR036603"
FT                   /db_xref="InterPro:IPR036643"
FT                   /db_xref="UniProtKB/TrEMBL:B8DW38"
FT                   /protein_id="ACL28689.1"
FT                   /translation="MLIAQRPTLTEESLNPQRSRFIIEPLEPGFGYTLGNSLRRTLLSS
FT                   IPGAAVTSVRISGALHEFTTLPGIEEDVTEILLNIKGIVLTSEYDEPVVMYLRKAGSGE
FT                   ATAGDITPPAGVTIANPDLHIATLAEDGELEIEFTVERGRGYVPAQMNKQDGDEIGRIP
FT                   VDSIYSPVLKVSYKVEATRVEQRTDFDKLILDVETKPAISPRDAVASAGSTLVELFGLC
FT                   RELNTQAEGVEIGPAPVAEQADPGMSVPIEDLNLTQRSYNCLKREGIHTVGELVNHTEQ
FT                   DLLDIRNFGMKSIDEVKEKLQSLGLSLKSSPLGFDTNNLEGGTFFSPEDE"
FT   gene            483158..483604
FT                   /gene="rplQ"
FT                   /locus_tag="BLA_0388"
FT   CDS_pept        483158..483604
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplQ"
FT                   /locus_tag="BLA_0388"
FT                   /product="ribosomal protein L17"
FT                   /note="COG0203: Ribosomal protein L17"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28690"
FT                   /db_xref="GOA:B8DW39"
FT                   /db_xref="InterPro:IPR000456"
FT                   /db_xref="InterPro:IPR036373"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8DW39"
FT                   /protein_id="ACL28690.1"
FT                   /translation="MPTPKKGPRLASSPAHERLMLANMATSLFEHGRITTTLPKAKRLR
FT                   PLAERLITFAKRGDLHSRRRVMRVIRNKSVVHKLFTQIAEQMEQREGGYTRIVKIAPRK
FT                   GDSAPAAIIELVTEPVSPKKAVVKEAEAATKVAAKEEQTEAAAE"
FT   gene            483706..484602
FT                   /gene="truA"
FT                   /locus_tag="BLA_0389"
FT   CDS_pept        483706..484602
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="truA"
FT                   /locus_tag="BLA_0389"
FT                   /product="tRNA pseudouridine synthase A"
FT                   /EC_number="5.4.99.12"
FT                   /note="COG0101: Pseudouridylate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28691"
FT                   /db_xref="GOA:B8DW40"
FT                   /db_xref="InterPro:IPR001406"
FT                   /db_xref="InterPro:IPR020095"
FT                   /db_xref="InterPro:IPR020097"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8DW40"
FT                   /protein_id="ACL28691.1"
FT                   /translation="MTRLRIDLAYNGAAFHGWAAQPGCRTVQGTVEEALRRITRMPDAG
FT                   SLRLTVAGRTDAGVHATHQVCHVDVPDQTLGQCVGHMNLTPVQALQTRLSRMMPDDIAI
FT                   HGISVAPAGFDARFSALERTYVYRIADARVPWDPRLKDFAWRTDRELDIAQMNAAAALT
FT                   LGLHDFGSFAIANPGGTTIREVKTAYWQRVPTRPLLGPGMGERYHTPAVESGLLCFTIV
FT                   ADAFARNMVRSLVGACVQVGMGKRDVDWFAGKMRVPLREGSTGPIAPQGLTLEHIAYPA
FT                   DDELAARAERIRAKRTL"
FT   gene            complement(484793..484881)
FT                   /locus_tag="BLA_t0016"
FT   tRNA            complement(484793..484881)
FT                   /locus_tag="BLA_t0016"
FT                   /product="tRNA-Ser"
FT   gene            complement(484981..485892)
FT                   /locus_tag="BLA_0390"
FT   CDS_pept        complement(484981..485892)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0390"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28692"
FT                   /db_xref="UniProtKB/TrEMBL:B8DW41"
FT                   /protein_id="ACL28692.1"
FT                   /translation="MQTRHRFLSVCARTVAVALTTLAFVGVTACSAPRIAGRSEQEQEL
FT                   GTCERFLETAQSYSNTMGDANIPLYLRYFTASLAQHDWLNVALQCPSQFGDATMRSAQA
FT                   QHFTRLAANHFGFAYAPLTVTKLDTVDSLDLPGEALATIALAEDRAGFAAEVLAGRYDS
FT                   FTPTSANTSSDAEFVRRLASNATLLTMSDNHKEAAARLTMLSKGAQDIRRKVYDTRMLT
FT                   TSEVNATDPATGLRTRTPAIVEMDCAREQLQRIDDLPASDIATAQSQSSDALLQLSLLI
FT                   ATHAVTAFGLGYPSADYALFAS"
FT   gene            486005..487081
FT                   /gene="nusA"
FT                   /locus_tag="BLA_0391"
FT   CDS_pept        486005..487081
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nusA"
FT                   /locus_tag="BLA_0391"
FT                   /product="N utilization substance-like protein"
FT                   /note="COG0195: Transcription elongation factor"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28693"
FT                   /db_xref="GOA:B8DW42"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR010213"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013735"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR025249"
FT                   /db_xref="InterPro:IPR030842"
FT                   /db_xref="InterPro:IPR036555"
FT                   /db_xref="UniProtKB/TrEMBL:B8DW42"
FT                   /protein_id="ACL28693.1"
FT                   /translation="MKLDLNGIHALAQEQGIDAETVDAALSEALRLAYLKMPHAAKYAR
FT                   VELDPRAGSFTIWARDEIPQEPTEDNPHPAPELGEEYDDTPHDFGRLAASTARQVIQQL
FT                   FRKAEDDRVFGAFSGQRGKLITGVVQQDVKDPANVHVAVGDVEALLPRREQVPGERYRH
FT                   GERIRVYVTTVARGLKGPEIIVSRSHPELVRRLFEREVPELASGAVSIMAIAREAGART
FT                   KIAVRANTPGINPKGALIGPGGSRVRAVMENLGSEKIDIIDWSANPAEFIAAALSPAVV
FT                   SDVQVISEKNQTAIAFINDEQLSLAIGKEGQNARLAAKLTGWKIGIESNSAHAAKLREQ
FT                   AAKAADGTQSGNAEESAE"
FT   gene            487291..490125
FT                   /gene="infB"
FT                   /locus_tag="BLA_0392"
FT   CDS_pept        487291..490125
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="infB"
FT                   /locus_tag="BLA_0392"
FT                   /product="translation initiation factor IF-2"
FT                   /note="COG0532: Translation initiation factor 2 (IF-2:
FT                   GTPase)"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28694"
FT                   /db_xref="GOA:B8DW43"
FT                   /db_xref="InterPro:IPR000178"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006847"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR015760"
FT                   /db_xref="InterPro:IPR023115"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036925"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8DW43"
FT                   /protein_id="ACL28694.1"
FT                   /translation="MAKARVYELAKELGVDSKTVLEKLKDMGEFVKSASSTVEAPVVRR
FT                   LKAAFPKDGGNDSRPSAKKSSTPKSGAPAAAKPAATPAAVAGATPATAAPSAPKPGQRS
FT                   NTSAKPGAHNTRRNEQTPRPGQNGGQRGATARPHAPGKPGANAGGTRNGGKAAPTPHAP
FT                   QHGGNRGGSNNAPKPGANAAQHAPRPGNNPFSRKQGMHTPTPGDIPRPHPMARPTVNNN
FT                   ERRGGGNGRPGQRGGFRPRPGQGGSGAPKPGSWGQHRQGAGSGGGRPGGNRFGGGNGGN
FT                   NFQNNGPSNGPSRGGGRGRGGAAGAFGRQGGKSSKARKNRLAKRHEYEELKAPVIGGVR
FT                   IPTGNGQTIRLRQGASLADLAEKINVNPAALVTVLFHLGEMATATQSLDESTFQILGEE
FT                   IGWNIKIVSAEEEDKELLQQFDIDLESEELQEEADLKPRPPVVTVMGHVDHGKTRLLDT
FT                   IRRTNVVAREAGGITQRIGAYQVTVDLEGEERKITFLDTPGHEAFTAMRARGAELTDIA
FT                   ILVVAADDGVMPQTVEAINHAQSAHVPIVVAVNKIDVPGANPEKVRGQLTEFGLVPEEY
FT                   GGSTMFVDISAKQGTNVDKLLEAVLLTADAELDLRANPDMDARGATVEARLDKGRGAVA
FT                   TVLVQSGTLHIGDSIVAGTSYGRVRAMLDENGKHMKEALPSTPVQVLGLTSVPTAGDLF
FT                   LVAPDDRAARQIAEKRQATERAAQLAKRRKVVSLEEFKKKFAESEIDMLNIVIKGDSSG
FT                   SVEALEGSLMKIEVSDEVGIQVIHRGVGAITQNDVNLASVDKAVIIGFNVRPNRQVADL
FT                   AEREGVEIKYYSVIYKAIEDIEASLKGMLKPEYEEVTTSHSEIREIFRSSKFGNIAGVM
FT                   VLDGEVKRGTKARILRDGVTTFNDLEISSLRRFKDDVKSVTEGYEAGINLGNFNDIEIG
FT                   DVIETFEMREIERK"
FT   gene            490279..490932
FT                   /gene="rbfA"
FT                   /locus_tag="BLA_0393"
FT   CDS_pept        490279..490932
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rbfA"
FT                   /locus_tag="BLA_0393"
FT                   /product="ribosome-binding factor A"
FT                   /note="COG0858: Ribosome-binding factor A"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28695"
FT                   /db_xref="GOA:B8DW44"
FT                   /db_xref="InterPro:IPR000238"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR020053"
FT                   /db_xref="InterPro:IPR023799"
FT                   /db_xref="UniProtKB/TrEMBL:B8DW44"
FT                   /protein_id="ACL28695.1"
FT                   /translation="MQGTNSRAARIAALIQRVIASNMESTLHDKRLKNVTITDVKVTND
FT                   LQLAKIYWTTLSRDGHEEGERKRAKEALNQAKGRLRTMVGAKAGLRLTPQLQFIFDEVP
FT                   GEAHEIEDILSLARKRDEELARMRANAAYAGDADPYRHDDETEEAVEEELDEQEHENKD
FT                   EYTEYPGDVVEVEEFEDFDNSGDDLEHSDDDPVDPVATDPASTIDTVDDHDEDK"
FT   gene            490936..491988
FT                   /gene="truB"
FT                   /locus_tag="BLA_0394"
FT   CDS_pept        490936..491988
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="truB"
FT                   /locus_tag="BLA_0394"
FT                   /product="tRNA pseudouridine synthase B"
FT                   /note="COG0130: Pseudouridine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28696"
FT                   /db_xref="GOA:B8DW45"
FT                   /db_xref="InterPro:IPR002501"
FT                   /db_xref="InterPro:IPR014780"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR032819"
FT                   /db_xref="UniProtKB/TrEMBL:B8DW45"
FT                   /protein_id="ACL28696.1"
FT                   /translation="MGTGKRDAKVNGVLIVDKPQGVTSHDIVAAVRAALHTRKVGHAGT
FT                   LDPMATGALVIGVGHATRLLQYIVEHTKTYSATIRFGQRTTTDDADGEFVEREAEAAVL
FT                   PTLEQVREAVANEYTGDIEQIPNAVSAIKVNGQRAYDLAREGRHVELKARRVTVHAFDV
FT                   LGGRQTQAANGTPVLDVDVRVTCSAGTYIRALARDLGNDFHCGAHLTRLRREAVGAFRV
FT                   RDARIVRAHAEARTFVNRDGEEITRNRAVLDCVGEDLAGHLLTMVQAAQLTLPVLAVSE
FT                   AQAADLRFGRRIVAQAPTDDERPAHHHGEHVWAAIGSADGEPEVVAIVERAKHHEFKPV
FT                   TVFAANTGNE"
FT   gene            491996..493282
FT                   /gene="ribF"
FT                   /locus_tag="BLA_0395"
FT   CDS_pept        491996..493282
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ribF"
FT                   /locus_tag="BLA_0395"
FT                   /product="riboflavin kinase"
FT                   /EC_number="2.7.1.26"
FT                   /EC_number="2.7.7.2"
FT                   /note="COG0196: FAD synthase"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28697"
FT                   /db_xref="GOA:B8DW46"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015864"
FT                   /db_xref="InterPro:IPR015865"
FT                   /db_xref="InterPro:IPR023465"
FT                   /db_xref="InterPro:IPR023468"
FT                   /db_xref="UniProtKB/TrEMBL:B8DW46"
FT                   /protein_id="ACL28697.1"
FT                   /translation="MDIFRLTPAADGNVAWPTLSTSKKSVVTVGAFDGLHVGHHAVIEE
FT                   TVRQARKLDAYSVVIMFDPRPAFVHAYAKAHAGKDVPAGVHDPEAITGVDARLRMLSRM
FT                   HVDYVLIVRYTIAFSEKSFRFFLGQLVGKLGMRMLVLGEDARMGANLEGDIKKIRTLAE
FT                   ATGVFELEVVTNQGGTVRVPERFTPTAPNEPGEPGDPLEGLGKAERRAWSKKHNAREVR
FT                   NQSSTNVRYLLSQGRVQAANEILGHAHAVEGVVEHGEERGRTIGFPTANIAEPMEGYLP
FT                   VDGVYAGWLVDLGPADEYERDQQQLSGKAADGEAVEAASVTVSDTPVVSHRFSSSRVDS
FT                   RLAAQSPFRWPAAISIGTKPTYSESTGLNERVLEAYALTDEWLDLYGHRVRVEFERFLR
FT                   PQIKFGSTDELVAELKHNVEETKELLGAE"
FT   gene            complement(493294..494769)
FT                   /gene="radA"
FT                   /locus_tag="BLA_0396"
FT   CDS_pept        complement(493294..494769)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="radA"
FT                   /locus_tag="BLA_0396"
FT                   /product="DNA repair protein RadA"
FT                   /note="COG1066: Predicted ATP-dependent serine protease"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28698"
FT                   /db_xref="GOA:B8DW47"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004504"
FT                   /db_xref="InterPro:IPR008269"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020588"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041166"
FT                   /db_xref="UniProtKB/TrEMBL:B8DW47"
FT                   /protein_id="ACL28698.1"
FT                   /translation="MAKKTVNYVCTECGWSGGKWYGRCPECGQWGTIEEFHEAPAATGA
FT                   RTPAPGRTSRTPISVPNVQSAAKPITSISTDTVNRLPTGFGEFDRVLGGGIVPGSVVLI
FT                   AGEPGIGKSTLLLETAGNIAKSVAAAHSRTPDGSDSEPHDAHAGTHDSVLYISGEESQA
FT                   QVRLRASRIGAVEENLLLAATTDLSTVLGLIDSVRPALAIVDSAQTIVSQDVDGISGGS
FT                   TQVREVASALIDSAKSLDVPVLLVGHVTKDGSIAGPRTLEHLVDVVCQFEGESQTALRL
FT                   LRAVKNRFGPTDEVGCFDMSGEGIEEVRDPAGLFLSSQNEPVEGTCVTFTLDGHRSLAV
FT                   EVQSLVTNSVLPTPRRAVNGVDPSRIAMLVAVLYRHGGISLLQNDLYISTIAGGQAKEP
FT                   GCDLAITAAMASAALNKPIAKNVCAIGEISLTGQVRPVPRLEYRLREAQRLGFTKAIVP
FT                   ATQKPLKMEGMTLAPATNLKDALAFLHLAKQRH"
FT   gene            494893..495573
FT                   /locus_tag="BLA_0397"
FT   CDS_pept        494893..495573
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0397"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28699"
FT                   /db_xref="GOA:B8DW48"
FT                   /db_xref="UniProtKB/TrEMBL:B8DW48"
FT                   /protein_id="ACL28699.1"
FT                   /translation="MANNSGSKGPSNAGRRTSQSGARRQPQPTQTSAVHSLRYVRIVVA
FT                   VFVMLFVLALVSAFGWPGWAVRTPAKPVAVPTATPSKATVKAKALPGDATALLRAMPDH
FT                   VSNFARVQADSTDAWADSNPIEEYKLTYSNGNDKDAVQLTVAQWSDSEKAQGQYTKLTG
FT                   DLKGSSLANGVVKVNGDVTGNYEVKTAESDDTQATAVWRNDTVVFSVTGTKNSVVSVYQ
FT                   LFPL"
FT   gene            495651..495740
FT                   /locus_tag="BLA_0398"
FT   CDS_pept        495651..495740
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0398"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28700"
FT                   /db_xref="InterPro:IPR013177"
FT                   /db_xref="UniProtKB/TrEMBL:B8DW49"
FT                   /protein_id="ACL28700.1"
FT                   /translation="MGSVIKKRRKRMSKKKHRKLLRKTRHQRK"
FT   gene            complement(495906..496607)
FT                   /gene="rpiA"
FT                   /locus_tag="BLA_0399"
FT   CDS_pept        complement(495906..496607)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpiA"
FT                   /locus_tag="BLA_0399"
FT                   /product="ribose 5-phosphate isomerase A"
FT                   /EC_number="5.3.1.6"
FT                   /note="COG0120: Ribose 5-phosphate isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28701"
FT                   /db_xref="GOA:B8DW50"
FT                   /db_xref="InterPro:IPR004788"
FT                   /db_xref="InterPro:IPR020672"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:B8DW50"
FT                   /protein_id="ACL28701.1"
FT                   /translation="MDKAQQDAMKKEAGIEAAKLVKSGMIVGLGTGSTVRFLVDELGRR
FT                   KQEEGLEFTGVTTSRRTQEQAEGYGIKIVNIDDVDHIDLCIDGADEVDKNFNGIKGGGA
FT                   ALLWEKIVAINSNRIVWIVDASKLVDVIGKFPLPVEVIPFGAMHVIERMKERGYNPTLR
FT                   LDAEGKPVRTDENNYVVDLHLERIDDPAGLNEDLINMVGVVEDGLFLDMVNEVIVGDPN
FT                   GPRTLINPNKA"
FT   gene            complement(496697..497686)
FT                   /gene="rnh"
FT                   /locus_tag="BLA_0400"
FT   CDS_pept        complement(496697..497686)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rnh"
FT                   /locus_tag="BLA_0400"
FT                   /product="ribonuclease H"
FT                   /EC_number="3.1.26.4"
FT                   /note="COG0328: Ribonuclease HI"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28702"
FT                   /db_xref="GOA:B8DW51"
FT                   /db_xref="InterPro:IPR002156"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR022892"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:B8DW51"
FT                   /protein_id="ACL28702.1"
FT                   /translation="MTITVSTDGSALRNPNGPMGWAWADHTDGARDEHAHAGDCAAGGA
FT                   TNGTNQIGELCAVLEALRAHPGSEPLVIESDSQYAINCSSKWVFGWKKNGWKNSKQEPV
FT                   KNAPIIKAIDAEISKRAGKVSFRWVKGHAGNAGNEKVDDLARGFAGDCESGAQEGYLPK
FT                   EGWQALLESPYARDVKVPADAQLLLDGEMDEREYTRLHAAEVDDLEHGEPNLTELGDVR
FT                   TPADSAETDAPADTAAHAAESAADGTDTPAGEPTATAGMQLAPTGLAASGRVTLSPPPN
FT                   SSPYYDGSPRRIHGYIEVDALVQGDGTVDLENARFLMHRRENGQETRQ"
FT   gene            complement(498481..498568)
FT                   /locus_tag="BLA_t0017"
FT   tRNA            complement(498481..498568)
FT                   /locus_tag="BLA_t0017"
FT                   /product="tRNA-Ser"
FT   gene            complement(498914..500200)
FT                   /gene="serS"
FT                   /locus_tag="BLA_0401"
FT   CDS_pept        complement(498914..500200)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="serS"
FT                   /locus_tag="BLA_0401"
FT                   /product="seryl-tRNA synthetase"
FT                   /EC_number="6.1.1.11"
FT                   /note="COG0172: Seryl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28703"
FT                   /db_xref="GOA:B8DW52"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002317"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR015866"
FT                   /db_xref="InterPro:IPR033729"
FT                   /db_xref="InterPro:IPR042103"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8DW52"
FT                   /protein_id="ACL28703.1"
FT                   /translation="MLDIQFIREHPEVVKESQRKRGESVELVDEVLRADEERRSSLKQF
FT                   EEARARQKEIGKQVAKAAPDEKAKLIAQTKELSEQVASFKASADTADEQYTTAMWQLSN
FT                   IVEPQAPEGGEDDYVVMRKVGQIRDFAAEGFEPKDHLTLGEEVAGIDMKRGVKVSGSRF
FT                   YFLRGDVARLQIAMLTMAVDQAQEHGFILAITPTLVRPEVMRGTGFLNSHADEIYRLRE
FT                   PDDDYLVGTSEVALAGMHENEILDLSDGPLRYCGWSSCYRREAGAAGKDTSGIIRVHQF
FT                   DKVEMFVYAKPENSDAEHQKLLAMEEEMLAKVEVPYRVIDTAAGDLGSSAARKFDCEAW
FT                   VPTQGRYRELTSTSNCTQYQARRLNIRERVADGGTSPVATLNGTLATTRWLVAILENHQ
FT                   QADGSIEIPKAMRPYMGGKEVIEPRKWEA"
FT   gene            500372..501529
FT                   /locus_tag="BLA_0402"
FT   CDS_pept        500372..501529
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0402"
FT                   /product="diacylglycerol kinase, catalytic
FT                   region-containing protein"
FT                   /note="COG1597: Sphingosine kinase and enzymes related to
FT                   eukaryotic diacylglycerol kinase"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28704"
FT                   /db_xref="GOA:B8DW53"
FT                   /db_xref="InterPro:IPR001206"
FT                   /db_xref="InterPro:IPR016064"
FT                   /db_xref="InterPro:IPR017438"
FT                   /db_xref="UniProtKB/TrEMBL:B8DW53"
FT                   /protein_id="ACL28704.1"
FT                   /translation="MGDNQWVLILVCMIAAIIVIVGAVVGIRIALHIRRVETIKNERRR
FT                   DAVHYAFVINPSKPTAGETRAFIERFCTNRGIADIMFIETQLDKDGRACALEALEQGAD
FT                   VVIAVGGDGTVRTVASAMGGTNHAMGIIPIGTGNLFARNMNIPVGDLEAAMLIAISHGS
FT                   YKVDIGRLQLLDHPEEDHAHAFLIIAGIGFDAVMIDDTDPKLKKNISWLAYFVAGAKHL
FT                   FAPKYHASVVLTGANGDQHVREDVEFRTFMSGNCGEIPVFSLMPDASFNDGLLDFEVID
FT                   TNGGIIGWMNLFGDVVHQTITRKAQQSPLSVHSTIDQVQGVSAELQLEKPVPAQVDGDM
FT                   LKPTRHIRFSVDHNALIVRAPGQDAEMTGNLQPVRVDASGKPRLR"
FT   gene            501689..503365
FT                   /gene="pgm"
FT                   /locus_tag="BLA_0403"
FT   CDS_pept        501689..503365
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pgm"
FT                   /locus_tag="BLA_0403"
FT                   /product="phosphoglucomutase, alpha-D-glucose
FT                   phosphate-specific"
FT                   /EC_number="5.4.2.2"
FT                   /note="COG0033: Phosphoglucomutase"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28705"
FT                   /db_xref="GOA:B8DW54"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR005852"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR016066"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/TrEMBL:B8DW54"
FT                   /protein_id="ACL28705.1"
FT                   /translation="MVAKNAGLPATPADLIDVDEVVGAYYDVVPDPSVPEQRVIFGTSG
FT                   HRGSSLKTSFNEAHIVAISQAIAEYRKAAGVDGPLYIGRDTHALSLPAWKTAIEVLVAN
FT                   GVTVCIDSRDDFTPTPVVSQAILTHNRAADGTQRFEGPGLADGIVVTPSHNPPTDGGFK
FT                   YDPVTGGPAPADVTNAIANRANELLGDFRNVKRVPFEQAVKSEFVKRFDYREHYVDDLK
FT                   NVIDFDVIRDSGVRLGIDPLGGASVNYWPLINEKYGLNIGVIRPEVDPTWRFMTIDHDG
FT                   KIRMDPSSQYAMKGLVDALNAGAWDKYDLVGGTDPDADRHGIVCPNWGVMNPNHYLAVC
FT                   VEYLFGGNRPDWPEHTGVGKTLVSSSLIDRVAASIGAPVVEVPVGFKWFVDPLFTGEIA
FT                   FGGEESSGMSFLRFNGRVWTTDKDGIIPDLLAAEITGKTGKNPAQLHQEQVDRFGESWY
FT                   SRIDTPTTLEQKQKFAKLDASDVTATKLGGEPIEQILTKAPGNDAPIGGIKVVTKDNWF
FT                   AARPSGTENIYKVYAESFVSPETLDSVLTEATEVVDKALGE"
FT   gene            complement(503487..505034)
FT                   /locus_tag="BLA_0404"
FT   CDS_pept        complement(503487..505034)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0404"
FT                   /product="putative dipeptidyl
FT                   aminopeptidases/acylaminoacyl-peptidase"
FT                   /note="COG1073: Hydrolases of the alpha/beta superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28706"
FT                   /db_xref="GOA:B8DW55"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B8DW55"
FT                   /protein_id="ACL28706.1"
FT                   /translation="MIALFAGLGIAMEPKWSVKPLSMHLQVTERSTAIKARGITTPQEG
FT                   TYQVRQTRLRLPISGGKTVNAILREPENAPSGRAACVFVHGAGTGKAEEVYADLANALA
FT                   SAGITTLVQDKRLDNYTPLRRDYDSSAEDYLAGLNLLRAQQGVDARKVGLYAESEGTWI
FT                   ASVMTHKDRHIAFQVLTSAPVYSGRQQIAMAATEYLNIIGAPGGVVDIIPRLLSLNFAP
FT                   IGLEYADFNTAEYRDTLTMPLLVNYGTIDPAMPIEQGALQLIGDAHAAGNSNVLVRYYA
FT                   ANHQMRTGSSLSLPGLPLDKDYTHNLEDWINAIAAGATEDDWLTPDIAGARPYQEYAIP
FT                   ENISSGLVSSVWVLVVLIVICLVSWLLTVVFCIGAFVSRKRVEAKTVDDSGHIVVHRFT
FT                   MLSKVLIITNIVLLPICAAGFLGYFAFTAKAALSLTDEATMLSFGWSMLRLGSLVLIVM
FT                   NSWMWVRMFFFYGPGNIDKEYPKTAMRMASGHTATVALLSVSVLCALVLSSFFGLIG"
FT   gene            complement(505137..505757)
FT                   /locus_tag="BLA_0405"
FT   CDS_pept        complement(505137..505757)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0405"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28707"
FT                   /db_xref="InterPro:IPR025191"
FT                   /db_xref="UniProtKB/TrEMBL:B8DW56"
FT                   /protein_id="ACL28707.1"
FT                   /translation="MSTRQTIKSIIEREWDQFQHTNNEGGRASCQGNRPMFEVMRASQF
FT                   AAWPQELLTSYLADLREADAGGRNLVTEKYARMMASTAPEIYARDLEPHLPRLSEARIA
FT                   QQERIIKRQLAWAHEFADRYPALGAGMRVFDTAEDSETTTSFETYLRGELATYSQRTLD
FT                   LYERFVRECERRQENLTEQIIANTVRLGGYTNLDEAEAAQRRA"
FT   gene            complement(505787..507919)
FT                   /locus_tag="BLA_0406"
FT   CDS_pept        complement(505787..507919)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0406"
FT                   /product="TPR-repeat-containing protein"
FT                   /note="COG0457: FOG: TPR repeat"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28708"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR025117"
FT                   /db_xref="UniProtKB/TrEMBL:B8DW57"
FT                   /protein_id="ACL28708.1"
FT                   /translation="MDDQRDLERMLGNLRQFQSESDASKESEKSPSNAGTSFDADEFLA
FT                   GLDAMFASHTAKDKADEYLQQAMADAENAQDYAGLLTVLNETMGFYRSQGRHQENQWII
FT                   QRAIELALRMGLEGTEAWTTTLINAATSQRAAGNLDQAEDLFEQALDAARRTYGPDDRR
FT                   LAALHNNRSMLFSQTHRRRQAIDELHESLRILEHSSVDAQSDVDIASTCTNLALAMLDG
FT                   EDQPTDAELEEAQSLARRTLDIYQHAGSDSSAHYASALAGAAHVSFASEDYAEAVRQYQ
FT                   RALDVIARCYGEHTDYYRVTAQNLQEAQRKLELTQSTDNPHDSVDDSPAQSTVHTDIHR
FT                   SAVHNASVPSTMQASAQHSTSPRTLAPGTALRVAEPGMALAKAYWQELVKPMIDERYAS
FT                   VKHRIAAGLVGHGSECYGFDDALSRDHDFGPRVCLWLTADDYAEFGERLQADYDALPSM
FT                   FHGVSRSAATPRAQGEGRRDGVFEIAAFFTQLTGMPHAPADDEPHLWLSLDESTLAAAT
FT                   NGRVFQDGLGAFSSARQSFTRMPDDVRLALISRRLGMISQAGQYNLPRMLERGDGAAAW
FT                   LCIEQFADAASSLVFLVNNPASVGYAPYYKWRFAALRRLSARPAMLLTEICGELEQLMR
FT                   LSSAACFGGAGFGEGGKGAAPSIDTVNAIVETICEQITHTLNALGLSDSPQTFLEWQRP
FT                   YVEAHITSPATCLHSL"
FT   gene            complement(507974..508684)
FT                   /locus_tag="BLA_0407"
FT   CDS_pept        complement(507974..508684)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0407"
FT                   /product="response regulator of two-component system"
FT                   /note="COG2197: Response regulator containing a CheY-like
FT                   receiver domain and an HTH DNA-binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28709"
FT                   /db_xref="GOA:B8DW58"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:B8DW58"
FT                   /protein_id="ACL28709.1"
FT                   /translation="MSERERQGIRIAVVDDHEMFRAGVIATLQPYFTIVGQAADVPSAI
FT                   EMIADTQPDVVLLDVHVPGGEGGGGAEILRKSQPHAPQTAFLALSVSDSAQDVGSVIRA
FT                   GARGYVTKTITGNDLIHSIEQVSDGYAVFSPKLAGFVLSAFQGAPLSDGMDASNESAAG
FT                   GDTVAHDAELDSLSTREQEVMRLIARGYTYKEVGAELFISVKTVETHVSNVLRKLQLSN
FT                   RNELTLWAADRHIV"
FT   gene            complement(508977..510437)
FT                   /locus_tag="BLA_0408"
FT   CDS_pept        complement(508977..510437)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0408"
FT                   /product="possible histidine kinase sensor of two component
FT                   system"
FT                   /EC_number="2.7.13.3"
FT                   /note="COG4585: Signal transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28710"
FT                   /db_xref="GOA:B8DW59"
FT                   /db_xref="InterPro:IPR007168"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B8DW59"
FT                   /protein_id="ACL28710.1"
FT                   /translation="MSQIPEHLAPPLLPAKLPLLRPKQGRVIAGVARGISMHLGVSVAL
FT                   VRIVFVLLACWFGVGALAYVALWIAIPEGNPVAEAARLRGTHSSRNAPLARGNASVGES
FT                   ESPLFVSQTLDSAQDAWYAYTGLEQSTDSPSAKDSVRRTLANASKPAIFAGIGVVLIAL
FT                   PSGLNAVMRFSGSQMLPIVPCLAGMGLPWLNTRARNGQAWLTLVGEGLIFTAFLVFVAQ
FT                   TVARNGAVPFGSAIACGFALLVAAICALIPLLMTLIRNIWQERALKEREEERADMTAHL
FT                   HDGVLQTLALIQLHADDEQQVFTLARSQERELRSWLYQERTTSDRSVSAGLQEIAAQVE
FT                   DTHGKPIEVVTVGDARPSAQTDALLDAARQAMVNAVTHGGEPVSVYCEADRHQVEVFVR
FT                   DHGNGFDIDDIPPERLGIRESIIGRVRRRGGTVEIVSRPDWGTEVRMHMPLEAGFDSSR
FT                   TSDSPTDRPAQSGDPIRPAQSTQSTQST"
FT   gene            510515..512638
FT                   /gene="pspC"
FT                   /locus_tag="BLA_0409"
FT   CDS_pept        510515..512638
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pspC"
FT                   /locus_tag="BLA_0409"
FT                   /product="phage shock protein C, PspC"
FT                   /note="COG1983: Putative stress-responsive transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28711"
FT                   /db_xref="GOA:B8DW60"
FT                   /db_xref="InterPro:IPR007168"
FT                   /db_xref="UniProtKB/TrEMBL:B8DW60"
FT                   /protein_id="ACL28711.1"
FT                   /translation="MPEQSAVCCNGTMGNANHNPQQPQGETLGNGQSAGQYGQPGQGQY
FT                   SHTSYNANTTYNTDYENGRPTPNANNGGERPESSFFRWIRESGVQRTNNRVIAGVCGAI
FT                   AQELGWNVTLVRVLMVVLAFMGGTGVFFYGLAWALLPDESDGSILLEDLIHGHWNWSFI
FT                   GVILCILLSGVLVVPFFGFHGAVNVMPILLSALAMYLVIDHGRRRFMRPNSMNGGIGGN
FT                   GGNTGGYGGPAPAPPMPPMPNVGERAAGPSMPAQQPGAYPNAARYGMPAAAPQNSGYTQ
FT                   YAQPAQPFRGERPNVTQPESQSPAQQSADAGTPTVNMPPVAAGSASAQAFRPAQPQSAS
FT                   QSAYHYTYHYEPKDYTYEYRGATKARRKPAGPAVVLLFLGLLIAGMAVVSLICGSAGNG
FT                   SFSTLFGASRGAVLFIGGACLVLGLIIVALGCAGRRTGGLHPFAWTLMFLAVIAMCFGG
FT                   AVGAANSLSPYLAKDYKHVNVGKTLVIDSSKASMETLRKGIAVQGEGYAKSTLTIDLTK
FT                   YTGHNKAKQVRLNDGQTRTTYCPVETIPMTVTDAKVMVKIPYGCSWGFNVSSGMMSTWN
FT                   SIDAQGGLLATGVCSEGDRGNGWDIQAGRSGFQISGAHPDGNGISSWYSMTGDMNELCE
FT                   NVGVDDDMNHAVTKNTDPRVKQLAENGYYWPCLTDNAKSVAHTELNISPRLLRNASVTV
FT                   SYGGDIADAAKKH"
FT   gene            512655..513299
FT                   /locus_tag="BLA_0410"
FT   CDS_pept        512655..513299
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0410"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28712"
FT                   /db_xref="GOA:B8DW61"
FT                   /db_xref="UniProtKB/TrEMBL:B8DW61"
FT                   /protein_id="ACL28712.1"
FT                   /translation="MKKQSDSNDAQTPYDDEATEVFAAEGPLDETVGIDERVDLTSTTQ
FT                   MPAADATAPVDMNAPLYAQFAGDTDADSGLGNDGGSDDGGANASSAEPGGEPVGDDLTI
FT                   PMQTTDASHQASTGEGAPRNIPLYQAPPQCKPEPERPKGASAGTIVFGVVVLLFGALTV
FT                   TVGLLMNSSMFSFVEFNRITGYLFAGLGILLSLIAIVMGVSSHWRNKNRGA"
FT   gene            513590..514789
FT                   /gene="metC"
FT                   /locus_tag="BLA_0411"
FT   CDS_pept        513590..514789
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metC"
FT                   /locus_tag="BLA_0411"
FT                   /product="cystathionine beta-lyase"
FT                   /EC_number="4.4.1.8"
FT                   /note="COG0626: Cystathionine beta-lyases/cystathionine
FT                   gamma-synthases"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28713"
FT                   /db_xref="GOA:B8DW62"
FT                   /db_xref="InterPro:IPR000277"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:B8DW62"
FT                   /protein_id="ACL28713.1"
FT                   /translation="MTQLNTKLVHGVPVTDNATGAVNPPIYNSSTYAFESVGSMPRWDY
FT                   ARSGNPTRDFLERQIAQLEHGVRGFAFASGLAAIHAVLSIFAPGERIVVGSNIYGGTYS
FT                   LFNEHFNRWGLVSYPVDTQDLRELEHAIGGHGEQAPAKAVYFETLTNPLLQVNDVHAIA
FT                   EIAHKYGAIVIVDNTFVTPYLQQPLDLGADIVIHSATKYLAGHSDVVAGLVAVANDILA
FT                   ARVYYSQNRLGGVLAPAECDAVRRGIQTLALRLERQQENALAVARHLDEHAAVARVHYP
FT                   GLHGEAVASKGLRGAGGVLSFEVREGVNPADVLNNLQTFRLAVSLGAVESLAEYPARMT
FT                   HFELPRSERLKVGVTDELIRLAVGIEDVRDLIEDLDQALAIATGHAQAPQSLELASLFR
FT                   "
FT   gene            514806..515537
FT                   /locus_tag="BLA_0412"
FT   CDS_pept        514806..515537
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0412"
FT                   /product="O-acetylhomoserine (Thiol)-lyase"
FT                   /EC_number="4.4.1.11"
FT                   /note="COG2873: O-acetylhomoserine sulfhydrylase"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28714"
FT                   /db_xref="GOA:B8DW63"
FT                   /db_xref="InterPro:IPR000277"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:B8DW63"
FT                   /protein_id="ACL28714.1"
FT                   /translation="MTAPLTDWLTMAHFSTLAIHAGYDSADCTNGDAAVPPIYLSAAFD
FT                   MQSAAHGDALSAGAAEGFSYSRMANPTLDVLERRIAALEGGRSAVAFASGMTAVSAALL
FT                   CAAEGGGRIIAARNLYGASVDAMDSLFPEFGIETDFVDDINDLALVESLIGPDTRAIFA
FT                   GSVANPSTEVADVAALASVAHRHGIPLIIDNTVPTPYLFRPIELGADVVVHSTTNSKWM
FT                   AAVSRSRGFSMAPTCSPMCRT"
FT   gene            515465..515710
FT                   /locus_tag="BLA_0413"
FT   CDS_pept        515465..515710
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0413"
FT                   /product="O-acetylhomoserine sulfhydrylase"
FT                   /EC_number="4.4.1.1"
FT                   /note="COG2873: O-acetylhomoserine sulfhydrylase"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28715"
FT                   /db_xref="GOA:B8DW64"
FT                   /db_xref="InterPro:IPR000277"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:B8DW64"
FT                   /protein_id="ACL28715.1"
FT                   /translation="MDGGREQVARILDGTHVFTYVPNIGDARSLIVDPARITHREVSPE
FT                   FRRMSGVDDNLIRLSIGLEDTADLIADLEQAIRRAY"
FT   gene            complement(515777..515850)
FT                   /locus_tag="BLA_t0018"
FT   tRNA            complement(515777..515850)
FT                   /locus_tag="BLA_t0018"
FT                   /product="tRNA-Pro"
FT   gene            516077..517741
FT                   /gene="lysS"
FT                   /locus_tag="BLA_0414"
FT   CDS_pept        516077..517741
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lysS"
FT                   /locus_tag="BLA_0414"
FT                   /product="lysyl-tRNA synthetase"
FT                   /EC_number="6.1.1.6"
FT                   /note="COG1190: Lysyl-tRNA synthetase (class II)"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28716"
FT                   /db_xref="GOA:B8DW65"
FT                   /db_xref="InterPro:IPR002313"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018149"
FT                   /db_xref="UniProtKB/TrEMBL:B8DW65"
FT                   /protein_id="ACL28716.1"
FT                   /translation="MTEANESADITVEEEVVAAPEMSTVERAEMLLNQDEAIFKRVQEG
FT                   ASLDEAVDPSNKEFGPLAHPEQVQTRVAKRAMMIKDGINPYPVNLDVTTTIDAVRVKYD
FT                   GKLEAGAETDDIVGVAGRVLFIRNAGGLCFVQLAAGDGTTIQAMLSKKQIGADSLKQFK
FT                   QLVDLGDHLFVKGRVIASKTGELSIFADEWAIAAKALQPLPTLHKELNEDTRTRKPYIG
FT                   MIADEKIRNMVRNRSRAVASLRRTFDEHGFLEVETPMLQTIHGGAAARPFTTHMNAFDL
FT                   DLYLRIAPELFLKRCLVGGIEKVFEINRDFRNEGVDATHAPEFTMVEAYEAYGNYDTIA
FT                   KLVKELIQKTAIDVFGSTKVTLLDGTEYDFGGEWKTMSMYDSLSEALGQQITPETSVEE
FT                   LGAIADRLGVERDEVENHGKLVEHLWEHFYEDKLYEPTFVRDFPVETSPLVKAHRSKPG
FT                   VVEKWDLYVRGFELATGYSELNDPIVQRERFVAQAKDALAGDEEACDIDEDFLEALGVG
FT                   MPPAGGMGMGIDRLLIALTGATIRETITFPLVKPLNN"
FT   gene            517892..518953
FT                   /locus_tag="BLA_0415"
FT   CDS_pept        517892..518953
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0415"
FT                   /product="large tegument protein"
FT                   /EC_number="1.6.99.5"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28717"
FT                   /db_xref="GOA:B8DW66"
FT                   /db_xref="UniProtKB/TrEMBL:B8DW66"
FT                   /protein_id="ACL28717.1"
FT                   /translation="MNPNENNGAQPSNDLPPYAQPTPAPQPAQGSPSPQGQQPAYANAQ
FT                   SAPQQPQSVSQTPHDAPQFAQNTPQGAPAGTTTVDMKESVNKFADALGKQHLKIGNHEV
FT                   AYGNLVTVVGALLAIIGVFLPFASISAFGVSMSVSLMPHGDGWILLIGAVVIAVLAVLR
FT                   QEIAALTVTIIYTLLVIYEIAAAGSKISQSGYGTLLQLSYGAGMWLLIIAIIVMLIGTI
FT                   FAFYNKQRAKNAQNGAPAMPVQNPAYDASYQDNGWQFGVPAQSDPSNVDNSQWQFGVEN
FT                   PPADAGVQQGTPVAPAPNAAAPVPPAVAHEPFNAAPDASATPAAPAAPAAPAAPAQPTI
FT                   PPASQDPDSQDAQ"
FT   gene            519258..519371
FT                   /locus_tag="BLA_0416"
FT   CDS_pept        519258..519371
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0416"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28718"
FT                   /db_xref="UniProtKB/TrEMBL:B8DW67"
FT                   /protein_id="ACL28718.1"
FT                   /translation="MFDGRISRFGAFWPFGAPATDMNQVVQIVGKASVANA"
FT   gene            519662..521074
FT                   /locus_tag="BLA_0417"
FT   CDS_pept        519662..521074
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0417"
FT                   /product="peptidase C45, acyl-coenzyme
FT                   A:6-aminopenicillanic acid acyl-transferase precursor"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28719"
FT                   /db_xref="GOA:B8DW68"
FT                   /db_xref="InterPro:IPR007000"
FT                   /db_xref="UniProtKB/TrEMBL:B8DW68"
FT                   /protein_id="ACL28719.1"
FT                   /translation="MRPRLRLPMLLLSSNKGDAMALTSEQQQIVDKATLTRINGWQYLT
FT                   VEGSPYEIGFEHGYLLTDEFKDAIRVYTHMTLETLGMDYSFFVDQAVKLHKDKIPQEYI
FT                   EEMQGMADGFTAGGFETSLDDVIGWNDWMELTGYWWPQVAAEYSNNPPDGPKGSHCSGF
FT                   VATGSATKDGKPVIAHESFDDFWSGQYFNVCESVKPAHGNSFKMQTVPGYIDSMTDFYV
FT                   TSAGLAITETTIAGFVGYDVDGIPEFVRARKATQYANSIDEWVTIVNEGNNGGYANIWL
FT                   LADANTNEIARYEQGLKHQELLRTKDGSFYGCNACHNPRIRNLECVDNGYNDTRQQTGA
FT                   RRARFEQLLPQLHGTIDDDVAKRILADKFDPYLGYVNASSRNICAHYDVDPQYYADDPH
FT                   GVWNVPFFPGGSCDGKCANGDDIKALHMWGIFGRADGEPFDADEFMRQHPQWSWQKGYL
FT                   YDRPSQPWTLFD"
FT   gene            521285..522643
FT                   /gene="pepC"
FT                   /locus_tag="BLA_0418"
FT   CDS_pept        521285..522643
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pepC"
FT                   /locus_tag="BLA_0418"
FT                   /product="aminopeptidase C"
FT                   /EC_number="3.4.22.40"
FT                   /note="COG3579: Aminopeptidase C"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28720"
FT                   /db_xref="GOA:B8DW69"
FT                   /db_xref="InterPro:IPR000169"
FT                   /db_xref="InterPro:IPR004134"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:B8DW69"
FT                   /protein_id="ACL28720.1"
FT                   /translation="MELTKQDLSQMAEAYKKDAAQQIAEQAVKNNGIHASSEREHVVVT
FT                   ENNFVFSVDVDSEAVANQRQSGRCWMFSALNFLRFHMEKSLKLPKGSFQLSQNYNFFYD
FT                   KLEKSNFFMENIIKYVGSDLNDRRVDFLLATPQQDGGDFDPICALIEKYGVVPLEAMPD
FT                   TAVTKNTSEFNAVLNRVLREDAFKLRKLVREGKSEKEVDDARRAMLSEIYRILCVSFGE
FT                   PPKTVDFEYRDTDKKYHADRGLTPLEFYKKYLGDVKLEDYVGVMNLPVEGMEYGKMYTI
FT                   DMTGEVLGSKRKLHYVNVPIDVMKEATIKQLKAGEPVWFGCDVLQDSDFVKGILSLNLY
FT                   DVQKMFGIKFDMDKGERFQYNQSLPTHAMTMAGVDLDADGKPIRWKVENSWGTTAHGKP
FT                   VGHQGYFIMDDSWFDQYMYEVAVRKEYLPEEYQKALETEPEVLPYWNTFNPEP"
FT   gene            522747..524870
FT                   /locus_tag="BLA_0419"
FT   CDS_pept        522747..524870
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0419"
FT                   /product="amino acid transporter"
FT                   /note="COG0531: Amino acid transporters"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28721"
FT                   /db_xref="GOA:B8DW70"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:B8DW70"
FT                   /protein_id="ACL28721.1"
FT                   /translation="MSDKTKSKSGAIVKGAKGSTGNLTTIALIMMNVTVIAGLANDVQQ
FT                   SFYGLSSVTFFLLGGLLFFLPTGLVAAELASGWSQRGGIFRWVGEGIGVFPAVSCLLIL
FT                   WFQTTFTFGSGIPSMSATIGFFTTKYDWAVDFAKNSHTWKVTLPIMIGWLAYYWFCCFL
FT                   ATKGVKTFSKIAQYGVILGTFLPLGVMTILAVVWLCQGHTPAIDMAPSALVPKWEGMST
FT                   LALAAGVFFSFAGIDMNAAHIKDLKKPNKQFPLAIFVSMILALLIFIVGTLIIAMVIPN
FT                   KQINLLYTLFATYRALGATIGFPDLYLVFCWLGMLNSFAALITNLAGPSYMLGQAGRSG
FT                   FLPKFLQNNNKHGMPSRLMYMQMALMTIIAFIVFLLPNVEGFVALITQAITILYLTYYV
FT                   LMFVAFLRLRYQQPNRPRGFKVPGGMFGAWLVAGIGILASVFGIVLAFYPPAQLAAEVG
FT                   SGATYDLIIIGLLAFVFIACVLIYRASRKHDWADPTNQFAPFTWQIEGLKKPSKALSNI
FT                   PTALLSEGQNPMGLPIKKHYDKDEMMKELPTGKDPKQGEVAAALLKKQGITEPSEPAKV
FT                   ALVGDPTVGVKTVSYEPEPVHTNESGDMIPQPTAADVSAAPVPTDAAADARRAEAEAKI
FT                   ASQDAHEYHNEAVALTDEAKDDATLSQDAHHVQVDEAEAHEAQAAVKSIDSINADQAVD
FT                   PTKPEDDPSQPKH"
FT   gene            524940..526481
FT                   /locus_tag="BLA_0420"
FT   CDS_pept        524940..526481
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0420"
FT                   /product="carboxypeptidase C"
FT                   /note="COG2939: Carboxypeptidase C (cathepsin A)"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28722"
FT                   /db_xref="GOA:B8DW71"
FT                   /db_xref="InterPro:IPR001563"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B8DW71"
FT                   /protein_id="ACL28722.1"
FT                   /translation="MRGAFLPCTIQAKEYSMADNTEAIKNEAGNGEQKKPLEPLPQTAT
FT                   KQYTWTGADGTKINYTATAEMIPVRANDGQLIGHMFMFSQVSDQEDKSDRPVTFCWNGG
FT                   PGGASYMVNIGGMGAKRVKTDGMAHLKGVGEVEDNPYSLLPSSDLVFIDAFGTGYSHVD
FT                   PNYDAKKVWGVDGDGDAFTRGIIAWLTKYDRMNSPHYLYGESYGTMRNAVVYRMLGEHG
FT                   VGVAGITEQSTILDYEPTLSGEDDYYMGMFPVYAATANYFKKAGVGVDQYEWYDKAFDY
FT                   ANNTLARALTLADALPADEMKKIAGEMSEFIGLPADFIEEKGLRIELDTFRKNLLKAEG
FT                   ETTGRYDTRFTTYGYQDVQGDNEFFAGEDPSYDAINAAYLDVYMKMLGDMGFKGYENYE
FT                   GLSLKVNSSWNWTHQAPGTMGSPQVPNVAYDLATALRRNPTSRICVLGGIHDAATPYWN
FT                   VRHDINKLFLPQALKDRIEYHLHSNGHMLYCDEVALAATGPELAAFYDKRHEDKD"
FT   gene            526690..528219
FT                   /locus_tag="BLA_0421"
FT   CDS_pept        526690..528219
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0421"
FT                   /product="amino acid transporter"
FT                   /note="COG0531: Amino acid transporters"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28723"
FT                   /db_xref="GOA:B8DW72"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:B8DW72"
FT                   /protein_id="ACL28723.1"
FT                   /translation="MTAATKSQGTPAPNNTGAGGPVTVKRTLSVFDLVVFGMIFMVPIA
FT                   PFSILASVANTSHGMPALAYVIAMVAMLFTAFSFDLMVPRYPSSGSIFVYASDEINGPV
FT                   GFVVGWLMLLQYLITPAVMLIMAGLAIHEYVPAVPVWAWCLIFLAIITVIAMRGAGATV
FT                   MVDKLALVAELIVLLLFFIFGVIYVAKNPSVAHFSFEGFYNPGHFEMGAVMSAVSLCAL
FT                   SFVGFGSVVTLDDQSLDPKHGPSRAMIVIVLILGALYMAMSLLTMCMDPSGKLMAANPN
FT                   NGFYLVAGLAGKWLGVLCAVANALALGIFTSLSGMTAGASLLRVMAKDDALPSVFAKIS
FT                   PKTRVATVATGFVAVLTLALIFIVLPIGMTTGAKISNYGALSTYFMLNIAVIWGLGIKA
FT                   KILEHGKFWRTIIFPLIGAIVTGVIFCSLGGEVLIVGTVWLVLGIIFYYVWTKALHHTP
FT                   DLLSDSRAKGETKAQRIARNAQADAHAKQVAQNVLDQQTAADSMSNESSKA"
FT   gene            528308..529378
FT                   /gene="menA"
FT                   /locus_tag="BLA_0422"
FT   CDS_pept        528308..529378
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="menA"
FT                   /locus_tag="BLA_0422"
FT                   /product="1,4-dihydroxy-2-naphthoate octaprenyltransferase"
FT                   /note="COG1575: 1,4-dihydroxy-2-naphthoate
FT                   octaprenyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28724"
FT                   /db_xref="GOA:B8DW73"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR004657"
FT                   /db_xref="InterPro:IPR026046"
FT                   /db_xref="UniProtKB/TrEMBL:B8DW73"
FT                   /protein_id="ACL28724.1"
FT                   /translation="MQFHDYVSGMRIPTLMLGIAPVLIGVSAACRVIGMRGADGLPACG
FT                   ILTASSACDAGTGRIITLGLLCLLVALFLQIAVNFANDYSDGVRGTDAHRTAAVRQYTV
FT                   ESDFQFLENGATAEEERQARELNGPTRLVAGGVTPRAVLMAAIVNAVLACVCGLAVIVI
FT                   TGYWWLVFVGALCVTAAWFYVGGSHPYGYFGFGELAAFVFFGPVAALGTQFVLCGQVNG
FT                   NGVYGAVVIGAVSAAVMAVNNLRDVNTDRESGKRTLAVRIGARAFTVCLCVLIALVMLA
FT                   MVIPWSVMWIHMDSDLPNLSVLGGYCAVLGEIALILLTVVVEFNVAKREYRSAMRNLSW
FT                   IALAVALVFVGLTMSI"
FT   gene            529281..530216
FT                   /gene="gpm"
FT                   /locus_tag="BLA_0423"
FT   CDS_pept        529281..530216
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gpm"
FT                   /locus_tag="BLA_0423"
FT                   /product="2,3-bisphosphoglycerate-dependent
FT                   phosphoglycerate mutase"
FT                   /EC_number="5.4.2.-"
FT                   /note="COG0588: Phosphoglycerate mutase 1"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28725"
FT                   /db_xref="GOA:B8DW74"
FT                   /db_xref="InterPro:IPR001345"
FT                   /db_xref="InterPro:IPR005952"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:B8DW74"
FT                   /protein_id="ACL28725.1"
FT                   /translation="MWPSGNTVAPCGICRGSRSPSRWCSSVSPCPSECAEIVAFADYPA
FT                   NRADMAMHVHLTRRVARLGHMTYKLVLLRHGQSEWNKTNQFTGWVDVPLTEKGREEAKN
FT                   GGKLMKDKGVLPDIVFTSLLRRAINTANIALDEADRLWIPVKRDWRLNERHYGALQGKN
FT                   KTEIREEYGDEKFMLWRRSYGTPPPEIDPNDQYAQNNDPRYAGDPVPEAECLADVVARV
FT                   EPYWEAEIIPELKSGKTVLIAAHGNSLRAIVKMLDGLTEEEIAKVNIPTAIPLVYELDE
FT                   NFKPIKKGGEYLDPEAAAAGAAAVAAQGQK"
FT   gene            530864..532990
FT                   /locus_tag="BLA_0424"
FT   CDS_pept        530864..532990
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0424"
FT                   /product="myosin-crossreactive antigen"
FT                   /note="COG4716: Myosin-crossreactive antigen"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28726"
FT                   /db_xref="GOA:B8DW75"
FT                   /db_xref="InterPro:IPR010354"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B8DW75"
FT                   /protein_id="ACL28726.1"
FT                   /translation="MYYSAGNFEAFAHPKKPEGLENKSAYIIGTGLAALTAAFYLVRDA
FT                   QMPGKNIHVFDKDVVPGGALDGAFIKGEGYVMRGGREMDNHFEVMWDVYRDVPSIEDPN
FT                   VSMLDHYYWLNKEDPNYSKCRATKARGHNAHTDNKFNLSDKGCMEILKLYLASEDELAN
FT                   KKITDYFDDEVLNSNFWLYWRTMFAFENWDSALEMHRYIHRFIHHIGGLPDFSALRFTR
FT                   YNQYESMILPLMNYLKAHDVQFHMGTAVDDVTFAISDHENGPVRNVFTNVSMDEAQRAQ
FT                   AENGAFPRNPYSTPNKKVAKTLVITDLVKNERKTIELTEDDFVFITNGGLVESTTEGDQ
FT                   NTPAGFDPTLKPGNGWDMWNRIAAVDPSFGHPEKFIYDPNLTKWMSATATTLDDTIPAY
FT                   IEKITGRSPFGGHTVTGGIVTVEDSNWLMSWTVNRQQQFRNQPKDMISAWIYGLFPDKP
FT                   GNYIRKPMQDCTGMEICEEWLYHMGVPEEQIEELAKNHCNTVPVMMPYVDAFFMPRELG
FT                   DRPDVVPDGAVNFAFIGQFAEEPRDTIFTTEYSMRTGMEAVYTLCDVDRGVPEVWNSEY
FT                   DVRDMLNAAVKLRDGQPLTTFGRNNVERKAIAFALGRTRGTYIYDMLKVYGAIADPKHP
FT                   VDMKPGMRFDESFNEADEQRLMQHAKEAEAEAFATPCSADAPVAADTVDTVDTVAPAAA
FT                   PDGALEPGENDSAK"
FT   gene            532987..533984
FT                   /pseudo
FT                   /locus_tag="BLA_0425"
FT                   /note="frameshift: oxidoreductase"
FT   gene            complement(534177..535547)
FT                   /gene="manA"
FT                   /locus_tag="BLA_0426"
FT   CDS_pept        complement(534177..535547)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="manA"
FT                   /locus_tag="BLA_0426"
FT                   /product="phosphomannose isomerase"
FT                   /EC_number="5.3.1.8"
FT                   /note="COG1482: Phosphomannose isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28727"
FT                   /db_xref="GOA:B8DW76"
FT                   /db_xref="InterPro:IPR001250"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR016305"
FT                   /db_xref="UniProtKB/TrEMBL:B8DW76"
FT                   /protein_id="ACL28727.1"
FT                   /translation="MYAIRPVPKHYAWGSHRTLQHVFHLDEHETQQPLAEMWFSGHAQS
FT                   PSPIMVDGVEQPLTSMIERNPIDMVGRRGSEEFGPVLPYLFKLICATEPLSLQVHPVAF
FT                   QARAGFNEENRAGIPLNAPERSFKDINAKSEMVVALEPFLAAVGFSTRTFALRNLELLR
FT                   LPVAQRMVEALNSTATQSAGESFVMADEMMPIASAVWSPARKRLFRAFHAAITAQETDP
FT                   QELLDDLQHARSLTEHTRNDLAFDFAIRAAKAFPGDTSSLALLMMNPVRLEEGQSVFLP
FT                   TGTPHAYIYGTAAEIMTNSDNVLRAGLTVKHKDIVNLLQCLDCRTSTPVDPSNSQIATM
FT                   LMRDLAFYKPNVSEYMLAYGQVDVQHEPWPVINALAKRYDSLVRQISGHTPFPHSGPRV
FT                   VVCTQGSVQVISEADSRVLHQGDAVFVPASDGWAHVEAVIDGEGEPQGKYLVASTPF"
FT   gene            complement(535882..537270)
FT                   /locus_tag="BLA_0427"
FT   CDS_pept        complement(535882..537270)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0427"
FT                   /product="sensor protein"
FT                   /EC_number="2.7.13.3"
FT                   /note="COG0642: Signal transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28728"
FT                   /db_xref="GOA:B8DW77"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B8DW77"
FT                   /protein_id="ACL28728.1"
FT                   /translation="MPQFTTTVIAVAFILLAVGAVIGLLVLLYDWLAPLISRTTHGVSL
FT                   PDSIGDLVSRLRRRRSRDDEDGDDDDDDELDDEAAALLSILPAASIVVDDSDDVVRANP
FT                   AAYRLGIVNDDVIVDSRVLDAVRKVREHGGKTSLEITTSTPKRFALPEPVDTEEDLKTS
FT                   TVSRPNWLKLVIGRIDEQFVVVLIDDISESVRFSQMRDDFVTNVSEMIIRPSEDLQRLA
FT                   DVLEHGGMSPEQVAQAARDVRRSSAYVDHMVKNLLLLIKAQGDAPNAQSAVLDVREQVE
FT                   VAVNELLPQARQRGITVSITGKGEPKVRGNATAIRAAIGKLVDNAIEYSPDNANVSVLI
FT                   ETTRDTKDALVRVVDRGTGIPLKEQPRIFERFYRGANQNERTQSGVGLGLAIVKHVAIM
FT                   HHGNVQVWSRPGQGSTFSLVLPLVPESAEEAGEISRRRADGNRDGENAPTQAMRNQSTR
FT                   HTSR"
FT   gene            537440..538120
FT                   /gene="phoU"
FT                   /locus_tag="BLA_0428"
FT   CDS_pept        537440..538120
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phoU"
FT                   /locus_tag="BLA_0428"
FT                   /product="phosphate transport system regulatory protein
FT                   PhoU"
FT                   /note="COG0704: Phosphate uptake regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28729"
FT                   /db_xref="GOA:B8DW78"
FT                   /db_xref="InterPro:IPR026022"
FT                   /db_xref="InterPro:IPR028366"
FT                   /db_xref="InterPro:IPR038078"
FT                   /db_xref="UniProtKB/TrEMBL:B8DW78"
FT                   /protein_id="ACL28729.1"
FT                   /translation="MRVIFNEGLKAVADDLDHMARDVRDAIRLAGEALLHQDLDAAQTV
FT                   IDNDASIDDLSTRIMDQCVELLARQNPVATDLRVIVSTMRLATTFERMGDLARHIAESA
FT                   RRTYPNSPVPQNLVPTFAKMQQFLDITGGRLVDMLADRDTAIAEQIIRDDDQLDDLHLK
FT                   IMQYADSAEWEGTNEQLINVVLIARFMERLGDHAVSAARRVVFIVSGFDPTKTPSRDEG
FT                   TDID"
FT   gene            complement(538277..539416)
FT                   /locus_tag="BLA_0429"
FT   CDS_pept        complement(538277..539416)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0429"
FT                   /product="phosphoserine aminotransferase, putative"
FT                   /EC_number="2.6.1.52"
FT                   /note="COG1932: Phosphoserine aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28730"
FT                   /db_xref="GOA:B8DW79"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR006272"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR022278"
FT                   /db_xref="UniProtKB/TrEMBL:B8DW79"
FT                   /protein_id="ACL28730.1"
FT                   /translation="MSTITIPQNMLPADGRFGSGPTKIRREQILDLTNAADTLLGTSHR
FT                   QRPVKQLVESIREGLAEFFSLPAGYEVVLGNGGASAFWDVVCCSLVSRKAACGVYGSFT
FT                   KKMAASLSSAPFLEEPAIYEGDFGTWRLPELTDGVDAYCWAQNETSTGVAAPVKRIAGS
FT                   VNQGALTIIDATSGAGALPVDLSQTDAYYFSPQKAFGSEGGLWVAILSPEAIERAEAVK
FT                   ENAAVPGSIRWIPPFLSLTSAISNSRKNQTLNTPAISTLVLMESQIRYLNGNGGLDWAV
FT                   KRCERSANTVYSWAEASRYASPYVVDEEARSHAVVTVDLIDAVPAAAVLEALRDNGIVD
FT                   VNGYRALGRNQLRIGVFPSVDPSDVEALTHCIDYVIEHL"
FT   gene            540368..540778
FT                   /locus_tag="BLA_0430"
FT   CDS_pept        540368..540778
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0430"
FT                   /product="transfer protein"
FT                   /note="COG3942: Surface antigen"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28731"
FT                   /db_xref="InterPro:IPR007921"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:B8DW80"
FT                   /protein_id="ACL28731.1"
FT                   /translation="MDEHQGQLPQGFDANHETGDRGNAYPYGQCTWWAYERRAQLGLNT
FT                   GSHFGNAGSWAVSAGSMGYWVDNTPRNTGDALVFSPGQEGASGVYGHVAVVEKVNPDGS
FT                   IEISESNVQGVGVISHRTFTSAQARNFQYIHF"
FT   gene            541240..542058
FT                   /locus_tag="BLA_0431"
FT   CDS_pept        541240..542058
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0431"
FT                   /product="NLP/P60 protein precursor"
FT                   /note="COG0791: Cell wall-associated hydrolases
FT                   (invasion-associated proteins)"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28732"
FT                   /db_xref="InterPro:IPR000064"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:B8DW81"
FT                   /protein_id="ACL28732.1"
FT                   /translation="MNTMKRSISIATAVVAASLAFTSIAPAATAADSQSGSNYVVSTRS
FT                   FPKVNVAKANFFAEATSTEVDKDSNWGGLGSMDVPQTKSTAEKEAEARAQAEKEGAEQR
FT                   AQEEAAAKAAREQAAAASRGQARESLTDTNANTAQQEAAPAAQPAAAPSVPTSKNGAAI
FT                   AAYAQKFIGAPYVSGGTTPSGWDCSGFVMYVFSRFGINLPRTSGAQAGVGTAVPSLAEA
FT                   QPGDIIANANHAAIYIGNGMIVNALNPAQGTQVTNLSAFGGAAYSIRRVL"
FT   gene            542551..543606
FT                   /locus_tag="BLA_0432"
FT   CDS_pept        542551..543606
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0432"
FT                   /product="UspA domain protein"
FT                   /note="COG0589: Universal stress protein UspA and related
FT                   nucleotide-binding proteins"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28733"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="UniProtKB/TrEMBL:B8DW82"
FT                   /protein_id="ACL28733.1"
FT                   /translation="MNDNTILVGVDGSHASYKATWWAANYAKHMGLSLQIVCAYSLPSY
FT                   AAVSFDATYTSMGDDNAAHNDAQEILSKAKAIADEQGVNAQTLIVTGDPSSVFVELSRN
FT                   YNLIVIGNRGKGGLAERLLGTTSSSLPAYAYCPIVVVPYTDDKDNLLHLNNVITKVAVG
FT                   SDDTKWGLRALQIAADFAANWGAELDVITVVPGNTNLDDPAQKQKFEDVLDARLESICT
FT                   THPDLKIRKSIVAGRAVETLTKASHTHDIVVVGSCGRGGLTGLLFNSTSQGLLQHSASP
FT                   VYVVPRKFVEAEEQRVKTGTASGTETAEVTSLEEFVREVPVERASEETERQIEIDIDPK
FT                   AHEYRQDDNEQ"
FT   gene            complement(543695..544108)
FT                   /locus_tag="BLA_0433"
FT   CDS_pept        complement(543695..544108)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0433"
FT                   /product="OsmC-like protein"
FT                   /note="COG1765: Predicted redox protein, regulator of
FT                   disulfide bond formation"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28734"
FT                   /db_xref="InterPro:IPR003718"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR036102"
FT                   /db_xref="UniProtKB/TrEMBL:B8DW83"
FT                   /protein_id="ACL28734.1"
FT                   /translation="MSKRIWVERNKDGSWDAFSDDGAHIKFGKGRGQFTPGDLMKIALA
FT                   GCAALSSNFAIESTLGEGKGAKIVVDGTYDADNDSYINFNETLMIDATDADLSPEDVEK
FT                   LKKRVRAHVDKGCTVKHTYEQVTPVRMDIEVRS"
FT   gene            544314..545114
FT                   /gene="thyA"
FT                   /locus_tag="BLA_0434"
FT   CDS_pept        544314..545114
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thyA"
FT                   /locus_tag="BLA_0434"
FT                   /product="thymidylate synthase"
FT                   /EC_number="2.1.1.45"
FT                   /note="COG0207: Thymidylate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28735"
FT                   /db_xref="GOA:B8DW84"
FT                   /db_xref="InterPro:IPR000398"
FT                   /db_xref="InterPro:IPR020940"
FT                   /db_xref="InterPro:IPR023451"
FT                   /db_xref="InterPro:IPR036926"
FT                   /db_xref="UniProtKB/TrEMBL:B8DW84"
FT                   /protein_id="ACL28735.1"
FT                   /translation="MPYEDLLRKILMEGNLKNDRTGTGTISLFGQQMRFDLAKGFPLLT
FT                   TKRVFFKGIAYELLWFLKGSSNVHWLQEHNVHIWDEWADENGDLGPVYGVQWRSWPAPT
FT                   ADDPDRTIDQISNVLELIKHNPDSRRMVVTAWNPAEVENMALPPCHALFQFYVADGRLS
FT                   CQLYQRSCDMFLGVPFNIASYSLLTMMMAQQAGLEPGEFVWTGGDCHIYDNHVEQVLEQ
FT                   LSREPYPYPRMEIRKADSLFDYQYSNFHIADYRYHPTIKAPIAV"
FT   gene            545240..545923
FT                   /gene="dfrA"
FT                   /locus_tag="BLA_0435"
FT   CDS_pept        545240..545923
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dfrA"
FT                   /locus_tag="BLA_0435"
FT                   /product="dihydrofolate reductase"
FT                   /EC_number="1.5.1.3"
FT                   /note="COG0262: Dihydrofolate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28736"
FT                   /db_xref="GOA:B8DW85"
FT                   /db_xref="InterPro:IPR001796"
FT                   /db_xref="InterPro:IPR012259"
FT                   /db_xref="InterPro:IPR017925"
FT                   /db_xref="InterPro:IPR024072"
FT                   /db_xref="UniProtKB/TrEMBL:B8DW85"
FT                   /protein_id="ACL28736.1"
FT                   /translation="MESGSSRSGYHEPVPGSAGPEVFEDDWGDDFPKTFSVNLIWAQAN
FT                   DKEGRSGAIGYEGEMPWHLPEDLKRFKELTVSHPVIMGRKTWEALNEKFRPLPNRDNIV
FT                   LSRDRDFRAPGATVVDNLEEALDMARQEAIPDDGLDRSEIWVIGGSQLFNQMLPMASKI
FT                   YMTQVDAKVNADAYAPDLTEALNNGSWKLMENSGWLTPKKPEGIDRYRYLTFERNTGDE
FT                   QAEEE"
FT   gene            545958..546494
FT                   /gene="ptpA"
FT                   /locus_tag="BLA_0436"
FT   CDS_pept        545958..546494
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ptpA"
FT                   /locus_tag="BLA_0436"
FT                   /product="low molecular weight
FT                   protein-tyrosine-phosphatase"
FT                   /EC_number="3.1.3.48"
FT                   /note="COG0394: Protein-tyrosine-phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28737"
FT                   /db_xref="GOA:B8DW86"
FT                   /db_xref="InterPro:IPR017867"
FT                   /db_xref="InterPro:IPR023485"
FT                   /db_xref="InterPro:IPR036196"
FT                   /db_xref="UniProtKB/TrEMBL:B8DW86"
FT                   /protein_id="ACL28737.1"
FT                   /translation="MGTKPQPYTVMTVCTGNICRSPMAEIILRHEFEERGLGDRARVES
FT                   SGVSSEEHGNPIDRRAVKVLREHGYDIPPEHFAHRITPNEIAETNLFLPMTASHMGALM
FT                   HMLPLSKRSHVFMYRSFDPNLPDPQPGRESDIDLVDPWYGGQRDFEISIDQIEEVAPYI
FT                   VDYVEKQLEAQDATR"
FT   gene            complement(546593..547603)
FT                   /gene="galE"
FT                   /locus_tag="BLA_0437"
FT   CDS_pept        complement(546593..547603)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="galE"
FT                   /locus_tag="BLA_0437"
FT                   /product="UDP-glucose 4-epimerase"
FT                   /EC_number="5.1.3.2"
FT                   /note="COG1087: UDP-glucose 4-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28738"
FT                   /db_xref="GOA:B8DW87"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR005886"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B8DW87"
FT                   /protein_id="ACL28738.1"
FT                   /translation="MTVLVTGGCGYIGAHVVHALHEAGEDVVVVDDLSYGKPNRIGNAR
FT                   LYGMDIATPGAGERLAEIMEAENVDSVIHFAARKQVGESVEKPLWYYQQNINGMLNVLE
FT                   GMKEAGVKKLVFSSSAATYGVPPVDVVPEDVEPMVPINPYGQTKLFGEWMARACEQPYG
FT                   IRFCGLRYFNVAGCGPVQLEDPAILNLIPMLFDRLKQGKAPAIFGDDYPTPDGTCVRDY
FT                   IHVSDLADAHIAALKYLDRDERKYDVFNVGTGEGTSVRQIVDEVKKVTGLPFKETVMGR
FT                   RAGDPPHLIGSPERINTEMGWHAKYDVEDIVESAWNAWQANPDHHIDVETWKQTD"
FT   gene            547940..548785
FT                   /gene="trmB"
FT                   /locus_tag="BLA_0438"
FT   CDS_pept        547940..548785
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trmB"
FT                   /locus_tag="BLA_0438"
FT                   /product="tRNA (guanine-N(7)-)-methyltransferase"
FT                   /EC_number="2.1.1.33"
FT                   /note="COG0220: Predicted S-adenosylmethionine-dependent
FT                   methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28739"
FT                   /db_xref="GOA:B8DW88"
FT                   /db_xref="InterPro:IPR003358"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B8DW88"
FT                   /protein_id="ACL28739.1"
FT                   /translation="MTEQNRNLEESGNGGAANNPLHGRKVLSFVRRSARLDARLQRALD
FT                   NYADEYILSDIALSEGSLDPCEGFVFSRDYVQGQWGNDNPLTVEIGSGQGENVVAAAAE
FT                   HPERNFLALEVYDPGVAHTVLLAGKRGLRNLRVAQINAPELFAVMEPGVLDEVWTFFPD
FT                   PWPKMRHHKRRIVQPELARDVHASLGVDGVWRIATDIEDYALHVHEVMDARRDFENLGT
FT                   LTVSLPVEHVGKGNAESAAALPHADFMESERFDGRVLTNFEKKGLAAGRVIHDFAYRAV
FT                   "
FT   gene            548903..548977
FT                   /locus_tag="BLA_t0019"
FT   tRNA            548903..548977
FT                   /locus_tag="BLA_t0019"
FT                   /product="tRNA-Glu"
FT   gene            complement(549395..550462)
FT                   /locus_tag="BLA_0439"
FT   CDS_pept        complement(549395..550462)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0439"
FT                   /product="putative membrane protein"
FT                   /note="COG1434: Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28740"
FT                   /db_xref="GOA:B8DW89"
FT                   /db_xref="InterPro:IPR003848"
FT                   /db_xref="UniProtKB/TrEMBL:B8DW89"
FT                   /protein_id="ACL28740.1"
FT                   /translation="MQADSAMMTLLTWCPLLVGVTFFALTMAFNRRSLWSGFSAFVMLL
FT                   GIGATSIVLLMTASQYVTGSLLGTLALIAISLVAVALLLFPFALGIFLIAEGIRLLRRE
FT                   GLSPANCLSLALGVLICSDLLVFPAIVASVHNDAVNWVFGVLSACTFYFSAQLAIYCLS
FT                   SALNLIHFGKARNIAQILVLGSGLFGETVPPLLQKRIAKGIEIQRQDPHARLILSGGQG
FT                   AGEDVPEGVAMKAWALAHGADPANTVCEERSRNTRENLLFSRNLFADPNGKTAIVSTGY
FT                   HVFRALLLSKQLHMNAVGYGSKTPWYFSLNALLREFIAYVSMTRKWQIVILVVLLTPFW
FT                   VSGVAGLVQAIQHLA"
FT   gene            550609..551604
FT                   /locus_tag="BLA_0440"
FT   CDS_pept        550609..551604
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0440"
FT                   /product="5'-nucleotidase"
FT                   /EC_number="3.1.3.5"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28741"
FT                   /db_xref="GOA:B8DW90"
FT                   /db_xref="InterPro:IPR010394"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:B8DW90"
FT                   /protein_id="ACL28741.1"
FT                   /translation="MGQTLDNKALVIGVASSALFDLGESDQIFREEGVEAYERYQNEHL
FT                   DEPFRPGVAFPFISKLLEFNSVFDGDDQGVEVVVLSRNSPRTGLRVMNSIEHYGLDITR
FT                   SVFRSGISPFEYMKAFDMALFLSADDADVREAVAEGFPAGCVLPLSDSGNRGDGTAAEA
FT                   THVHESGEELRVAFDFDGVLAGDSAERVFREAQVSDPANALEKYNEHEADLANRPIEEG
FT                   PLKRLLEGINILQNAAREYREANPAAQTPNLRVALVTARSGKAQKRAVNTLEDWGLTVD
FT                   DAFFLGGLNKAPFLNRMQPDIFFDDQMGNLDRYTLSIPSVHIPFGAHNGE"
FT   gene            551708..552283
FT                   /locus_tag="BLA_0441"
FT   CDS_pept        551708..552283
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0441"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28742"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:B8DW91"
FT                   /protein_id="ACL28742.1"
FT                   /translation="MQPNKTLSVNGEPFEVLRLLGKGKGGYSFLVRSQSHSKTEYVLKQ
FT                   MHHEPMPFLQPNDKVQAEIRDYRRLCELGIRLPAMLDIDIAKERILKEYIDGPTVYNLV
FT                   LTDQMDDSYVDQVREMAKRLQSHRLNIDYFPTNFVVENGLVYYIDFECTAYTRERSFDG
FT                   WGVTYWSKTPEFLRFVAAHAPHAPAAAQ"
FT   gene            552309..553856
FT                   /locus_tag="BLA_0442"
FT   CDS_pept        552309..553856
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0442"
FT                   /product="predicted ATP-dependent endonuclease, OLD family
FT                   protein"
FT                   /note="COG3593: Predicted ATP-dependent endonuclease of the
FT                   OLD family"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28743"
FT                   /db_xref="GOA:B8DW92"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041685"
FT                   /db_xref="UniProtKB/TrEMBL:B8DW92"
FT                   /protein_id="ACL28743.1"
FT                   /translation="MRLTSLSIANHSRVTDFRIDVRRHLVLVGTNESGKSSILRCLDLV
FT                   LGKSTADLYATVTAADIREPQLPFTIAVELENDGMHTCMRFEAALDADGETVHISRTMG
FT                   DDGHVVTAADLARIGWVYLSDSFPSNRETQHEIVDELLETVQLEQEEAVFEAVADQYAR
FT                   LLHSSPALLALRKRIADALTSALPMRCNPNNLMFVPGSKLNRNPFSDVHLQLRMHGKQR
FT                   GLWEQSGGLRSIYTVALYDLLDEHVHIVGVDEPETHLHPTSQRNLARLLKEGASQKILA
FT                   THSPDIIGEFEPDQIVVVRANGGVVQPRRDFLSEDDKLLLHMWVRDRLEPLTAEHVIVV
FT                   EGVTDRALVEHCANVTGRNLDAHGVVLLEAGGCREMPAWQRVFGEHGFRVPLTQLVDED
FT                   AQGDLAHQYHVRAGELESKLVFVSHVDLEAEYIRALGVDLAYEALSQSNLFRPAETKSL
FT                   RTARQQGTLNESMLADFCRMRANKTRAVLAVLPRISAKRARRIDSVQRLLTSVIGLA"
FT   gene            553990..554352
FT                   /locus_tag="BLA_0443"
FT   CDS_pept        553990..554352
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0443"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28744"
FT                   /db_xref="UniProtKB/TrEMBL:B8DW93"
FT                   /protein_id="ACL28744.1"
FT                   /translation="MVSRTIGTRCRSLLAAVGALTLCVALGACGARHDERAAEGRSQVA
FT                   PSPTPSQTAQERTRGTDSLLSADLIEQIRQLDGNSDPQTTRSVFAGILFNGPGHESPGG
FT                   PGRGATPDATRTSRCA"
FT   gene            554343..555146
FT                   /gene="axe"
FT                   /locus_tag="BLA_0444"
FT   CDS_pept        554343..555146
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="axe"
FT                   /locus_tag="BLA_0444"
FT                   /product="Axe"
FT                   /EC_number="3.1.1.72"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28745"
FT                   /db_xref="GOA:B8DW94"
FT                   /db_xref="InterPro:IPR000675"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B8DW94"
FT                   /protein_id="ACL28745.1"
FT                   /translation="MRVITVRGTNEQLNGGMLGPLAQQIASASPGHIQVTPLEYAASVE
FT                   PGTQADGVNLLMSTLNGQAEQCPAQHTVLLGYSQGAMVVGDALSAPDVRPNEDNGYTLS
FT                   DRASENVIVAELFGDPRFNSETSYDVGDFTKGTNGVMGARGPHELDRYASRTQSYCNYD
FT                   DPICQTYGSRKGHREYATNGLRDQAHTRRAAVNRRMRMHMRNIWRAHVRGISWNTYRCT
FT                   EREPWQAMRSSARIAGNRSPSTRRATPTSCSRCGGRNSTANSNHA"
FT   gene            555020..556507
FT                   /locus_tag="BLA_0445"
FT   CDS_pept        555020..556507
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0445"
FT                   /product="conserved hypothetical protein"
FT                   /note="COG4487: Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28746"
FT                   /db_xref="InterPro:IPR019219"
FT                   /db_xref="UniProtKB/TrEMBL:B8DW95"
FT                   /protein_id="ACL28746.1"
FT                   /translation="MASHEIKCPHCGESFTIDEAGYADIVQQVRGQEFDRELESRLKLA
FT                   EDDKAKAVELARQKANSELQQAKASKDAEISELKAQLAAFEDRQKLAVSEAVGDVEKER
FT                   DELRHEVERLKSDAESERELAKANLEAEKAKAAAEKDVRIQQLQSQLDNVQTSKQLEIA
FT                   EQVGKVERECDRLRGELSTAKMQQELELKSVREQYEVQLRDREDEIERLRDFKTRLSTK
FT                   MVGESLERHCQDEFNKVRMGSFPNAYFEKDNDARTGSKGDFIFRDYDGPEDDEGRTEFI
FT                   SIMFEMKNENETTATKHRNEDFFKELDKDRREKGCEYAVLVSMLEEDSDLYNQGIVDVS
FT                   YRYPKMYVIRPQYFIQMITLLRNAARGTLEYRRELAEMRAQNIDITNFEDKLNEFKSGF
FT                   ERNYELASKKFQTVIDEIDKSIDHLQKTKKALLGSEDNLRIANKKVQEVTVRRLTYKNP
FT                   TMQEKFKQARAVRDEEKAIGKVPEVGIELAEDTGVER"
FT   gene            556621..558195
FT                   /locus_tag="BLA_0446"
FT   CDS_pept        556621..558195
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0446"
FT                   /product="conserved hypothetical protein"
FT                   /note="COG1196: Chromosome segregation ATPases."
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28747"
FT                   /db_xref="InterPro:IPR021804"
FT                   /db_xref="UniProtKB/TrEMBL:B8DW96"
FT                   /protein_id="ACL28747.1"
FT                   /translation="MADVRSELAQLRPVYETGVLRMLLHKYSDIYIAMLRACFDPLTAE
FT                   VPQERLLARMREAIGELAADGTYTPREGEDDMMAARRILKELKAEDAGDYAWVADSIDR
FT                   RQHRLMCRLTQRAHRAIEALATLQQRTVSLSGAQVNSIIMEIESARKQLTVNVEERIEL
FT                   LEREIEERRHQIDNLKAHGIGQRPTREQVSDIINVVYNTLRGVPVDLRELVITERDNGD
FT                   ALRRRIDDGSMSSNDMLTFYHEEYERTYRLSDEGRRFNDAFQVMYAPQSREELNEALQD
FT                   ISNSEWLHGEADDLMSVVNREFEDIYDGIDDVRHQIRVTDESVKLLVRQQTDMQFRTMS
FT                   RQLAKLFTQLGESVHAKGRYDIGTATTSLLTLPTRARETPVKTAAPELQMQADDGIAQV
FT                   DLNGIVAAGGPRIHHMIELVAAHPVLIDDAGDALADSVVDIAASFNELPADERRESEIV
FT                   GFLSYLGSASPAGAAGNSDGGQIPVPRESLWHCVTTDGRTRVWRTCALFVPGQVLKDFL
FT                   DDTMVED"
FT   gene            558263..559006
FT                   /locus_tag="BLA_0447"
FT   CDS_pept        558263..559006
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0447"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28748"
FT                   /db_xref="InterPro:IPR025449"
FT                   /db_xref="UniProtKB/TrEMBL:B8DW97"
FT                   /protein_id="ACL28748.1"
FT                   /translation="MLSAEYEEGVADEAGMADLANVHALFDGDIGDMPAPAREAAIALK
FT                   RNRSISGDMYHQALDYMEHVRRSLNNDMLVPVIDTYYEVMYAEPITADEYGIRSLKTRA
FT                   SLSAREAVMLAALRRKVLDYENVGAAAADWLISKEEIVNTMSTGAGPLAGRNSEEAVQA
FT                   QVDRLIGSAKNNGFLAPVEDDEGMYVITKLVPVVLNPERIAAWLGADDASTAQPEPDGT
FT                   GDDSDGSGHTGQDEHPEDDDMEALF"
FT   gene            559003..562500
FT                   /locus_tag="BLA_0448"
FT   CDS_pept        559003..562500
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0448"
FT                   /product="putative ATP-binding protein"
FT                   /note="COG4913: Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28749"
FT                   /db_xref="GOA:B8DW98"
FT                   /db_xref="UniProtKB/TrEMBL:B8DW98"
FT                   /protein_id="ACL28749.1"
FT                   /translation="MSETSDIYASIELMPPHWALASRQLVNWGSYDGYHVFEPSTAGND
FT                   TVTLLTGQSESGKSTLVDAQVSLLYPANAAFNKASNAGRSDRSDYSYLLGLRGIRNNNG
FT                   HDEPVYLRGRSGNGEPYAVWGAIVDHYVDTANSGALWIAKFMYLPADGAPESMVKLYVV
FT                   SGYAIDPRLMDAHREERFSVPLIKQVYPGVTVYNYAKQFHEDIWKRFGLTESACRLLHR
FT                   MQASDAPSQLDDIFRKGVLNEPRAVEFGKLAIDDYEQFAENFSSMERTRKRVRQLEAIA
FT                   SEFAEYESAERGVRELSTIAPEQGDSARIRTQWLDDRIHADITEVLPEYEQHATDCSAS
FT                   AQAAKERAEQMREQADSLNRQLQGMGGDEISRLEDRIRDAQRRQREVLGRRELLASRFS
FT                   ASGEALPESRGQWDALVAEYTQFESEYQQRKTELHGLQYPLIDAQKKAEQRTKALEKDL
FT                   ERKRQSKTRISSDMDEARNMIARATGLSPQELPYAAELMDVGEENEEWRTAMNVAYRSL
FT                   ATVILVDSCHENGFAAKVSQIPQEALPRRNWRFVDTSVHVEAEEREGWLSSKLTFNVES
FT                   PFADWLRARVTEARYDAWCVEAIDDTNETTRQVQRDGQIKEGRKGSHGTKNMPAVIGFV
FT                   TDAYLRDLEADIAEARKTRDAATRDLEQYDVQLNALEQRHSLAQTLQDHAWNDIDAYGV
FT                   EEEIASLQQRVDELEQNPELAQLNATLKVQQQEMAKANSACYAAEDKLKRANAAVRSTR
FT                   QWLEAYDRRTQSVERRPLNEACGRLLERGYLAYFGESTQSANERMGRILGLDGQSCTSL
FT                   GGHVRENEACAKHVRELLGTLAQTVGRQVKELATQRDNRKRSCEASMRSYLDQYASGDE
FT                   RVSAEVENERYFRKDLEELKPGVIGDEATNVEYMNSLDKMLQDLVQLQTMLKLDQQRIT
FT                   EQIGKINHLLERYPFGARGGRLSIVVQVHRPDAKFTTALTGQIGRINAFKANDEHDVER
FT                   CRKLFAGLAGLIEMLRGSFDEYAGNGRGNANLDPRKRSRFFGSVTNPDGVVESINSTGG
FT                   GSGGYLQELTSFAYGAALMYLLATDNATEPSYATVFLDEALIKADGQYTRRALSVLPGL
FT                   GFQVIVSAPESKTGEIMGSASKVIVARKDQASGRTTLMQGDLLGDADGDESSMGERSE"
FT   gene            562497..563717
FT                   /locus_tag="BLA_0449"
FT   CDS_pept        562497..563717
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0449"
FT                   /product="conserved hypothetical protein"
FT                   /note="COG4924: Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28750"
FT                   /db_xref="InterPro:IPR024534"
FT                   /db_xref="InterPro:IPR024537"
FT                   /db_xref="UniProtKB/TrEMBL:B8DW99"
FT                   /protein_id="ACL28750.1"
FT                   /translation="MTDTATLKTPADVRGDVARIVQRELFAAESPWPRTIHIPWPKETQ
FT                   LVADVAGVHAANNALKEFAARFGCQTDFISRKMGTAVSLVAHIHVPDEATALAIAGPTL
FT                   RRPRERVLARAAQLEQRCHVDHALAMDVVRRLNNESDVDFGLFVEAAQWFGRHWAEVPG
FT                   LTAREIPLPGFSAKWLAGSRSRRRAAICTVLGVDRLPLRERPGEVRYRYMDQRFAAEPD
FT                   RVATSVQCVPERPVSLAVIVENKDTYQAMGPIDGAVCVFGSGFAVNRVPELLPWLAGDG
FT                   VRVVYWGDIDAAGFEILSGLRASGVACESVLMDRMTYAEYERFGTTRDAASHEIRCGEP
FT                   KHGLHLSPEEYALYRDLCTGELAVPRIEQERIPIAEFMRLISAGRSDGSDGARADQCHS
FT                   QSLRTPK"
FT   gene            complement(563638..564015)
FT                   /locus_tag="BLA_0450"
FT   CDS_pept        complement(563638..564015)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0450"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28751"
FT                   /db_xref="GOA:B8DWA0"
FT                   /db_xref="UniProtKB/TrEMBL:B8DWA0"
FT                   /protein_id="ACL28751.1"
FT                   /translation="MTEHTDANRGTSRLLMTIGWIILGIGMLIAIVLRCTDQYGFITGF
FT                   MLMFVFPVLALAATATATAGSVHGYWLGLAAAAVEIAILASATRGIDVFALYGGITLVC
FT                   AAIGYGIGRLLHRHFHRSGLR"
FT   gene            complement(564085..564441)
FT                   /locus_tag="BLA_0451"
FT   CDS_pept        complement(564085..564441)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0451"
FT                   /product="putative uroporphyrin-III C-methyltransferase"
FT                   /note="COG3189: Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28752"
FT                   /db_xref="GOA:B8DWA1"
FT                   /db_xref="InterPro:IPR007438"
FT                   /db_xref="UniProtKB/TrEMBL:B8DWA1"
FT                   /protein_id="ACL28752.1"
FT                   /translation="MIQLKRAYAPAEPDDGYRILVDRLWPRGMSKAKEHLDLWMKQIAP
FT                   STDLRKAWNHNPNTILEFAESYRRELDANPAVEQLEQILADHPVVTFVYGARDPLVNHA
FT                   RILRDYVEERQKVQ"
FT   gene            complement(564720..566236)
FT                   /pseudo
FT                   /gene="lacS"
FT                   /locus_tag="BLA_0452"
FT                   /note="frameshift: galactoside symporter"
FT   gene            566546..569749
FT                   /gene="lacZ"
FT                   /locus_tag="BLA_0454"
FT   CDS_pept        566546..569749
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lacZ"
FT                   /locus_tag="BLA_0454"
FT                   /product="beta-galactosidase"
FT                   /EC_number="3.2.1.23"
FT                   /note="COG3250: Beta-galactosidase/beta-glucuronidase"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28753"
FT                   /db_xref="GOA:B8DWA2"
FT                   /db_xref="InterPro:IPR004199"
FT                   /db_xref="InterPro:IPR006101"
FT                   /db_xref="InterPro:IPR006102"
FT                   /db_xref="InterPro:IPR006103"
FT                   /db_xref="InterPro:IPR006104"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014718"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR023230"
FT                   /db_xref="InterPro:IPR023933"
FT                   /db_xref="InterPro:IPR032312"
FT                   /db_xref="InterPro:IPR036156"
FT                   /db_xref="UniProtKB/TrEMBL:B8DWA2"
FT                   /protein_id="ACL28753.1"
FT                   /translation="MNEETLQEVAEEKATEPPRNDVPSTDGALRSEEPTAAWLTDPRVF
FT                   AVNRLPGHTDHNCADDQSGALKQHLDGEWAVKVVPSHLDRLPTEGLDEHWQHAHLPPEF
FT                   ASRSFADGDFTRVQVPGCLEMQGLMRPQYVNIQYPWDGHENPQAPSVPTDNLVALYRRA
FT                   FTADDRVGEALSRGERVSLTFHGAATAIYVWLNGVFVGYAEDSYTPSEFDVTEALHAGE
FT                   NLLAVACFQYSSASWLEDQDCWRFHGLFRDVELEVRPHAHVRDMLAHADWNVDAQCGEL
FT                   AVELDLDGAWCAANVELRLSTWEEHADGAALLWSATVESAPKIRYATTCEQVLPWSAEQ
FT                   PNLYVLEAVVRDANGRVLETARTRIGFRHVEIRDGVLVLNGERIVFHGVNRHEFDARRG
FT                   RSVTEEDMLWDVRFMKRHNINAVRTSHYPNQTRWMELCDEYGLYVIDEANLETHGSWNL
FT                   PGDTADGVSIPGDDVRWQPACVDRVESMVRRDRNHACVVAWSLGNESYAGDVIRAMGNR
FT                   CRELDPTRPVHYEGVTWNREYDDISDFESRMYAKPDEIREYLESDPAKPYISCEFMHAM
FT                   GNSVGGLGEYVALERYPQYQGGFIWDFMDQALWQRLDDGTERLAYGGDFGDRPSDYEFS
FT                   GDGIVFADRTVSAKAQEVKAQYAGVRLEPDGRGVRVTNTNAFQGTSGTVFVARMLLDGR
FT                   EAWSKSYEFEVAAGSARSFDIGFPDVHSLPDGGVMHEVVYEVSQQLAHDTAWAEAGYEI
FT                   AWGQAVVRPHASGRSGSKMNDAFDDDNLQIVTLGRWNAGVRVGQREILLSRTHGGVISL
FT                   RDGEREYVIRVPKLLTFRPLTDNDRGMSSGFDRVQWFGAGRYARVVTGVGQVYRDELTG
FT                   DLCGEYWYELADGAQTQVPIRYRIDSQLRMHIELEYTGCAGAPSLPAFGLEWMLPKQYE
FT                   NLEFYGRGPAETYRDRKRAKLGIWNTTAQADMAPYLVPQETGNHEDVRWAYVFDADCHG
FT                   LLVEADDSLALSLLPHSSLEIENATHQNELAQPRHMFLRLLAGQMGVGGDDSWGAPVHD
FT                   RYLLPADEPLKLAVTISML"
FT   gene            complement(569852..570847)
FT                   /locus_tag="BLA_0455"
FT   CDS_pept        complement(569852..570847)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0455"
FT                   /product="LacI-type transcriptional regulator"
FT                   /note="COG1609: Transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28754"
FT                   /db_xref="GOA:B8DWA3"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:B8DWA3"
FT                   /protein_id="ACL28754.1"
FT                   /translation="MVTRKDIAEQAGVSQSTVSRLLNGDPTLKVKADTRRRIMRTAAEL
FT                   GYRAFTSRSIAVLNVPPQFDELQDAYFQSLQTELRKVAAEQGTTLTFFDSIDSLIAHAD
FT                   DHDGFVATGPTSFQRTDLAHLRDALRYGVFIDTNPAPDWFDSVRPDLSQTMLDALDTLL
FT                   VDGYTCIGYIGGVGSIMGLHNHTEDIRSLAFSDWSKRLGLPNEQYIYADGPFTVSNGRA
FT                   LAARLLTDHPDDLPNALVIGSDPMAVGVLQAFAEAGVRVPTDIAVVSVDNLPIAQYTAP
FT                   PLSSYAIDLHELVYAALTTLTDAIARDRHVRRHVLLSTELVRRESLPSKS"
FT   gene            571281..571889
FT                   /locus_tag="BLA_0456"
FT   CDS_pept        571281..571889
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0456"
FT                   /product="possible alpha beta hydrolase"
FT                   /note="COG1011: Predicted hydrolase (HAD superfamily)"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28755"
FT                   /db_xref="GOA:B8DWA4"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:B8DWA4"
FT                   /protein_id="ACL28755.1"
FT                   /translation="MPITDVVFDYCGVLLDWRPELTMEGKVDTSTMRRLLDHADPYGFW
FT                   HYDLMSDLGWSEEQVLRDFARHHPHDVALNHAMQLYFANYTRAFAGMVDGMPELLRTLH
FT                   ERGYRLWGLTNFSTPFVTLAHREFPALRLLLDTVVSSEVRCAKPDARIYEIAMERFGID
FT                   PAHAMFFDDKYENAKAASESGMHGVQFLSADQAMQAILG"
FT   gene            complement(572016..572411)
FT                   /locus_tag="BLA_0457"
FT   CDS_pept        complement(572016..572411)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0457"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28756"
FT                   /db_xref="GOA:B8DWA5"
FT                   /db_xref="UniProtKB/TrEMBL:B8DWA5"
FT                   /protein_id="ACL28756.1"
FT                   /translation="MAEDKTSDELTERDIEDLNDPDDNPDVADADATEHNLRRAVIICF
FT                   IVTSVMCLCINIVVLLMLQRKGKLDKAAANLDEFKENMQHLASDKSRQIARNKDVRKAM
FT                   DTISQHIREIPSEAQSAVTRVRDSLAK"
FT   gene            572558..573148
FT                   /locus_tag="BLA_0458"
FT   CDS_pept        572558..573148
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0458"
FT                   /product="peptidyl-prolyl cis-trans isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28757"
FT                   /db_xref="GOA:B8DWA6"
FT                   /db_xref="InterPro:IPR025241"
FT                   /db_xref="UniProtKB/TrEMBL:B8DWA6"
FT                   /protein_id="ACL28757.1"
FT                   /translation="MRLCRAFLQYALHMTANDTLGSPYSSPDPNEHGDNPYVGDPGYSQ
FT                   VPQQAYTAQYATPQPNYTQQYPPQGAYGYPMAPVDQWNGMCIAGFICSFFFPLVGLVLS
FT                   IIALVQINKTGEKSRGMAIAGIVIGGISTALALIAIIMVICGLAIGLGALAETGWDDYE
FT                   YHYDTHSDYSQFDEVGADYLAHIRSVDQLMKTA"
FT   gene            573328..573828
FT                   /locus_tag="BLA_0459"
FT   CDS_pept        573328..573828
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0459"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28758"
FT                   /db_xref="GOA:B8DWA7"
FT                   /db_xref="InterPro:IPR025241"
FT                   /db_xref="UniProtKB/TrEMBL:B8DWA7"
FT                   /protein_id="ACL28758.1"
FT                   /translation="MTNYQPNYDSNNPYGRGLSEPPMQQEPNQTPFAQPQYGDYGAQGN
FT                   AQQPYAQPQYGQYARGSGQQYGQPDYTQNMSNYAPYGQCNQSQYGNGYSPEPTTWNGLC
FT                   IAGFVCSFLVPIVGLILSIIALTQINRTGEKSRGMAIAGIVISVVIWLFSFIFMASGNS
FT                   IFF"
FT   gene            complement(573915..574415)
FT                   /locus_tag="BLA_0460"
FT   CDS_pept        complement(573915..574415)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0460"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28759"
FT                   /db_xref="GOA:B8DWA8"
FT                   /db_xref="InterPro:IPR025241"
FT                   /db_xref="UniProtKB/TrEMBL:B8DWA8"
FT                   /protein_id="ACL28759.1"
FT                   /translation="MTNCHPNCDSNNPYGRGLSGPPMQQEPNRTPFAQPQYGDYGAQGN
FT                   AQQPYAQPQYGQYARGSGQQYGQPDYTQNMSNYAPYGQCNQSQYGNGYSPEPTTWNGLC
FT                   IAGFVCSFLVPIVGLILSIIALTQINRTGEKSRGMAIAGIVISVVIWLFSFIFMASGNS
FT                   IFF"
FT   gene            complement(574498..575859)
FT                   /locus_tag="BLA_0461"
FT   CDS_pept        complement(574498..575859)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0461"
FT                   /product="probable solute binding protein of ABC
FT                   transporter system for sugars"
FT                   /note="COG1653: ABC-type sugar transport system,
FT                   periplasmic component"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28760"
FT                   /db_xref="GOA:B8DWA9"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="InterPro:IPR006061"
FT                   /db_xref="PDB:6H0H"
FT                   /db_xref="UniProtKB/TrEMBL:B8DWA9"
FT                   /protein_id="ACL28760.1"
FT                   /translation="MEKGRTMKFSTRAIAFLGATAMLIPLAACGGGSSNSGQPSQESNV
FT                   KEIDVWAWDPSLKQIAADYEKKTGIKVNLKNVGTNTKEYTQLDNAIEAGSGAPDVAQIE
FT                   YYALPQYAIKGNLLDITDKTSGYEDFYNPGPWSSVQIDGKVYALPIDAGPMAFFYNKEI
FT                   FDKAGVDGEKIKTWDDYYEAAKKIHALGDEYYITSDSGDAGFFDSMTWLAGGKPFQTTN
FT                   NGKDVTINLTGDNGVKEFEKFWQKLLDEKLLDTKTVGWSEDWFKGMQDGTIASLLTGAW
FT                   MPGNLVNSAPAAAGKWRVALMPTPNGEKANAENGGSSLAVLKSSPKAQAAYDFIEYVAH
FT                   GDGVKTHVETGAFPADKASLEADYFKNATTIKNSDGKEIDYFGGQKYNEVLAQASADVL
FT                   TGYQFLPFEVKARGVFGDYLGKSYTGNQPLSEGVAAWQKALIDYGKEQGFTMKE"
FT   gene            complement(576087..578174)
FT                   /locus_tag="BLA_0462"
FT   CDS_pept        complement(576087..578174)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0462"
FT                   /product="beta-galactosidase"
FT                   /EC_number="3.2.1.23"
FT                   /note="COG1874: Beta-galactosidase"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28761"
FT                   /db_xref="GOA:B8DWB0"
FT                   /db_xref="InterPro:IPR003476"
FT                   /db_xref="InterPro:IPR013529"
FT                   /db_xref="InterPro:IPR013738"
FT                   /db_xref="InterPro:IPR013739"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:B8DWB0"
FT                   /protein_id="ACL28761.1"
FT                   /translation="MSASTQHRAHRWPQPLPGNDRKIWFGADYNPDQWPEDVQDEDIRL
FT                   MKQAGVNIVSLAIFSWANIETSDGNFEFDWLDRVIDKLYKAGIAVDLASATASPPMWLT
FT                   SAHPEVLRRDEQGHVIWPGARQHWRPTSPTFRTYALRLCREMAEHYKDNPAIVSWHVGN
FT                   EYGCHNYFDYSDDAVQAFREWCRDRYGTIDKVNAAWGTNFWSQRLNSFEEILPPRYVGG
FT                   EGNFTNPGRLLDFKHFCSDALKEFFCAERDVLSEVTPNIPLTTNFMVSASQNTLDYDDW
FT                   AHEVDFVSNDHYFTPGSWHIDELAYSASLVDGISRKKPWFLMEQSTSAVNWREINPRKE
FT                   PGELIRDSMLHLAMGADAICYFQWRQSRSGAEKFHSAMLPLAGEHSQIYRDVCALGADL
FT                   DTLSDAGILRSKLSKARVAIVQDIQSEWATEHTATPTQHIREWTEPLDWFAAFANRGVT
FT                   ADVTPIHAQWDTYDAVVIPCVYLFSEEMAERLRTFVRNGGKAFVTYYSALADEHDRLHT
FT                   EGWPGLIGDVVGVRIEEHCPLGTLFPGMLDHLDVSNGTVVHDLADVIDAIADDTTVLAT
FT                   FEADPATGMDGRAAITVHPYHEGGVAYIAGKLGRDGISQSLPEICAALGFELDADPRAG
FT                   DVLRVVREQEDGAIFEFLFNRTRNTVTADRPAGDMLICSLATDSTDKVTLEPNGVLAFR
FT                   R"
FT   gene            complement(578216..579196)
FT                   /locus_tag="BLA_0463"
FT   CDS_pept        complement(578216..579196)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0463"
FT                   /product="probable permease of ABC transporter system for
FT                   sugars"
FT                   /note="COG0395: ABC-type sugar transport system, permease
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28762"
FT                   /db_xref="GOA:B8DWB1"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B8DWB1"
FT                   /protein_id="ACL28762.1"
FT                   /translation="MTTTVSTDIQNTRNARRIERDRQRRIAQDERAERKRSRKNGFTNV
FT                   ANPRKSTLLTIVCAVFAIYCLFPFLYILINSTKTQADFTSTFGLGFGKTFALWDNIKTV
FT                   FTYQDGIFGRWFLNTLFYVIVGAGGATLLAIMGGYALAKFRFPGRKAVFAVIIGAISVP
FT                   GIALAVPQFLLFAKLGLTNTPWAMIIPSLISPFGLYLMWIFSEQAVPTELLEAARVDGA
FT                   SEARTFFTVALPLLSPGIVTCALFTIVATWNNYFLPLIMLKDANWYPLTIGLNQWKDQA
FT                   STAGGQAIQNLVITGSMITIIPLVVAFLLLQKYWQSGLAAGAVKE"
FT   gene            complement(579216..580184)
FT                   /locus_tag="BLA_0464"
FT   CDS_pept        complement(579216..580184)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0464"
FT                   /product="probable permease of ABC transporter system for
FT                   sugars"
FT                   /note="COG1175: ABC-type sugar transport systems, permease
FT                   components"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28763"
FT                   /db_xref="GOA:B8DWB2"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B8DWB2"
FT                   /protein_id="ACL28763.1"
FT                   /translation="MTSTTKSPGTAGTPDAAAIAANAVTTGGSARVNKHHADWRGWKFL
FT                   WPFALVFVFVFIIPILYAIYISFFQTKMIGGTQFVGFDNYIKLFHDPHFWSSVGRVTIF
FT                   TVVQVPIMLCLAALMALALDSMKLHGTKFFRISTFLPYAVPAVVSTLIWAFMYGAKYGL
FT                   VGSLNAWFGTHIDVLAPSVLLAAIGNIVTWEFTGYNMLIFYSSLSTIPHSLYEAASIDG
FT                   ASEWQIVKSIKLPELKGSLAITVIFSIIGSFQLFNEPSIMQNMVPGNTITTYYTPNMYA
FT                   YNLSFSGNQSNYAAALAIVMAIITMAIAYAVQLRSMKDQMK"
FT   gene            580453..581469
FT                   /locus_tag="BLA_0465"
FT   CDS_pept        580453..581469
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0465"
FT                   /product="probable LacI-type transcriptional regulator"
FT                   /note="COG1609: Transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28764"
FT                   /db_xref="GOA:B8DWB3"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:B8DWB3"
FT                   /protein_id="ACL28764.1"
FT                   /translation="MAGSVSMKDVARLAGVSSQTVSRVANNSSEVKPETRLRVERAMEE
FT                   LGYRPNYAARALKHGSFKDVGVVLFNMTSYGDSHILNGVVDAAREHGYATTIRSFEQGC
FT                   PATLQSAIDQMKTLPVDGVVFILEQQVADFNTFVPSVELPVVLVSEEPSDHCPTIDSDQ
FT                   YGTSVVLVDYLLAKGHRNVYHIAGPSYSVAAQSRRRGWEDALRQQGIVPPSVYIGDWEA
FT                   DSGYQAGLALAHERDCTAVYAANDQMAYGCILGLREAGKRVPEDVSVVGVDDSLQGIVP
FT                   RLELTTMREKFNELGREAFGMILAQCNGDKLPVGVKTVIPSVLVERGSVSEVEDRGA"
FT   gene            581660..581736
FT                   /locus_tag="BLA_t0020"
FT   tRNA            581660..581736
FT                   /locus_tag="BLA_t0020"
FT                   /product="tRNA-Asp"
FT   gene            581770..581846
FT                   /locus_tag="BLA_t0021"
FT   tRNA            581770..581846
FT                   /locus_tag="BLA_t0021"
FT                   /product="tRNA-Asp"
FT   gene            581871..581946
FT                   /locus_tag="BLA_t0022"
FT   tRNA            581871..581946
FT                   /locus_tag="BLA_t0022"
FT                   /product="tRNA-Phe"
FT   gene            complement(582091..583116)
FT                   /locus_tag="BLA_0466"
FT   CDS_pept        complement(582091..583116)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0466"
FT                   /product="probable glycosyltransferase"
FT                   /EC_number="2.4.1.175"
FT                   /EC_number="2.4.1.226"
FT                   /note="COG0463: Glycosyltransferases involved in cell wall
FT                   biogenesis"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28765"
FT                   /db_xref="GOA:B8DWB4"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:B8DWB4"
FT                   /protein_id="ACL28765.1"
FT                   /translation="MLKVSIIIPAWNEKERIVDCLDNATRQTVMPHEVLVVDNRSTDHT
FT                   VEIVERYIAEHPDLPVKLLHQDEEQGLIPTRNYGLNHATGDILGRVDADCMLKPDWVEV
FT                   VRGIFTEDAEAMGATGPVTYYDMPAHKIALRGDDSVRRHTYRADGGQVLLFGSNMALRA
FT                   SAWKLIHDEVCLDKEDVMHEDIDISLHLLGRGLKTVYSGRMICGISARRMDTSFKSFRN
FT                   YMRRFKNTFAAHPEHWRNHKSERTLYLMYPWLHAMFPIYRQYLESKDINPAVRIWFREQ
FT                   AKLARKEGDPLADLPGIEKFVEETPTDIPGLEEIDENTAFDPDGAPQSEDSSITGTTTA
FT                   Q"
FT   gene            583277..584836
FT                   /locus_tag="BLA_0467"
FT   CDS_pept        583277..584836
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0467"
FT                   /product="putative membrane protein"
FT                   /note="COG0628: Predicted permease"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28766"
FT                   /db_xref="GOA:B8DWB5"
FT                   /db_xref="InterPro:IPR002549"
FT                   /db_xref="UniProtKB/TrEMBL:B8DWB5"
FT                   /protein_id="ACL28766.1"
FT                   /translation="MASLFPSKGDPRRPPEWYGRALFYAVIAVYLGWFVFTSYGKITYI
FT                   VFDIVIALFLALAVEPLVIRLIRHGWKRGVASVTCLAGLLVIVIVLMALFGNMFVQQMI
FT                   SMVKGLPDLYNQFAAFVDAKTHFKLPEMNDLGGEIMKNIKGSWVTDFAGQAVSTTMGVL
FT                   GQILNLTTALMVAFYISIAGPKLRRSVCQWIAPRSQRRFLMVWTVVQDQISGFLFSRSI
FT                   LAAINAACMSVFLMIIKVPYWLPLALFCGIVSQFVPTLGTYIGGALPVLFAWGERGIGY
FT                   AIGVVVFITVYQQIENLVLSPKISERTMDLNPCIAFLTVLFFGSIFGAAGAFLALPITA
FT                   SIQVLLKVAMKRYPLVDMPLMSDPEPNKKSKMVEAADAINEHVIKPVSDHMPRQAKGSS
FT                   AHVSFDDDHIQYLREQMYGSDREDDAASGHAHSESEESPTMAIPKHLLERHAGEGLQHK
FT                   PRRGVPGKGESQNEVDIVRKTDTAESSTPVESERTDSDGAKPSAAATTTGTKPKNPRSQ
FT                   WS"
FT   gene            584836..586122
FT                   /locus_tag="BLA_0468"
FT   CDS_pept        584836..586122
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0468"
FT                   /product="predicted glycosyltransferase"
FT                   /note="COG1215: Glycosyltransferases, probably involved in
FT                   cell wall biogenesis"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28767"
FT                   /db_xref="GOA:B8DWB6"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:B8DWB6"
FT                   /protein_id="ACL28767.1"
FT                   /translation="MAILDVLDLLLVIVGGVSIAYQGFCILVSLFAKPVTFPAAPMDKR
FT                   YAVLISARNEEQVVGNLIRDIQSQSYPSKLIDIWLVADNCDDGTAQLARDLGCHVVERF
FT                   NQQQVGKGYALTYLLNAMIDSKASDQYDAFFVFDADNRLDKHYFEEMNKAYQSGFRILT
FT                   SYRNSVNLSENWVSSGSALWFIRESRFVSASRMWLGNSCHVGGTGFMFSQEVMRRNQGW
FT                   KFHLLTEDLEFTMDSVLHGDRIGYVGSAILYDEQPVTFAQSWRQRLRWSKGFLQVFRYY
FT                   GPALVRRAIQERDFSSIDLTLFICPFTVLAIIRVLLGTIFAACGFISWSSQGAALFNWM
FT                   LGVVSSMVFMMVLAGLTMVVERKQIGASNRELFAYALSFPIYILSYVPISFQAVFAKAQ
FT                   WKPIEHQGSSGAEDPRIREQDREERAMAS"
FT   gene            586333..587205
FT                   /locus_tag="BLA_0469"
FT   CDS_pept        586333..587205
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0469"
FT                   /product="ATP-binding protein of ABC transporter system"
FT                   /note="COG1131: ABC-type multidrug transport system, ATPase
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28768"
FT                   /db_xref="GOA:B8DWB7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B8DWB7"
FT                   /protein_id="ACL28768.1"
FT                   /translation="MTQIMQQPIAAPGPVPADPSMAVSIRGLYRRYDDKVAVNGLSLDI
FT                   PTGSFYGLVGPNGAGKTTTINMMTGMLKPDAGMVLVLGKDVWHDVNAVKREIGLMPQPD
FT                   QIFDRLTGRQLLVYSGMLRSMPRAEALERSNDLMHAFDLLDAADKPVFDYSAGMTKKIC
FT                   LATAMIHSPRVLVLDEPFEAVDPVSSSNIRDILSAYVSTGGTVIISSHVMSMVERMCTH
FT                   VAVINKGQVVAAGTVDQVAGGEDLDERFLQLVGGRHDTMHLDWLNGGVHAADEAVSVPQ
FT                   DDHQNGGQA"
FT   gene            587259..588923
FT                   /locus_tag="BLA_0470"
FT   CDS_pept        587259..588923
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0470"
FT                   /product="putative integral membrane transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28769"
FT                   /db_xref="GOA:B8DWB8"
FT                   /db_xref="UniProtKB/TrEMBL:B8DWB8"
FT                   /protein_id="ACL28769.1"
FT                   /translation="MNRDAGGERPNIVTTMVRLRWSLMFAAMRKSPWQVVGYVLALLMA
FT                   LGIVVGAGLAAFALTGGAVEWNEAAFAVLRVVMVNAGTVGIIFAALIQLLLIGESSTMS
FT                   AQKFSLFGIGDRTLTAGLYLSAFTGLPATCAFLSLLCASRLYVGYGTGAVLGGVLSAAL
FT                   TVMVAMCFSKAALSLASQLTRTERGKNTLYILVTLLVVVAAQLPNIYVNTHTEEDFSAI
FT                   DVNGLVRLTDVVGWLPFGWSLGLPFDAARGNAAACIARVALALVFCALCFAASVWCIRR
FT                   ERLQGEPQSNVRRERSIGAFNWMPDSASGAISARLFISLKRDPRQAMQYVLPVLFIVIF
FT                   ALQSHGESMVVWQCFLWMGLMMLIGESNGIAYDGRAYAMEQIAGVPGRVDRWGRTRVYL
FT                   AYLAIFYVLCALLTYALTGDWRTPAGVMRGITCTVVGFGVVLISLGSAEFFSTFLMYPV
FT                   PSIRKPFSSPQGRAMAQGLFPFAFMLATCVMALPTGIVAIVLAATGHWGMNWVLMPVSL
FT                   ANGVLFLWLGVWLGGKILDARGLKVLATLDNFASLQQ"
FT   gene            588980..590425
FT                   /gene="dacB"
FT                   /locus_tag="BLA_0471"
FT   CDS_pept        588980..590425
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dacB"
FT                   /locus_tag="BLA_0471"
FT                   /product="D-alanyl-D-alanine
FT                   carboxypeptidase/D-alanyl-D-alanine-endopeptidase"
FT                   /EC_number="3.4.16.4"
FT                   /note="COG2027: D-alanyl-D-alanine carboxypeptidase
FT                   (penicillin-binding protein 4)"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28770"
FT                   /db_xref="GOA:B8DWB9"
FT                   /db_xref="InterPro:IPR000667"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:B8DWB9"
FT                   /protein_id="ACL28770.1"
FT                   /translation="MPRTARVAYGPVAHSPWPSPPSSPWGAAVPTCGPTSPTRHLESSP
FT                   MPPCNRILPSRRGHLLTADAPFIANADTSRAIDAGEAAKLIDALRAKNGVGPDVSAIIM
FT                   QADGTVVADHAADVAREPASTMKTLTSLAAASVLDMGDTLPTQTFLLQAEQGTDTVVIK
FT                   GNGDMLLGAGDSDPDHVNGRAGLLTLAKNTAHALKQRGVTKVNLQYDDSLFGADRTPTG
FT                   IEANNPDSLYYTPVSSMAIDGGRQWNGANPRNPDVFESYPALSQNTAADVTAIFRNLLG
FT                   AQGITIVNAEPTQTTVSADRTPIAEVESAPLAMVMAFMLRHSDNTLAEEFGRLLALSTK
FT                   QENSPAGATAAVRNELRTLGIDLTGLQMADCSGLTPGSRLTANTLAQVQARNLDVGGAV
FT                   AAAEGLSIPGLVGTAANRLASTQAAGLTRVKTGSLQEVSSMTGNVSREQGGVAAFAVIV
FT                   NNPEDFEATRTAINEFVAGLAAL"
FT   gene            590470..591618
FT                   /locus_tag="BLA_0472"
FT   CDS_pept        590470..591618
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0472"
FT                   /product="tRNA(Ile)-lysidine synthase"
FT                   /note="COG0037: Predicted ATPase of the PP-loop superfamily
FT                   implicated in cell cycle control"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28771"
FT                   /db_xref="GOA:B8DWC0"
FT                   /db_xref="InterPro:IPR011063"
FT                   /db_xref="InterPro:IPR012094"
FT                   /db_xref="InterPro:IPR012795"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015262"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8DWC0"
FT                   /protein_id="ACL28771.1"
FT                   /translation="MAYSAAMKAAIGEMRDVLKAHGLGQQSKEFSAHGEHKPHDDAPFV
FT                   FVACSGGRDSLALAACAQVVCAAWGIRCGAIIVDHHLQDASHKVAQQTAQTCRDLGLEP
FT                   VLIVDVQVKERGQGIEAAAREARYAALVGTARRWHATAVLLAHTKDDQAESILIDLIRA
FT                   AGTDAFAGMPQTQLFDDVLVLRPLLGITRAQTTRICEDEGLEYWDDPTNGDAVPLETAL
FT                   PASYPLRSRVRHDLMPYLSAFAGCDMVDRLARTARIARRDVEALNQEAERALAQTVEFE
FT                   GNMRDLQADRLADDKLGANIDARALERWPEAIRYRVIARTLAACGLAYASRHVAAVDKL
FT                   VSQWHGQGKVALPSKYSAKRKAHVIRICEDITHANRRCAKRN"
FT   gene            591587..592150
FT                   /gene="hpt"
FT                   /locus_tag="BLA_0473"
FT   CDS_pept        591587..592150
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hpt"
FT                   /locus_tag="BLA_0473"
FT                   /product="hypoxanthine phosphoribosyltransferase"
FT                   /EC_number="2.4.2.8"
FT                   /note="COG0634: Hypoxanthine-guanine
FT                   phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28772"
FT                   /db_xref="GOA:B8DWC1"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005904"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:B8DWC1"
FT                   /protein_id="ACL28772.1"
FT                   /translation="MRIVDVQNEIDHELITHDEIMKRIQEAADQVSEDYKHTLPLLVCV
FT                   LKGAANTMTAFAQAMSIQVELDYMSLSSYGAGTSSSGTITVRQDLSRDVRGRDVIIVED
FT                   IIDSGRTLDWLVNELKSRGAKSVEIFALLEKPARRVIDVDVKYKGFEIPDEFVVGFGLD
FT                   YDERYRNLDSIAVLKPEVYEGAVQ"
FT   gene            592147..594243
FT                   /gene="ftsH"
FT                   /locus_tag="BLA_0474"
FT   CDS_pept        592147..594243
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsH"
FT                   /locus_tag="BLA_0474"
FT                   /product="ATP-dependent zinc metallopeptidase involved in
FT                   cell division"
FT                   /note="COG0465: ATP-dependent Zn proteases"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28773"
FT                   /db_xref="GOA:B8DWC2"
FT                   /db_xref="InterPro:IPR000642"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR005936"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037219"
FT                   /db_xref="InterPro:IPR041569"
FT                   /db_xref="UniProtKB/TrEMBL:B8DWC2"
FT                   /protein_id="ACL28773.1"
FT                   /translation="MTYPNQPGNNSGGRNNRPNPFNPFGDNSNKPRNNGGPNGNNNAPR
FT                   SFWQRPWLYIVLIVLILFFIFQAFLGNNTQTINTQDGMNILNSQASDVESATIVDNTQQ
FT                   VQLKLKNDFKKNDPQTGRERNYGKDVQFYYTTAQQAQVVRAVEKANPSQGWTATMHSTS
FT                   MWTYLLSSVVPFLIFFALIWFLMSRMSSSAGGMLGMGGKKSAKLADGQIPKTKFSDVAG
FT                   EEAAVQEVEEIKDFLKDPAKYKALGARIPRGVLLYGPPGTGKTLLARAIAGEAGVPFYA
FT                   MAGSDFVEMFVGLGASRVRDLFDEAKKNAPAIIFIDEIDAVGRKRGSGMGGGHDEREQT
FT                   LNQLLVEMDGFDNDTHLIIIAATNRPDVLDPALLRPGRFDRQVAVEAPDLEGREEILKV
FT                   HAKGKPFVPDIDLHSVAVRTPGFTGADLANVLNEAALLCARVGAQLIDNRAIDEAIDRV
FT                   MSGPRRRSRGMALDELRNTAYHEGGHALVAAALHNTDPVTKVTILPRGRALGYTAVMPT
FT                   EDRYSQSRNELLDQMAYAMGGRTAEEIVFHDPTTGASNDIEKATQIARQMVGLYGLSSQ
FT                   LGAVKWLDSNDDQGLDGLRPREYSDATAEMIDEEVLKLIETAHTEAWQILTENREVLDE
FT                   LVSRLLVKQTLNEKELKEIFANLKMAPKRKVWLSNPNRPDSDKPPVAIPEALKKSAGLP
FT                   QQEF"
FT   gene            594329..595198
FT                   /gene="sulD"
FT                   /locus_tag="BLA_0475"
FT   CDS_pept        594329..595198
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sulD"
FT                   /locus_tag="BLA_0475"
FT                   /product="SulD"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28774"
FT                   /db_xref="UniProtKB/TrEMBL:B8DWC3"
FT                   /protein_id="ACL28774.1"
FT                   /translation="MTTVDCSGIDLGSNEDDMRVWTADVSWVIDDDQLVDAEDLAAHVA
FT                   AIGQMMLGVPVEQLAERIAAQLANQSVFRSVTVTVHMHWKAPLRTFEQLSATVTANRQS
FT                   SANPSAAAANTGGEESASTHDGALPVDPSYRDAVISLHSAALNAEQLFREVIVTLDSMP
FT                   GNQVDGISPLYFVGSLNGTDGHAAVIKLSTAMGVRQLNQVLDALHTTHEGAVQLSVVAT
FT                   GKVGDESLHAPKGAADHHLGAAVLEPWAAMDPNASYNGDPLAYLLAMAPDSAQVGVESE
FT                   RWVMGGGR"
FT   gene            595195..595812
FT                   /locus_tag="BLA_0476"
FT   CDS_pept        595195..595812
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0476"
FT                   /product="permeases of the major facilitator superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28775"
FT                   /db_xref="GOA:B8DWC4"
FT                   /db_xref="InterPro:IPR021517"
FT                   /db_xref="UniProtKB/TrEMBL:B8DWC4"
FT                   /protein_id="ACL28775.1"
FT                   /translation="MKARRTPWWWYVIAMLVGLLAGMGISHLEETRGLGLAGIPYLASA
FT                   VMVVVGFIVLYLAWQVHKYTTTDPKKRAQLKPMDSERCVNTLIVSKALAIAGALLAGWY
FT                   GGQIVMLYDRFEAPFFRHIVIECIIAVIASVIDMVLGIISEGLCQLPPNMGPEHPKVVR
FT                   KRREERLARFTNRASGLPMQAAGHHAGNNGADESDKWEKPCN"
FT   gene            complement(595879..596784)
FT                   /gene="tesB"
FT                   /locus_tag="BLA_0477"
FT   CDS_pept        complement(595879..596784)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tesB"
FT                   /locus_tag="BLA_0477"
FT                   /product="acyl-CoA thioesterase II"
FT                   /note="COG1946: Acyl-CoA thioesterase"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28776"
FT                   /db_xref="GOA:B8DWC5"
FT                   /db_xref="InterPro:IPR003703"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="InterPro:IPR042171"
FT                   /db_xref="UniProtKB/TrEMBL:B8DWC5"
FT                   /protein_id="ACL28776.1"
FT                   /translation="MASDTKTPLQRIVDVLKLGEPSQYRDHTYINGESMYFPTGRVYGG
FT                   QVISQSLIAASKTVPEDRLPHSIHGYFIAPGDIHQDLLFDVENLRDGHSFSARRVNVTQ
FT                   SQGSILTAIASFQTKDQPGVEYFDPMPADVPDPESLPSSVDLMKPYADQSDYAKYYATT
FT                   SPFDIRYISSPIVLGPDEESHRLDTGKQMLWMRAMGEIEVSQTFHRALLALGCDQVMLE
FT                   PILRRAGLTLLTPGISFASIDHSMWWYRDIDVTKWHLYVQDTPTAAHGRGLSSAKVYSQ
FT                   EGDLVACMVQEAMIRVPQTD"
FT   gene            complement(596985..598697)
FT                   /locus_tag="BLA_0478"
FT   CDS_pept        complement(596985..598697)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0478"
FT                   /product="ATP binding protein of ABC transporter"
FT                   /note="COG0488: ATPase components of ABC transporters with
FT                   duplicated ATPase domains"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28777"
FT                   /db_xref="GOA:B8DWC6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR022374"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032781"
FT                   /db_xref="UniProtKB/TrEMBL:B8DWC6"
FT                   /protein_id="ACL28777.1"
FT                   /translation="MAEFIYQMINARKAYGDRVILDNVTLSFLPGAKIGVVGPNGMGKS
FT                   TLLKIMAGLDTVSNGEAQLTPGYTVGILQQEPPLDEDKTVGENIKMAFGDVAAKVARFN
FT                   EIGEEMANPDADFDSLMEEMGKLQTEIDAANGWDLDSQLEQAMDALQCPDPDTPVSVCS
FT                   GGERRRVALCKLLLEAPDLLLLDEPTNHLDAESILWLEKFLHQYPGAVIAVTHDRYFMD
FT                   NVAEWICEVDRGQLYPYKGNYSTYLETKAKRMEIQGAKDAKLAKRLKNELEWVRSSPKA
FT                   RQAKNKARLERYDQMEQEARNSKKLDFSEIQIPPGPRLGSTVLEAEHIHKAFGDRVLID
FT                   DLSFTLPRNGIVGVIGPNGVGKSTLFKTIVGLEPLSGGDLKIGDTVKISYVDQNRAGLD
FT                   PNKNLWEAVSDGNDFIEVGGVEVPTRAYVASFGFKGSDQQKLTGVLSGGERNRLNLALT
FT                   LKQGGNLLLLDEPTNDLDVETLESLENALIEFPGCAVVISHDRWFLDRIATHILAWEGD
FT                   DEHPANWYWFEGNFQAYQENKIARLGEEAARPHRCTASSRASSGICTRIVAHG"
FT   gene            598865..599293
FT                   /gene="fms"
FT                   /locus_tag="BLA_0479"
FT   CDS_pept        598865..599293
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fms"
FT                   /locus_tag="BLA_0479"
FT                   /product="polypeptide deformylase"
FT                   /EC_number="3.5.1.88"
FT                   /note="COG0242: N-formylmethionyl-tRNA deformylase"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28778"
FT                   /db_xref="GOA:B8DWC7"
FT                   /db_xref="InterPro:IPR023635"
FT                   /db_xref="InterPro:IPR036821"
FT                   /db_xref="UniProtKB/TrEMBL:B8DWC7"
FT                   /protein_id="ACL28778.1"
FT                   /translation="MQRTIVTDTSFLSRPSDPADPADPLDAAIAQDLKETLAAHREECV
FT                   GMAANMIGEPKRVIAFVDEGLGSAITVMFNPQITAADGEYDACEGCLSLHGERHTPRFR
FT                   RIEVDYTTRKGRARHATFTDWTAQIIQHEIDHCNGVLI"
FT   gene            complement(599325..600611)
FT                   /locus_tag="BLA_0480"
FT   CDS_pept        complement(599325..600611)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0480"
FT                   /product="O-acetylhomoserine (thiol)-lyase"
FT                   /EC_number="2.5.1.49"
FT                   /note="COG2873: O-acetylhomoserine sulfhydrylase"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28779"
FT                   /db_xref="GOA:B8DWC8"
FT                   /db_xref="InterPro:IPR000277"
FT                   /db_xref="InterPro:IPR006235"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:B8DWC8"
FT                   /protein_id="ACL28779.1"
FT                   /translation="MGEHVDTICVQGGYQPGNGESRTPPIIQATTFKYTSSEQMSRLFD
FT                   LSETGYFYTRLQNPTNDTVAAKICEMEGGVAAMLTSSGQAANFFALFNICNEGDHIVAS
FT                   SAIYGGTFNLINVTMRKMGITCTFVNPDCSPEELEAAFQPNTKAVFGESISNPALIVLD
FT                   FDKFAKAAHSHGVPLIVDNTFPTPINCRPFEYGVDIVTHATTKYMDGHGSCVGGAIVDS
FT                   GNFDWLAHSAKFPGLCTPDDSYHGVVYAKDFGKAAFITKATAQLMRDFGSTPAPINSWI
FT                   MGMHLESLGVRMERHCANARAVAQFLEDDPRISWVSCPELPTDRYHALAEKYMPNGTCG
FT                   VISFGVPGGREKVSAFLDHLKMISIATHVADARSCTLYPAGTTHRQLTEEQLEEAGVGV
FT                   DLVRLSCGIENPDDIIADLRQALDAVFGE"
FT   gene            600899..601531
FT                   /locus_tag="BLA_0481"
FT   CDS_pept        600899..601531
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0481"
FT                   /product="ABC transporter, permease protein"
FT                   /note="COG4721: Predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28780"
FT                   /db_xref="GOA:B8DWC9"
FT                   /db_xref="InterPro:IPR017195"
FT                   /db_xref="UniProtKB/TrEMBL:B8DWC9"
FT                   /protein_id="ACL28780.1"
FT                   /translation="MSTGITQSPRPSSSRFRWTPADIALGAALGVGCGLVFWGFNFAYT
FT                   PISSVLGSILPGIASVLHAVWYFSGTLAVLILRKPGAAVYVNVVGSAVEMLLGNNFAFG
FT                   FVFISAILQGVFAEIPFAATRYRVFNLPMAVLSGLCTALEYGFYLLFFRYQGVALLSPR
FT                   GIVHMISELVGGALIAGVFSWLLFVAVAKTGALDHFASGRAVHVREE"
FT   gene            601831..602721
FT                   /locus_tag="BLA_0482"
FT   CDS_pept        601831..602721
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0482"
FT                   /product="erythrocyte binding protein"
FT                   /note="COG1196: Chromosome segregation ATPases"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28781"
FT                   /db_xref="GOA:B8DWD0"
FT                   /db_xref="UniProtKB/TrEMBL:B8DWD0"
FT                   /protein_id="ACL28781.1"
FT                   /translation="MYAGNEAGSQTELINPNEIAAMGRRPPTSHRRQPDDDDRGFYRRL
FT                   AVTCVSILAVLAVLIAVIFGIGRHRQSIIAAKRTECERSLVGLDDKVVAYQDLVGGDGE
FT                   LASKIADVDVKDMTVVKQLDIEMASESPATVNCDVSSVEEFENRIAQAKASSQWYDEHT
FT                   ASLRSAIQAVNESRHAKQAEDAHASLEEVLRNADNILTSAQGHVTDEAVWDDLSKLIGE
FT                   ARNRSGETDMGRIGTLMDDLNARMDAVERSNRENLRQEEQARAEAERKAQEAEQKRKEA
FT                   EAKAKAEEEKNKDKH"
FT   gene            602808..602881
FT                   /locus_tag="BLA_t0023"
FT   tRNA            602808..602881
FT                   /locus_tag="BLA_t0023"
FT                   /product="tRNA-Met"
FT   gene            complement(602959..603864)
FT                   /locus_tag="BLA_0483"
FT   CDS_pept        complement(602959..603864)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0483"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28782"
FT                   /db_xref="UniProtKB/TrEMBL:B8DWD1"
FT                   /protein_id="ACL28782.1"
FT                   /translation="MADRQISEVLGDFLHRYRELYGIDADSFLRCAHSYGMNWGDRTLN
FT                   VIEKGQATAGIRLTLVILCVLNQISDAKLRLADILDFTDPADSIRITPDISTPSRTLQR
FT                   ILRGRPVWFYGSPERPGNVDRAQREHEVRRSRDADNLTPPPPTCTEEQAMARLDVDLQT
FT                   LRGWCNALFGMSLDETAHMRAQASADSTPELEAHAIVEEIYQDHVRKVKYSMRNCTTWS
FT                   NSSINLMPTDELDRLEDDLSQMEDCLMKFMALRHISFVRDKRAYDADPRNTGPYAFQPD
FT                   SDIWVDIDEPEDGTLGAEES"
FT   gene            604229..604438
FT                   /gene="rpmE"
FT                   /locus_tag="BLA_0484"
FT   CDS_pept        604229..604438
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmE"
FT                   /locus_tag="BLA_0484"
FT                   /product="ribosomal protein L31"
FT                   /note="COG0254: Ribosomal protein L31"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28783"
FT                   /db_xref="GOA:B8DWD2"
FT                   /db_xref="InterPro:IPR002150"
FT                   /db_xref="InterPro:IPR027491"
FT                   /db_xref="InterPro:IPR034704"
FT                   /db_xref="InterPro:IPR042105"
FT                   /db_xref="UniProtKB/TrEMBL:B8DWD2"
FT                   /protein_id="ACL28783.1"
FT                   /translation="MQQGIHPDYHKVTVTCSCGNTFETRSTAKGDHMTVDVCSKCHPFY
FT                   TGKQKILDTGGRVARFEKRYGKKN"
FT   gene            604732..606084
FT                   /gene="xylA"
FT                   /locus_tag="BLA_0485"
FT   CDS_pept        604732..606084
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="xylA"
FT                   /locus_tag="BLA_0485"
FT                   /product="xylose isomerase"
FT                   /EC_number="5.3.1.5"
FT                   /note="COG2115: Xylose isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28784"
FT                   /db_xref="GOA:B8DWD3"
FT                   /db_xref="InterPro:IPR001998"
FT                   /db_xref="InterPro:IPR013452"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:B8DWD3"
FT                   /protein_id="ACL28784.1"
FT                   /translation="MAGLWDIDKIEYVGRTKGLQEGLGFQYYDADKVVAGKKMKDWLRF
FT                   GVAWWHTFDAPLTDPFGDGTAQRPWDGKYSDPMDNALAKVDYAFEFFTKLGAEYFCFHD
FT                   RDIAPEGDTLRETNANLDRVVDKIEENMQSTGVKLLWNTSSLFTNPRFVAGASTSPFAD
FT                   VYAYAAAQLKHSLEIGKRLGAENYVFWGGREGYENLWVTDMKREQEHMAKFFHMCADYA
FT                   KQIGMDAQFLIEPKAKEPTTHQYDFDAATACNFLRAYDLIDVFKLNLEGNHANLAGHTY
FT                   QHEIRVARDNGVLGSLDANQGDMLLGWDLDEFPTNLYETTSVMWEVLDEGQIGPHGGLN
FT                   FDAKPRRTSFSAEDLFRAHIAGMDSFAAGLLVADKMHQDKYIEDLVANRYGSYDSGIGK
FT                   SIDDGTATLESLNDYAIDMPQSEIIASTHPDHLEDVKATINNYIIDALANA"
FT   gene            606489..608171
FT                   /locus_tag="BLA_0486"
FT   CDS_pept        606489..608171
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0486"
FT                   /product="alpha-L-arabinofuranosidase"
FT                   /EC_number="3.2.1.37"
FT                   /EC_number="3.2.1.55"
FT                   /note="COG3507: Beta-xylosidase"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28785"
FT                   /db_xref="GOA:B8DWD4"
FT                   /db_xref="InterPro:IPR006710"
FT                   /db_xref="InterPro:IPR023296"
FT                   /db_xref="UniProtKB/TrEMBL:B8DWD4"
FT                   /protein_id="ACL28785.1"
FT                   /translation="MTATTATMDITNPVLRGMYPDPSWMWDERGERVALVNSSFELVPG
FT                   LPIHVSDDIANWELAGNAVDEAMAQRLLIPFVLDSGGLYAPTLRMIRGKYVIACTVARI
FT                   DLDAADAAGVDPESIEAARTSQGNFIIEADALEGPWRGPYWIEGAEGIDPDIFEDLDGS
FT                   VYWTQTRPAVRPRWEGQTEVWTQRIDPETWRLCASHDADGDYGKTVLWTGYGVEAVWAE
FT                   GPHLYRIGDWVYLMTAEGGTSFDHSEMTMRTWAPDGLGPAIESLQGQAHADGTEPRAPR
FT                   ADERSVVGRYARLFHPCKKNPFLTHRHLGLEERVQCVGHADLLHHPRLGWWVACLGSRE
FT                   TPTADHGALSFLGRETFVAPVEWQHDPAQWSLESNGPAQRRTDDPGWPVLAGGAGRLAQ
FT                   TLRIDAADGTLLDMRIGPCESQAVVDARMPFTVGEGEAAAVRADGVVYRRMPEDRCVVL
FT                   CPPRGTVRIRQDSRHTLSVATDGASVQWALGEGPERREGMVPISEGEPGSVMLVFDKGM
FT                   ARVVVAQSAEQAWEAPAVEVIDVAPLSTEWSGGFVGCLVGCEA"
FT   gene            complement(608184..608714)
FT                   /locus_tag="BLA_0487"
FT   CDS_pept        complement(608184..608714)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0487"
FT                   /product="LacI-family transcriptional regulator"
FT                   /note="COG1609: Transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28786"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:B8DWD5"
FT                   /protein_id="ACL28786.1"
FT                   /translation="MADKWAGGVLATRHLLALGHTRIGIITGPEEMMCSRARLDGYTSA
FT                   LAEQGIELDPELVTEGDFTTEGGYAQAMALLENPNRPTAIFAGSDLQAMGVYEAARQNR
FT                   LRIPEDLSVVGFDDVQTSAFLGPALTTVRQPLHDMAAVSTRMLIDTAEGRPTQHHVILP
FT                   TTLVVRNSTHDLH"
FT   gene            608739..608813
FT                   /locus_tag="BLA_t0024"
FT   tRNA            608739..608813
FT                   /locus_tag="BLA_t0024"
FT                   /product="tRNA-Val"
FT   gene            608838..608910
FT                   /locus_tag="BLA_t0025"
FT   tRNA            608838..608910
FT                   /locus_tag="BLA_t0025"
FT                   /product="tRNA-Gly"
FT   gene            complement(608920..610890)
FT                   /locus_tag="BLA_0488"
FT   CDS_pept        complement(608920..610890)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0488"
FT                   /product="translation elongation factor"
FT                   /note="COG0480: Translation elongation factors (GTPases)"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28787"
FT                   /db_xref="GOA:B8DWD6"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005517"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035650"
FT                   /db_xref="UniProtKB/TrEMBL:B8DWD6"
FT                   /protein_id="ACL28787.1"
FT                   /translation="MKRIVTGIVAHVDAGKTTLSEALLYATGTTRRLGRVDHGDAFLDT
FT                   DAMERARGITIYTEPAVMRVGEAELTILDTPGHVDFSAETERTLQALDYAILVVSAADG
FT                   VQGHTLTLWRLLRRYHVPVFVFVNKMDAPGADRARILEQLHARCSDACIDFTGAADALS
FT                   ERQLDTLAMQSEAAMDEYLETGGIDVRTVRALIADGAAVPVYFGSALKMQGISEFVEGF
FT                   AFFTREPHYTAEFGACVFKISHDRQGNRLSWIKVTGGELTAKMMLPEAGGAEKVDQVRV
FT                   YSGAKFTTVESVPAGTVCAVTGPAHTFPGEGLGAARNAAQPVLRPVLTYTLLPGGNDMH
FT                   ACLQALRELEDEEPLLHVVWQERLQEAHVQLMGAVQLEIIEQLMHDRFGLDIAFGPGSI
FT                   LYAETITAPGEGVGHFEPLRHYAEVHVLIEPLERGSGLEFATDVSEDELDRNWQRLIMQ
FT                   HLQETEHPGVLIGAPITDMRLTLIGGRGHLKHTEGGDFRQATYRAVRQGLMEAREAGHA
FT                   VLLEPWYRFRLELPQEMLGRALSDVQRMGGESAAPQIEDGLAVVEGAAPVSEMRDYAMD
FT                   VNAYTHGEGRLALMFGGYRECHDEQTVVDGAGYDPEADLEHTPDSVFCAHGAGYTVKWY
FT                   KVPEFCHVPMRRGVGINRLEQ"
FT   gene            complement(610920..612455)
FT                   /locus_tag="BLA_0489"
FT   CDS_pept        complement(610920..612455)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0489"
FT                   /product="amino acid permease"
FT                   /note="COG0531: Amino acid transporters"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28788"
FT                   /db_xref="GOA:B8DWD7"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004754"
FT                   /db_xref="UniProtKB/TrEMBL:B8DWD7"
FT                   /protein_id="ACL28788.1"
FT                   /translation="MADSGQHASNAPAMVEGSGAAAAGPRSTVGFVGLFALVVSAMVGG
FT                   GIFSLPQNMAQHASAGGQIVAWAITGVGMWFIVNTFRVLTHVKPHMQDGLYSYARSGFG
FT                   DFVGFLVAYGYWLCNCFSLVAYGVLIMSTLDIFMPGTFTNGNNVAATIGSSLILWLMLA
FT                   VALLGTKTGALINVAGTVCKIIPVIVFVVALAAVFKTGVFLRGFWGLGAQGTPLGFDVH
FT                   RIGAQVSDSMLVTLWLFIGMEGAVVVSGSARHPRDVSRATTAGYLTVLVLYILVSLLPL
FT                   GVYSSGQVARMPNPSMSVIMEQCFGQGGSIMVNAGVIISVVFAWLVWMIMISQMPLYAA
FT                   RDGIYPRSFLATNRFGAPSTGLVWTAVTCQLLLILCHFVNGDAWDVMISITSVMAMPCY
FT                   LLCCVYLWKIAVREPPAFPSAAARRRALATGVLGTLFSLFLVYSAGLRYLMMACALYAI
FT                   GLPLLVVARRQRRPGVPLRQLFSHRGWVVLSLIVVLGVCGLVYTVHGGVFGVA"
FT   gene            complement(612558..613196)
FT                   /locus_tag="BLA_0490"
FT   CDS_pept        complement(612558..613196)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0490"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28789"
FT                   /db_xref="UniProtKB/TrEMBL:B8DWD8"
FT                   /protein_id="ACL28789.1"
FT                   /translation="MECMPSENELTAALMRLCDGPDDHARLHMQARANHGHVVTLDCDY
FT                   DAEGLTATFIEQAADAPKSQRILTTMRADTPSASAARRIAYAYRDLIGTVGNPPAVTVD
FT                   LLEQRIVRIAPIVLPESQLGIAPPVRVAASAEDPCAFELHSADAHAAPNAALLRFHGTA
FT                   ANGFSCATIWRLEDGYASYAMVDYTAGPLNDILVDVLCTLRFYAVRGWV"
FT   gene            complement(613332..613586)
FT                   /locus_tag="BLA_0491"
FT   CDS_pept        complement(613332..613586)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0491"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28790"
FT                   /db_xref="UniProtKB/TrEMBL:B8DWD9"
FT                   /protein_id="ACL28790.1"
FT                   /translation="MGYRLLTRKVVVMADEKKPHETLKERFDDFKADVDVHKAEHQEKD
FT                   AIKDVERAAKHDAKSDVDLDKAAANVDKAIEREAEAKEG"
FT   gene            613851..615551
FT                   /gene="dppA"
FT                   /locus_tag="BLA_0492"
FT   CDS_pept        613851..615551
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dppA"
FT                   /locus_tag="BLA_0492"
FT                   /product="DppA"
FT                   /note="COG4166: ABC-type oligopeptide transport system,
FT                   periplasmic component"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28791"
FT                   /db_xref="GOA:B8DWE0"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:B8DWE0"
FT                   /protein_id="ACL28791.1"
FT                   /translation="MFHPRFSHPSAHVTAAVASIAALGMLLAGCGTSGGTGSPSAQGSS
FT                   STATTSVITVNNVEPSANLLPGNTNDMASWKVVTQLFEGLVTFSDDGELIYAEAESITP
FT                   NSDASQYTITLRDGLRFSDGQKITAQTYAKAWSFAANAANGQLGAAIFSTIQGYDALQD
FT                   TNGGNDAQLSGLKVVDDHTLQVTLNAPDSSFPYKVGDVAFLPIPESAYADANAFGEHPI
FT                   GNGPYMLKQWNHDSSIQLVPNPKYTGPRTPKNGGVTFELYTDVQTAYADVESGNLDVID
FT                   TIPTSALATYQHENGIQAFNKPGPAFRSFTIPQKLKHFSGEEGRLRRAAISHAVNRANI
FT                   IEKVMYGTATVATDFTAPTIAGYSKSLKGADVLDYNTETARKLWSQADAISPWSGTFRL
FT                   AYSADSGDKQRVEGITNSIKNALGIDAQPYIIPTQKELSSAIHDRTINAAFLQGLQSDY
FT                   PYPEGYLMQAYDSSAADGKGLNNGDYKSTAFDKLIDDAARQTNVDDAISYYHQAEEVLF
FT                   KDLPVIPLWYANVTAAAGEHVQHVGFNYMGVPKYNVNHEVMAYGSNCER"
FT   gene            615553..616950
FT                   /locus_tag="BLA_0493"
FT   CDS_pept        615553..616950
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0493"
FT                   /product="drug resistance transporter, EmrB/QacA subfamily
FT                   protein"
FT                   /note="COG0477: Permeases of the major facilitator
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28792"
FT                   /db_xref="GOA:B8DWE1"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B8DWE1"
FT                   /protein_id="ACL28792.1"
FT                   /translation="MITAKDGQQHSWKSVKLLIATLIVSTLGDGFCGVMMAVALPNISE
FT                   TYHVSIATANWVTVGYAIVAATAVMTAATVLARIGLKKLFFWSRVLLIVSSLIGLFSLN
FT                   FPMMLTSRLIQAVGSGLMFPTINTVIIRVVPAKISGRVVSLNSAIIGLGIAVAPLLSGV
FT                   FLTYVSLTSMYVVPLAVGIISILMGAKFMFDVEPRKQHPIDVLSIVLSFVGLAALMMGF
FT                   SELTHRPLFAVPMLIAGVAVLVWFAVRQFHLDVPLLDLHPMKHLYVSLGVLMYMAGAMG
FT                   QQAVLLLLPLYLERACDYTPFVAGCFLLIMTLFYSGSVIVGGKTVDRSGMWPVVSSGFL
FT                   LMVIGLFATFFAAPPRSRGSWCSSDPLWLSATRSSTCPTRMWCLRRCPTIRCPTRARSS
FT                   RPATRSRVRSGQRCSSACFPPMYSGRPRKASTAMPHTRTASSIRSSSPRSSRWPCCLCR
FT                   YGIHARW"
FT   gene            complement(617153..617791)
FT                   /gene="pspA"
FT                   /locus_tag="BLA_0494"
FT   CDS_pept        complement(617153..617791)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pspA"
FT                   /locus_tag="BLA_0494"
FT                   /product="phage shock protein A-like protein"
FT                   /note="COG1842: Phage shock protein A (IM30), suppresses
FT                   sigma54-dependent transcription"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28793"
FT                   /db_xref="InterPro:IPR007157"
FT                   /db_xref="UniProtKB/TrEMBL:B8DWE2"
FT                   /protein_id="ACL28793.1"
FT                   /translation="MAILKRFGDIMRANINALLDKAEDPAKMVDQMLLDLNEDLASVKK
FT                   ETASVMAAATNARQQVNDCKADIAKYEAAAKAAVKAGNDDDARKLLATKQQYESTLTSL
FT                   ETAATVAEDNAAKMRQMHDKLVNDINSLQARRAAVHAKVSVANAQQHVNEATEKTAKAS
FT                   RGTAAFERMEEKADRMLNEANATAELNTQASNEDIANKYLAGGLRIGGR"
FT   gene            complement(617794..619095)
FT                   /locus_tag="BLA_0495"
FT   CDS_pept        complement(617794..619095)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0495"
FT                   /product="PE-PGRS family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28794"
FT                   /db_xref="GOA:B8DWE3"
FT                   /db_xref="UniProtKB/TrEMBL:B8DWE3"
FT                   /protein_id="ACL28794.1"
FT                   /translation="MPRAGAGSGSGRSSSGHDGGSRMSSGHRPSMPGSGRRAGGGGSAG
FT                   FPQSSGSTGSGGFDVGDLFRAAGIGMAGGYNAGRRSTRNRYGRRSMPFPEEIFDAMGQQ
FT                   PNYGRQQTPGPYSAGPFGTGAPGAGQGPFSPAGGPPVAPPTMQTPFGGNNNGGKKPNGG
FT                   LTGLMPLIGILAALVIFLLIFMMPSCSNNEPNRNDYNVTVPESTYNRTKLDSGLPYDSN
FT                   CIDDQLGWFENRTSAAKRLKVFYDKTGIQPYILFAKYNPQLKTDDEKQAWAREWYDDHI
FT                   DNEDTLLFVYFAEQDVDNDVGYMTLVNGKHVSSIMDAQATEIFWTYLDEYWYSDRSTDD
FT                   AIVATFDSTADRIMTKTTTKNDVHKWVIIAVIVIGMLAIGAVITWMLIKRKREHEQYVE
FT                   RMVTTPLEEARDPILEKYDQADHNDQVGQEQKGQ"
FT   gene            complement(619129..619290)
FT                   /locus_tag="BLA_0496"
FT   CDS_pept        complement(619129..619290)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0496"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28795"
FT                   /db_xref="UniProtKB/TrEMBL:B8DWE4"
FT                   /protein_id="ACL28795.1"
FT                   /translation="MFALAIAVAIVVRRRAKTPAWSACTLSMYRATMFIVRNKTMRQPG
FT                   SLPAHRLY"
FT   gene            complement(619659..622982)
FT                   /gene="ileS"
FT                   /locus_tag="BLA_0497"
FT   CDS_pept        complement(619659..622982)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ileS"
FT                   /locus_tag="BLA_0497"
FT                   /product="isoleucyl-tRNA synthetase"
FT                   /EC_number="6.1.1.5"
FT                   /note="COG0060: Isoleucyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28796"
FT                   /db_xref="GOA:B8DWE5"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002301"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR023586"
FT                   /db_xref="InterPro:IPR033709"
FT                   /db_xref="UniProtKB/TrEMBL:B8DWE5"
FT                   /protein_id="ACL28796.1"
FT                   /translation="MVSETPQHVYPKASVGEQSANVAPNPDFPQLEQDVLRYWDTNGTF
FT                   QKSIDENPSGEHSSNEFVFFDGPPFANGLPHYGHLLTGYAKDVVPRYQTMKGRRVNRVF
FT                   GWDTHGLPAELEAQKELGIDSVDQIEQMGIDKFNDACRASVLKYVNEWRDYVHRQARWV
FT                   DFEHGYKTLDIPYMESVMWAFKTLYEKGLAYKGYRVLPYCPKDQTPLSAHELRMDADVY
FT                   QDRQDTTVSVAVKLRDEDDAYAVFWTTTPWTVPTNFAIVVGADIDYVEVRPKEGKFAGK
FT                   KFYFAKALLGSYNKELGEDYEVVRELKGSDMVGWRYYPVFPYFAGEQATAEGGTPGPNA
FT                   YQILTADYVDTTEGTGLVHQAPYGEDDMNTLNAHGIASVDVLDSGCRFTSLCPDYEGMF
FT                   VFDANLPILRNLRAGDGPLAERPESERALLFQEKSYVHSYPHCWRCGTPLIYKPVSSWF
FT                   VSVTKIKPRLLELNQQINWIPENVKDGQFGKWLANARDWSISRNRFWGSPIPVWVSDDP
FT                   KYPRVDVYGSLDELKRDFGDYPRDKDGNINMHRPWIDNLTRPNPDDPTGKSTMHRITDV
FT                   LDCWFESGSMPFAQYHYPFENKEYFEHHFPSDFIVEYIGQTRGWFYLLHVMATALFDKP
FT                   AFKNVICHGIVLGDDGQKMSKHLRNYPDVNGVFDKYGSDAMRWFLMSSPILRGGNLIVT
FT                   EDGIRDTVRQIMLPVWSSYYFFTLYANAANHGDGYDARTLRADEVPGLPQMDRYLLART
FT                   RKLIANVTEHMDNFEISDACDEVADFIDMLTNWYIRNTRDRFWNEDENAFNTLYTVLEA
FT                   FMRVLAPLAPMEAEAVWRGLTGGDSVHLGDWPYLTDPQTGVDTALGKVLVEDGALVEAM
FT                   DKVREIVSSTLSLRKAHKMRVRQPLAKLTVVVDDPSQVDGYDALLKSELNIKAIDYSTL
FT                   DEAAEHGLKIIDELKVNARAAGPRLGKQVQFAIKASKSGDWHADPVTGDPVIETPNGEI
FT                   TLQGDEYDITRRVEEADATARRDSASSILPSGGFVILDLELTGDLIAEGYARDVVRAVQ
FT                   DARKEAGLEVSDRIALTLTVPSGDLPKVEQFRDLICSETLSTSMQVEQGDALGVHVAKA
FT                   "
FT   gene            complement(623424..623591)
FT                   /locus_tag="BLA_0498"
FT   CDS_pept        complement(623424..623591)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0498"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28797"
FT                   /db_xref="UniProtKB/TrEMBL:B8DWE6"
FT                   /protein_id="ACL28797.1"
FT                   /translation="MVSETDKPQADPATGEPEVDAEGCATAHKHKVAEQNEKDLLFESA
FT                   DTWQHMEVPE"
FT   gene            complement(623774..624544)
FT                   /locus_tag="BLA_0499"
FT   CDS_pept        complement(623774..624544)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0499"
FT                   /product="protein-tyrosine phosphatase"
FT                   /note="COG2365: Protein tyrosine/serine phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28798"
FT                   /db_xref="GOA:B8DWE7"
FT                   /db_xref="InterPro:IPR016130"
FT                   /db_xref="InterPro:IPR026893"
FT                   /db_xref="InterPro:IPR029021"
FT                   /db_xref="UniProtKB/TrEMBL:B8DWE7"
FT                   /protein_id="ACL28798.1"
FT                   /translation="MRVVSRKLPLPTVENCRDLGGIHTEQGRMVRPGLLVRSANLHDAR
FT                   HDDLETLAHRGISNVIDLRTDPERDLKPDRLLEDWSFYALPTFRETKALRLQLRDIVTR
FT                   PGTFIEDLYPRLVLDDAAVACWKRMFRLLIDEPGGYLFHCTQGKDRTGIAAALILAALE
FT                   VPEDVIRDDYLQTNLYMSTEMPAFVDTFEALLGPKAHADIDEFLVASPLYFQTYIDATA
FT                   SFGGPVGYLRTAIGLSEADLRALRDFYLTDDASN"
FT   gene            complement(624572..624862)
FT                   /locus_tag="BLA_0500"
FT   CDS_pept        complement(624572..624862)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0500"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28799"
FT                   /db_xref="UniProtKB/TrEMBL:B8DWE8"
FT                   /protein_id="ACL28799.1"
FT                   /translation="MAEQQNIPDTNTHEGLGAVSADQVKQMEQIVSDTDHPYTDPITGK
FT                   PNEDIPENEVGVSDASKEAKQDAAQREELAIDRPEETDNENQWEDPYLEDK"
FT   gene            complement(625101..625313)
FT                   /locus_tag="BLA_0501"
FT   CDS_pept        complement(625101..625313)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0501"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28800"
FT                   /db_xref="UniProtKB/TrEMBL:B8DWE9"
FT                   /protein_id="ACL28800.1"
FT                   /translation="MVDMSDKMKENFEEIKARIDEHKDDFEDIKKSVGDLTDKLKDVKE
FT                   GWETSRAEKGDKKEVAEHEETHQTH"
FT   gene            complement(625472..627529)
FT                   /locus_tag="BLA_0502"
FT   CDS_pept        complement(625472..627529)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0502"
FT                   /product="ABC transporter, ATP-binding transmembrane
FT                   protein"
FT                   /note="COG1132: ABC-type multidrug transport system, ATPase
FT                   and permease components"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28801"
FT                   /db_xref="GOA:B8DWF0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:B8DWF0"
FT                   /protein_id="ACL28801.1"
FT                   /translation="MAQTSATDKETLNDDARMPEANGAQGMPREKAKKGTLKRLLKYVF
FT                   TYKVRMVVIIIAIIVSAVAQAGSALFLQALIDRYIMPLVGESVPDWAPLIQALIFMGIL
FT                   YALGTFSAWLYSYLLVGVEQGVMKEIRDEMFEHMQTLPISYFDTHEHGDVMSRYTNDTD
FT                   TLRQAISQSLPQMFASGVSALAALIAMLYLSIPYTVFVLVFTGLLLLLIRVIVSRSGRY
FT                   FVVQQQELGDVNAFVEESVNGQKVIKVFNHEDATQASFDDRNERLYHASASANTYGNVL
FT                   MPVVGNMGYLLYVLSAIFGGLAALGNWGNLSFSGAAFTIGTIISLLTLSRSFVNPIGQV
FT                   SQQMTMVMMALAGASRIFALMDEPSEQDNGTVTLVNVELASDGRTMTETPKKTGHWAWK
FT                   REASDDGTRSREAAKRLSKRAAEVAEEAHEEAVTSADGRLTLLRGDVRFTDVTFGYNPD
FT                   KPVLHDITWFAKPGQKIALVGATGAGKTTITNLINRFYDIQEGMILYDGINVKGIRKPD
FT                   LRRSLGIVLQDVNLFTGTVMDNIRYGKLDATDDECIAAAKLVNADSFIRMLPDGYQTVL
FT                   SGDGSGLSQGQRQLISIARAAVADPPALILDEATSSIDTRTEEVVQAGMDNLMKGRTVF
FT                   VIAHRLSTVRNSDVIMVLDHGRIIERGSHDELMEEKGEYYQLYTGSLELE"
FT   gene            complement(627547..629520)
FT                   /locus_tag="BLA_0503"
FT   CDS_pept        complement(627547..629520)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0503"
FT                   /product="ATP-binding protein of ABC transporter"
FT                   /note="COG1132: ABC-type multidrug transport system, ATPase
FT                   and permease components"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28802"
FT                   /db_xref="GOA:B8DWF1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:B8DWF1"
FT                   /protein_id="ACL28802.1"
FT                   /translation="MSTTTATDTTPSKAHVIRTLAKSLREYRTASLLSPLFVIVEAVIE
FT                   IAIPTVIAILIDKGISGKSMPDIWKYGGILIACAVVSLCAGFLSGRFAAIGSSGFAKNL
FT                   RHDEFEKVQQFSFANIDRFSTGSIITRLTTDVTNVQNAYQMLIRVGMRAPIMLIVAWIF
FT                   AFRISPQISMVFLACIPVLAVGLFGLIIVVHPIFERVFHTYDELNNVVDENLQGVRVVK
FT                   SFNREDFEGKKFGRISLKIYEQFCKAEKLLSINSPLFNLCMYASLIAIAWVGARQIVAS
FT                   GNNAALGLTTGDLTALVTYAMQIMMAMMMLSMIFVMVIISRASAERICGVLTEESTIRE
FT                   ADEPITTVADGSIDFDHVSFRYSEHSERPVLDDIDLHIRSGQTIGIVGGTGSAKTSLVQ
FT                   LIPRLYDVSSGALKVGGVDVRDYELEALRDEVAMVLQKNVLFAGTIAENLRWGNPYATD
FT                   EEIRHACELAQADGFIQEFPDKYNTYIEQGGTNVSGGQRQRLCIARALLKKPKILILDD
FT                   STSAVDTKTDKLIREAFHHEIPNTTKIIIAQRVASVEESDKIVVMHEGRILDQGTNAEL
FT                   LERCEEYRSIYESQTQQHSQQDLDKESQDLHEEEAEASGFATDYNEDMRTSDVIARQKE
FT                   REREQQAHMAQDIEAIKGGEQR"
FT   gene            complement(629517..630068)
FT                   /locus_tag="BLA_0504"
FT   CDS_pept        complement(629517..630068)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0504"
FT                   /product="possible MarR-type transcriptional regulator"
FT                   /note="COG1846: Transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28803"
FT                   /db_xref="GOA:B8DWF2"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B8DWF2"
FT                   /protein_id="ACL28803.1"
FT                   /translation="MDRVQGVNSPGMLRPSLEIKALHNLIGRYWNGIVPPDSMMSGANM
FT                   PIVQYLHEHRDSDVFQYDIERAFSITRSTASRVLGLMEKKGLITRSAVDWDARVRKIEL
FT                   TPTASDLVVEIMRAAHQLETTLFTGFTPDEQERFMDDLARMRANLVETGLVGSERTAVE
FT                   PATRTRQDATHQQQKGDEAA"
FT   gene            complement(630186..630284)
FT                   /locus_tag="BLA_0505"
FT   CDS_pept        complement(630186..630284)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0505"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28804"
FT                   /db_xref="UniProtKB/TrEMBL:B8DWF3"
FT                   /protein_id="ACL28804.1"
FT                   /translation="MCAIRDLRAVGRGSLAYVEAVTRDCCTGSLSA"
FT   gene            complement(630326..630892)
FT                   /locus_tag="BLA_0506"
FT   CDS_pept        complement(630326..630892)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0506"
FT                   /product="predicted NADPH-dependent reductase"
FT                   /EC_number="1.6.5.2"
FT                   /note="COG0431: Predicted flavoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28805"
FT                   /db_xref="GOA:B8DWF4"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:B8DWF4"
FT                   /protein_id="ACL28805.1"
FT                   /translation="MADKPTIAFVETSLTDGSFEADLAKEIMGIVGDRAEAITIDYEDL
FT                   PLAGEDPEYPLPEAALAVRDKLGNADAVWVVVSEYKKEIPDSLRNLFDWLSLPSTKDEE
FT                   GKNVLDQKPVAISGVGGFEELHPRIMVGDLLEDAGMRLFPVEVGLSVPDEAVETGDWAM
FT                   TGADQEALRTQADDFLTFVSENEVK"
FT   gene            631006..631518
FT                   /gene="vsr"
FT                   /locus_tag="BLA_0507"
FT   CDS_pept        631006..631518
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="vsr"
FT                   /locus_tag="BLA_0507"
FT                   /product="possible XorII very-short-patch-repair
FT                   endonuclease"
FT                   /note="COG3727: DNA G:T-mismatch repair endonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28806"
FT                   /db_xref="GOA:B8DWF5"
FT                   /db_xref="InterPro:IPR004603"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="UniProtKB/TrEMBL:B8DWF5"
FT                   /protein_id="ACL28806.1"
FT                   /translation="MNKARKGAQWYARTIHCPGDTGGVAQSPSHPESPYARGTRSYTMS
FT                   RIRGKDTSIEKTVRSYLFARGFRFRKNDKRYPGHPDIVLPKYRTIVFVNGCFWHMHEGC
FT                   ESFHMPKSNVEFWAAKLTRNRDRDRRQHEQLRQMGWRVIDVWECELRGDAREARLERLV
FT                   GQIAEGV"
FT   gene            632522..632737
FT                   /locus_tag="BLA_0508"
FT   CDS_pept        632522..632737
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0508"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28807"
FT                   /db_xref="InterPro:IPR041535"
FT                   /db_xref="UniProtKB/TrEMBL:B8DWF6"
FT                   /protein_id="ACL28807.1"
FT                   /translation="MSVKESDVEMVRAAKAARNTRNLALALHSAEMEGGHVSDVLLHEA
FT                   HDYANGLIDAATLGLRVCARYGLNDR"
FT   gene            632747..632878
FT                   /locus_tag="BLA_0509"
FT   CDS_pept        632747..632878
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0509"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28808"
FT                   /db_xref="UniProtKB/TrEMBL:B8DWF7"
FT                   /protein_id="ACL28808.1"
FT                   /translation="MSEPVFDPYLVPGTDLLRNLSGAHTQRELAEIEHSLVTARHWS"
FT   gene            complement(633064..633372)
FT                   /locus_tag="BLA_0510"
FT   CDS_pept        complement(633064..633372)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0510"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28809"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="UniProtKB/TrEMBL:B8DWF8"
FT                   /protein_id="ACL28809.1"
FT                   /translation="MHTTLDLSQYNDVTAYADAVHRPVVHVDYLPTPQAVARRVREAVD
FT                   DRHLSMEQLAKDAHVSIQAAYSLRDSGLASLSEARRVFAVLDIHVHAYPVEMVPLSL"
FT   gene            634268..634435
FT                   /locus_tag="BLA_0511"
FT   CDS_pept        634268..634435
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0511"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28810"
FT                   /db_xref="UniProtKB/TrEMBL:B8DWF9"
FT                   /protein_id="ACL28810.1"
FT                   /translation="MPAFGMGTHDMSAFHLGYFVICLHHQGVPSAPPQSTNAVFHGIFK
FT                   YGRQPKTKHV"
FT   gene            complement(634481..637504)
FT                   /locus_tag="BLA_0512"
FT   CDS_pept        complement(634481..637504)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0512"
FT                   /product="CRISPR-associated HD domain protein"
FT                   /note="COG1203: Predicted helicases"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28811"
FT                   /db_xref="InterPro:IPR006483"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR035011"
FT                   /db_xref="InterPro:IPR038257"
FT                   /db_xref="UniProtKB/TrEMBL:B8DWG0"
FT                   /protein_id="ACL28811.1"
FT                   /translation="MLVELYDLFVESLHQGRKPYLWQTRLMREVVNNGQWMKLISAPTG
FT                   SGKTAVIDVHLFVNALAGLAALDDIPLPKELNHLLKSLSLDAVPRRMAVTVNRRGIVDD
FT                   QYLEASAACARINDVASLDDDTESEILKLIAVGLYARQYSELMDRQWTFDQLAFQCQEQ
FT                   GKVVCSAQRLRGGLDDKADMRVWRYKPLECQILCGTPDMIGSRLLFSGYGVSDAAKPIE
FT                   AALLAYDAVIVVDEAQLSRQFAYTAQQIPRIEACIRQGEPLPVSPLQVVVTTATPSGEN
FT                   ISNLQDEQSICGVEEADFKIDLELRRRLRTPRPIQVLSVDDKQIATCMAKESIALQERL
FT                   GGVVVCFVNTVPRASEVVRRLREALGKDAGDNAVRAFVGPMRDYERDQFVQRLDSTEPL
FT                   YDAIRGDQSAITQTGLKFVVATQTLEAGIDADFSGMISELAPAASLVQRAGRVNRRGLR
FT                   PEGPVVICCQNSGKIRGPYMKEDLTAAQMWLESLPVEGLTAWSSVLQPPAPAQLERMVL
FT                   QRLEWWDVENLSHTSEDVFAEHRAAGRPYPADVDLWLRDDLADRVTPDVAVVIRTLPQD
FT                   DYLAQRLLATTPPDSRELFPVTSYAMLDALQNKLKGRRAFIMRTNSSENGNAVHLLDGQ
FT                   ADSDPTLRSGDVLIVDDGARVFSEGIPMLDPFSKDDKHSKKLQDEITSPGDVFNKCQQS
FT                   MAVLHANREKQPALYEELSEVLRAETDTDETVEAEYQGIDVSKYPNLQEALNSCAINNH
FT                   GFRIAFVDGFIDGDSSDSSVFIVLQSSDAADGDQLQEIGRFNRQGPVLLDGPGSHQESV
FT                   GSRAELFAAKLGFDSRLVADIRTAGLHHDDGKKDPRFQTLLRYRMPNVPAEPLAKSMYR
FT                   SSSWERAKRIELRLDGWRHEQRSAAECWALDSESLQAHDKELVTRLAGTSHGHGRSMFP
FT                   MNAQQVIPDAIIQTVSEENGDGSQTIHAIRSAAEELFDAGYWQSIMERTNERYGLWGIA
FT                   FLETLLRAADVTISMEGR"
FT   gene            complement(639183..640376)
FT                   /locus_tag="BLA_0513"
FT   CDS_pept        complement(639183..640376)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0513"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28812"
FT                   /db_xref="InterPro:IPR013403"
FT                   /db_xref="UniProtKB/TrEMBL:B8DWG1"
FT                   /protein_id="ACL28812.1"
FT                   /translation="MRKLTVQDLNEAAKIGGSNALTEVTSLAPAAGMGSIVAPAKYTAG
FT                   NGSTYVYEKRWVNDECVDTVLIDSRTSQANRLEDYISRAIEVGHPIFSKMPQVRVRYEM
FT                   IPGDESSVRYFDDVQLPHRAVDAHIRIAEFSESDKVKYMAARNSSLEDLSAMLAISPVT
FT                   VMFGCWDSTRNKNQLRIPASFNGEIYAVLADQTHESPIHRAGARIDPVAAGVHLTKNEA
FT                   KKIAERIKGTMNDKKLSKFASSGDGSTIVIGAIPPSTDANALDGIAVRSITRTHVLSFS
FT                   MLRAMRFGKGPEGDEAIRVLLAAALINAMVGSNAELHLRENCFLVEADEPKTVLDRRGG
FT                   KHDDLEMLTLEDADELLAQAYAQAQKKAGIDWHGQIITVQGDPAVIESASAADDDDR"
FT   gene            complement(641098..642705)
FT                   /gene="cas1"
FT                   /locus_tag="BLA_0514"
FT   CDS_pept        complement(641098..642705)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cas1"
FT                   /locus_tag="BLA_0514"
FT                   /product="CRISPR-associated protein Cas1"
FT                   /note="COG1518: Uncharacterized protein predicted to be
FT                   involved in DNA repair"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28813"
FT                   /db_xref="GOA:B8DWG2"
FT                   /db_xref="InterPro:IPR002729"
FT                   /db_xref="InterPro:IPR011604"
FT                   /db_xref="InterPro:IPR013343"
FT                   /db_xref="InterPro:IPR022765"
FT                   /db_xref="InterPro:IPR042206"
FT                   /db_xref="InterPro:IPR042211"
FT                   /db_xref="UniProtKB/TrEMBL:B8DWG2"
FT                   /protein_id="ACL28813.1"
FT                   /translation="MKRGEGLEDTLPISLICDFIFCPRRAWLEIQGEKIESLQMERGFH
FT                   DHRAVDDANGGRGDTDYRAVNVNHQGWGLSGRLDAVRLNEDNGVIIREYKATPVRRSMD
FT                   VTHAMRIQLALQAACMEDMGYRVDGTEIFFTSHHRIVPVELRKSDYEEAYGSVQEVRKL
FT                   IECETAPLPFEDDPRCMRCSHAGICLPEERAHNIPEHRIMVKVPDHAVTHLATPGARAY
FT                   LKSGRMHVSKNGDEITSVPLDSIQALQIHGNVDVSSGLMRELMWRNIPILWCSGTGRLM
FT                   GWSVSSYGPNGETRVAQHVASHEGRLDLAREFISAKIHNQIVLLRRSDKNNNVLFDMKH
FT                   IEKSVVNANRIQDILSLEGQAAALYFSQFHHLISVNKRNEWPWLERMRHPAPDPLNALL
FT                   DYTYSLLLSDCIRAIVSCGLDAHAGFLHSSKRNKPALALDLMEEFRAPIADSVVQTVVN
FT                   NGEIKRNGFANVMGSVRLRDETRKTLIGAYERRMATELKHPVYAYRASWRRIVEIQARM
FT                   VLGRLEGSLERYRGIRVR"
FT   gene            complement(644342..645613)
FT                   /locus_tag="BLA_0515"
FT   CDS_pept        complement(644342..645613)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0515"
FT                   /product="possible glutamate--cysteine ligase"
FT                   /EC_number="6.3.2.2"
FT                   /note="COG3572: Gamma-glutamylcysteine synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28814"
FT                   /db_xref="GOA:B8DWG3"
FT                   /db_xref="InterPro:IPR006336"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR035434"
FT                   /db_xref="UniProtKB/TrEMBL:B8DWG3"
FT                   /protein_id="ACL28814.1"
FT                   /translation="MTAPRVSYAHLLVQPNPRHVRSLVRFFEEGCSAPGTGGFGVEIEH
FT                   LPVHNADDTAVTYGEPNGVEELLRRLRPYYDSAQEYWQDDHLVGLAREGIAISLEPGGQ
FT                   IETSIGILRKPKDLLELHGQFMREATPILDELDFRLVNYGYQPKSSYADIPLNPKLRYA
FT                   AMNEYLGRIGQFGPCMMRASASTQVSIDYTSERDAIDKMRLGTAIGPILAWFFRNTPYF
FT                   EGAPNPWPLCRQRMWDYLDVQRTNVTPGLYDERFSWEDYAADVLSTPLMFADLTHTPEA
FT                   EGASVHGTEFTAFYTTAADLYPDRELNAYEINHVLSTHFNDVRLKNFIEMRHWDSLPIE
FT                   RAELLTQIVSNLFYDVERRTSLESYFSGLTGEDVHAAKAVLQARGGDAKPYDQPMDYWA
FT                   EVLGVGDALADVPGDAKWPEVRQG"
FT   gene            complement(645687..650354)
FT                   /locus_tag="BLA_0516"
FT   CDS_pept        complement(645687..650354)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0516"
FT                   /product="activator of 2-hydroxyglutaryl-CoA dehydratase
FT                   (HSP70-class ATPase domain)"
FT                   /note="COG1924: Activator of 2-hydroxyglutaryl-CoA
FT                   dehydratase (HSP70-class ATPase domain)"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28815"
FT                   /db_xref="InterPro:IPR002731"
FT                   /db_xref="InterPro:IPR008275"
FT                   /db_xref="InterPro:IPR010327"
FT                   /db_xref="InterPro:IPR018709"
FT                   /db_xref="UniProtKB/TrEMBL:B8DWG4"
FT                   /protein_id="ACL28815.1"
FT                   /translation="MVQEPSSISQTLNTEPRPLRIGLDIGSTTVKAVVLDDSDSLDATL
FT                   FADYRRHHANVRATMEGLLRDIRAHLAELGRADEPVRLAITGSGGLALADAVHVPFVQE
FT                   VIAETRAIDEAIPQADVIIELGGEDAKITYLKPTPEQRMNGSCAGGTGAFIDQMSTLLD
FT                   TDAAGLNEMAKYYQTLYPIASRCGVFAKTDLQPLINDGAAKPDLAASIFTAVATQTIAG
FT                   LASGRPIHGTVVFLGGPLFFMSELREAFRRALDGKVDEFITPTDAHLYVAYGAALAVGE
FT                   PGQIEHADEYPARSLDDIINALEDLKNLPSNTATMPPLFDTAADRDAFNARHHREHVHV
FT                   GTLEGARGPHFLGIDAGSTTIKATLVNDDREIVWSSYATNDGSPLTAAIEIVKRIQSEL
FT                   PSDAWIARSCATGYGEGLITTGLHLDEGVVETMAHYRGAEMVSPGVTAVIDIGGQDMKY
FT                   LAVTDGVIDSIAVNEACSSGCGSFLQTFARSMGLTIEEFTQAALASEHPVDLGSRCTVF
FT                   MNSSVKQAQKEGASIEDIAAGLCYSVVRNALYKVIKLRDSGELGSTVVVQGGTFLNDAV
FT                   LRAFELLTEREVTRPNIAGLMGAYGAALTARMHYDDIADDTDGDTDAAGVHVACIDGVD
FT                   HTVSSILHGTALDELSMTTERDVCKLCQNHCKLTITTFHDGSRYVTGNRCERGGDAKRK
FT                   RSDRPNLYDFKYKRAFAYRRLTDKKATRGEIGIPRVLNMYENYPFWFTLLTSLGFKVVI
FT                   SGRSNHELFETGIESIASENICYPAKLVHGHIKWLLNKGIRTIFYPCVSFEDDLVPESD
FT                   NHYNCPVVANYPVVIEANMPELRADGIRFMRPYFNLSKHSLMVDRIVEEFAWAGVTREE
FT                   AEAAVAAAYAEDTVFKHDVQQEGVRALAYMKEHNCRGIVLAGRPYHVDPEVNHGIPETI
FT                   CSLGMVVLSEDSVSWLDPNDVPALTAYLAEDETDPAAHTSEGFRHVNDRKLTTMPLRVM
FT                   NQWAYHARLYRAAQFVASWPGLELVQLNSFGCGLDAVTTDQVSEILADKADVYTMLKID
FT                   EVSNLGAAKIRLRSLKAAVEERERNAQRAATPAASAGTFRHTGTAAPTPGRQILLDAVM
FT                   GRQAGGAQQNRQSATMSAYANRVPFGKDMRRDYTIVAPQMSPIHFRLVEAAIRASGYKF
FT                   DVLEHASKTDVETGLKYVNNDACYPAIMTVGQLVEAIKSRRYDPDSTALAISQTGGMCR
FT                   ATNYFALIRKALVDAGYPQIPVIAISTQGFVDNPGFTPTVPLLHRAAKSLIIGDLLMKC
FT                   LYRVRPYEANPGSANRLYERWNVIVRETLLNHGMSKTAKMLYGRAYWPYAKLVAKIVES
FT                   FDALPLRDVERKVRVGVVGEILVKYQPDANNHVVEVIESQDCEAVVPGIIDFMTMRPYI
FT                   NDWNEHNLGTGRNKALYTAFKGVIHTYMKPVNDALESSGGKFEKDLPMDQLVAKAQTVT
FT                   SIGVQAGEGWLLTGEIVELIESGCPNIICAQPFACLPNHVTGRGMFGKIRRLYPQANIV
FT                   SIDYDPGASEANQLNRIKLMIAAAKKNAAAGRSSV"
FT   gene            650640..651224
FT                   /locus_tag="BLA_0517"
FT   CDS_pept        650640..651224
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0517"
FT                   /product="predicted integral membrane protein"
FT                   /note="COG3548: Predicted integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28816"
FT                   /db_xref="GOA:B8DWG5"
FT                   /db_xref="InterPro:IPR010617"
FT                   /db_xref="UniProtKB/TrEMBL:B8DWG5"
FT                   /protein_id="ACL28816.1"
FT                   /translation="MSKERVVAFTDAVLAIIMTILVLDLDKPDPLTWSGFGKLWPQFLA
FT                   YAFSFFWLGSMWVHLHIEWSGVKLVDQPVLWTSITLLFFCSLIPYSTSLVAGNVLSWDL
FT                   AIKIVGIMITLTIWPPAMLVFTLAAAMFLFLKSASAERRMQVKIKKDALANNGMATPDD
FT                   VAAVGGSAEEYLAAIEAAKQAAKEADEGDKQ"
FT   gene            651221..651622
FT                   /locus_tag="BLA_0518"
FT   CDS_pept        651221..651622
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0518"
FT                   /product="transmembrane protein"
FT                   /note="COG3759: Predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28817"
FT                   /db_xref="GOA:B8DWG6"
FT                   /db_xref="InterPro:IPR009732"
FT                   /db_xref="UniProtKB/TrEMBL:B8DWG6"
FT                   /protein_id="ACL28817.1"
FT                   /translation="MNTALITASIFAMLAGLLHVYIFVMESFLWTSRSTRETFSMGADE
FT                   AEQTKEMAFNQGFYNLFLAIMSIGGAIVLWCGVTVVGVTLMTAGSASMFCAALVLLCTA
FT                   PDKHSAAIKQIFFPALTLIALLVALILFA"
FT   gene            651774..652574
FT                   /locus_tag="BLA_0519"
FT   CDS_pept        651774..652574
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0519"
FT                   /product="M-like protein Szp3 precursor"
FT                   /note="COG0840: Methyl-accepting chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28818"
FT                   /db_xref="GOA:B8DWG7"
FT                   /db_xref="UniProtKB/TrEMBL:B8DWG7"
FT                   /protein_id="ACL28818.1"
FT                   /translation="MQQGYAPPSYQAPSYQQANYQPESGDGGKRRRRWPVVVAIITVVA
FT                   IVGGVVGGIIYKNKHDEAYARCQTAVSEFSEARKALLDTTSDSPALQKLVRNALGVDKI
FT                   LDAAADAASAAEGTVAQQGCAANATIIQLNLVANTLNSATESLRKSTAQIVRGASADTD
FT                   NTGDESESAASSDTEDVAQAKRNLQEAIDQGRALLDTLKQRYADSAVGRQLTAGFEAAL
FT                   DLAQEKFDESGIKDSRYYKAAQATLDEATNAVNAWIDRQAQKAD"
FT   gene            complement(652571..653320)
FT                   /gene="nrdG"
FT                   /locus_tag="BLA_0520"
FT   CDS_pept        complement(652571..653320)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nrdG"
FT                   /locus_tag="BLA_0520"
FT                   /product="anaerobic ribonucleoside-triphosphate reductase
FT                   activating protein"
FT                   /note="COG0602: Organic radical activating enzymes"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28819"
FT                   /db_xref="GOA:B8DWG8"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR012837"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR034457"
FT                   /db_xref="UniProtKB/TrEMBL:B8DWG8"
FT                   /protein_id="ACL28819.1"
FT                   /translation="MAEAANMNDSANGTWRSTGKPRLHDFAAGETGRGPAIPTPMSNNP
FT                   KPGQWTNRMSHNMIADYKRFLMTDGEGIRCSLYVSGCPFHCVECYNSSIWDFQAGHEYN
FT                   DKLEAQIMDDLAQSFVQGITFLGGEPLLNTGVLLPLARKIRERFGHTKDIWCWTGYTWE
FT                   ELMRDGETQDKLDLLHEIDILVDGRYIKTLHDSLLQFRGSRNQRILDVQESFRQGKPVV
FT                   WAKLHDQERFIPEIYGKERAAGEGDAS"
FT   gene            complement(653662..656088)
FT                   /gene="nrdD"
FT                   /locus_tag="BLA_0521"
FT   CDS_pept        complement(653662..656088)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nrdD"
FT                   /locus_tag="BLA_0521"
FT                   /product="anaerobic ribonucleoside-triphosphate reductase"
FT                   /EC_number="1.17.4.2"
FT                   /note="COG1328: Oxygen-sensitive
FT                   ribonucleoside-triphosphate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28820"
FT                   /db_xref="GOA:B8DWG9"
FT                   /db_xref="InterPro:IPR001150"
FT                   /db_xref="InterPro:IPR005144"
FT                   /db_xref="InterPro:IPR012833"
FT                   /db_xref="InterPro:IPR019777"
FT                   /db_xref="UniProtKB/TrEMBL:B8DWG9"
FT                   /protein_id="ACL28820.1"
FT                   /translation="METQILGDTLSRTVVGDGDDVFEGMFTDRVLVEKRDGRVVDFDPV
FT                   NIVVAVKSAFADLDKEVGPQEERMILDIANQIEGEIRERYNGPAKIEDIQNLVEHALIE
FT                   DHLYEVARTYTNYRLNKDIQRAKATDINEAVSRLVNRDESLVRENANKDSNVYATQRDL
FT                   LAGAVSKASAFSMLPDAVANAHMKGDIHFHDADYSPFTSMNNCSLPDFGDMLKHGFALG
FT                   NAMMDSPKSIGTASTQITQIIKDIAGAQYGGQTVNRADEMLEEYAKRDYVKNLDMAHAM
FT                   IPDSTPIEVARDMVAGLKAQEPRWLHFENREPLPADEAFDTNAPELEQIREIYAKIMTR
FT                   KAIYDAMQTMEYQINSNRVSNGQTPFVTVGFGLGMSWFAREIQRAILLNRIRGLGKERH
FT                   TAIFPKLVFTVKHGVNADEGDPNYDLKQLALECATKRMYPDVVFYDNIVKITGSFKAPM
FT                   GCRSFLQGWIDPKTGKDVEDGRMNLGVVTVNVPRIALESHGDVERFWKIFDERMEVAHQ
FT                   ALQFRIMRCKQATPVNAPTLFRYGAFGRLETNENVDQLFRNERATVSLGYIGLYEATAV
FT                   FFGKDWMRDHAWDPEGKDFALSIVRRMNELCKQWSKAEGYHYSVYSTPAESLTDRFNRM
FT                   DRKKFGKVEGVTDHDFYTNSFHYPVWLQPTPMEKLDYEKDFPYYASGGFINYCEFPCLQ
FT                   ANPKALEAVWDYAYNIGIGYLGTNTPIDHCFVCGFEGDFAPTEEGFKCPECGNSDPDKC
FT                   NVTKRTCGYLGNPVQRPMVHGRHEEIAHRVKHMAGETGHVTLADGETREWFEETK"
FT   gene            656445..657743
FT                   /gene="xseA"
FT                   /locus_tag="BLA_0522"
FT   CDS_pept        656445..657743
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="xseA"
FT                   /locus_tag="BLA_0522"
FT                   /product="exodeoxyribonuclease VII, large subunit"
FT                   /EC_number="3.1.11.6"
FT                   /note="COG1570: Exonuclease VII, large subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28821"
FT                   /db_xref="GOA:B8DWH0"
FT                   /db_xref="InterPro:IPR003753"
FT                   /db_xref="InterPro:IPR020579"
FT                   /db_xref="InterPro:IPR025824"
FT                   /db_xref="UniProtKB/TrEMBL:B8DWH0"
FT                   /protein_id="ACL28821.1"
FT                   /translation="MVFNNGYQTGYRQGYAPAPAAGPNELPRMAAQTTAENPWPVSMVS
FT                   QKFHSAVERWPAVWMEGQIIEINTRRSGSAYLTLRDNDQDVSMSVLGFGAFAQMARDYK
FT                   QGDRVVVHGKADLYVKSTRLSLRADMIKRVGAGNLQEQINQLRMRLKGEGLFDESRKVA
FT                   LPEFPKNIGLICAPQARAEGDVVMNVNLRWPGVRFTIVHAHVQGEQCPPDIVSAIQQLD
FT                   ADPNVDVIIVARGGGSFEDLMGFSDERVVRATAACATPIISAIGHEDDWTLIDLAADVR
FT                   ASTPTDAAKRVVPDVREQQQLITEGINRMRTFIANRAGNEERLVEGYANRPSLTQPLTM
FT                   LIPHERDIADAVSAMRNGLRRIVDEEQMQVERLAATLRALSPQSTLDRGYAVLQNADGA
FT                   IIDDASQVQVGDELTLTLRRGKVVSQAQAVYDE"
FT   gene            657787..658104
FT                   /gene="xseB"
FT                   /locus_tag="BLA_0523"
FT   CDS_pept        657787..658104
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="xseB"
FT                   /locus_tag="BLA_0523"
FT                   /product="exonuclease VII, small subunit"
FT                   /EC_number="3.1.11.6"
FT                   /note="COG1722: Exonuclease VII small subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28822"
FT                   /db_xref="GOA:B8DWH1"
FT                   /db_xref="InterPro:IPR003761"
FT                   /db_xref="InterPro:IPR037004"
FT                   /db_xref="UniProtKB/TrEMBL:B8DWH1"
FT                   /protein_id="ACL28822.1"
FT                   /translation="MAEDMEITEVSETEPQTASSLSQEERERIAQLPYEQARDELIQAV
FT                   RALENGGLSLEDSMKQWELGEALAQRAQSLLSTIRAKLDAAQQAQAQTANTAGTQSNLE
FT                   S"
FT   gene            complement(658105..659130)
FT                   /locus_tag="BLA_0524"
FT   CDS_pept        complement(658105..659130)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0524"
FT                   /product="endonuclease/exonuclease/phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28823"
FT                   /db_xref="GOA:B8DWH2"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:B8DWH2"
FT                   /protein_id="ACL28823.1"
FT                   /translation="MAMMRKHRVLGAIAGLLALASLCSCALRLLPVDLQTLPYVSVVLA
FT                   ATPWFAIVSVVSLVLALISTRWVTAIVAGVCLAIQVCWQLPFYHNGTPLSGSALSSQSL
FT                   PRADTADAVARLMTCNVYKGHADAAAIVNAVRDNHVEVLALQETTPDFLKRLEEAGISQ
FT                   LLPYSQTSSADGYFGNALFSALPFENPSQTDVDSIASYMPGGTVGFDNGAIPVRFVSVH
FT                   TQSPTEGRFEKWSRSIAELKQLNEHPDTDYILMGDFNSTWDHAVFRDMLGTRFQDAAEV
FT                   SGHGLVFTWPADRKYLPAFAGIDHIVTSKDVTIGQVNSLTIPGSDHRALLATVDVSGLR
FT                   H"
FT   gene            659306..659378
FT                   /locus_tag="BLA_t0026"
FT   tRNA            659306..659378
FT                   /locus_tag="BLA_t0026"
FT                   /product="tRNA-Arg"
FT   gene            659483..660211
FT                   /locus_tag="BLA_0525"
FT   CDS_pept        659483..660211
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0525"
FT                   /product="Tmp"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28824"
FT                   /db_xref="InterPro:IPR025503"
FT                   /db_xref="UniProtKB/TrEMBL:B8DWH3"
FT                   /protein_id="ACL28824.1"
FT                   /translation="MAIEAHCGTLSALTLALPRSCAVPESRGTLPKGMFVAKVAVSAKT
FT                   KQHLIHAIDGITMLAILRAANTGVEQGRRIPEVLVIGLRLADGIEEAPHDIVELIQAQR
FT                   KSGIVFVCVRNVEFEGAMREEACFVVRRPLSERSGHAPTFHEFASAWIPSGEALLEIAD
FT                   AAATTDDLWDSLCSQVIFGSTDFADLDARIVRASRIAQLRTQIAKLEGDHARAKTQERR
FT                   NEAHAKLRKARAQLESLEQL"
FT   gene            complement(660227..661456)
FT                   /locus_tag="BLA_0526"
FT   CDS_pept        complement(660227..661456)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0526"
FT                   /product="probable aspartate aminotransferase"
FT                   /EC_number="2.6.1.1"
FT                   /note="COG0436: Aspartate/tyrosine/aromatic
FT                   aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28825"
FT                   /db_xref="GOA:B8DWH4"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:B8DWH4"
FT                   /protein_id="ACL28825.1"
FT                   /translation="MTGADEQTKDSQRQNMRPPFAKRAALARPFMGMRISNEAKRLRAQ
FT                   GVDVINLSLGQPDYGAPEPVREAMRDLYDGRPLPYSDSMGLSELREAIARFYRTAHDVE
FT                   VDPKRIVITEGGSAALLLATALSVDEGDEVIIADPSYPSNRELVRSFGGKVVDVPTSAA
FT                   TRFHLDQPLVRQYWSERTRAVMITSPSNPTGTTIAPDVLRDVCAYAAHHGAWRIMDETY
FT                   LDLTDVEADGSRVESALAVDPEAMVCGSFSKFFGMTGWRLGWMVVPEFALDAVDNLATN
FT                   FFLGAHTPSQYAALACFTPQSLRICEERRQELLERRAFVVDALARIGLPLEVVPNGAFY
FT                   AYFNISSTGLDAQTFCERALHEAHVALTPGGDFGPATGSTHVRLSYAASMSDLEVGFER
FT                   LGDFVASLRR"
FT   gene            complement(661482..661976)
FT                   /gene="vsr"
FT                   /locus_tag="BLA_0527"
FT   CDS_pept        complement(661482..661976)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="vsr"
FT                   /locus_tag="BLA_0527"
FT                   /product="possible XorII very-short-patch-repair
FT                   endonuclease"
FT                   /note="COG3727: DNA G:T-mismatch repair endonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28826"
FT                   /db_xref="GOA:B8DWH5"
FT                   /db_xref="InterPro:IPR004603"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="UniProtKB/TrEMBL:B8DWH5"
FT                   /protein_id="ACL28826.1"
FT                   /translation="MGTSADSGDSKYARGTRSYTMSRIRGKDTSIERLVRSYLFARGFR
FT                   FRKNDRRYPGHPDIVLPKYHTIVFVNGCFWHMHEGCPKFKMPGSNVGFWTAKLTRNRER
FT                   DGAQHEQLRAMGWRVIDVWECELERQSRDARLQSLASQILDAPVEGAVENGGETADTGQ
FT                   Q"
FT   gene            662132..663700
FT                   /locus_tag="BLA_0528"
FT   CDS_pept        662132..663700
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0528"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28827"
FT                   /db_xref="UniProtKB/TrEMBL:B8DWH6"
FT                   /protein_id="ACL28827.1"
FT                   /translation="MGLRNRHTQPVYYNELYDIEDFIGTSCLNNDDLHAPTFLWDSSIC
FT                   EESRDDDAERLGTPVAPTDEAETVMTLSMQWYFDSLAAIVPGAQRTGDGIEMPLRDMPT
FT                   FRIDSQALQGVSCVVGNAVASNHWLDAVNNLARALEITAEFLNNCADRDNEGLDFLEDT
FT                   IMQVQVYMDSVARNASPDVAATALRRITDVACSKYFHLNATKMIELLSCTLSFASYDDT
FT                   RVLAYESLERAVDYMRANLDEMDNFDTPSGSSHARNADDGASPNRSDPHAQAAPTDDIA
FT                   QVNEQFEQMMAAEFDADDDLGIVVPHADSDDEMALNLTLDPEAFNRRLHIYAREQFEQA
FT                   VQFLRHDLLRISGDDAAADELLRDHTDMEPLADMLALRLISTKRFHELLSLAIRIERER
FT                   PNQQIMLFPETLVPYQWDSIREIALQGIDNRDELKRIYRERIVEAYDPSDTRALANLNA
FT                   LCSEEGDWDEQVRQIVEEYANGEGRYARNVIYEQMLIAEDMVEEAVEYVEHFPEAKEDL
FT                   ALLLW"
FT   gene            complement(663734..665119)
FT                   /locus_tag="BLA_0529"
FT   CDS_pept        complement(663734..665119)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0529"
FT                   /product="DNA polymerase III"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28828"
FT                   /db_xref="GOA:B8DWH7"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:B8DWH7"
FT                   /protein_id="ACL28828.1"
FT                   /translation="MTYEQNTQWLEASKHDVTQWAAVMERDADERIIDWDWVCSLDFVA
FT                   GVGAGARLDLVHDEYDAHALLMQDYAIRERLEAILENVTSVFMGDFDRNLDSFRLARAL
FT                   AYANRRLNDEITLIMEQGKVRRLWNVERRFERGTAFVVLHGNEDAHANEIVDRSAQLAQ
FT                   ERAQRRNHAMNQRKAGSQMMQQASLSSFTDDKVLSEESGQTSRPAAPRRSDSQYDWRMA
FT                   YLPGRDVDAVLGIDIETTGTSAWRDYIIDVGFERMNLQTPAPEGAKARDVYSETDYAAD
FT                   GAYDQSRLSFGVPLRCAEVANPFIAQLTGIDVTKIAGEPIFDEWPRMQQALLERLMQQP
FT                   YVAHNATFEHRFFMANVEGYAEAYRNGEITILDTMPMSRHWDAGSVPSPGHPHGDNTLE
FT                   AYAKRQGALDGNSHERHLGLEDAHIMLVAMRHHLGTLKVAGEGPWGPAGRGGVGGKHTG
FT                   RRR"
FT   gene            complement(665257..665910)
FT                   /gene="def"
FT                   /locus_tag="BLA_0530"
FT   CDS_pept        complement(665257..665910)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="def"
FT                   /locus_tag="BLA_0530"
FT                   /product="peptide deformylase"
FT                   /EC_number="3.5.1.88"
FT                   /note="COG0242: N-formylmethionyl-tRNA deformylase"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28829"
FT                   /db_xref="GOA:B8DWH8"
FT                   /db_xref="InterPro:IPR023635"
FT                   /db_xref="InterPro:IPR036821"
FT                   /db_xref="UniProtKB/TrEMBL:B8DWH8"
FT                   /protein_id="ACL28829.1"
FT                   /translation="MFGKKNHVDIELNADVERLLKSAKEGVLPIVEAGEPVLREQCVRY
FT                   DGQLSKHTLHKLIETMHKTMLDAPGVGLAGPQIGLNLAIAVVEDHANGDDDGDPREIAE
FT                   FPFHAIINPVYRPAGEETRSFYEGCLSFDGYQAVRKRYLDIIAHWHDEDGKEHEEHLHG
FT                   WPARIFQHETDHLSGELYIDQAEIRSLTTVENLEDFWAQDPVPTQAAKELGFEL"
FT   gene            complement(665948..667312)
FT                   /gene="glmM"
FT                   /locus_tag="BLA_0531"
FT   CDS_pept        complement(665948..667312)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glmM"
FT                   /locus_tag="BLA_0531"
FT                   /product="phosphoglucosamine mutase"
FT                   /EC_number="5.4.2.10"
FT                   /note="COG1109: Phosphomannomutase"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28830"
FT                   /db_xref="GOA:B8DWH9"
FT                   /db_xref="InterPro:IPR005841"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR006352"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8DWH9"
FT                   /protein_id="ACL28830.1"
FT                   /translation="MPRMFGTDGVRGLANRDLTAQLALDLGDAAVRVLGDDGGRETNRH
FT                   RALIGRDTRVSGDFLSHALAAGMSAGGFDVIDAGIIPTPGVAFLTSVLNVEMGAVISAS
FT                   HNPMPDNGIKFFARGGFKLPDTKEDEIEAVLGQDWERPTGAGVGRVSHDTTTATNLYID
FT                   HLVSAIAPEGNEQPLKGLKVVADCANGATSVVAPEALRRAGADVIVINASPDGYNINKN
FT                   AGSTHPESMQAMVRASGADLGVAFDGDADRCLAADAEGNMVNGDQIMGILARAKKREGK
FT                   LNHDTLVVTVMSNLGLKLALKEMGIDTVQTNVGDRYVLEEMLRGDYSLGGEQSGHVINR
FT                   EFATTGDGTLTALTLCNEVVKSGKSLKELAADFPQLPQQLINVPNVDKMAAKTNKAVLE
FT                   AVAREEELLGDTGRVLLRPSGTEPLVRVMAEAATQEQADEVTARLAQIVADELAL"
FT   gene            complement(667777..670401)
FT                   /gene="pepN"
FT                   /locus_tag="BLA_0532"
FT   CDS_pept        complement(667777..670401)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pepN"
FT                   /locus_tag="BLA_0532"
FT                   /product="aminopeptidase N"
FT                   /EC_number="3.4.11.2"
FT                   /note="COG0308: Aminopeptidase N"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28831"
FT                   /db_xref="GOA:B8DWI0"
FT                   /db_xref="InterPro:IPR001930"
FT                   /db_xref="InterPro:IPR012778"
FT                   /db_xref="InterPro:IPR014782"
FT                   /db_xref="InterPro:IPR024571"
FT                   /db_xref="InterPro:IPR042097"
FT                   /db_xref="UniProtKB/TrEMBL:B8DWI0"
FT                   /protein_id="ACL28831.1"
FT                   /translation="MPGSNLTRVEAQERKAIITYPIEYTVDLDLTQGPKTFVSTSTIRF
FT                   GAHAGESTFLDLIADSVESVTVNGETLDVNEVFDDDRIDLNNLKEHNEVVVKAVCRYST
FT                   TGEGLHRSVDPSDGNVYLYSQFEVPDARRVYAVFDQPDLKATFKFSVKAPQSWTVLSNM
FT                   PVESTEDLADLTADGTLAGKPAESTKLWHFATTPTMSSYLTAICAGPYAAWHTTYENED
FT                   GRTVPMSQYCRQALKDAFAKDVDYLFDITKKGFAFYAKTWGVPYPYAKYDQIYVPEYNA
FT                   GAMENIGLVTIRDSYVFESKVTDALAERRVVTVLHELAHMWFGDYVTMKWWNDLWLNES
FT                   FAEFTSTLATAEATDWKDAWATFCSGEKSWALAQDQLSTTHPIVAPINDLNDTYVNFDG
FT                   ITYAKGASVLKQLVAYVGRERFFEGISHYLNRHAYSNATLNDLLDELEATSGRDLKTWS
FT                   AKWLEQAGINTISTAVQADADGKITSLTLTQAAPTEFPVLRPHRLAVGFYDEDPQTGKI
FT                   VRTDRIELDVDGEHTTVAQAAGKAKPSLLLANDDDLTYTKLRFDDDSLAFAMANLYRFD
FT                   DALARAVIWLSLWDMTRDGELAATDFIDTTLKMLGTETESTTFRYALAMLSTTVWHYTD
FT                   AKQRNRIAKHVASELFALAKQAKAGSDEQFQLVSAYLTYGVEGDSEFADTVRGLLSGSL
FT                   VFEGLELDNNFRWSIMHALASINAIKQADIDAELKRRDTTENREFAVGTRASLHSKESK
FT                   DWAFDQALHNDELTNSQLGEVARGFSGTHDADLADGYVDAYFEAIDWIWKNKTFHMSEV
FT                   LIGDLYPAYADPAKLVEAGDRWLAAHQDADNALLRMVKANVEASHRTRMVSDFNASIGE
FT                   SAR"
FT   gene            complement(670558..672465)
FT                   /locus_tag="BLA_0533"
FT   CDS_pept        complement(670558..672465)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0533"
FT                   /product="beta-lactamase-like protein"
FT                   /note="COG0595: Predicted hydrolase of the
FT                   metallo-beta-lactamase superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28832"
FT                   /db_xref="GOA:B8DWI1"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR004613"
FT                   /db_xref="InterPro:IPR011108"
FT                   /db_xref="InterPro:IPR030854"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="InterPro:IPR041636"
FT                   /db_xref="InterPro:IPR042173"
FT                   /db_xref="UniProtKB/TrEMBL:B8DWI1"
FT                   /protein_id="ACL28832.1"
FT                   /translation="MATQEAKTTRKRSAGKSATGTKRRSTKSAASQAKSPRTRKSTRNT
FT                   STRVRKQINVNKPLATSDTQDENRVAPPKYRKGSMRIVPLGGLGEIGRNMNVIEYNGHI
FT                   LLIDCGVLFPEEEQPGVDLILPDFNYIKDRLDKVDALVLTHGHEDHIGGVPYLLKMRPD
FT                   IPLIGSKLTLGFVEAKCREHRIEPVMTQVEGRDKLKVGPFNLEFVSVTHSIPDALAVCV
FT                   RTPAGSLIDTGDIKLDQLPLDHRVTDLVEFGKLGEQGIDLLMMDSTNAEVPGFVKPETS
FT                   IGPALDQVFATATRKIIVASFSSHVHRVQQVVDAAHKYGRKVVFVGRSMVRNMAIAADL
FT                   GYLHLPEDTVIDVKKAKDYPDNKLVYMCTGSQGEPMAALGRIADGNHRDITINEFDTVI
FT                   LASSLIPGNEHGVYKVINKLVQLGARVVNRDNAAVHVSGHCNEGELLYMYNIVKPRNAM
FT                   PIHGENRHLVANGLIAVKTGIEPENVVLAEDGDVVDLYHGKAAIVGSVPCGYIYVDGDS
FT                   VGELTDEELEKRRILGTEGFVSCFAVVDTDAAEVVSGPKVYLNAVAEDESEFEKVRHQI
FT                   VEQLRDAMMTGTKDTHKLQQIMRRTLGGWVSRELKRKPMIVPVVADVAADMNKMESYND
FT                   "
FT   gene            complement(672566..673477)
FT                   /gene="dapA"
FT                   /locus_tag="BLA_0534"
FT   CDS_pept        complement(672566..673477)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dapA"
FT                   /locus_tag="BLA_0534"
FT                   /product="dihydrodipicolinate synthase"
FT                   /EC_number="4.3.3.7"
FT                   /note="COG0329: Dihydrodipicolinate
FT                   synthase/N-acetylneuraminate lyase"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28833"
FT                   /db_xref="GOA:B8DWI2"
FT                   /db_xref="InterPro:IPR002220"
FT                   /db_xref="InterPro:IPR005263"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR020624"
FT                   /db_xref="InterPro:IPR020625"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8DWI2"
FT                   /protein_id="ACL28833.1"
FT                   /translation="MSDGIMHLLDPAPFGRVLPAMITPMKPNGDVDFDMAQTVAKQLVA
FT                   DGADGLVVNGTTGESPTTHMDEKVELVKAVKEVVDVPVISGAGSNDTAHTVRMVEQTQE
FT                   AGADAVLVVCPYYSRPSQQGIFCHYQAVNESADKPIIVYDVPGRTGVRIALDTYVHLAE
FT                   LDHVKAVKDATGDIAGAVRKRMETGLTWYSGDDALYLPFLSIGAVGIISVVAHAAAKPM
FT                   RELAEAFDRGDIAKAQGLANRIAPVIEAMNGTGFQAVMAKAALKVRGIMECTTMRLPNI
FT                   GPNDEQIEVVRDGLRASGLIPE"
FT   gene            complement(673523..674284)
FT                   /gene="dapB"
FT                   /locus_tag="BLA_0535"
FT   CDS_pept        complement(673523..674284)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dapB"
FT                   /locus_tag="BLA_0535"
FT                   /product="dihydrodipicolinate reductase"
FT                   /EC_number="1.17.1.8"
FT                   /note="COG0289: Dihydrodipicolinate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28834"
FT                   /db_xref="GOA:B8DWI3"
FT                   /db_xref="InterPro:IPR000846"
FT                   /db_xref="InterPro:IPR022663"
FT                   /db_xref="InterPro:IPR022664"
FT                   /db_xref="InterPro:IPR023940"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8DWI3"
FT                   /protein_id="ACL28834.1"
FT                   /translation="MIRVSVVGAKGRMGSHVVEAVRAADDTELALALDAGDDLTQITPQ
FT                   NTDVVVEFTVPAVSLNNVLTLVRQGVNVVVGTTGWTDEKLDQVRAALAETETIDGRKQS
FT                   VFIAPNFAISAVLADVFARIAAPYFESAEVIELHHPDKVDAPSGTAIHTAHAIADARKA
FT                   AGLGEMPDNTQTDDGSRGAVIDGVHVHAVRLRGLNAHEEVLLGNAGEQLVIRADSFDRI
FT                   SFMPGVLLAVRKVDSGEFPGLTVGLDQFLDL"
FT   gene            complement(674340..675758)
FT                   /locus_tag="BLA_0536"
FT   CDS_pept        complement(674340..675758)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0536"
FT                   /product="possible transport protein"
FT                   /note="COG0477: Permeases of the major facilitator
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28835"
FT                   /db_xref="GOA:B8DWI4"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B8DWI4"
FT                   /protein_id="ACL28835.1"
FT                   /translation="MSSKPSNLPKTADGATQAAQGSGSPYARLFRLKGAKAFCLSAAFA
FT                   RLPMSMMSLGIVLALNHLYDNWTVAGAMSAVYILAVAAVTPFYARLFDRFGQVKVGRVA
FT                   LTVQVIVMLAFAFAALARVPIPLLFVLAVVMGATQFSFGALVRTRWTYLLERTDNMDLL
FT                   NTAYALEAAIDEIVFIFGPILAATLATSVHPVSQLFVPTAACAIGGGIFFSLRSTQPPV
FT                   LHAVETVQVNGDDDDVRMARSGFAAQADGSHVAGQRAGVERKHRGMVSQSRRTTRNVLS
FT                   YAGILPLMLAFICFNMSFTTFDVSMTGQMEADHLDRFLGLQLAMIAVGSCIGAFYFGSR
FT                   QHRGSHWRRLIVCLCILTVGFMLMRVTMDIYWVLGIVELLAGLVVSPMFATGNLIVKDT
FT                   VPESQLTEGLSWLTTAGQIGAAMGSLLGGMVLDHIDAHAGVMTTWVYTLAAIPFAVLGW
FT                   YVASRKAQAVDPNA"
FT   gene            complement(675755..676465)
FT                   /locus_tag="BLA_0537"
FT   CDS_pept        complement(675755..676465)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0537"
FT                   /product="acetyltransferase, GNAT family"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28836"
FT                   /db_xref="GOA:B8DWI5"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:B8DWI5"
FT                   /protein_id="ACL28836.1"
FT                   /translation="MSDTNNRHDNVASASSTANRDLTLRAMTLGDLQDVARVFDEVWPQ
FT                   AAPLTGTPMAYELARYFVLEYMRSATASCVAVTADGEFAGVTLARIDGQPLAFPQTEGM
FT                   LGDLRQIIDENPIAKMMRSGFDHFRATDHQLELRSGVGQSTQAELLLFMVNPAVKGHGV
FT                   GGALWNALLQGFRANGVHAFYLHTDTSCDYTYYEHHGLQRVAERLRADHPEDNGRADGI
FT                   RDDMFVYRGEVPAV"
FT   gene            complement(676688..680824)
FT                   /locus_tag="BLA_0538"
FT   CDS_pept        complement(676688..680824)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0538"
FT                   /product="UvrD/REP helicase"
FT                   /note="COG0210: Superfamily I DNA and RNA helicases"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28837"
FT                   /db_xref="GOA:B8DWI6"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="InterPro:IPR038726"
FT                   /db_xref="UniProtKB/TrEMBL:B8DWI6"
FT                   /protein_id="ACL28837.1"
FT                   /translation="MAQSNKPVPSAEQQRIVDADANANVIVVAGAGSGKTFTMTERVIH
FT                   LIHEGVPPEHILGLTFTNKAASELLSRVSKAVLDDARERAREGGPHPARLAFMKPDVRT
FT                   YDAFFQSIVRQYGLLVGFDPQTQPLSVAGARQIIASVVGRHVDEIVQLPVDMGSFGTVV
FT                   DAVGALANNIANSMIGNGCLTVADAIERITQWDAAFRTQILDLLQTDETGLLTGPLADR
FT                   QRGATPKAVKDVLKARKKAEKKGGEYVETPGDKDAVGEAIHADAELAARDLYLVAMKRD
FT                   VLLGLVREFDEEKRRRHMAEYSDFVIAAYQLVERFPSIGAHYRRQFTHVLLDEFQDTST
FT                   TQSALLAALFHVDEPHGTDRSAAVSAVGDPFQSIYAWRGASPGAFRMFINDFHMPAAAE
FT                   PLPMTRTRRNSRVVLQGANNLTKVLRRVEQRPSSANAQEVPVQPLRNVDDGSVEVDEGT
FT                   LAVLGFQTRGQEVDAVTRFVKQSVEQYGDACKPGDSPVAVLFRGKKSMALYEDQLSQVT
FT                   LRDGRPLRVRAVGLSAMLDRPEVQDVLALLKVVGDHTDANALMRLLATPRYALGALDLK
FT                   RLARRAADLNTEYRFRTLVEAGLAPAGTPKREWGALVRQYARNAPNMVYLIDMLLRDDV
FT                   EAQLEAAGLSDEGRAGVMQAVRAMHRVQDEMYQPLAQVIHTAVEALNLDVDLMVASSLR
FT                   TGGAPAPRDAVRAAIDALLETVNTYTSEIAQQQRPTLRGFLTYLDMANGSDMPEAAADL
FT                   GDEPADVVLMTVHQSKGLEWDAVAIVGMQQGAFPSNKGDALRVKALEDRGSKLDWEPPL
FT                   YEETAKSWLESPEAVPVPIRVDAAILPKFPTIPDAGGSDASSLQESAVRALRDIDSVES
FT                   LENDAYGELRALLRDNGVLLDELGEPDAWNLSQKEERGRALHADERRLMYVALTRAKHD
FT                   ALVTYSVGATTSRIPEDNAKESGAPSVFWRELRDSMSCDDSFSQRVELTAFDNQTTAPA
FT                   RPVAATAGNTAVTYDDLESTQPRSLHERGAKRPEGVIVGKGAEQFATLLVDEPYEEPME
FT                   PIDTEQHLPWPSRLSEEMHRTLRKGAAQVVQRMSQNNPTDMPGETAEGDGRSLLERARQ
FT                   LIDNRATLIREGMTADEIEQAVRMRGQRVLAAKDKLTATGLQRNAEAGENATDFALEII
FT                   RPVPQVSTPQAQAGTRFHAWAQRYLEAGVNPEYGISQEAMAREVAHEAEAVEQAERGGR
FT                   PVPREQRDLLIWKQRFLESAWSAREPAAVEQTVSTFVSGIGKRVDAKLDAVFHGGLGDG
FT                   TSGASGDARYTIIDWKTGSRPRNAQQRAGKLAQLDMYRYFWALQKRIPMSQIDAALYYV
FT                   SEKDPAKALVVAPQRSEAEVLAEMRAGVPEPDDND"
FT   gene            complement(680837..683554)
FT                   /locus_tag="BLA_0539"
FT   CDS_pept        complement(680837..683554)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0539"
FT                   /product="putative ATP-dependent exoDNAse (Exonuclease V)
FT                   beta subunit"
FT                   /note="COG0210: Superfamily I DNA and RNA helicases"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28838"
FT                   /db_xref="GOA:B8DWI7"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038726"
FT                   /db_xref="UniProtKB/TrEMBL:B8DWI7"
FT                   /protein_id="ACL28838.1"
FT                   /translation="MRLNTVNAALSSLEALARISQTDILDDASATADPDRSALAESVKA
FT                   SALSDLRSQWDALASTVRAAHAAQEQASGIVVDDSRLSDTDKVGDGLEFGIDALYLLLA
FT                   QGDDETLLDVLEALCGDHNEDVRNFNLLWRIVGQIADDLGSLPSKAPQYALEAAWKACH
FT                   VADAWKVQAIFDSPDGRAANDRLDTAMRLFNYVQSEGVAPDINAFIDQVRQLQIEADSL
FT                   ASLAPVDEAVTLTTPAGTAGLSWEHVWIPAVQQGIWPNLAARNTMFGGEDLVDIALHGS
FT                   QTRHRNEVGGQLDEVLASEQKGWLVALTRANGTLNVSASQNDDAVPSDFLYAYLPECFT
FT                   RDDAERPLAERLADASDAGNADSRRNQTETSVDTAEHGHSVKESERHAGDETLTASMRG
FT                   VIALARMTLAHSEESSAEFQDAVAALAALASAGVDEADPRRWPFLRDAPTGARSPGRHE
FT                   RTQSGNSVQSTGTALSLNAGSAQSGASPQAMSVPTDPFAPIVLSPSQVDRLWGCAVCAR
FT                   LERDFSGPTPSAVVADFGTLVHDAAQYATEHHWDLPQVYEQFVPIQGPHTDTWREQTAQ
FT                   AIADRMFDEYYAPRRIDPLGIEDASERFAALQRDAESKAMLFNIARYFVDSNEAEYIHK
FT                   TTGAIGTLVESFAECSFEGAFTLRSITDAYNHAGDRPKLTVQQMRAILGVLMDGWPVQL
FT                   ADGQEVQINGRIDRLERRRFDNGDEHWRVVDYKTGNSFSPAEQFSDLQLVCYQLGLAFN
FT                   TDGSTTALTGPRPKVSRAELFFVKDQPAPAGTATRVESYYQPALMEGGAVTDTGFAARY
FT                   YMPHMSSLFKMQLPSKAPDGVPEEVWHDLLAGAQEGTLWALTMLARVFYAAAAKQADHI
FT                   VAHPTDAHRGACRHKQVCAACNEAMATVFETEWE"
FT   gene            685725..687128
FT                   /locus_tag="BLA_0540"
FT   CDS_pept        685725..687128
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0540"
FT                   /product="probable serine/threonine-protein kinase"
FT                   /EC_number="2.7.11.1"
FT                   /note="COG0515: Serine/threonine protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28839"
FT                   /db_xref="GOA:B8DWI8"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:B8DWI8"
FT                   /protein_id="ACL28839.1"
FT                   /translation="MTQQVPQPPRLAGYSYVRVLGHGSTATVYLYRQQGIERDVAIKVS
FT                   VEQVDSRIADAFRAEARAMAALSSHPYILSTYDAGVTDDGRYYLVFEYAPGGTLKDVLC
FT                   NHVLDVPQMLSMGVHLASAVATAHRAGIVHRDIKTSNVLITWQRLPTLADFGIAVTAYD
FT                   HSSTGYSLPWAPPETLRTGGAGGEAADIYSLGAVLYASLVGTSPFEYGYHPKTAKELAR
FT                   LIMTQPLPTIQRNDVPTVVHETLAHAMAPNADDRYPSALAFARALQQAQFDLYGHATPV
FT                   NVEGADPYPSSIARRQITERPPAARQRGKHRKAWMVAGFTVALLTLFLAVFMGFVLPGL
FT                   DTHASGNQTVVEGSHGALQNGERPEPTGNEPPGASVVPSPQQLSGTLDENGIAHFHWRN
FT                   PDPREGDTYVWSRIGAATTPGASHVVDSTGFDIPADQTDQAQVCVRVSIVRADRSMSAQ
FT                   PAIACAVRK"
FT   gene            687225..693056
FT                   /locus_tag="BLA_0541"
FT   CDS_pept        687225..693056
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0541"
FT                   /product="C-terminal fibronectin type III domain-containing
FT                   protein"
FT                   /EC_number="3.1.3.48"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28840"
FT                   /db_xref="GOA:B8DWI9"
FT                   /db_xref="InterPro:IPR003961"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR036116"
FT                   /db_xref="UniProtKB/TrEMBL:B8DWI9"
FT                   /protein_id="ACL28840.1"
FT                   /translation="MLVIVLAVIAGALVMHSVSQRHLQLDDGTVWVTSQADQKAARYNV
FT                   RLREPDASVTAQSPNFDIAQHGGDVILAEPQKASGIDQSTMGTADATATTSTMRTLVGG
FT                   RTAAIIDADRGEVWVGKADGIAHLSPTTATATMKLGTGGRIAIAADGTVYGLDAHTAKV
FT                   YTVGAGSNTAHEIVTLNEGEPIAADSFTVVDGQPVASSGNRLYFGRSHITVDGVGTLTL
FT                   QAPPADTDDRSQRGWVAAAAPGALVTMPLNEGAKPAIHRTAGTGEAAQPVSVNGCVHGA
FT                   WSQTARNYATVCSANGEPDMLDLQAITATANLRLRVNHRLVVLNDIANGNIWNPADSPD
FT                   VIQIQWKRLDNDTSRQTSTTTDSTSSKHTFARECSTKSGQIRAVDDEFGIRAGSNTVID
FT                   PLRNDEQTDCSVLRITSVSSPENDSVKASAIYDGRFLQVSAHNPGRATFTYEIGDGRGQ
FT                   SSRATVTLTIAGDQNRTPTRKEQPEETEVEQGATYTMNALGGFVDPDGDPLTLVGASVE
FT                   NTDEATVSARPDGELVFHAGSMREGRAAVRLQVSDGRNLTEATVYFTIRPPHTLAANID
FT                   PVCRTTTPNTAVTVDLSKVVHATSADTPQLTRVDNPERTNVTMRATDMSFTFQSSEPGT
FT                   YHVPYTIVQGDVEASGLARIDVEPDQEESARPVAANDVALLGADKTAIVEPLANDVDPM
FT                   GGVLAVTDVRADAKSGIKAGIVGNKRVYITAQTLPSAPVSLDYTVANAQGIATGTIVVQ
FT                   PPALTSADSVPKASDITVPVRTGGIVSVDVLDHVSYTGASALALDRNLKTDAGKFRGLA
FT                   FASSNTVRYQAPSTSGNYPLTYTVTDALGNASSAVVTFAVHDSDAESKSAPKPTDVEAQ
FT                   VAAGRKIRIPIRVTGIDTDGDDVQLLGLGNNAPKLGRVMETGADYLVYEAFADSVGTDT
FT                   FSYAVEDWTGRRAQAQVRVGVFQSGADSGVYARDDSVTLRPGTSTTVPVLRNDIASDNS
FT                   NLVLENNVQCQGIDNVKVQGGMISLTAPDHTGTAYIIYTVRNAAGVKDVGLLSVTVDPN
FT                   APIQPPSAYDYRVPASATVDKRTVNVDVSAWISNPSGSLDELAVNVDKSAAQHARATGD
FT                   TTLSIDLTDEARAIAYTVTNTTHGITSTAFIHVPAYGVFPPTLRPQAPPLRVNAGETIT
FT                   IPLADHVRVGAGKAPMLANSESVSATKSDNDDYVVNSGTLRFTARRDYSGPASITFTVT
FT                   DGSRGTNVRFVNTAVITLPITVIGNTRPAPTFAGTTVDVVAGEAATVIDLNALVSGGAN
FT                   EDRKPYSFTGGQSSAPFTTSLTTDGKLTVAADATATPGATQSIPITLDYGNGALHAGIT
FT                   VRAVPSTRPLARLNPATIRLKPGESTGIDVTQGAYNPFPQTPLSLVSANADADSTLQMQ
FT                   TEGTVLRLSAPPTMPAATYHVVITVMDATKTEERSVSATLTVVVQNVPGAPLLSPVAAK
FT                   PEDSAVTLNWTTGSANGSPITDYLVRWQGGEQSCGNVTSCRIGNLHNGTTYTFTVRARN
FT                   AIGWSPDSNAVTGRPNRAPEPPGQVQVRGGHRSVEVSWNEPDYAGSRPSSYTVQLQGPD
FT                   GWTKTNTRVTALATSFEIDNNVITDSSAFSATVVANNEVGASVPSRLVSTRDVWGDPDA
FT                   PQVSITQANDHEITGTVTLGNMRRAGCASIQLSHGTTSCESLRFRVPLDNAMYFKPLSV
FT                   SATVHTSRRPATVATGQSNTIEPTIGIAEPSVRMEGRNDECILEWSVPRGRHDGVHVKF
FT                   GSIDANREPAGSETVRLSPWERCPAGEVRTRLQGHYSPPARATSTHQYRVAPTVDANEI
FT                   EVSWSQHNRDAIVMRNTGRAFTDYGQPVTITLSFSNGFTTRWNPDTDVTVRPAPGESTV
FT                   PDNLRWTASITMNEDAGYAARTEEHTVQGIRRAATTRTIAWHTTPRLPAGHHSLEPHHI
FT                   AKERFHDSQA"
FT   gene            692899..694278
FT                   /gene="moxR"
FT                   /locus_tag="BLA_0542"
FT   CDS_pept        692899..694278
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="moxR"
FT                   /locus_tag="BLA_0542"
FT                   /product="putative methanol dehydrogenase regulator-like
FT                   protein"
FT                   /note="COG0714: MoxR-like ATPases"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28841"
FT                   /db_xref="GOA:B8DWJ0"
FT                   /db_xref="InterPro:IPR011703"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041628"
FT                   /db_xref="UniProtKB/TrEMBL:B8DWJ0"
FT                   /protein_id="ACL28841.1"
FT                   /translation="MPHAPKSTRYRAFAGRPQPAQSPGTRHHDFRQGITVSSRIILQRR
FT                   GSMTAKHEQPDAPHAQHTDEGYESTVLSRRGFHTPADVAPDSDATRLGGVHASPSRTEV
FT                   QTVTETVSTVNMPTERDATAVRSESAHKGDIVRFHSLFDAIVANISQVVVDKEKTIREC
FT                   VTALLAGGHVLLEDNPGTGKTQLARALAQSIDTSFKRIQFTPDLLPSDVVGVTFYDQKN
FT                   GEFTFRPGPVFASIVLADEINRASPKTQSALLEVMEEQHVTVDGTTHTVPQPFMVIATQ
FT                   NPIEQLGTYSLPEAQMDRFLLRTTIGYPSRTRSMQLLKEADITDRASTIGSVVSAHDIL
FT                   DMRKAVQQVHIDDAIYEYILRLVEQTRNSELVAVGSSMRGALALTRCARVWAAADNRAY
FT                   VIPDDVKDLAISVLAHRLTLTPDATFAGQSQHSAMQAIIDDVPVPQTGLNEAHESTHGE
FT                   R"
FT   gene            694163..695458
FT                   /locus_tag="BLA_0543"
FT   CDS_pept        694163..695458
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0543"
FT                   /product="conserved hypothetical protein"
FT                   /note="COG1721: Uncharacterized conserved protein (some
FT                   members contain a von Willebrand factor type A (vWA)
FT                   domain)"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28842"
FT                   /db_xref="GOA:B8DWJ1"
FT                   /db_xref="InterPro:IPR002881"
FT                   /db_xref="UniProtKB/TrEMBL:B8DWJ1"
FT                   /protein_id="ACL28842.1"
FT                   /translation="MPPSPARASTVQCRRSSTTCRCRRRDSTKPTNPRMASADMAIRKY
FT                   VSPLGWAVAGMFVLTLALFLCLGWVEMLAFALVCATLLVSSAALSVGNTAFTATLSVSN
FT                   TRVSVNQTMHAMVTVSNPSTSVTASASGDLPISQSNYGSLEWHHERFAIPSLGAHQSKQ
FT                   TAIPLTATHRAVVTVGPLSVRKGDPFGLVRREHRLTEQIRVYIHPDIVPLHTLHAGIIR
FT                   DLEGNPSDDLVNDDLSFFGLREYEYGDDVRNVHWLSTAKTGTLMIRQFEATRRTDSSVS
FT                   LDVAAFSYASAEEFELAVSVFASIGVQCVSERRALYAQSGRLHVQPRKPADFLDTCSEI
FT                   EPETRGGTMLANLAREALLACDKASLYCFVAGSAHEVDDLRRLGAAIPDSATCVVVQVV
FT                   AGASSAVRTLPECVFITVGVLDDLPLLMEVLS"
FT   gene            695455..697944
FT                   /locus_tag="BLA_0544"
FT   CDS_pept        695455..697944
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0544"
FT                   /product="transglutaminase domain protein"
FT                   /note="COG1305: Transglutaminase-like enzymes, putative
FT                   cysteine proteases"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28843"
FT                   /db_xref="GOA:B8DWJ2"
FT                   /db_xref="InterPro:IPR002931"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:B8DWJ2"
FT                   /protein_id="ACL28843.1"
FT                   /translation="MTSPTSSFGATRHGRTRGDASWINDNSTQMPVWLTMNARDARRAD
FT                   AAHAAGHATRDAAISLVVVMAIVLCACANLIDVYGSAGSWARAAIPAALLGSGIAFMTL
FT                   VPRLRFWWQILASVLAQCVIGPLVALPHTSVAYVLPTWQTLAEGCSAMFTSFKFLIAVP
FT                   APTGTADGSLMAVWTLCLLSCTLGGVLAVLPQRRWSALSVLVVIGDFAVCALLGTSAGV
FT                   LRLPCGVVCALAAVVWLSWRWRLFEMSRWLGAGALLLLAGAVAVGACLPVHATRTILRD
FT                   HYEPPLAPFDYASPMSGMRAYLKEHKADTLLTVRNLPAGASVRLAVMDRFDGNVWNLSN
FT                   TRIAGASSNYTRMGLRITQDGDDSGTWFTAMFDVRDGMRDDWLPLAGAATQVTFATNAN
FT                   ADDFYYNTGTESGLLTSGVRSGLAYTETGTLARRPSDDEIRQTQAARIALPDAGDIPNA
FT                   VRRMAEAFAGGQPTAGAAALALANGLRDNGWFSHGLVDDYPSLAGHGNYRITQLLGGTA
FT                   MVGDSEQYASAMALMARSLGIPSRVVLGFVPKDEHGDITEARTQRTENGTTTDFTGNDI
FT                   EAWVEVALEGHGWVAFHPTPQETKTPEDNQNPTPPNPQTLVRQPPLPLTDPLRDKQEAT
FT                   GSTVLSGDDAQDPRTSGVWSKIGAVTRDVAIYGSPVWILLVICGCILAVKAALLMRLRR
FT                   NGSTNHRVESGWRSLTQFAMQSGIPVHGTRREQAHAIARSFAAESAAEATASPSDTSRG
FT                   PVTEAQLRHSAQTADYAAFSGNPVPESEVVQYWESVDGMRAALLKTLPFWRRVRTRLSL
FT                   RGLFRHHAYKETSDHPA"
FT   gene            698211..698858
FT                   /locus_tag="BLA_0545"
FT   CDS_pept        698211..698858
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0545"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28844"
FT                   /db_xref="UniProtKB/TrEMBL:B8DWJ3"
FT                   /protein_id="ACL28844.1"
FT                   /translation="MVDYQTAVAAVQDPQADPILLAKIAYENPEFGANVAVHPRAYPGL
FT                   KRWLAEFGDKRARMTLAQMGVIATADPVEDRFDESETPSGQRNPEPARAVKLAVEQLVR
FT                   NSGAQQPVQARPTRFTQPAQSTQAAQHTLATQPDRATASNPNAQYSANGEFTPQLAMTT
FT                   SDPAVMHDIAQYAPDLHVYLVQNPYIYPELLNWLASLNETEVNEAIAARRAR"
FT   gene            complement(698873..699481)
FT                   /locus_tag="BLA_0546"
FT   CDS_pept        complement(698873..699481)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0546"
FT                   /product="FHA domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28845"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="UniProtKB/TrEMBL:B8DWJ4"
FT                   /protein_id="ACL28845.1"
FT                   /translation="MSRIPYPPAPEPGWYDDDVDAVPGVAFPAYGTQEMRRVQAHRQDG
FT                   QVSEQPEWHGEPDDYAGEPDEYTAEPGSEGDAQWDGTVLSKRFARETEREAVLTNAVTN
FT                   QHIDINMNTLLGRKPSHDIPEGSKSVRLIDPTRTVSRNHCAISYGEHGTLWLEDMGSLN
FT                   GTYVVHDDEEMRVSQGMPVELDLPANIRIGDQFFTLDAR"
FT   gene            complement(699619..703656)
FT                   /gene="rpoC"
FT                   /locus_tag="BLA_0547"
FT   CDS_pept        complement(699619..703656)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoC"
FT                   /locus_tag="BLA_0547"
FT                   /product="DNA-directed RNA polymerase, beta' subunit"
FT                   /EC_number="2.7.7.6"
FT                   /note="COG0086: DNA-directed RNA polymerase, beta'
FT                   subunit/160 kD subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28846"
FT                   /db_xref="GOA:B8DWJ5"
FT                   /db_xref="InterPro:IPR000722"
FT                   /db_xref="InterPro:IPR006592"
FT                   /db_xref="InterPro:IPR007066"
FT                   /db_xref="InterPro:IPR007080"
FT                   /db_xref="InterPro:IPR007081"
FT                   /db_xref="InterPro:IPR007083"
FT                   /db_xref="InterPro:IPR012754"
FT                   /db_xref="InterPro:IPR038120"
FT                   /db_xref="InterPro:IPR042102"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8DWJ5"
FT                   /protein_id="ACL28846.1"
FT                   /translation="MLDVNAFDKLKIGLATADDIRGWSYGEVKKPETINYRTLKPEKDG
FT                   LFGEQIFGPTRDWECACGKYKRVRFKGIVCERCGVEVTRSRVRRERMGHIELAAPVTHI
FT                   WFFKGVPSRLGYLLGIAPKELEKVIYFASYMVTSVDEEQRHQDLPDLQDEFDHEVQNLE
FT                   RRRNNEIEERAKKLEADLAELEADGEVKGSAKTKLRNGAERDMAAIRQRYDDQIKRIAA
FT                   VFDKFKSLKPGDMESDVDLWREMEDRYGDYFEGCMGAEAIKKRLQDFDLEAAAKELREE
FT                   IETGTGQRKARALKRLKVVNAFLTTDNKPEAMVLDVIPVIPPDLRPMVQLDGGRFATSD
FT                   LNDLYRRVINRNNRLKRLIELGAPEIMLNNEKRMLQEAVDSLFDNGRRGRPVTGASNRP
FT                   LKSLSDMLKGKQGRFRQNLLGKRVDYSGRSVIVVGPSLRMHQCGLPKPMALELFKPFVI
FT                   KRLVDLNYAQNMKSAKRLVDRGDSEVWGVLEEVISEHPVLLNRAPTLHRLGIQAFEPIL
FT                   VEGKAIHLPPLACAAFNADFDGDQMAVHLPLSAEAQAEARSLMMASDNILKPADGHTVT
FT                   MPSQDMILGLYYLSTVIDGAKGQGRIFSSLEEAQMALDKHEIDMQAKVLIRLPQDFVLP
FT                   KDWEPGEVQVIDPEPGSPDVVKEERFADGSVLFATSLGRILFNDTLPVDYPFINEQAPK
FT                   GKLSKIVDDIATRYSTQQVAATLDALKDLGFTRAPWSGVTMAFSDIVAPPDREEIIKGY
FT                   EAQAAKVNNQYDLGLLTEEERRQELINLWTECTDKVAEAMRENFHDDNNVNIMVQSGAR
FT                   GNWMQIRQIAGMRGLVANPKGEIIPRPVKSNYREGLSVLEYFISQHGARKGLADTALRT
FT                   AESGYLTRRLVDVSQEIIVREEDCGTTHGLPMTVAERDENGNLVLVKAADGGPYSRLLA
FT                   QDVLDPADGKTVLYHAGDALSMDVLNDLVAHGVEQVIGRSVLTCESKRGVCAKCYGWSL
FT                   ATNKLVDVGEAVGIVAAQSIGEPGTQLTLRSFHSGGVASASDITQGLPRVTELFEARTP
FT                   KGEAPISEFAGTIKVQDTERGREVILQPDDDSLEPITYQVTRRAPMLVKDGQHVDPGTQ
FT                   LVEGSVDPKKILRILGPRAAQMNIVNEVHDVYRSQGVDIHDKHIEVIVHQMLRRVTVID
FT                   SGDTDLLPGELVDRARFREQNKKTVAAGGRPAAGRPELMGITKASLATDSWLSAASFQE
FT                   TTRVLTEAALNEKEDDLKGLKENVIIGKLIPAGTGLARYRNATVEPDKAIRDTIYPNFG
FT                   LGDGSLGGDLSDGDLGDVDFSNIDFGDLKLGDDFNPDDFLDDNDNPVDFGDEFRIDPDE
FT                   LK"
FT   gene            complement(703717..707277)
FT                   /gene="rpoB"
FT                   /locus_tag="BLA_0548"
FT   CDS_pept        complement(703717..707277)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoB"
FT                   /locus_tag="BLA_0548"
FT                   /product="DNA-directed RNA polymerase, beta subunit"
FT                   /EC_number="2.7.7.6"
FT                   /note="COG0085: DNA-directed RNA polymerase, beta
FT                   subunit/140 kD subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0548"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28847"
FT                   /db_xref="GOA:B8DWJ6"
FT                   /db_xref="InterPro:IPR007120"
FT                   /db_xref="InterPro:IPR007121"
FT                   /db_xref="InterPro:IPR007641"
FT                   /db_xref="InterPro:IPR007642"
FT                   /db_xref="InterPro:IPR007644"
FT                   /db_xref="InterPro:IPR007645"
FT                   /db_xref="InterPro:IPR010243"
FT                   /db_xref="InterPro:IPR014724"
FT                   /db_xref="InterPro:IPR015712"
FT                   /db_xref="InterPro:IPR019462"
FT                   /db_xref="InterPro:IPR037033"
FT                   /db_xref="InterPro:IPR037034"
FT                   /db_xref="InterPro:IPR042107"
FT                   /db_xref="UniProtKB/TrEMBL:B8DWJ6"
FT                   /protein_id="ACL28847.1"
FT                   /translation="MSQTTTNTTSVTARADQHDIDLHKASDRVNFGSIKEPIDVPYLLG
FT                   VQTDSFDWLVGNERWKKRVEEDEANGTNTVPHVSGLDEVFHEISPIENFAQTMSLTFSD
FT                   PYFEEPRHTVQECKEKDYTYSAPLYVNAEFENGETGEIKSQTVFMGDFPLQTPHGTFII
FT                   GGTERVIVSQLVRSPGVYFDRQPDRTSDKEIFGAKIIPSRGAWLEFEIDKRDFLGVRVD
FT                   RKRKQSAIVFLMAIGMTRSEIRDAFKDYPLVLDALEKETIDSEDAALVDLYRKIRPADA
FT                   ATPEAGRTLLDSFYFNTKRYDLARVGRYKINRKLGLEKDYNDRSLSREDIIATIKYLVT
FT                   LHAGDATFPGKRDGEDVELRVDVDDIDHFGNRRIRQVGELIQNQLRTGLSRMERVVRER
FT                   MTTQDAEAITPQSLINIRPVNATIKEFFGTSQLSQFMDQNNPLAGVTNKRRLSALGPGG
FT                   LSRDRASMEVRDVHPSHFGRMCPIESPEGPNIGLIGSLATFGRINPFGFIETPYRKVEN
FT                   GHVTDEVVYMTADREVEHVIAQANQKLDENGNFVEKEALVRDAAGEAEDVPVEMVDYMD
FT                   VSPRQMVSVGASLIPFLEHDEGHRALMGTNMQRQAVPLIKSERPLVGTGAEWRAAVDSG
FT                   DVILAEKPGVVIYVSADIIRVMNDDGTTSSYKLAKFQRSNQTTCYNQVPLIHDGERVEK
FT                   GTVLADGPATEKGEMALGKNLLVAFMPWNGYNYEDAVIISQRLVQDDTLSSIHIEEYEI
FT                   DARETKLGAEEITRDLPNVGEDAVANLDERGIIRIGAEVEAGDILVGKVTPKGETELTP
FT                   EERLLRAIFGEKSREVRDTSLRVPHGETGTVIAVKEITREDAEEDGDELPNGVNQMIRV
FT                   YIAQHRKITQGDKLSGRHGNKGVISRILPEEDMPFLADGTPVDIMLNPLGVPSRMNLGQ
FT                   VLELHLGWVAHAGWDISLDPDMEAEWKKMVPKGAEKGEPGTPVATPVFDGVRQDVLKGL
FT                   LSTTLTDRDGNKLVGDNGKATLFDGRTGEPYPKPISVGYMYMLKLHHLVDDKIHARSTG
FT                   PYSMITQQPLGGKAQFGGQRFGEMEVWALEAYGAAYTLHEMMTTKSDDVDGRVRVYGAI
FT                   VKGDNLPPAGIPESFKVLLKEMQSLSLNVEVLNAEGVAIDMKDEDDDPVSSSNDLGFNI
FT                   GARPDAAAKADQVADEPEYR"
FT   gene            complement(707511..708176)
FT                   /locus_tag="BLA_0549"
FT   CDS_pept        complement(707511..708176)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0549"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28848"
FT                   /db_xref="GOA:B8DWJ7"
FT                   /db_xref="UniProtKB/TrEMBL:B8DWJ7"
FT                   /protein_id="ACL28848.1"
FT                   /translation="MSSPQSPRRGTTRTTGGRKRMTAAERKRLYRRRRIVFFSALAVVL
FT                   ALAVFTVYSLVRGAVSVHGMAGASAAPALSRAEVPAAPQRSKVETCTPGDVDVQLVPDA
FT                   TSVGVGGSLDFTERVAYVGKSPEGCRMNTAADSLVLTITSGSDVIWRSDVCEAAYRPRL
FT                   FFADVTDEQKIAWNTNRTGTSCVADDQLPKVDRGTYVAQLSLKDDPKVQSKPQTITVE"
FT   gene            complement(708493..709557)
FT                   /gene="mutY"
FT                   /locus_tag="BLA_0550"
FT   CDS_pept        complement(708493..709557)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mutY"
FT                   /locus_tag="BLA_0550"
FT                   /product="probable A/G-specific adenine glycosylase"
FT                   /note="COG1194: A/G-specific DNA glycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28849"
FT                   /db_xref="GOA:B8DWJ8"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR003651"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="InterPro:IPR023170"
FT                   /db_xref="UniProtKB/TrEMBL:B8DWJ8"
FT                   /protein_id="ACL28849.1"
FT                   /translation="MVTAYCGQSTVRPCRSGQSAVRCCAMVSDMADASPRTKSRKRAQA
FT                   TPEQTVGERRARELERSARQALRELATWWQTSARDLPWRYGRTTPWGVLVCEVMSQQTQ
FT                   MSRVVPYWEAWMSQWPDAASLAAAEKSEVIRAWGRLGYPRRALRLQECAEVVARDYDDR
FT                   LPREYDELMALPSVGDYTASAVLSFAYGERVAVIDTNIRRALSRAFLGVESLGGSCTPL
FT                   ERALAWVVLPKAVEQSVLWNQAVMELGALVCTAKAPQCEQCPLQPQCEFVKAGMPGLGE
FT                   KRTRPRQRFHGTDRQVRGSILQALRALPAGGALTHAQAEGLCADAVQLDRCIASLDDDG
FT                   LIEILPGHAMRLPA"
FT   gene            709718..710227
FT                   /gene="yibK"
FT                   /locus_tag="BLA_0551"
FT   CDS_pept        709718..710227
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yibK"
FT                   /locus_tag="BLA_0551"
FT                   /product="probable RNA methyltransferase"
FT                   /note="COG0219: Predicted rRNA methylase (SpoU class)"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28850"
FT                   /db_xref="GOA:B8DWJ9"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR016914"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:B8DWJ9"
FT                   /protein_id="ACL28850.1"
FT                   /translation="MMTAREAAETPTTTPHLCYYSPRIPGNTGSAIRLCAVTGTILHLV
FT                   EPLGFNLRDTKLRRAGLDYHDMAHVVLHPNFEDLVESMPNSRIIAFTAHATKLYTEVEY
FT                   KPTDILLFGPEPGNIPDPMDIMAGPHVAEQVRLPMRPSLRSLNLTNCASIAIYEAWRQL
FT                   GFDGGQ"
FT   gene            complement(710352..711716)
FT                   /locus_tag="BLA_0552"
FT   CDS_pept        complement(710352..711716)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0552"
FT                   /product="conserved hypothetical protein"
FT                   /note="COG2848: Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28851"
FT                   /db_xref="InterPro:IPR007841"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8DWK0"
FT                   /protein_id="ACL28851.1"
FT                   /translation="MLNILEVHETNQMIEQEKLDVRTITMGIDLMDCVSTDLQTTCDLI
FT                   YNKITSYAKDLVSTGESIERDFGIPIVNKRITVTPIALVGASCCKTSADFVQIAHALDR
FT                   AAKTVGVDLIGGYSALVSKSMTPAEELLIRSLPAALSETDIVCSSVNVGSTKTGIDMNS
FT                   VELLGHIIKEIAEATADIDSYGCVKFVAFCNAPDDNPFMAGGFHGVTEGDAVINVGVSG
FT                   PGVVSRALDAAKGKDFEFLCETIKRTAFKITRVGQLVAQEASKRLGIPFGIIDLSLAPT
FT                   PAVGDSVGEVLEKIGLAQVGAPGTTAALAMLNDQVKKGGIMASSYVGGLSGAFIPVSED
FT                   KNMIDAAESGCLTIEKLEAMTCVCSVGLDMIAIPGDTTASTISGIIADEAAIGMVNQKT
FT                   TAVRVIPVVGKTVGQMANFGGLMGYAPIMPVNTASCEAFVTRGGRIPAPIHSFKN"
FT   gene            complement(711761..712033)
FT                   /locus_tag="BLA_0553"
FT   CDS_pept        complement(711761..712033)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0553"
FT                   /product="conserved hypothetical protein"
FT                   /note="COG3830: ACT domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28852"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR022986"
FT                   /db_xref="UniProtKB/TrEMBL:B8DWK1"
FT                   /protein_id="ACL28852.1"
FT                   /translation="MNKAIITVVGQDTVGIIARVCTYLSDHHTNVLDISQTIIDGFFNM
FT                   MMIVDYADADVSFETIVNDLEELGEEIGVRIRCQREEIFTKMHRV"
FT   gene            complement(712158..713000)
FT                   /locus_tag="BLA_0554"
FT   CDS_pept        complement(712158..713000)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0554"
FT                   /product="sortase-like protein"
FT                   /note="COG3764: Sortase (surface protein transpeptidase)"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28853"
FT                   /db_xref="GOA:B8DWK2"
FT                   /db_xref="InterPro:IPR005754"
FT                   /db_xref="InterPro:IPR023365"
FT                   /db_xref="InterPro:IPR042002"
FT                   /db_xref="UniProtKB/TrEMBL:B8DWK2"
FT                   /protein_id="ACL28853.1"
FT                   /translation="MIISMVIMLLVGVGLIVYPTVADAWNRHVSSRAIAGYSEQVANTP
FT                   KEDREAQIKKAREYNENLLGQGNARFLPNGEEKKVYNSILDVSGTGIMGYIAIPAIHAK
FT                   LPIYHGTDETVLQIAAGHYEGSSFPIGGESTHAVITGHTGLPSAQLFTGIDGMKKGDKF
FT                   SITVYDDVLTYEVEERQVVLPTNVKPLAIQEGRDLVSLVTCTPYGVNSHRLILTAHRIP
FT                   TPENKKEVEVNPERAIMSDIAITAFVIVGVAVCMATIVITQRRRRKTHAHGSHLRSRK"
FT   gene            complement(713287..714537)
FT                   /gene="galK"
FT                   /locus_tag="BLA_0555"
FT   CDS_pept        complement(713287..714537)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="galK"
FT                   /locus_tag="BLA_0555"
FT                   /product="galactokinase"
FT                   /EC_number="2.7.1.6"
FT                   /note="COG0153: Galactokinase"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28854"
FT                   /db_xref="GOA:B8DWK3"
FT                   /db_xref="InterPro:IPR000705"
FT                   /db_xref="InterPro:IPR006203"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR006206"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR019539"
FT                   /db_xref="InterPro:IPR019741"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/TrEMBL:B8DWK3"
FT                   /protein_id="ACL28854.1"
FT                   /translation="MTSVEFIEPMSDAEGAARAAELFKQAYGKEPAGVWAAPGRVNLIG
FT                   EHTDYNAGLCLPIALPHRTYIALSPRDDTSVRVVSDLASDVIAEADLDGLEAGGVDGWA
FT                   AYPVGVAWALRNAGFDGVQGFDAAFSSCVPLGSGLSSSAAMTCSTALALDDVYSQGFGD
FT                   TDEGRVTLINAAIASENDMAGASTGGLDQNASMRCTPDHAIRLDCRPGLSAVDSVQQEV
FT                   FDLEGHGLELLVLDTRAPHQLNDGQYAQRRATCEEAARILGVANLREVADLVNAQADPA
FT                   AALDGVLDRLDDETMRKRVRHVVTEIGRVDDFVRAFAEGDMQTAGELFNASHDSLRDDY
FT                   EVTVPELDVAVDVARDEGALGARMTGGGFGGSIIALVNAGESQRIAQAICDEFERRGFV
FT                   LPRALPAQASASAHRVQ"
FT   gene            complement(714604..715875)
FT                   /gene="galT"
FT                   /locus_tag="BLA_0556"
FT   CDS_pept        complement(714604..715875)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="galT"
FT                   /locus_tag="BLA_0556"
FT                   /product="galactose-1-phosphate uridylyltransferase"
FT                   /EC_number="2.7.7.12"
FT                   /note="COG1085: Galactose-1-phosphate uridylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28855"
FT                   /db_xref="GOA:B8DWK4"
FT                   /db_xref="InterPro:IPR001937"
FT                   /db_xref="InterPro:IPR005849"
FT                   /db_xref="InterPro:IPR005850"
FT                   /db_xref="InterPro:IPR036265"
FT                   /db_xref="UniProtKB/TrEMBL:B8DWK4"
FT                   /protein_id="ACL28855.1"
FT                   /translation="MSQTPNQPEFAHYQPGEYAAEHLRITPTTLSDGRDFFYLDDEPEY
FT                   VNGSRTRVLDDPRDLDYRFAPHLNAEGVEVKYAAPQMRRDPLTGDWIPMATARMNRPIT
FT                   AGAGATAKGNPLAARKPGDPYQDGEVPDTDYDVVVFENRFPSMVQVPGVPNEVRYVDGN
FT                   PLWQERPAAGRCEVICFDSDENGLPADLPVERLRTVVEAWAFRTAELSAIDGIEQVFPF
FT                   ENHGEEIGVSLAHPHGQIYAYPFIAPKLETELQHTQAYFERTGGNLLRDLMHAEIDAGE
FT                   RVIMRNHSWVAYVPAAARWPLEVHVQPLRDGILTLDQLNDAERWDLAQMYSTLLRRGNR
FT                   FFDKGDGKGMDLPYIAAWHQAPVRDARRENYRLNLQFFSFRRAANKIKYLAGSESGMAA
FT                   WVSDTTPELIAQRFHELGPVDIAD"
FT   gene            complement(715884..716705)
FT                   /locus_tag="BLA_0557"
FT   CDS_pept        complement(715884..716705)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0557"
FT                   /product="probable DeoR-type transcriptional regulator"
FT                   /note="COG1349: Transcriptional regulators of sugar
FT                   metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0557"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28856"
FT                   /db_xref="GOA:B8DWK5"
FT                   /db_xref="InterPro:IPR001034"
FT                   /db_xref="InterPro:IPR014036"
FT                   /db_xref="InterPro:IPR018356"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:B8DWK5"
FT                   /protein_id="ACL28856.1"
FT                   /translation="MCDNVRMISSQRQHLILGRLRTRGAVRITALSKEFGVSAMTIRRD
FT                   IAELADKGLLRRVHGGAVSTSTLLSEPLFSVKSQMDIGLKDAIAGEAIKFVSPGDVIAI
FT                   GGGTTAYVFAQHLLESPNANGITILTNSIPVAELVQALESKDVEVIVTGGVITRSNSLV
FT                   GPIADKVIASLRVNTVFLGTHSVSMPRGFLMPNSLEAATDMAMMDIADRTIILTDHTKW
FT                   SSTSLSLFAKFDQVDTVITDDGLDPDSVAKTRDLVKELVLAHQIETEEESE"
FT   gene            complement(716823..717854)
FT                   /locus_tag="BLA_0558"
FT   CDS_pept        complement(716823..717854)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0558"
FT                   /product="putative glycosyl transferase"
FT                   /EC_number="2.4.1.83"
FT                   /note="COG0463: Glycosyltransferases involved in cell wall
FT                   biogenesis"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28857"
FT                   /db_xref="GOA:B8DWK6"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR039528"
FT                   /db_xref="UniProtKB/TrEMBL:B8DWK6"
FT                   /protein_id="ACL28857.1"
FT                   /translation="MAQVNSGHRVCVVMPTYNERDNLEPTLTDLFLRNAGVDVLIVDDN
FT                   SPDGTGTLADVISRVTRLPQDLNVEHNENDVLRDVSFADEDSDSSLYSDTQVSTQDLKI
FT                   ADRLASCTMDSRVFVLHRPGKQGLGTAYIQGFEWALGHRYDIVCEMDMDGSHRPQDLRA
FT                   IIDVLERHPQVDLVLGSRRVPGGSTQDWPWYRDVISRAGSQYARVMLGLKVRDMTSGFR
FT                   AYRSRILRQIDLDGIDANGYVFQIDMTRRVIAAGGHVVEVPIVFPDRTKGDSKMDGSIV
FT                   REAMRKVTQWGFTRMQQTILHNNERMERQVEDDLELPGQLMREDAGLAQDDPEQSEEYM
FT                   ERE"
FT   gene            718161..719177
FT                   /locus_tag="BLA_0559"
FT   CDS_pept        718161..719177
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0559"
FT                   /product="dihydroorotate dehydrogenase-like protein"
FT                   /EC_number="1.3.98.1"
FT                   /note="COG0167: Dihydroorotate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28858"
FT                   /db_xref="GOA:B8DWK7"
FT                   /db_xref="InterPro:IPR005719"
FT                   /db_xref="InterPro:IPR005720"
FT                   /db_xref="InterPro:IPR012135"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:B8DWK7"
FT                   /protein_id="ACL28858.1"
FT                   /translation="MIRFCQITGKMPPLMWLCRTMLNYTDPILETNVMGINFANPFGLS
FT                   AGLDKNCDMAAVLDHAGFGFETVGSTTSRPCAGNPRPWFHRLPEYDSMMVHVGLANDGS
FT                   DVVIERAEDAWRRTQSMQLSVSIARTNDDQVGDLNEGIEDYCISMERAAGRTAMVEVNV
FT                   SCPNTTVGEPFTESAENLDKLFAALDRIERPQPTLVKMPLNKPWPQFKEFLDVLAAHNV
FT                   QGVTIANLQKDRTGLDDIPKDWLGGLSGGPCTVASTELIRRTYAEYGDRFAIAGVGGVF
FT                   TPEQAYEKIRAGSSLIMFISSLMYRGPQQITVLKRGLAKLLRRDGFGSVAEAVGVDA"
FT   gene            complement(719476..720606)
FT                   /gene="baiC"
FT                   /locus_tag="BLA_0560"
FT   CDS_pept        complement(719476..720606)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="baiC"
FT                   /locus_tag="BLA_0560"
FT                   /product="probable NADH-dependent flavin oxidoreductase
FT                   YqjM"
FT                   /EC_number="1.6.99.1"
FT                   /note="COG1902: NADH:flavin oxidoreductases, Old Yellow
FT                   Enzyme family"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28859"
FT                   /db_xref="GOA:B8DWK8"
FT                   /db_xref="InterPro:IPR001155"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:B8DWK8"
FT                   /protein_id="ACL28859.1"
FT                   /translation="MGKSKDSKKVKAQQPTLFTPFTLRGITARNRIWMPPMDTYSAFAL
FT                   DGRPGNFHYQHYVSRAMGGFGLIIVEATAVTPDGRISPCDLGLWEDSQIDSYRWIAQGM
FT                   KDAGAVPAIQLNHAGRKGSTSCFAIRTDSGYVSPELGGWQTVAPSELPFGDLPAPRQLT
FT                   VDEIHDIVNRFRDAAWRAMEAGFEVIEIHAAHGYLLSEFLDPLVNDRDDEYGGSLENRI
FT                   RIVIEVADAIRSVIRGDMPLFARISATDWAEGGWDLDQSIVLAKALKEHGVDLVDVSTG
FT                   GILPNVTIPTKPGYQVPFSEQIRKKADVPVTAVGLITKPKQAARILAKGEADAVEIGRA
FT                   ALREPYWPLRAGFKLGEPTDLLPYPPQYVRGAWRNE"
FT   gene            complement(720899..723102)
FT                   /pseudo
FT                   /locus_tag="BLA_0561"
FT                   /note="frameshift: possible penicillin-binding protein"
FT   gene            complement(723233..723994)
FT                   /locus_tag="BLA_0563"
FT   CDS_pept        complement(723233..723994)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0563"
FT                   /product="probable transcriptional regulator with cyclic
FT                   nucleotide-binding domain"
FT                   /note="COG0664: cAMP-binding proteins - catabolite gene
FT                   activator and regulatory subunit of cAMP-dependent protein
FT                   k"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0563"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28860"
FT                   /db_xref="GOA:B8DWK9"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR012318"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B8DWK9"
FT                   /protein_id="ACL28860.1"
FT                   /translation="MNQSAERMPSGAMSDEPAGMGDARERRNPLLETALFKQVSEEQAR
FT                   ELVPYLHHEEYDKGEYIFTEGDTDQRMYVIQEGRVKLTRQSVDKRVQLLSIHTRGELLG
FT                   EIPVFDPQGGPRTANAVAMVDGTQVVWLDHDALFAWLSKYPGVAVDMLQVLANRMRANN
FT                   ERIADLVFSDVPGRLAKTLLSLASRFGKPVEEGLQVPHDLTQEEMAQLVGSSRETVNKA
FT                   LMDFANRGWIARNGRTIIIYQPGALIRRSQR"
FT   gene            complement(724034..725197)
FT                   /gene="snoP"
FT                   /locus_tag="BLA_0564"
FT   CDS_pept        complement(724034..725197)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="snoP"
FT                   /locus_tag="BLA_0564"
FT                   /product="probable lipoate protein ligase"
FT                   /note="COG0095: Lipoate-protein ligase A"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28861"
FT                   /db_xref="GOA:B8DWL0"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="UniProtKB/TrEMBL:B8DWL0"
FT                   /protein_id="ACL28861.1"
FT                   /translation="MRSGEVKIPGGKLVRVTLQGDEVRGWHATIDGDFFMEANAGSVLG
FT                   RAQSAIDAHLPELPDDWEHWGSADYLAFYRALSGELRGVIGDTLIGANGEAIALAVVRA
FT                   LVGGGARESAQTAEREFERIREARATRQGERAQSGDEPAPMLIGLQDAKRRWARMNPQT
FT                   VVDIPRMPAEQMQVDELWATQVANGERQATLRIWDWAAPAVVCGKFQSIADEVDLEYAK
FT                   EHGIEVVRRDTGGGAMFIEPQNTITYSLYVPEPVVAGLDARQCYQFCDMWLLEALAACG
FT                   VRAHFAGLNDIASAAGKIGGAAERRFPASGEGPGCLLHHDTLAYAMNTEHLQHVLRPSK
FT                   EKMSDKAVKSASKRVDPMNSQTSCTRAQIVDCMLETASRFGVVGNTI"
FT   gene            complement(725294..725758)
FT                   /locus_tag="BLA_0565"
FT   CDS_pept        complement(725294..725758)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0565"
FT                   /product="TM2 domain-containing protein"
FT                   /note="COG2314: Predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0565"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28862"
FT                   /db_xref="GOA:B8DWL1"
FT                   /db_xref="InterPro:IPR007829"
FT                   /db_xref="UniProtKB/TrEMBL:B8DWL1"
FT                   /protein_id="ACL28862.1"
FT                   /translation="MSDPNGYQPQGGDQQNNGVSGAAQAPQYTQPAQNYAAPQYTQSQG
FT                   GYNGQYQDPNAYAQQNYTYAQPPAAYPTYLPRNKYVAAALALFFGIFGLHNFYLGYTGK
FT                   GVAQVLISVLTFGIGAIAVMIWAIVEAIQILTADYGTEHHRDARGVELQD"
FT   gene            complement(726130..726264)
FT                   /locus_tag="BLA_0566"
FT   CDS_pept        complement(726130..726264)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0566"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0566"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28863"
FT                   /db_xref="UniProtKB/TrEMBL:B8DWL2"
FT                   /protein_id="ACL28863.1"
FT                   /translation="MCCNCNEEAPFNYSNGFQTYARPTSGPYIATTHIPSEYGPVYVD"
FT   gene            complement(726340..727380)
FT                   /gene="leuB"
FT                   /locus_tag="BLA_0567"
FT   CDS_pept        complement(726340..727380)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="leuB"
FT                   /locus_tag="BLA_0567"
FT                   /product="3-isopropylmalate dehydrogenase"
FT                   /EC_number="1.1.1.85"
FT                   /note="COG0473: Isocitrate/isopropylmalate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0567"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28864"
FT                   /db_xref="GOA:B8DWL3"
FT                   /db_xref="InterPro:IPR023698"
FT                   /db_xref="InterPro:IPR024084"
FT                   /db_xref="UniProtKB/TrEMBL:B8DWL3"
FT                   /protein_id="ACL28864.1"
FT                   /translation="MTQNAKQYTIAVIPGDGIGKEVTPWAQQALEKATEGVATFEYEPF
FT                   DLGAERYLRDGEILPDEDLERIKSTDAILLGAVGDPRIKAGILERGLLLKLRFALDQYV
FT                   NLRPSKLYPGVESPLANPGEIDFVVVREGTEGLYCGAGGAIRRGTEHEVATEVSINTAY
FT                   GVERVVRYAFELAMKRRKHVTLVHKKNVLVNAGDMWQNIVNKVAAEYPEVQHDYSHIDA
FT                   ATIYLVTDPSRFDVILTDNLFGDILTDEAGAVVGGVGYSASGCINASNEYPSMFEPIHG
FT                   SAPDIAGQGIANPTAAILSAAMLLRHLGFDDAAAKIDAAVELDIAENGSRQRSTDEVGR
FT                   DILARL"
FT   gene            complement(727548..730013)
FT                   /gene="ptrB"
FT                   /locus_tag="BLA_0568"
FT   CDS_pept        complement(727548..730013)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ptrB"
FT                   /locus_tag="BLA_0568"
FT                   /product="protease II"
FT                   /EC_number="3.4.21.83"
FT                   /note="COG1770: Protease II"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0568"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28865"
FT                   /db_xref="GOA:B8DWL4"
FT                   /db_xref="InterPro:IPR001375"
FT                   /db_xref="InterPro:IPR002470"
FT                   /db_xref="InterPro:IPR023302"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B8DWL4"
FT                   /protein_id="ACL28865.1"
FT                   /translation="MEVCGCPFLRKGGCAGIIFGLMTGMHVFPKPPEAKQVPSVRTFHG
FT                   DTFTDSYEWMRDKDSADLKSYVAAENAYTSARTAGLANLRKTLFDEFRSHVQETDMSVP
FT                   TRLDGYWYYARTQEGKQYGVQCRMPIRGEDDWTPPEINANDAPGVIPGEQVILDANTEA
FT                   EGHDFFQIGGMDISKDGTWLLFGVDTSGDEQYDFRIRNLDTGEQLPDELDGLAAACFTP
FT                   DGRYVFATLLDDAQRPYAIRRHKVGEPVERDVIVYEEHDEKFWVGIGLSFDERNLVIGT
FT                   GSKTTTEVLMLPTATPEGEFQAFIPRQEGVEYDVSFAVFEHAGEHGEDLPVAIVYHNLA
FT                   NPNFEIDVIDMSAARPPYRIGDGVRIVQGSPYGSEDGEKVIAGASAMPVGTPYDDATNP
FT                   QILRGVRGLAVEGIAMHEHFVALSYRANGLPKLAVMSKQQAAQDFLARRPWQFAEVNVP
FT                   ELDGDWDGASDDAAVNPPQLKDFEGSSARLYSIGTAGNPSYEAPRMRYMVTGYTRPGEL
FT                   REFDPRTGEDVLLKRANVLGSFDARDYVERRIWVQVRDGEQVPVSLVWRRDCVRGRMPM
FT                   FVIGYGAYEISSDPAFSVSRLSMLDRGVLYVVPHVRGGGEMGRAWYEMGRRRNKKHTFE
FT                   DFIDVTAAIQDCGLADRARTVANGGSAGGLLMGAVANMAPERFAGIEADVPFVDALTTI
FT                   LDPTLPLTVTEWDEWGDPLHDAETYRYMKTYTPYENAPAPGEGGARWPDGTPVTAFPKI
FT                   FVTTSMNDSRVMVVEPLKWVARLQAAGLDAIIKIEAEAGHGGTSGRYAQWKQICYENAW
FT                   VLAAMGIEE"
FT   gene            complement(730169..731632)
FT                   /locus_tag="BLA_0569"
FT   CDS_pept        complement(730169..731632)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0569"
FT                   /product="ATPase component of ABC transporters with
FT                   duplicated ATPase domains"
FT                   /note="COG4850: Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0569"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28866"
FT                   /db_xref="InterPro:IPR019236"
FT                   /db_xref="UniProtKB/TrEMBL:B8DWL5"
FT                   /protein_id="ACL28866.1"
FT                   /translation="MLEAALAQVKREQAERARLAADGDGSTVATQGRTVRSGEGPTDAD
FT                   FDDTQHAGSAETRVITGIANGQAETETPERQWRAPAVALRTTSAATSTDDMPTVAVPLG
FT                   SLSAAKAPAGRTRLRRNPKLVSSIKRVLRKAITWTFGLWIRFSTAIAKQLHWFPMVKPY
FT                   VGYGTEEYSRLVCRTILAPADGQPNKPMRGIHAMLEVPAPGQCVQIDIDGVPLRTVQVG
FT                   TMEVYNPVDSARSVTMDYSVSDSAGYLDLLAEHRLEPGVHMVSCKVTRRPAVEAELFTI
FT                   PSTAKVGVISDVDDTCMVTQVPTLWKAVYNMLFLSPHKRASVPGMAVMYNKIASMFPGA
FT                   PFFYLSTSPWNVENSIRNFLKDYGFPDGPLLLRDLDPRPKTFVPSGVQHKLEYAEQLME
FT                   DFPDMKFILIGDDGQKDPTTYAEIARRYPGRVLAIGIRQLSPKESGGFGTMSGFSTTQP
FT                   VPVTDVPVFTGTTGSNIMKTMLPYLRQFM"
FT   gene            complement(731737..732147)
FT                   /gene="gcvH"
FT                   /locus_tag="BLA_0570"
FT   CDS_pept        complement(731737..732147)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gcvH"
FT                   /locus_tag="BLA_0570"
FT                   /product="glycine cleavage system H protein"
FT                   /note="COG0509: Glycine cleavage system H protein
FT                   (lipoate-binding)"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0570"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28867"
FT                   /db_xref="GOA:B8DWL6"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR002930"
FT                   /db_xref="InterPro:IPR003016"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR017453"
FT                   /db_xref="InterPro:IPR033753"
FT                   /db_xref="UniProtKB/TrEMBL:B8DWL6"
FT                   /protein_id="ACL28867.1"
FT                   /translation="MAEENEQGTHLDVPDFLQYSHDHVWVDESVTPAVLGITEFAANKM
FT                   GDIVFVDLPEVGMRVEAGDELVQIESAKAVEPMISPVAGVVRYVNSETEDDGAVINDDP
FT                   YGEGWIVKIELDDDEPDLLSAGEYAKFIAQQQ"
FT   gene            complement(732211..733320)
FT                   /gene="nudC"
FT                   /locus_tag="BLA_0571"
FT   CDS_pept        complement(732211..733320)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nudC"
FT                   /locus_tag="BLA_0571"
FT                   /product="NADH pyrophosphatase"
FT                   /EC_number="3.6.1.22"
FT                   /note="COG2816: NTP pyrophosphohydrolases containing a
FT                   Zn-finger, probably nucleic-acid-binding"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0571"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28868"
FT                   /db_xref="GOA:B8DWL7"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015376"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="UniProtKB/TrEMBL:B8DWL7"
FT                   /protein_id="ACL28868.1"
FT                   /translation="MFAPLALTQALPYLPLAQGDIDYQVERRADPQLIEQVLQMPSTCV
FT                   LLCRKGKVAVPFGQHNMAQLAASRMRLATLPGSYVARALEHGNNGVVAMYLGRYKGAHD
FT                   EHAIALDLTAVEEGEELRRVEERAAAAGHAVDAAFGDDVDARESADSNAVNMFEQAVER
FT                   FDWVDLRMFAPHASSREIGQAVTMLSLANWHDMQRHCPHCGAPTEPAMSGWAQRCTSES
FT                   DDHRILFPRVEPAVICTVVDAKDRLLLQHNRAWKHSNLFSVSAGFVETGENLEHACRRE
FT                   TMEETGIRVGEVKYLGSQPWPFPFSLMMGFKAQALSNDIHVDGDETIAARWVTRDEYTN
FT                   LLVTGEIEAPGKATIARVMIEEWYGRELD"
FT   gene            complement(733320..734246)
FT                   /locus_tag="BLA_0572"
FT   CDS_pept        complement(733320..734246)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0572"
FT                   /product="possible alpha beta hydrolase"
FT                   /EC_number="3.1.1.24"
FT                   /note="COG0596: Predicted hydrolases or acyltransferases
FT                   (alpha/beta hydrolase superfamily)"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0572"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28869"
FT                   /db_xref="GOA:B8DWL8"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR000639"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B8DWL8"
FT                   /protein_id="ACL28869.1"
FT                   /translation="MADDHARELPVIANHVIREGNGIPLVLVHGFPVDSRMWGRCAMAL
FT                   MELSDADELVQYPIWAPDMPGAGESPVPTAAQSGRENEDGSLPDGLDRIADAYVALLND
FT                   AGYTQAIWAGLSMGGYVVLGIQRRHPQAVAGIALLDTKGDADSDQAHASRIAIAKECVE
FT                   RQTTEPVMFFVDVHEGDSSVKKSAAYIDQFSQWIREQQPDGVAWRERMAAARPDLNDEF
FT                   AKITAPAAVICGEEDPSSAPAVMRPLAERMVNTTVVMTEIEDCGHFSAWERPETVARAL
FT                   HELVSRVPAAAGADPAAADAAIAAREA"
FT   gene            complement(734326..734928)
FT                   /locus_tag="BLA_0573"
FT   CDS_pept        complement(734326..734928)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0573"
FT                   /product="ADP-ribose pyrophosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0573"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28870"
FT                   /db_xref="GOA:B8DWL9"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR032582"
FT                   /db_xref="UniProtKB/TrEMBL:B8DWL9"
FT                   /protein_id="ACL28870.1"
FT                   /translation="MPDDGDFDAGRSRGEFDHITPEDITRGTGNPPGWLGADDIADLRS
FT                   RMPIAYVEIVPVRVDDFGRVTQIGSLLRVANDQSIVERTLIAGRVLYHESLREAIARNI
FT                   SKDMGELALPVLPQTLTPFTVAEFFPTPGVSPYFDARQHAIALCYVVPIAGDCKPQDET
FT                   LDVEWVDPHGPQITEFIEQMNDGHGTIVRQALAWVNL"
FT   gene            735126..735521
FT                   /gene="trx"
FT                   /locus_tag="BLA_0574"
FT   CDS_pept        735126..735521
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trx"
FT                   /locus_tag="BLA_0574"
FT                   /product="thioredoxin"
FT                   /note="COG0526: Thiol-disulfide isomerase and thioredoxins"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0574"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28871"
FT                   /db_xref="GOA:B8DWM0"
FT                   /db_xref="InterPro:IPR005746"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B8DWM0"
FT                   /protein_id="ACL28871.1"
FT                   /translation="MAVKELTSADFEQAVKGNEIALFDFFATWCGPCKAFSPIFDKVAD
FT                   ENPDIFFGKIDIDKNQELANAANVQAVPTLMIVKKGHVIYQEAGALREADLNDLIGQAK
FT                   ALDVEAALAAAKAAGTDQDELIEEHDA"
FT   gene            735921..736880
FT                   /locus_tag="BLA_0575"
FT   CDS_pept        735921..736880
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0575"
FT                   /product="secreted protein"
FT                   /note="COG3583: Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0575"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28872"
FT                   /db_xref="InterPro:IPR007137"
FT                   /db_xref="InterPro:IPR011098"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:B8DWM1"
FT                   /protein_id="ACL28872.1"
FT                   /translation="MAGVVATQSMYSRAEAQPTPSATAYSITESNHAASRGNAREAMDG
FT                   DTSYVTVKVNGKSRVVLGQDFTDVKSVLDAGDITLEPGDQVNPSLTTKVDESTTISIER
FT                   QGAKMETTESKIPFNTVKKDDPSLPKGTEKVQTEGEEGILEKTNLVTRTGDKVVSSNTF
FT                   ATWVKKAPVEKVVLVGTGNPQPAATSAPAQTSNNSNTNANNSSQQAAASSIGSTAPVGE
FT                   MQQWAHDYLLANGGSEGDFTATVYIISRESGWNVNATNPSSGAYGLAQALPGSKMASHG
FT                   ADWQSNYQTQLKWFWDYCKGRYGSVQGAYNFWQANHWY"
FT   gene            complement(737157..738803)
FT                   /gene="rfbP"
FT                   /locus_tag="BLA_0576"
FT   CDS_pept        complement(737157..738803)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rfbP"
FT                   /locus_tag="BLA_0576"
FT                   /product="undecaprenyl-phosphate sugar phosphotransferase"
FT                   /EC_number="2.7.8.6"
FT                   /note="COG2148: Sugar transferases involved in
FT                   lipopolysaccharide synthesis"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0576"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28873"
FT                   /db_xref="GOA:B8DWM2"
FT                   /db_xref="InterPro:IPR003362"
FT                   /db_xref="InterPro:IPR017475"
FT                   /db_xref="UniProtKB/TrEMBL:B8DWM2"
FT                   /protein_id="ACL28873.1"
FT                   /translation="MRDTSRWTAGSSMQTQEIRIVTGHEQNHRAESKESTRQQLPYEPI
FT                   TFYNTSFEESGKKRANHLCNAPRWRFLFIFTIAVVDVISMLIAVVGVLLVNREAYTTIE
FT                   RYMPVWAFIVLYCIVWLTCLVWRGTYHRHIMAEGYELYVEVLNATIATIVVFCFIVFML
FT                   HLDYPRTILLVAPIFGMVLALFGRLFLRLMLHRKREEGEYKYNTVIIGSSAGINSVLKL
FT                   FDANRNWGYRAVAICPIEKVPDRDDAYIMTDFVPEEGIAEKYAVQTVPLNSNFPRKLQQ
FT                   IGVQEVFVADVLDRDSKLLHGIALAIESLGMELALSVALADVAGHRLYLHNTTEQPILL
FT                   ASLPQYRATTFLLKRIFDIVLSSLALIISSPIMLGVAIAIKLDDGGPIFFKQTRIGLHG
FT                   RRFQMYKFRSMVTNAEEVKKKLMQETGQTDRFIFKMKDDPRITRVGRFIRRTSLDEFPQ
FT                   FLNVLKGDMSMVGPRPALPEEVARYGSLYSARLLVKPGITGPWQISGRSDLTEEQSEYL
FT                   DVSYIENWSITGDIAILIKTVWVVIRGTGAY"
FT   gene            complement(739030..739479)
FT                   /locus_tag="BLA_0577"
FT   CDS_pept        complement(739030..739479)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0577"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0577"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28874"
FT                   /db_xref="UniProtKB/TrEMBL:B8DWM3"
FT                   /protein_id="ACL28874.1"
FT                   /translation="MSSLQGFEVVSPNTASGRSVLTVTKNYARLNKNAVLELGRPEFIE
FT                   FFINPTTKQFAFKACEESNPNAIPFFIPGKTTASVTLNQQFVLDAMGPYFEFPEVEDDQ
FT                   EAYAQIKGTLLNSEDMLVFNAAKAEQGVMKKRGRKKGQKVKVSEA"
FT   gene            739996..741330
FT                   /locus_tag="BLA_0578"
FT   CDS_pept        739996..741330
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0578"
FT                   /product="membrane protein-like protein"
FT                   /note="COG4713: Predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0578"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28875"
FT                   /db_xref="GOA:B8DWM4"
FT                   /db_xref="InterPro:IPR018674"
FT                   /db_xref="UniProtKB/TrEMBL:B8DWM4"
FT                   /protein_id="ACL28875.1"
FT                   /translation="MRESWKMMALFLIISMVEGIAFITTTAPLTMADPDMHLPSTYALA
FT                   TGQSFNITRAPESHRQYDPRTSEVPSSMPVGGRQLLTGEARYLQGSVNGAKNALVESIN
FT                   PFDLTRNDEYATQCDRLNNLAEGERIITTPTRSNQYMFFAYIPQAIGMKFGFLTHANPS
FT                   TCINYARASNLVCYLLLFLLAIAVIPTAKGIIALLGMLPLPVFCSSTLMTDGTLFAAVA
FT                   LFIAVCVRLMQRERRLNNWQVAALTVGTCLICFLKYVYIPIILLPWLACKALSGKQKVW
FT                   YTASTVLVVGATVLCWQKFFGYNPERVEGLYAYNFNAALHNPFGTTFRILANVFLTTFN
FT                   MVQSNPTLIVCLILLLIAWMFGQDARIAVPRRTTMQVYTLVGFIVFATLFLMYIPFLLT
FT                   WTLPSESLRLDGLQVRYYYPILPLLVIPFIYRYKTGTKDLVTVHQ"
FT   gene            complement(741314..742321)
FT                   /locus_tag="BLA_0579"
FT   CDS_pept        complement(741314..742321)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0579"
FT                   /product="possible glycosyltransferase"
FT                   /note="COG0463: Glycosyltransferases involved in cell wall
FT                   biogenesis"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0579"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28876"
FT                   /db_xref="GOA:B8DWM5"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:B8DWM5"
FT                   /protein_id="ACL28876.1"
FT                   /translation="MTTHQTTAVLIPCLNEEQTIGKVVADFRRELPDAVIYVYDNASDD
FT                   RTSQVAADAGAIVRMAPERGKGNVLRRMLRDIDADRYVLVDGDDTYPAEDVHTLLDTLD
FT                   QGWDMVVGDRLSSTYFTENKRPFHNTGNRLVRSAINSTFHAQIRDVMSGYRVFDNLFAK
FT                   AYGVMSNGFEIETEMTIFALDRKLRVTEVPIQYRDRPEGSTSKLSTFSDGAKVLNLIFR
FT                   LAYENRPLPFFGTLGGIIGGVGLGLALWVCIEFAQTGMVRRFPLLIGSTMLMIIGVIAV
FT                   FTGLVLAVFARKDRSRFAFAAQTYIAASGRHPSVSEPYRACVDEVSHEPVTDGQ"
FT   gene            complement(742399..744075)
FT                   /locus_tag="BLA_0580"
FT   CDS_pept        complement(742399..744075)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0580"
FT                   /product="methyl-accepting chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0580"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28877"
FT                   /db_xref="InterPro:IPR025101"
FT                   /db_xref="UniProtKB/TrEMBL:B8DWM6"
FT                   /protein_id="ACL28877.1"
FT                   /translation="MQAMMVKNYELGSIDTIRRTAMSGNVKELPNAVSKMQENTRKANR
FT                   ITHNGLWNFIGSWPGMGSNIGAAQDLTQIVADVSQDVVPKYIDIASNIMSDKLFSNGQV
FT                   NIKPVTAQYVNFVEANSDLMSQLARINDIPEPSIGVVRNLVNMAKGYVGTADGLLKQAE
FT                   TIMQDLPSYLGYKEPQTYAVMAMTPAEMRMSGGLIGAIGTLTLNKGKIEIGEFLPNDAY
FT                   VKEGGADVDFDTKRIFMNDGPLYMTYDVRDLANFTDTEMTANAFLSLWKRMPWGEKTTL
FT                   NGIIMVDPVVVQALVKVTGDVKLPDGTVLNGNNTAQFMMNTVYTEHEPEETNAYFGIVA
FT                   KACVGTLMKHMDMKTIGSLAKDLRTLAKERHLAMYSFTPSLEDLIKAAGFSATLPTDKV
FT                   NPTLGVYLTEQNPSKMGWYIKRSTKIKQICTDSAPYKYQVEYTLENTLKEDEVGKLSWY
FT                   ITGQFPYNEGASLDKVFFYPPYGGELSNFKVQGTGSVPAMDSFNAAIMYRSLAQVRPEQ
FT                   KVTYTFDVTTSKQAASRLAVDQTPMGTENTNVEYLNSCPVN"
FT   gene            complement(744432..745322)
FT                   /gene="rfbA"
FT                   /locus_tag="BLA_0581"
FT   CDS_pept        complement(744432..745322)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rfbA"
FT                   /locus_tag="BLA_0581"
FT                   /product="glucose-1-phosphate thymidylyltransferase"
FT                   /EC_number="2.7.7.24"
FT                   /note="COG1209: dTDP-glucose pyrophosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0581"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28878"
FT                   /db_xref="GOA:B8DWM7"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR005907"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:B8DWM7"
FT                   /protein_id="ACL28878.1"
FT                   /translation="MKGIILAGGSGTRLYPLTTVTSKQLLPVYDKPMIFYPLSALMMAG
FT                   IRDILIISTPKDLPNFERLLGDGSRYGISLQYKVQPSPDGLAQAFLLGEDFIGDDACAL
FT                   VLGDNIFYGNGLGRQLRKAAALEHGATVFGYYVDDPERYGVVEFDKEHKAVSIVEKPEH
FT                   PASNYAVTGLYFYDNRVVDFAKQVKPSPRGELEITDLNRMYLDDGSLHVQTLGRGYAWL
FT                   DTGTMDSLFEAGEFVRTVEHAQGLPISVIEEIAYENRWIDRDQLLAAAERYGKSPYGKH
FT                   LLDVAEHRFLSTIDD"
FT   gene            complement(745336..746787)
FT                   /locus_tag="BLA_0582"
FT   CDS_pept        complement(745336..746787)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0582"
FT                   /product="dTDP-4-dehydrorhamnose reductase"
FT                   /EC_number="5.1.3.13"
FT                   /note="COG1091: dTDP-4-dehydrorhamnose reductase"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0582"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28879"
FT                   /db_xref="GOA:B8DWM8"
FT                   /db_xref="InterPro:IPR000888"
FT                   /db_xref="InterPro:IPR005913"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR029903"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B8DWM8"
FT                   /protein_id="ACL28879.1"
FT                   /translation="MEFEKELKVTETNIPGLLVFDLPVHGDNRGWFKENWQKAKMTALG
FT                   LPKDFQPVQNNVSFNAKRGVTRGIHAEPWDKFISLATGEIFGAWVDLRPGDTFGQVYTT
FT                   RLDPSKAIYVPRGVGNSFQALEDGTAYTYLVNAHWSLEQKKTYTFVNLADPELNIQWPI
FT                   PLEQAELSEADLHHPMLKDAKPMDPKRTLVTGANGQLGQSIRKYVEEHDLKGFEFTDID
FT                   EFDFSDPAAYEGYDWSLYGTIINAGAFTAVDKAETPEGRVTAWKANALGPALLAKVATE
FT                   HNLTLVHVSSDYVFDGTAKVHDEDEAFSPLGVYGQTKAAGDIAVANAPKHYIVRSSWVI
FT                   GNGHNFVKTMMMLSNKVSDPNDALNEVTVVDDQYGRLTFTDDMAAAIFHLLDDEDPYGT
FT                   YDLTGSGDVVSWAQIAAEVFAMTNGNGDKVRPISTEQYFESAKAPVSPRPTNSTLDLAK
FT                   IEETGYETTDWHDSLKAYVEVELKK"
FT   gene            complement(746862..747905)
FT                   /gene="rfbB"
FT                   /locus_tag="BLA_0583"
FT   CDS_pept        complement(746862..747905)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rfbB"
FT                   /locus_tag="BLA_0583"
FT                   /product="dTDP-glucose 4,6-dehydratase"
FT                   /EC_number="4.2.1.46"
FT                   /note="COG1088: dTDP-D-glucose 4,6-dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0583"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28880"
FT                   /db_xref="GOA:B8DWM9"
FT                   /db_xref="InterPro:IPR005888"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B8DWM9"
FT                   /protein_id="ACL28880.1"
FT                   /translation="MVVAKLMPMTDAFIPKNIIVTGGCGFIGSNFVHYVYNNHPDVHIT
FT                   VLDALTYAGNLENIKPILGDRVEFVHGNICDAQLLDELVPGHDAIVHYAAESHNDNSIA
FT                   NPEPFVKTNVEGTFRLLEAARKYDVRFHHISTDEVYGDLALDDPAKFTEETPYHPSSPY
FT                   SSTKASSDMLVRAWHRTYGLRTTISNCSNNYGPYQHVEKFIPRQITNIIEGIRPKLYGD
FT                   GLNVRDWIHTEDHSSAVWTILTTGRLGETYLIGANGERNNLTVLHDILRVMGQPEDAFD
FT                   WVKDRPGHDRRYAIDSTKLQTELGWRPTHTDFESGLRQTVQWYIDNPQWWEPAKAATEA
FT                   KYKAQGQ"
FT   gene            748037..749002
FT                   /gene="cps2F"
FT                   /locus_tag="BLA_0584"
FT   CDS_pept        748037..749002
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cps2F"
FT                   /locus_tag="BLA_0584"
FT                   /product="putative glycosyl transferase"
FT                   /note="COG0463: Glycosyltransferases involved in cell wall
FT                   biogenesis"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0584"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28881"
FT                   /db_xref="GOA:B8DWN0"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:B8DWN0"
FT                   /protein_id="ACL28881.1"
FT                   /translation="MQPEIEILMATYNGAEYIEQQIESIQQQSVPNWKLSISDDCSSDG
FT                   TLGILQRMANHDTRINIVSQGVKYGSPQANFTFLMSQASGQYVFLADQDDIWHTNKLEL
FT                   FMQRMHNAEARYGKNAPILAFSDLVVVDANNHVIAPSFLRFIGRNPHRTQLNELLAQNL
FT                   VTGCASAMNTALLNVIQSWDPENANRMIMHDWCYALIAATLGHVVYVDEATVNYRQHGD
FT                   NAMGAHSYSALKTFMSLVIHRNSIRRQRVTHMNHMLDQATYIRDALSDLQQTRNLIILD
FT                   QYCALPQMTKRQRTHTLFAYEFWPNKFMDRIVQLATIRAL"
FT   gene            complement(749004..750443)
FT                   /gene="wzx"
FT                   /locus_tag="BLA_0585"
FT   CDS_pept        complement(749004..750443)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="wzx"
FT                   /locus_tag="BLA_0585"
FT                   /product="flippase Wzx"
FT                   /note="COG2244: Membrane protein involved in the export of
FT                   O-antigen and teichoic acid"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0585"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28882"
FT                   /db_xref="GOA:B8DWN1"
FT                   /db_xref="InterPro:IPR002797"
FT                   /db_xref="InterPro:IPR029303"
FT                   /db_xref="UniProtKB/TrEMBL:B8DWN1"
FT                   /protein_id="ACL28882.1"
FT                   /translation="MKQPKIRSVKFNVVMNTILTTSTFLFPLITVPYVSRVLGPDNNGI
FT                   VSWAFTFVGYFSLVALLGFNMYGTRECAKLRDDREKLSVVVQELLVILICSTTVVYVAF
FT                   VVLVFLLPRTHDELPLMFIVGTSIWLSACGAEWFYRSIEQYEYITVRNILFKIASIVLL
FT                   FVFVRQTNDYLAYAAVTVLGTTGSNVLNILRLRSFVTFSRKYEMNIRRHFKPMFAFSIS
FT                   SITSGMYGQIDMLLLGFFSSNYALGLYQLVFKIRNMCTGVGGSVTGVMLPRLSYYEAQE
FT                   GHDQTTKLMAKNFNFLLMLGLAIISALVICADPLIMILGGNDYLPGNAALKIGAPLVLL
FT                   GSIGSMQSQYMVASDQEKVYTYTNVAGLVIAIVLECIFIPLWGINGAALGLVLTELSVY
FT                   CIRTYILRDFMRKVRKYTDYWKIAFAWAVASIVTAGICYAMRGWNPFVQIIIAALVFCV
FT                   ADGGLLVLVKESFIMSMVRKR"
FT   gene            complement(750481..751368)
FT                   /locus_tag="BLA_0586"
FT   CDS_pept        complement(750481..751368)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0586"
FT                   /product="putative glycosyl transferase"
FT                   /note="COG1216: Predicted glycosyltransferases"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0586"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28883"
FT                   /db_xref="GOA:B8DWN2"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:B8DWN2"
FT                   /protein_id="ACL28883.1"
FT                   /translation="MTAAKFGFVVLHYLAGDATAGCIESIKTHCPQAVIVVVDNNSANG
FT                   SYEELQRKYGADSTVTLLHNAVNEGFARGNNTGYEYARNRLHCDFIVTMNNDATISCDD
FT                   FMELCEEDFKAHPDVGVIGPDIVSGKNGSHSNPIYSIIDTRAEVDRQIWRFKVILLLLH
FT                   LHLFGPLTRLKAKLTHSDANALPEHVNATADAITGKPYKLHGACFVFTPAFVKQFSCAF
FT                   DSGTFLYFEEDILLMRCRARHLTMWYDKRIRVDHMEDVSTDQMMRKDERRKMIFTLHNY
FT                   VRSLKVLKQYVNSK"
FT   gene            complement(751387..752400)
FT                   /locus_tag="BLA_0587"
FT   CDS_pept        complement(751387..752400)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0587"
FT                   /product="putative glycosyl transferase"
FT                   /note="COG0463: Glycosyltransferases involved in cell wall
FT                   biogenesis"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0587"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28884"
FT                   /db_xref="GOA:B8DWN3"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:B8DWN3"
FT                   /protein_id="ACL28884.1"
FT                   /translation="MPEISVIIPVYNQEEYVGACMDSLLDQSFEDFEVLAVNDGSTDAS
FT                   VSILEGYEQRDGRVQLIDQNNSGVSVARNNGLSHAKGEWVCFIDPDDYVAPDYLDTLLK
FT                   ATERNTDIAMSTCVAFDDQRSARQHFFPESFTARAADEKVELFRQLMDGSYAQPKGFVT
FT                   AIGVPWGKLYRHAFLQEHGLQFDAALPRMQDNLFNMQAFQLAHEIVYVDYAGYYYRMGG
FT                   LSARTYKNNARGLYHPAIDERARLMREYHLDGDATLLRAWNEEQVNLYFQELKAVIMLA
FT                   DPQSVKQAARTRAQALGPRLDQIDVSALSPAIRFKYTMMRNATLCSLLVRALRAKG"
FT   gene            complement(752393..753739)
FT                   /locus_tag="BLA_0588"
FT   CDS_pept        complement(752393..753739)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0588"
FT                   /product="oligosaccharide repeat unit polymerase Wzy"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0588"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28885"
FT                   /db_xref="GOA:B8DWN4"
FT                   /db_xref="UniProtKB/TrEMBL:B8DWN4"
FT                   /protein_id="ACL28885.1"
FT                   /translation="MTDTTETVQRQAEYSPRIREVVNALMDYALVLAIIYNSNSLWALA
FT                   GDNFSLSCFVLLAVCMAYMLCCWREARHRLHRVGSAMLVLVLATVIGQLVMAVSHGGSG
FT                   YTNGTWFQYALIVPALMGCMLMRGHEYVRKVLLNRLVVVAAVFAAISVVLWAASSFLLL
FT                   PPSHVERLSWVHNVPPIYSYADVYYNVQDAHVLGMTVWRNSSIFNEPPCAVAFYGMVLA
FT                   IDLYIGKKVHWGADLCIIGALVTSLSTGGALYVLVLLVPLLWKAMLHVQRRGLRYALLS
FT                   VAALVSIAAVVAGTRIVISKMATSYSGQTHLLDFTEGFRIWWQRPLTGFGFDSDEYIWT
FT                   HYMSAYRDGMGYTSGLLFLLIHGGLVLALYMIVPFVLLVLGSHDWHMWYFAGFVMIVFI
FT                   TAPVQNCAFLLLVAAYGYASFIWRYSRRMSSLPLVARTPLTHEGSEGHA"
FT   gene            complement(753736..754629)
FT                   /gene="epsQ"
FT                   /locus_tag="BLA_0589"
FT   CDS_pept        complement(753736..754629)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="epsQ"
FT                   /locus_tag="BLA_0589"
FT                   /product="EpsQ protein"
FT                   /note="COG1216: Predicted glycosyltransferases"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0589"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28886"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:B8DWN5"
FT                   /protein_id="ACL28886.1"
FT                   /translation="MRCAGIVTYNPDLERLRANLNNTASQVDAVFVFDNGSENVADIRS
FT                   LADSEYTTLRVEADPNNRGIAFALNRLLDAAKEHGFKHMLLLDQDSVPTEGMCDELERH
FT                   LTGSVALVCPFILDRNRMTEEEWQAQKMPPLERLTHAAKHGAITSGSLVDVAAALEVGG
FT                   FDDNLFIDYVDFDFNERLILNGYEIVKDNTVYLLHEKGKSERTWLKVPRNTSAGVQWQP
FT                   LYKLGYSPMRCYYQSRNRIVYWKKYHRHTGGEGLTEIPLLMALSLLFENHRIAKLRAYS
FT                   RGIHDGMKMKIVEYRK"
FT   gene            complement(754642..755406)
FT                   /locus_tag="BLA_0590"
FT   CDS_pept        complement(754642..755406)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0590"
FT                   /product="putative glycosyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0590"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28887"
FT                   /db_xref="GOA:B8DWN6"
FT                   /db_xref="InterPro:IPR025536"
FT                   /db_xref="UniProtKB/TrEMBL:B8DWN6"
FT                   /protein_id="ACL28887.1"
FT                   /translation="MSVSSETIMYIVSHKDFDAPQLPGYVPILAGAVKNHASIEVKDNT
FT                   GDNISAKNPGFCELTAQYWVWKNRDDRDANIGFVHYRRYFYIDHRKAQIVPAEQFSRDL
FT                   EQYDVVLPEPWVLRKTIGDQFAQFHNLDDLEVVRSIMQEQCPEYVPALDELLKSHSLHA
FT                   YNMFVMSGERFDAYMTWLFRILDEAERRIDVSKYDAYNQRLFGFLSERLLNVWVNARKL
FT                   RVKEYPVYMPEQSARKENLRTRVKSLLFEHKL"
FT   gene            complement(755411..756295)
FT                   /gene="rfbN"
FT                   /locus_tag="BLA_0591"
FT   CDS_pept        complement(755411..756295)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rfbN"
FT                   /locus_tag="BLA_0591"
FT                   /product="glycosyl transferase family 2 protein"
FT                   /note="COG0463: Glycosyltransferases involved in cell wall
FT                   biogenesis"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0591"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28888"
FT                   /db_xref="GOA:B8DWN7"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:B8DWN7"
FT                   /protein_id="ACL28888.1"
FT                   /translation="MDGAISVIVPTLNAGRQIDTLLTRLEQQTRKPDEIIVVDSSSEDI
FT                   TQEMIKRHPEVKLIVIDRKNFNHGGTRDAMLRESTGDFVLFLTQDAMPSGNDYIAKIVA
FT                   PFADDEVALVYGRQLPRKDARPAEALVRKYSYGDESMVITKADIPSLGIKAFHSTDVCA
FT                   AYRRTAYLEVGGFETDVLTNEDMFIAARFLHAGWKIVYEANATVIHSHNFTFKQQYKRN
FT                   YIQGVEIAKHKDILGDASLSGEGFSLVKYTLGGLLRQGHVIEAMRFTVDCGFRLIGNRN
FT                   GQRAAAKSHGRKE"
FT   gene            complement(756448..757509)
FT                   /gene="cps1A"
FT                   /locus_tag="BLA_0592"
FT   CDS_pept        complement(756448..757509)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cps1A"
FT                   /locus_tag="BLA_0592"
FT                   /product="polysaccharide biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0592"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28889"
FT                   /db_xref="InterPro:IPR008441"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:B8DWN8"
FT                   /protein_id="ACL28889.1"
FT                   /translation="MSRISPMPPTRCIRAISSAVTDNTQGAWILPRKAEHLYTWKAAMG
FT                   KLHNIRTKLKRYRKECVSAWRLFGPKLAMEGYLAHTVGIGVDRYYTDLSQATWSTLMED
FT                   LPYSMSIPAVDEQQCANAPIWVMWWQGVDNQAPDIIQACVRSIRKHANGHPVHVISKQN
FT                   LHEYASIDESVVQAAECGEIPMAVLSDIIRCTLLYQHGGAWIDATVYLTDDINPEVFTH
FT                   PIYSIPVHQKNPTRNWTSYFIASTQGNPLFDYAGRSLTHLVTRGKGIPEYFMLDVMLSV
FT                   AYTRHAEFTAMIDAIPANNEGRFALSEQMDSTEAQPRIPSSTYINKLTYQIDYPTTVNG
FT                   KETIYQRLLDGEF"
FT   gene            complement(757445..758692)
FT                   /locus_tag="BLA_0593"
FT   CDS_pept        complement(757445..758692)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0593"
FT                   /product="UDP-glucose/GDP-mannose dehydrogenase"
FT                   /EC_number="1.1.1.22"
FT                   /note="COG1004: Predicted UDP-glucose 6-dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0593"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28890"
FT                   /db_xref="GOA:B8DWN9"
FT                   /db_xref="InterPro:IPR001732"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR014026"
FT                   /db_xref="InterPro:IPR014027"
FT                   /db_xref="InterPro:IPR017476"
FT                   /db_xref="InterPro:IPR028357"
FT                   /db_xref="InterPro:IPR036220"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B8DWN9"
FT                   /protein_id="ACL28890.1"
FT                   /translation="MKIAVAGTGYVGLSVALLLSQHNEVHALDIVPEKVELLNNCQSPI
FT                   VDTEITRFLDGKRDGTMDLDFQATLDPAVAYTGADYAVVATPTNYDSKKNYFDTSSVEA
FT                   AIKAIREYDPDCWIVIKSTIPVGYTAQLREKTGDKKIIFSPEFLREGHALYDNLHPSRI
FT                   VVGAPTDDAEAVKAAQTFAMLLAEGAAPEENDRLNADGSTGIPELVCGTTEAEAIKLFA
FT                   NTYLALRVAYFNELDTYAESRGLNTAEIIRGVCLDPRIGTHYNNPSFGYGGYCLPKDSK
FT                   QLLANYADVPQNLIGAIVESNRTRKDFIADQILSKLEGVEKPVVGIYRLTMKSGSDNFR
FT                   QSSIQGIMKRIKAKGIDVLVYEPTLDDAEFFGSEVTHDLNAFKNRSDIIVANRWNESDL
FT                   ADAADKVYTRDLFRRD"
FT   gene            complement(758813..760249)
FT                   /gene="wzx"
FT                   /locus_tag="BLA_0594"
FT   CDS_pept        complement(758813..760249)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="wzx"
FT                   /locus_tag="BLA_0594"
FT                   /product="flippase Wzx"
FT                   /note="COG2244: Membrane protein involved in the export of
FT                   O-antigen and teichoic acid"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0594"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28891"
FT                   /db_xref="GOA:B8DWP0"
FT                   /db_xref="InterPro:IPR002797"
FT                   /db_xref="InterPro:IPR029303"
FT                   /db_xref="UniProtKB/TrEMBL:B8DWP0"
FT                   /protein_id="ACL28891.1"
FT                   /translation="MSNSLAKNSIFNVCYQLLNVIFPLISASYVARVLMPSGVGLVAMA
FT                   QNWVAYFVIFASLGIPNYAIREVAHARDSKAGTKRVFTELISINAISTTLAAIAYCAMI
FT                   FVVPNFKENLVLYIVCGGSILLNYINVDWIYQGLEDYSFIAVRSFIVKLVSLAALFVFV
FT                   RSQNDYVWYALIGVCAIGLNNIFNVGHLHKLNIGLGFSNIELKKHIKPIILIFSTIISI
FT                   KLYTLLDVTILGLMSNNAAVAYYTNADKIIRIIITVITAVGGVLLPRISRYKVEKRYEE
FT                   CASIVSRVFEILFFCFLPIGIGLICTSRQLVLILFGDAYSAGILTMQIMSLLIYALGFS
FT                   NLFGTQVLLAFDQEKKLLYCTIGGALINITLNLALIPLLSQNGTAVASVASETFVTATT
FT                   AWFASKTLSFGIRKNVIWKTVVSTLIMTIIVEVFNFVIKNVFFSFITCVLMGGVSFLLS
FT                   SVMLKNPILNYIVNVLRRRK"
FT   gene            complement(762311..763846)
FT                   /locus_tag="BLA_0595"
FT   CDS_pept        complement(762311..763846)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0595"
FT                   /product="galactosyl transferase CpsD"
FT                   /note="COG2148: Sugar transferases involved in
FT                   lipopolysaccharide synthesis"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0595"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28892"
FT                   /db_xref="GOA:B8DWP1"
FT                   /db_xref="InterPro:IPR003362"
FT                   /db_xref="InterPro:IPR017475"
FT                   /db_xref="UniProtKB/TrEMBL:B8DWP1"
FT                   /protein_id="ACL28892.1"
FT                   /translation="MAQAKSDAQLAEEVDVRSSRVLRWRFVMNLALMLFDALVYFATSM
FT                   IVLVVSHGTNLVTTRLQLNLPIDPWLYSAACAAIYVYCMHVAGVYHRHVFADGYQLNML
FT                   LLKGGFIAWVAICALNFIIQCNIFFYMVCLTSLIVWVAEMIVRFIARVILTSKHRKGEY
FT                   SYPTVIVGSPEGIGQILKFLNQRRQLNYKPIRLCPIRVNSETGLIEADPNTELLSKEVH
FT                   ESWNSPIDVIEYGPQLAGRIAETGAQTVMVTDVLDRFSDNLSTFALQMESVNLEIALIT
FT                   SALDIAEHATQMRNIQGMSIMTISLPQYSPSAQIKKRVFDLVVSTIAIILSSPIMLIVA
FT                   LAIKIEDGGPVFYKQERIGLRGKPFYIHKFRSMRVDADAHLKEVLAAQGQELGARYKLK
FT                   HDPRITKVGNFIRKTSLDELPQFFDVFMGSMSVVGPRPQRSFEVAEYDPVYATRLLVKP
FT                   GITGPWQVSGRNDLNEEESRQLDVSYVQDWSVMGDVVYILRTIGTVLHPSGAY"
FT   gene            764123..764464
FT                   /locus_tag="BLA_0596"
FT   CDS_pept        764123..764464
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0596"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0596"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28893"
FT                   /db_xref="UniProtKB/TrEMBL:B8DWP2"
FT                   /protein_id="ACL28893.1"
FT                   /translation="MTTINDSPITNDSDTELEAFEQRVNEMLSTGELDSALSITDENGV
FT                   AQVLPMLDTEPIAHLLDGIEELGGSANVFVRTAEGTAILTVNEYSPEDAALDTAESEAD
FT                   AEADAQSAE"
FT   gene            764537..766261
FT                   /locus_tag="BLA_0597"
FT   CDS_pept        764537..766261
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0597"
FT                   /product="conserved hypothetical protein"
FT                   /note="COG0477: Permeases of the major facilitator
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0597"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28894"
FT                   /db_xref="GOA:B8DWP3"
FT                   /db_xref="InterPro:IPR004638"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B8DWP3"
FT                   /protein_id="ACL28894.1"
FT                   /translation="MTSHEGPEEGEQRGGNTVTAAGKPYTRDVHHDTEPAPPRASGYFA
FT                   GLTQALTRTDAYRDGHLSRPAFLSLAILTFITFVGNFTQLQLSAALPTLVSDFHISVTL
FT                   GQWMTSIFQLTMGVMVPLTAYLTRRFSTRQIVITSMVVFTLGSVLAWLSPSFPLALFGR
FT                   FLEAVGTGVMWPVLQITVFSIFPLARRGMAMGIVGMAMAVAPAIGPTLGGVQTDLNGWR
FT                   SIFLTLTIIGCLAIVLTTFGLHNFGQADTSAHADFFSVGLSIIGFGGLMFGFTNIQAYP
FT                   FSAPVVWLPMAIGLAGIIWFVLRQFHTEKMFKAGKSSRPALLDLSVLRNRSFSIGTIIA
FT                   SLSFFAFSSLIVLIPLFIQDCRGYSATISGLVMLPGAIAQAISQFFGGRALDRFGARPV
FT                   ALIGTILLTAGTACMSTIGLHTWIWSISFYQFIRQIGMGFVMMPVTTWSLNCLKPSEVS
FT                   AGSAVTNTVRQIAGAVGSPVMILIMYSITAASMSNGQQTIPANITGIEWALRISAVINF
FT                   IMILMVVFGVKGEDAGSAREAVRIALHHDSIEQEDKGTKALAHTDDTAKLRTIETGK"
FT   gene            complement(766399..767715)
FT                   /gene="mntH"
FT                   /locus_tag="BLA_0598"
FT   CDS_pept        complement(766399..767715)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mntH"
FT                   /locus_tag="BLA_0598"
FT                   /product="H(+)-stimulated manganese uptake system protein"
FT                   /note="COG1914: Mn2+ and Fe2+ transporters of the NRAMP
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0598"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28895"
FT                   /db_xref="GOA:B8DWP4"
FT                   /db_xref="InterPro:IPR001046"
FT                   /db_xref="UniProtKB/TrEMBL:B8DWP4"
FT                   /protein_id="ACL28895.1"
FT                   /translation="MVSGEPVVDIDTVAEAAVADQDVAIARKDSGKPEKPIHALASMLG
FT                   PAFIAAVAYVDPGNVAANLTSGAQYGYLLVWVLVLANCMAVLIQYQASKLGIVTGKSLP
FT                   QILGERMGSAGSFLFFAQAEVIAIATDLAEVIGGAIALNLLFGLPLLVGGLIIGAVSTV
FT                   LLLFQGGKTHKIFERLVIGLLLVITFGFIAGLFMDPPNPLKVAEGLIPRFNGGASVLMA
FT                   ASMLGATVMPHAIYLHSTLVNDHYAHKAHKPSIKEMLHGSRIDVVWALALAGSVNIALL
FT                   VLAANSLHGMGGTDTIEGAQHTISQVLGPTVGTVFSIGLLASSLSSTSVGTYAGSEIMK
FT                   GLLHWNVPMWACRITTLVPALVVLALTSNPTEALIIGQVVLSIGIPFAVIPLMRYTHNK
FT                   QIMGKYVDGPVKHAICLLVVAVIIALNLVLIVLTLMGKA"
FT   gene            complement(767861..768589)
FT                   /locus_tag="BLA_0599"
FT   CDS_pept        complement(767861..768589)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0599"
FT                   /product="excalibur precursor"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0599"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28896"
FT                   /db_xref="InterPro:IPR011089"
FT                   /db_xref="UniProtKB/TrEMBL:B8DWP5"
FT                   /protein_id="ACL28896.1"
FT                   /translation="MARRFKRKYGVTPLERILIILLIAVVVGATLGVILPRINNGIAEI
FT                   TGRYTATGTAAETLNKLAVVDRPNGDGYDRDLFGFRETDDDGNGCDVREDILARDLTDV
FT                   AYVTRNGCKVKSGVLNDPYTGKVIHFTRGQNTSAAVQIDHVVALQNAWQSGAKDWNARK
FT                   RMQFANDPYNLLAVDGPANQGKGSASAAYWLPTNASYRCDYVARQIGVKDKYGLSVTSS
FT                   EKRAMQSVLHGCPGQEIPAD"
FT   gene            768748..769623
FT                   /locus_tag="BLA_0600"
FT   CDS_pept        768748..769623
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0600"
FT                   /product="pyridoxine biosynthesis protein"
FT                   /note="COG0214: Pyridoxine biosynthesis enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0600"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28897"
FT                   /db_xref="GOA:B8DWP6"
FT                   /db_xref="InterPro:IPR001852"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR033755"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8DWP6"
FT                   /protein_id="ACL28897.1"
FT                   /translation="METTRNELNRNLAQMLKGGVIMDVTTPEQARIAEDAGACAVMALE
FT                   RIPADIRAAGGVSRMSDPAMIKGIQEAVSIPVMAKVRIGHIAEARILQAIEIDYIDESE
FT                   VLSPADDVYHIDKREFDVPFVCGAKNLGEALRRIEEGASMIRTKGEPGTGDVIQAVRHM
FT                   RTMTKQIRELASLRDDEVYEAAKQLAVPYELAKYVHDNGRLPVVNFAAGGVATPADAAL
FT                   MMELGAEGVFVGSGIFKSGDPAKRAAAIVQATANWRDADLLARLSENLGEAMVGINEDE
FT                   IETIMAARGE"
FT   gene            769650..770300
FT                   /gene="pdxT"
FT                   /locus_tag="BLA_0601"
FT   CDS_pept        769650..770300
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pdxT"
FT                   /locus_tag="BLA_0601"
FT                   /product="glutamine amidotransferase subunit PdxT"
FT                   /note="COG0311: Predicted glutamine amidotransferase
FT                   involved in pyridoxine biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0601"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28898"
FT                   /db_xref="GOA:B8DWP7"
FT                   /db_xref="InterPro:IPR002161"
FT                   /db_xref="InterPro:IPR021196"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:B8DWP7"
FT                   /protein_id="ACL28898.1"
FT                   /translation="MVVDVSYISKEHSEDATTASSGVTGILAVQGAFAEHAAMLDRLGA
FT                   PWKLLRAREDFDESIDRVILPGGESTTQGKLLRSTGLFEPINEHIKAGKPVFGTCAGMI
FT                   LLAQRLENDPNVYFGALDATVRRNAYGRQLGSFMATENVATFHADGTPAGVIENFPLVF
FT                   IRGPFVAETGANARVMCEANGNTVALQQGRILATAFHPEITPDTRIHEFFLII"
FT   gene            770742..771779
FT                   /locus_tag="BLA_0602"
FT   CDS_pept        770742..771779
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0602"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="COG0451: Nucleoside-diphosphate-sugar epimerases"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0602"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28899"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B8DWP8"
FT                   /protein_id="ACL28899.1"
FT                   /translation="MELSGKTILITGAAGFIGWNLAERLLHSYPDITIVGLDNLNDYYD
FT                   VKLKEARLERLTKYPNLIFEKGDLSDKKLIGRLFEKHHFDVVVNLGAQAGVRYSITNPD
FT                   AYVSSNLIGFYNILEACRHNPVEHLVYASSSSVYGGNKKVPFSTEDKVDNPVSLYAATK
FT                   KSNELMAHAYSKLYDIPSTGLRFFTVYGPAGRPDMAYFGFTNKLLAGETIKIFNYGNCQ
FT                   RDFTYIDDIVEGIVRVIQGAPTRQTGEDGLPVPPYALYNIGCGHPENLLDFVTTLQEEL
FT                   IRAEVLPDDYDFEAHKELVPMQPGDVPVTYADTEALTRDYGYRPTTSLRDGLRRFAEWY
FT                   KQYYM"
FT   gene            771884..772348
FT                   /gene="cpsF"
FT                   /locus_tag="BLA_0603"
FT   CDS_pept        771884..772348
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cpsF"
FT                   /locus_tag="BLA_0603"
FT                   /product="beta-1,4-galactosyltransferase enhancer"
FT                   /note="COG0707: UDP-N-acetylglucosamine:LPS
FT                   N-acetylglucosamine transferase"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0603"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28900"
FT                   /db_xref="GOA:B8DWP9"
FT                   /db_xref="InterPro:IPR013969"
FT                   /db_xref="UniProtKB/TrEMBL:B8DWP9"
FT                   /protein_id="ACL28900.1"
FT                   /translation="MVHKRKPRLCFVSSSGGHWEQLQKLLPLAEKYEGFFVTEKTQFET
FT                   PRAKYFMKQTDLKDKFMVPKMIVNSARALVIWIKERPDFIITTGTMVAYPFYLLAVLFH
FT                   KKFIFIETFGRANMPTEAGKKMEKHSDLFIVQWESQKKFYTKAIYGGCLY"
FT   gene            774894..776027
FT                   /locus_tag="BLA_0604"
FT   CDS_pept        774894..776027
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0604"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0604"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28901"
FT                   /db_xref="GOA:B8DWQ0"
FT                   /db_xref="UniProtKB/TrEMBL:B8DWQ0"
FT                   /protein_id="ACL28901.1"
FT                   /translation="MIQAVSYFILLSISFFKRKSYILYFVCIVFLWLIASFTTGNADEQ
FT                   IYQSRYDEYQLWEDNTEYLYMALIKTCNALGLTYQAFKCVSAFIVLTLISCTILRFAAC
FT                   PILTLLLYAVYPFPIDVAQMRNCLATSVFIFGMGFLLDDVQNGDNQGRFLTKNDILYCL
FT                   CIFIATMVHTAAFFWIIILVAKKLNTKWAAIFTFVFCLLFSAIMTPRFISGLSGLFGSN
FT                   DRINAYTTAAYDLTRDLHLPLALLRVAIFFITSLAVLLITNLSSMKMTGVQKKEYIFYF
FT                   KITILTLCILPITINYTPEIYRMQTGLSLIFYMIILNIISGETINSTNDAILRFIIPLL
FT                   LLVFGVVNAFLLYIFGDNLETVFIPIFENNTFFNSIV"
FT   gene            complement(776152..779733)
FT                   /locus_tag="BLA_0605"
FT   CDS_pept        complement(776152..779733)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0605"
FT                   /product="ATP binding protein of ABC transporter"
FT                   /note="COG4988: ABC-type transport system involved in
FT                   cytochrome bd biosynthesis, ATPase and permease components"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0605"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28902"
FT                   /db_xref="GOA:B8DWQ1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="UniProtKB/TrEMBL:B8DWQ1"
FT                   /protein_id="ACL28902.1"
FT                   /translation="MFDKRLFPLAPGVRGLIVAKVVCLWVGLLADIALSVTAVSLMGAV
FT                   LGRNTAYTFTVVSLGWYALAFAVIAFIRFLAHYLGSRFGTEAAERVKLGLRNALYRKLL
FT                   VLGPSYRQQASTASIVQLAGEGVDQVQSFYEKFVPQLFYAVLAPLTLFAVLAPINMPTA
FT                   VVLLVCAPLIVIIVGMVAMRASRVFKKYWGKYTDMGSAFLDNLQGLETLKTFDADESAA
FT                   RKMHEEAENFRVMTMRVLQIQLRSLTAMDVVAYGGAAAGIGVAIWQLTHSGVTMFRTTF
FT                   APLDMFAGPQLGSPGMLLIVLLSASFFLPLRQLGSFFHVAMNGMTSSKKIFALLDAPAP
FT                   HHGEQTLPAGPISVHAHNLGFFYGDDEADAQPALRKVSLDIPAHSLTAIVGESGSGKST
FT                   LAALIAGELEGYSGSLAFEVDGESVEVADLSESALMAAVSFVGARSHLFVGTLRDNLIM
FT                   ANPQATDEQLHHALRLAHIDDFVREQPAGLGMPIDPANLSGGQRQRIAVARALLHEAPI
FT                   MIFDEATSSVDAESEALIMQTIHELAQSKTVIVVTHRLADTVDADMIAVFDHGSCVETG
FT                   DSSTLMAADGRYARMFHAQATVEQVHRRTEGGGIRYAHTQNEVGGDMPKRVAESAGKRN
FT                   AALSGIDMAADDAMTTVQVIRRLLAQVGSLRPLMVLACCFGVLGHLAATFMPVFGIMAA
FT                   CAAFGHPVWGLSVGWAVTLMVVCAAIRGIMAYCEQYMNHNLAFRLLALFRERAFDALRR
FT                   LAPAALANRGNGDMISLITTDVELLEIFFAHTISPTIIALSTTVLYTVALLFLSPWFAL
FT                   LLVIAHLLLGVLMPRLFAAALRGVGSKLRKDSAALDDQVLDDMHGLDQIIRFDCGDDRL
FT                   KRIDAWSRSLWRQRTRLSARNGAFSGYDSMIVIVVTAVAALLALTLSLGNTSAAANIAA
FT                   FVLVVSSFGPTLALSALPANLTQTFASARRLFSVLDAEPAVEERGTEQCAYDGMSLDGV
FT                   TFGYGDGAPVLRDVTMDIPLSGILGIQGPSGRGKSTLLKLLMRYWDPQQGTVSMSGHAL
FT                   PAIDAHTRRRLQTMMSQETYLFDDTIAGNLRIAKPEASDDELHRALEQASIAALVDDLP
FT                   EGMETRVGELGDRLSEGERQRLGLARMFLRDASLYLFDEPTSRLDSLNEAYILQSINAL
FT                   VEERDAAVVLVSHRASTMRIADGIHKA"
FT   gene            779975..781794
FT                   /pseudo
FT                   /gene="fadD"
FT                   /locus_tag="BLA_0606"
FT                   /note="frameshift: probable long-chain-fatty acid CoA
FT                   ligase"
FT   gene            complement(781869..783257)
FT                   /pseudo
FT                   /locus_tag="BLA_0608"
FT                   /note="interrupted by in-frame stop: septum formation
FT                   protein Maf"
FT   gene            783445..784011
FT                   /locus_tag="BLA_0610"
FT   CDS_pept        783445..784011
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0610"
FT                   /product="protein-tyrosine-phosphatase"
FT                   /EC_number="3.1.3.48"
FT                   /note="COG0394: Protein-tyrosine-phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0610"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28903"
FT                   /db_xref="GOA:B8DWQ2"
FT                   /db_xref="InterPro:IPR017867"
FT                   /db_xref="InterPro:IPR023485"
FT                   /db_xref="InterPro:IPR036196"
FT                   /db_xref="UniProtKB/TrEMBL:B8DWQ2"
FT                   /protein_id="ACL28903.1"
FT                   /translation="MKVLFVCTGNICRSPMGELLFPHFFHTNGIETDSAGTQGLVDSPI
FT                   DPSSAKLMALDGIDSSQFRSKRLTPQLAMSSDLILCFTEHQRRKIVALAPRVRSKTFLL
FT                   SDFANLCRYFGQNNLLHGSNVEDRMREVMCNASMARRALPEAEDIADPYRKEFAAFQVA
FT                   HDQIGYAIADIAQALEPSRAGHATE"
FT   gene            complement(784096..785925)
FT                   /locus_tag="BLA_0611"
FT   CDS_pept        complement(784096..785925)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0611"
FT                   /product="methyl-accepting chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0611"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28904"
FT                   /db_xref="GOA:B8DWQ3"
FT                   /db_xref="InterPro:IPR025101"
FT                   /db_xref="UniProtKB/TrEMBL:B8DWQ3"
FT                   /protein_id="ACL28904.1"
FT                   /translation="MASHRVSRTNVKRHHRVWPWVLSIVGLFVAVLVLFGIAGFNVYRQ
FT                   SKEVQAHESRALSMISDFSTKIDDANVQKVKDQLPQIQQETSQASAIANGAWWNIANKI
FT                   PYFGSNVSTVQGMTNVIDDLMHQSVPQFMDVVTNLQHANLSSTDDGINLRPIIDCQQGM
FT                   QKANESLQHQVGAYNALPQPNIDIVRSAYAQGSDKLNALATRVDALSSTFRMLPGFLGN
FT                   GQTRTYAVMSMTTSEMRSSGGLIGSVGELTADNGSVHVGEFKANKDYLPYGIGDHSADM
FT                   ARVFSDEGPLHMSFDIRDTAVFPDTERAALAMQSIWNRTPWGQQKPLSGVIMVDPVFVQ
FT                   EMVAINGPVTLADGTTLNGDNTAEYFLNTVYKQYEASQTDAVFGETTGNVIAGMFKSLN
FT                   LGKLVKIGETMGTMARERHFTMFSFDANLEKEIQAAGFTGETPNDPQNPSVGIYLTEQN
FT                   PSKMGWYIKRTATIEKTRCDASGATYHVEYTLNNTMKVSDVANLPPYITGVDAPNRGKG
FT                   IEKILFYPPAGGRINNISQLNGAVNAVQKTTMNGKELYKTVVEILPEQSVTYSFDVTVS
FT                   PQAQSALTIDQTPLGWKDTGITVKEPKCSAKAN"
FT   gene            complement(785991..787487)
FT                   /locus_tag="BLA_0612"
FT   CDS_pept        complement(785991..787487)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0612"
FT                   /product="possible Etk-like tyrosine kinase involved in Eps
FT                   biosynthesis"
FT                   /EC_number="2.7.10.2"
FT                   /note="COG0489: ATPases involved in chromosome
FT                   partitioning"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0612"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28905"
FT                   /db_xref="GOA:B8DWQ4"
FT                   /db_xref="InterPro:IPR003856"
FT                   /db_xref="InterPro:IPR005702"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B8DWQ4"
FT                   /protein_id="ACL28905.1"
FT                   /translation="MLEWKALYMAENEVNRYSQSQSQTPVPAHEGMTIVDLLSILRKHI
FT                   ITIAVTFVVILGVDILYTAMSPVAYTTTTQLFATYNSSNDSANSSEQYSGSSYIMSQIK
FT                   SYPDLAKTQSVLQPVVDELKLDTTPISLASQITVTNPTNTAFVNIAVTDADPSTAARIA
FT                   NGVAASLSNVVEKSLYTAGSNSAVKLSIVQPAQVPTKQSSPKWSLNILVGVLGGLIIGI
FT                   LAALLKDVLSKKIQDESDVTDIVDAPIIGRVVKDDILAGSSPVVVSEPGSPIAEDFRRI
FT                   RTNLSFSTPVEGTNCRLVVVTSAGASEGKTTISVNIAAALAEDGPRVLLIDADLRHPSV
FT                   AHKIDIDGSAGLTHVLSGQAAVKDVIQRYWKPNLHIIPAGPKPPNASTLLNSPLMTTLV
FT                   ANAMQQYDYIIIDTAPMVVANDAVIFMKQGGTLEMVCRRDQTLKRDLHEIADELETLDM
FT                   PVTGVIINCAKENKKALENSNYYYYSNSSPAEKNRKNRKS"
FT   gene            788352..789206
FT                   /locus_tag="BLA_0613"
FT   CDS_pept        788352..789206
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0613"
FT                   /product="putative actin"
FT                   /note="COG3064: Membrane protein involved in colicin
FT                   uptake."
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0613"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28906"
FT                   /db_xref="GOA:B8DWQ5"
FT                   /db_xref="UniProtKB/TrEMBL:B8DWQ5"
FT                   /protein_id="ACL28906.1"
FT                   /translation="MFNGKKKAPKNDWRQSIMSLGQVKNEANESESQTTRRMPFGRTGR
FT                   TDRPQSQHMPTATMPNGPATGMQVAAQAAPPQKRKRFKVLIYAFAFLMVFALGVGAGSS
FT                   NASKPAGTVPSAAVAPTEQIDAKENDAELKRREEALNKQAEELDKLKRELDEQQKSQSE
FT                   RQTQLDEREKSIASKEEAKKQAEVEAAQRKKAEQEQAAAAEKARAEAEAAERERAQAQA
FT                   AQAAAEEAARQQEQAPQVVEQQTSRIVHPGAFCSTAGETGVSQKGVGYTCKADNSGRLR
FT                   WRR"
FT   gene            790074..791405
FT                   /locus_tag="BLA_0614"
FT   CDS_pept        790074..791405
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0614"
FT                   /product="transposase"
FT                   /note="COG3464: Transposase and inactivated derivatives"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0614"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28907"
FT                   /db_xref="InterPro:IPR002560"
FT                   /db_xref="UniProtKB/TrEMBL:B8DV44"
FT                   /protein_id="ACL28907.1"
FT                   /translation="MNEETRPEPEFSVFDPQRFLGLDEMGLRVLSWRRLGRPDGPGLRQ
FT                   IRCEPDSHDARWCPSCGAYARVRSSWLRTLAHVPYGDDAVHLPVRVRRYECVPCSRSWS
FT                   DDLEAVGAGRGVLSVPAVMWALRRVCLDSMTVSACARLLHVAWAVVDRAVRERGMLLLE
FT                   QADRFSSVRAIGVDEHVWRHGAFGDRYVTVIVDLTPRCDGRPARLLDMVPGRSAQVLRE
FT                   WMQARGGEFTRRVGVVAMDAFAGWKQAVESVVPHAVEVIDPFHVVQLAAARVTKVRCRL
FT                   QRDATGRRGVKGDRLYDCRRALLTSDEYLGARGRARLMALFAIQANRDLMLAHDAYQRV
FT                   IHAYRCDDRRRGERMMRELIDDLTGPGRYKGCRELASLGRVLKRRMRDILALFRHPRSS
FT                   NGPTEAINGRLETLRGNAMGFANTTSYIQRCLIHSSQLKDILTH"
FT   gene            complement(791968..792951)
FT                   /gene="thrB"
FT                   /locus_tag="BLA_0615"
FT   CDS_pept        complement(791968..792951)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thrB"
FT                   /locus_tag="BLA_0615"
FT                   /product="homoserine kinase"
FT                   /EC_number="2.7.1.39"
FT                   /note="COG0083: Homoserine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0615"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28908"
FT                   /db_xref="GOA:B8DWQ7"
FT                   /db_xref="InterPro:IPR000870"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/TrEMBL:B8DWQ7"
FT                   /protein_id="ACL28908.1"
FT                   /translation="MDPVTRKVHVRVPATSANLGSGFDTVGLALDYHDELEFTLSSDPL
FT                   NMAAQILITGEGENTLPRDESHLVVSTFRRACSRFGLSKCGFIMEAHNNIPQARGMGSS
FT                   AEAIVAGISAAYAFSHEGELDRDVIFQYAADLEGHPDNVAPAVYGGMTVSWTEDGQSEI
FT                   VQGEVVNTGFRSVNYLVDAGVRASIFVPDYELSTAQARAALLNTVPFADAVFNVSRMGL
FT                   LIGAMNPSALAGEQDPNELLFTATQDKLHQSYRAPLMKPSAELIDLLREHGYAAAVSGA
FT                   GPCVCVLHNGDASDDLNQIATAQLASGHWRVLHLNVDTQGVQVARL"
FT   gene            complement(793014..794324)
FT                   /gene="thrA"
FT                   /locus_tag="BLA_0616"
FT   CDS_pept        complement(793014..794324)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thrA"
FT                   /locus_tag="BLA_0616"
FT                   /product="homoserine dehydrogenase"
FT                   /EC_number="1.1.1.3"
FT                   /note="COG0460: Homoserine dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0616"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28909"
FT                   /db_xref="GOA:B8DWQ8"
FT                   /db_xref="InterPro:IPR001342"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR005106"
FT                   /db_xref="InterPro:IPR016204"
FT                   /db_xref="InterPro:IPR019811"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B8DWQ8"
FT                   /protein_id="ACL28909.1"
FT                   /translation="MAEQNAPIRVGLLGAGTVGSQTARILVEQKDELGQRIGRPLEISG
FT                   IACLDPNEVDFPWIDKSLLTSDTMSVVKNADIVVELIGGTGVARTFVLEALNNGASVVT
FT                   ANKALLAKYGPELYKAAEDNHADIYFEAAVGGAIPIVRPLRESLVGDQVKSMLGIVNGT
FT                   TNYILDEMTTKGLDFDVALKEAQEKGYAEADPTGDIEGYDAANKAAIMATLGFHTNVGI
FT                   DDVTVEGITHITADDIAAATAEGKVVKLLAVVDHTEDGVSARVYPALIRNEHPLASVHG
FT                   SFNAVFLHAEYADDLMFYGRGAGGAPTASAVVGDIVTVARHIASGCTGPAIRMYNDYPI
FT                   APLSSAKASFAVRFLIHDKPGVLLQVAKEFADRGISINGVNQDLKPTATEPGYDGEIQQ
FT                   LRLVTHMTDETTLREAVDAVCQLDSVTGDPSIIRVLD"
FT   gene            complement(794597..796186)
FT                   /gene="lysA"
FT                   /locus_tag="BLA_0617"
FT   CDS_pept        complement(794597..796186)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lysA"
FT                   /locus_tag="BLA_0617"
FT                   /product="diaminopimelate decarboxylase"
FT                   /EC_number="4.1.1.20"
FT                   /note="COG0019: Diaminopimelate decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0617"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28910"
FT                   /db_xref="GOA:B8DWQ9"
FT                   /db_xref="InterPro:IPR002986"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR022643"
FT                   /db_xref="InterPro:IPR022644"
FT                   /db_xref="InterPro:IPR022653"
FT                   /db_xref="InterPro:IPR022657"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:B8DWQ9"
FT                   /protein_id="ACL28910.1"
FT                   /translation="MAISPIWPADTARNSNGELTFHGITASTLLDEFGSPLYVLDLDEV
FT                   RARASHFVKAAAHAFTNNTTHVSYAAKAFLSKEMARIVTEEGMFVDTCTLGEMKIALAA
FT                   GVPGRRLVLHGNNKSDEEIELAIAEGFSKIVIDSPDEPARIAAIAERLGKRARVMLRVT
FT                   SGIHAGGHEYVSTAHEDQKFGVALLPAGADTEIVDNIDQLQDVSPAATNALVHETELER
FT                   GGETKQQADRQLRYDVRYPYDLNAADVTEGDRLLAAAMELVANGPAIAVLREIAKYGNL
FT                   ELVGVHSHIGSNIHDAEAFIQAAKRMMLLRKTFYATNAYTLPEVDLGGGYSVAYTDDED
FT                   RMDVDRELGRLADAVSKTNRLLGMPAPIISFEPGRWIVAPAGVTLYRVGTVKTVQLGDG
FT                   FTNNAGERIRERAYISVDGGMSDNIRPALYDAKYTAILANRESAEPAKLSRVVGIHCES
FT                   GDIVVNEANLPADVHRGDILAVPVTGAYGRSMASNYNMALIPAVVGIDGHGAHVMMRRQ
FT                   TIDDLLALDVSE"
FT   gene            complement(796381..798177)
FT                   /gene="argS"
FT                   /locus_tag="BLA_0618"
FT   CDS_pept        complement(796381..798177)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argS"
FT                   /locus_tag="BLA_0618"
FT                   /product="arginyl-tRNA synthetase"
FT                   /EC_number="6.1.1.19"
FT                   /note="COG0018: Arginyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0618"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28911"
FT                   /db_xref="GOA:B8DWR0"
FT                   /db_xref="InterPro:IPR001278"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR005148"
FT                   /db_xref="InterPro:IPR008909"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR035684"
FT                   /db_xref="InterPro:IPR036695"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8DWR0"
FT                   /protein_id="ACL28911.1"
FT                   /translation="MSPEALQELIFTIANNLVSEGKAGTLTAEELPDSAKFAVMRPKDR
FT                   AHGDWASNAAMQLAKKAGMKPRDLAQLFADALNGTDGIAAVEVAGPGFINITLDSASAA
FT                   AVVDQVLDEGNRFGKNNHLSGKTLNLEFVSANPTGPIHIGGTRWAAVGDSMARILQANG
FT                   ATVVREYYFNDHGEQINRFAKSLVAAAHDEPTPVDGYKGAYIDEIARRVIVEANAEGID
FT                   ILNLPRVDGGTDEKGEPLGEGDSEQREEFRKRAVPMMFDEIRQSMKEFRVHFDVWFHEN
FT                   SLYEDGEVEKAIADLRNAGDIYEKDGATWFESTEHGDDKDRVIIKSDGTYAYFAADIAY
FT                   YRNKRHRKTDPADVAIYMLGADHHGYIGRMMAMCAAFGDKPGENMQILIGQMVNVMKDG
FT                   KPVRMSKRAGNIVTIDDLIDAIGVDASRYSLARTDYNSPVDIDLNLLASHSNDNPVYYV
FT                   QYAHARSCNVDRNAEAAQINAADADLSLLDTEADGEVIAALAQWPALLTLAGDLRAPHR
FT                   IAHYLEDLAAAYHKWYNVERVVPMPLTEAEERADEQTRERTRIAKNPEPARAAARLKLN
FT                   DAVQTVIAEGLDLLGVTAPDKM"
FT   gene            complement(798417..799871)
FT                   /locus_tag="BLA_0619"
FT   CDS_pept        complement(798417..799871)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0619"
FT                   /product="glucosylceramidase precursor"
FT                   /EC_number="3.2.1.75"
FT                   /note="COG5520: O-Glycosyl hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0619"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28912"
FT                   /db_xref="GOA:B8DWR1"
FT                   /db_xref="InterPro:IPR001139"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR033453"
FT                   /db_xref="UniProtKB/TrEMBL:B8DWR1"
FT                   /protein_id="ACL28912.1"
FT                   /translation="MIQAFSTYANAQGTTLAAAFAPLGNAYLRVGRTPESTSHASTPTL
FT                   SIDTTRVRQPIDGFGASITEATSWLWHNRVTDKERCIRDLFSPRDGIGISMLRQPIGPS
FT                   DHVSAPYRFVRRFPDRNLNSLDFTPEMERVLPMVEAANDCALATQSHALNIMASPWSAP
FT                   WWMKTNLSVLGKRRYTRITGHLRRGMYAAYARYITGFARLYAQRGLPLFALTVTNEPDY
FT                   PQSRWPSMAMTPREQAEFVARHLRPMLDHAGLEGTRILCWDHNYSTDHYPDGAFVRDMY
FT                   ADSAALTACAGSAWHYYGGSARTMSRIHDAFPNKGIWATEASGGDWGPRNFTPALLSLG
FT                   TAVIDMMNNWARSAVLWNIALDEHGGPDYYYLRNDRRHSENRGLITVRDDGSIRRNADY
FT                   YALGHFSKYVPIGSRCVECALDHAQGVRAAAFLVPAALTHGDGDQVVAVLVNSRPEPLD
FT                   LLCHLRGAGNGVMLTLPASSLTSFLA"
FT   gene            complement(799939..800337)
FT                   /locus_tag="BLA_0620"
FT   CDS_pept        complement(799939..800337)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0620"
FT                   /product="translation initiation inhibitor protein"
FT                   /note="COG0251: Putative translation initiation inhibitor,
FT                   yjgF family"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0620"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28913"
FT                   /db_xref="InterPro:IPR006056"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:B8DWR2"
FT                   /protein_id="ACL28913.1"
FT                   /translation="MYENLQAVTTMEAPAALGAYSQAVKANGFVFVSGQLGIDPATGEL
FT                   DGVTAAEQAARALKNITNILAAAGCGVEHVCRATIYLRNVEDFSEVDGVYAKTFTGTVK
FT                   PARVAFGNNMIPKGALVEIDVIAVCPQN"
FT   gene            complement(800458..800550)
FT                   /locus_tag="BLA_0621"
FT   CDS_pept        complement(800458..800550)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0621"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0621"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28914"
FT                   /db_xref="UniProtKB/TrEMBL:B8DWR3"
FT                   /protein_id="ACL28914.1"
FT                   /translation="MSLYLGLFHIRNPQNIEDAWFPNLSRETFA"
FT   gene            complement(800585..801274)
FT                   /locus_tag="BLA_0622"
FT   CDS_pept        complement(800585..801274)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLA_0622"
FT                   /product="putative sugar transport integral membrane
FT                   protein"
FT                   /note="COG0395: ABC-type sugar transport system, permease
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:BLA_0622"
FT                   /db_xref="EnsemblGenomes-Tr:ACL28915"
FT                   /db_xref="GOA:B8DWR4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B8DWR4"
FT                   /protein_id="ACL28915.1"
FT                   /translation="MIPGTGLFRNIARAFGAMKFWEALGGTFLVATIVSISTVFFSTLA
FT                   GYSFSKLRFRGRNALLMLVVATMTIPQQLSVVPLYIMANKAGLFGSLWAVIIPGLVSAF
FT                   GVFWMTQYIGDALPYELIEAARVDGCSMFRTFLHVAIPAARPAAAMLFLFTFIAQWTNY
FT                   FWPMLILGPNKNKMLTVAAATLKGAYFTDYTIVMSGVVLTTAPLLLLFFFAGKQLVSGI
FT                   MAGAVKG"
FT   gene            801177..802181
FT                   /locus_tag="BLA_0623"
FT