(data stored in ACNUC1104 zone)

EMBL: CP001220

ID   CP001220; SV 2; circular; genomic DNA; STD; PRO; 5373644 BP.
XX
AC   CP001220;
XX
PR   Project:PRJNA29203;
XX
DT   31-OCT-2009 (Rel. 102, Created)
DT   11-SEP-2019 (Rel. 142, Last updated, Version 8)
XX
DE   Comamonas thiooxydans strain CNB-1 substr. CNB-2 chromosome, complete
DE   genome.
XX
KW   .
XX
OS   Comamonas thiooxydans
OC   Bacteria; Proteobacteria; Betaproteobacteria; Burkholderiales;
OC   Comamonadaceae; Comamonas.
XX
RN   [1]
RP   1-5373644
RX   DOI; 10.1128/AEM.00933-09.
RX   PUBMED; 19734336.
RA   Ma Y.F., Zhang Y., Zhang J.Y., Chen D.W., Zhu Y., Zheng H., Wang S.Y.,
RA   Jiang C.Y., Zhao G.P., Liu S.J.;
RT   "The complete genome of Comamonas testosteroni reveals its genetic
RT   adaptations to changing environments";
RL   Appl. Environ. Microbiol. 75(21):6812-6819(2009).
XX
RN   [2]
RP   1-5373644
RA   Ma Y., Liu S.;
RT   ;
RL   Submitted (30-OCT-2008) to the INSDC.
RL   Environmental Microbiology Research Center, Institute of Microbiology,
RL   Chinese Academy of Sciences, Datun Road, Chaoyang District, Beijing,
RL   Beijing 100101, P.R. China
XX
RN   [3]
RC   Sequence update by submitter
RP   1-5373644
RA   Ma Y., Liu S.;
RT   ;
RL   Submitted (03-MAR-2014) to the INSDC.
RL   Environmental Microbiology Research Center, Institute of Microbiology,
RL   Chinese Academy of Sciences, Datun Road, Chaoyang District, Beijing,
RL   Beijing 100101, P.R. China
XX
DR   MD5; 7db1d201b0ce46f9bd0a5e449d65499b.
DR   BioSample; SAMN02603356.
DR   EnsemblGenomes-Gn; CtCNB1_R0001.
DR   EnsemblGenomes-Gn; CtCNB1_R0002.
DR   EnsemblGenomes-Gn; CtCNB1_R0003.
DR   EnsemblGenomes-Gn; CtCNB1_R0004.
DR   EnsemblGenomes-Gn; CtCNB1_R0005.
DR   EnsemblGenomes-Gn; CtCNB1_R0006.
DR   EnsemblGenomes-Gn; CtCNB1_R0007.
DR   EnsemblGenomes-Gn; CtCNB1_R0008.
DR   EnsemblGenomes-Gn; CtCNB1_R0009.
DR   EnsemblGenomes-Gn; CtCNB1_R0010.
DR   EnsemblGenomes-Gn; CtCNB1_R0011.
DR   EnsemblGenomes-Gn; CtCNB1_R0012.
DR   EnsemblGenomes-Gn; CtCNB1_R0013.
DR   EnsemblGenomes-Gn; CtCNB1_R0014.
DR   EnsemblGenomes-Gn; CtCNB1_R0015.
DR   EnsemblGenomes-Gn; CtCNB1_R0016.
DR   EnsemblGenomes-Gn; CtCNB1_R0017.
DR   EnsemblGenomes-Gn; CtCNB1_R0018.
DR   EnsemblGenomes-Gn; CtCNB1_R0019.
DR   EnsemblGenomes-Gn; CtCNB1_R0020.
DR   EnsemblGenomes-Gn; CtCNB1_R0021.
DR   EnsemblGenomes-Gn; CtCNB1_R0022.
DR   EnsemblGenomes-Gn; CtCNB1_R0023.
DR   EnsemblGenomes-Gn; CtCNB1_R0024.
DR   EnsemblGenomes-Gn; CtCNB1_R0025.
DR   EnsemblGenomes-Gn; CtCNB1_R0026.
DR   EnsemblGenomes-Gn; CtCNB1_R0027.
DR   EnsemblGenomes-Gn; CtCNB1_R0028.
DR   EnsemblGenomes-Gn; CtCNB1_R0029.
DR   EnsemblGenomes-Gn; CtCNB1_R0030.
DR   EnsemblGenomes-Gn; CtCNB1_R0031.
DR   EnsemblGenomes-Gn; CtCNB1_R0032.
DR   EnsemblGenomes-Gn; CtCNB1_R0033.
DR   EnsemblGenomes-Gn; CtCNB1_R0034.
DR   EnsemblGenomes-Gn; CtCNB1_R0035.
DR   EnsemblGenomes-Gn; CtCNB1_R0036.
DR   EnsemblGenomes-Gn; CtCNB1_R0037.
DR   EnsemblGenomes-Gn; CtCNB1_R0038.
DR   EnsemblGenomes-Gn; CtCNB1_R0039.
DR   EnsemblGenomes-Gn; CtCNB1_R0040.
DR   EnsemblGenomes-Gn; CtCNB1_R0041.
DR   EnsemblGenomes-Gn; CtCNB1_R0042.
DR   EnsemblGenomes-Gn; CtCNB1_R0043.
DR   EnsemblGenomes-Gn; CtCNB1_R0044.
DR   EnsemblGenomes-Gn; CtCNB1_R0045.
DR   EnsemblGenomes-Gn; CtCNB1_R0046.
DR   EnsemblGenomes-Gn; CtCNB1_R0047.
DR   EnsemblGenomes-Gn; CtCNB1_R0048.
DR   EnsemblGenomes-Gn; CtCNB1_R0049.
DR   EnsemblGenomes-Gn; CtCNB1_R0050.
DR   EnsemblGenomes-Gn; CtCNB1_R0051.
DR   EnsemblGenomes-Gn; CtCNB1_R0052.
DR   EnsemblGenomes-Gn; CtCNB1_R0053.
DR   EnsemblGenomes-Gn; CtCNB1_R0054.
DR   EnsemblGenomes-Gn; CtCNB1_R0055.
DR   EnsemblGenomes-Gn; CtCNB1_R0056.
DR   EnsemblGenomes-Gn; CtCNB1_R0057.
DR   EnsemblGenomes-Gn; CtCNB1_R0058.
DR   EnsemblGenomes-Gn; CtCNB1_R0059.
DR   EnsemblGenomes-Gn; CtCNB1_R0060.
DR   EnsemblGenomes-Gn; CtCNB1_R0061.
DR   EnsemblGenomes-Gn; CtCNB1_R0062.
DR   EnsemblGenomes-Gn; CtCNB1_R0063.
DR   EnsemblGenomes-Gn; CtCNB1_R0064.
DR   EnsemblGenomes-Gn; CtCNB1_R0065.
DR   EnsemblGenomes-Gn; CtCNB1_R0066.
DR   EnsemblGenomes-Gn; CtCNB1_R0067.
DR   EnsemblGenomes-Gn; CtCNB1_R0068.
DR   EnsemblGenomes-Gn; CtCNB1_R0069.
DR   EnsemblGenomes-Gn; CtCNB1_R0070.
DR   EnsemblGenomes-Gn; CtCNB1_R0071.
DR   EnsemblGenomes-Gn; CtCNB1_R0072.
DR   EnsemblGenomes-Gn; CtCNB1_R0073.
DR   EnsemblGenomes-Gn; CtCNB1_R0074.
DR   EnsemblGenomes-Gn; CtCNB1_R0075.
DR   EnsemblGenomes-Gn; CtCNB1_R0076.
DR   EnsemblGenomes-Gn; CtCNB1_R0077.
DR   EnsemblGenomes-Gn; CtCNB1_R0078.
DR   EnsemblGenomes-Gn; CtCNB1_R0079.
DR   EnsemblGenomes-Gn; CtCNB1_R0080.
DR   EnsemblGenomes-Gn; CtCNB1_R0081.
DR   EnsemblGenomes-Gn; CtCNB1_R0082.
DR   EnsemblGenomes-Gn; CtCNB1_R0083.
DR   EnsemblGenomes-Gn; CtCNB1_R0084.
DR   EnsemblGenomes-Gn; CtCNB1_R0085.
DR   EnsemblGenomes-Gn; CtCNB1_R0086.
DR   EnsemblGenomes-Gn; CtCNB1_R0087.
DR   EnsemblGenomes-Gn; CtCNB1_R0088.
DR   EnsemblGenomes-Tr; CtCNB1_R0001-1.
DR   EnsemblGenomes-Tr; CtCNB1_R0002-1.
DR   EnsemblGenomes-Tr; CtCNB1_R0003-1.
DR   EnsemblGenomes-Tr; CtCNB1_R0004-1.
DR   EnsemblGenomes-Tr; CtCNB1_R0005-1.
DR   EnsemblGenomes-Tr; CtCNB1_R0006-1.
DR   EnsemblGenomes-Tr; CtCNB1_R0007-1.
DR   EnsemblGenomes-Tr; CtCNB1_R0008-1.
DR   EnsemblGenomes-Tr; CtCNB1_R0009-1.
DR   EnsemblGenomes-Tr; CtCNB1_R0010-1.
DR   EnsemblGenomes-Tr; CtCNB1_R0011-1.
DR   EnsemblGenomes-Tr; CtCNB1_R0012-1.
DR   EnsemblGenomes-Tr; CtCNB1_R0013-1.
DR   EnsemblGenomes-Tr; CtCNB1_R0014-1.
DR   EnsemblGenomes-Tr; CtCNB1_R0015-1.
DR   EnsemblGenomes-Tr; CtCNB1_R0016-1.
DR   EnsemblGenomes-Tr; CtCNB1_R0017-1.
DR   EnsemblGenomes-Tr; CtCNB1_R0018-1.
DR   EnsemblGenomes-Tr; CtCNB1_R0019-1.
DR   EnsemblGenomes-Tr; CtCNB1_R0020-1.
DR   EnsemblGenomes-Tr; CtCNB1_R0021-1.
DR   EnsemblGenomes-Tr; CtCNB1_R0022-1.
DR   EnsemblGenomes-Tr; CtCNB1_R0023-1.
DR   EnsemblGenomes-Tr; CtCNB1_R0024-1.
DR   EnsemblGenomes-Tr; CtCNB1_R0025-1.
DR   EnsemblGenomes-Tr; CtCNB1_R0026-1.
DR   EnsemblGenomes-Tr; CtCNB1_R0027-1.
DR   EnsemblGenomes-Tr; CtCNB1_R0028-1.
DR   EnsemblGenomes-Tr; CtCNB1_R0029-1.
DR   EnsemblGenomes-Tr; CtCNB1_R0030-1.
DR   EnsemblGenomes-Tr; CtCNB1_R0031-1.
DR   EnsemblGenomes-Tr; CtCNB1_R0032-1.
DR   EnsemblGenomes-Tr; CtCNB1_R0033-1.
DR   EnsemblGenomes-Tr; CtCNB1_R0034-1.
DR   EnsemblGenomes-Tr; CtCNB1_R0035-1.
DR   EnsemblGenomes-Tr; CtCNB1_R0036-1.
DR   EnsemblGenomes-Tr; CtCNB1_R0037-1.
DR   EnsemblGenomes-Tr; CtCNB1_R0038-1.
DR   EnsemblGenomes-Tr; CtCNB1_R0039-1.
DR   EnsemblGenomes-Tr; CtCNB1_R0040-1.
DR   EnsemblGenomes-Tr; CtCNB1_R0041-1.
DR   EnsemblGenomes-Tr; CtCNB1_R0042-1.
DR   EnsemblGenomes-Tr; CtCNB1_R0043-1.
DR   EnsemblGenomes-Tr; CtCNB1_R0044-1.
DR   EnsemblGenomes-Tr; CtCNB1_R0045-1.
DR   EnsemblGenomes-Tr; CtCNB1_R0046-1.
DR   EnsemblGenomes-Tr; CtCNB1_R0047-1.
DR   EnsemblGenomes-Tr; CtCNB1_R0048-1.
DR   EnsemblGenomes-Tr; CtCNB1_R0049-1.
DR   EnsemblGenomes-Tr; CtCNB1_R0050-1.
DR   EnsemblGenomes-Tr; CtCNB1_R0051-1.
DR   EnsemblGenomes-Tr; CtCNB1_R0052-1.
DR   EnsemblGenomes-Tr; CtCNB1_R0053-1.
DR   EnsemblGenomes-Tr; CtCNB1_R0054-1.
DR   EnsemblGenomes-Tr; CtCNB1_R0055-1.
DR   EnsemblGenomes-Tr; CtCNB1_R0056-1.
DR   EnsemblGenomes-Tr; CtCNB1_R0057-1.
DR   EnsemblGenomes-Tr; CtCNB1_R0058-1.
DR   EnsemblGenomes-Tr; CtCNB1_R0059-1.
DR   EnsemblGenomes-Tr; CtCNB1_R0060-1.
DR   EnsemblGenomes-Tr; CtCNB1_R0061-1.
DR   EnsemblGenomes-Tr; CtCNB1_R0062-1.
DR   EnsemblGenomes-Tr; CtCNB1_R0063-1.
DR   EnsemblGenomes-Tr; CtCNB1_R0064-1.
DR   EnsemblGenomes-Tr; CtCNB1_R0065-1.
DR   EnsemblGenomes-Tr; CtCNB1_R0066-1.
DR   EnsemblGenomes-Tr; CtCNB1_R0067-1.
DR   EnsemblGenomes-Tr; CtCNB1_R0068-1.
DR   EnsemblGenomes-Tr; CtCNB1_R0069-1.
DR   EnsemblGenomes-Tr; CtCNB1_R0070-1.
DR   EnsemblGenomes-Tr; CtCNB1_R0071-1.
DR   EnsemblGenomes-Tr; CtCNB1_R0072-1.
DR   EnsemblGenomes-Tr; CtCNB1_R0073-1.
DR   EnsemblGenomes-Tr; CtCNB1_R0074-1.
DR   EnsemblGenomes-Tr; CtCNB1_R0075-1.
DR   EnsemblGenomes-Tr; CtCNB1_R0076-1.
DR   EnsemblGenomes-Tr; CtCNB1_R0077-1.
DR   EnsemblGenomes-Tr; CtCNB1_R0078-1.
DR   EnsemblGenomes-Tr; CtCNB1_R0079-1.
DR   EnsemblGenomes-Tr; CtCNB1_R0080-1.
DR   EnsemblGenomes-Tr; CtCNB1_R0081-1.
DR   EnsemblGenomes-Tr; CtCNB1_R0082-1.
DR   EnsemblGenomes-Tr; CtCNB1_R0083-1.
DR   EnsemblGenomes-Tr; CtCNB1_R0084-1.
DR   EnsemblGenomes-Tr; CtCNB1_R0085-1.
DR   EnsemblGenomes-Tr; CtCNB1_R0086-1.
DR   EnsemblGenomes-Tr; CtCNB1_R0087-1.
DR   EnsemblGenomes-Tr; CtCNB1_R0088-1.
DR   EuropePMC; PMC2772449; 19734336.
DR   EuropePMC; PMC3716083; 23576541.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00140; Alpha_RBS.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00504; Glycine.
DR   RFAM; RF01057; SAH_riboswitch.
DR   RFAM; RF01070; sucA.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01497; ALIL.
DR   RFAM; RF01750; pfl.
DR   RFAM; RF01850; beta_tmRNA.
DR   RFAM; RF01852; tRNA-Sec.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF01989; SECIS_3.
DR   RFAM; RF02194; HPnc0260.
DR   RFAM; RF02243; Xoo8.
DR   RFAM; RF02278; Betaproteobacteria_toxic_sRNA.
DR   SILVA-LSU; CP001220.
DR   SILVA-SSU; CP001220.
XX
CC   On Mar 3, 2014 this sequence version replaced CP001220.1.
CC   Source DNA and bacteria are available from State Key Laboratory of
CC   Microbial Resources, Institute of Microbiology, Chinese Academy of
CC   Sciences.
CC   The organism was changed from 'Comamonas testosteroni CNB-2' to
CC   'Comamonas thiooxydans' in October 2018.
CC   ##Taxonomic-Update-Statistics-START##
CC   This Genome (query) :: GCA_000093145.2
CC   Current Name        :: Comamonas thiooxydans
CC   Previous Name       :: Comamonas testosteroni CNB-2
CC   Date Updated        :: 2018-10-26
CC   Analysis Type       :: Average Nucleotide Identity (ANI)
CC   Analysis 1 (A1)     :: Query vs. TYPE genome for current name
CC   A1 Genome (subject) :: GCA_001418295.1
CC   A1 Name             :: Comamonas thiooxydans
CC   A1 ANI              :: 96.97829%
CC   A1 Query Coverage   :: 86.61%
CC   A1 Subject Coverage :: 88.37%
CC   Analysis 2 (A2)     :: Query vs. TYPE genome for previous name
CC   A2 Genome (subject) :: GCA_000740035.1
CC   A2 Name             :: Comamonas testosteroni CNB-2
CC   A2 ANI              :: 94.33658%
CC   A2 Query Coverage   :: 83.71%
CC   A2 Subject Coverage :: 83.2%
CC   ##Taxonomic-Update-Statistics-END##
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..5373644
FT                   /organism="Comamonas thiooxydans"
FT                   /strain="CNB-1"
FT                   /sub_strain="CNB-2"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:363952"
FT   gene            1..1407
FT                   /locus_tag="CtCNB1_0001"
FT   CDS_pept        1..1407
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0001"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /note="COG0593, DnaA, ATPase involved in DNA replication
FT                   initiation"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ACY30747"
FT                   /db_xref="GOA:A0A454XX05"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454XX05"
FT                   /protein_id="ACY30747.1"
FT                   /translation="MTEEPTNDAGQALWQVCVEQLGQELPEQQFNTWIKPLTALVAEDF
FT                   SKVTVYVANRFKLDWIRAQYAGRISAMLESLYGQPVTLELALAQRESVVRTYVRPPSST
FT                   QQAAPQTHNVAVPTVTSEEASAPVFRTRLNPALTFETLVEGTANRMARSAAMHVAGSPG
FT                   HLYNPLFIYGGVGLGKTHLVHAVGNQLLKDKPDAKILYIHAEQFVSDVVKAYQRRTFDE
FT                   FKERYHSLDLLLIDDVQFFANKDRTQEEFFNAFEALLAKKSHIVMTSDTYPKGLANIHE
FT                   RLVSRFDSGLTVAIEPPELEMRVAILINKARAENADMPEEVAFFVAKNVRSNVRELEGA
FT                   LRKILAYSRFNQKEVSIQLAREALRDLLSIQNRQISVENIQKTVADYYKIKVADMYSKK
FT                   RPASIARPRQIAMYLAKELTQKSLPEIGELFGGRDHTTVLHAVRKIAGERQTNTELNQQ
FT                   LHVLEQTLKG"
FT   gene            1590..2711
FT                   /locus_tag="CtCNB1_0002"
FT   CDS_pept        1590..2711
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0002"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /note="COG0592, DnaN, DNA polymerase sliding clamp subunit
FT                   (PCNA homolog)"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ACY30748"
FT                   /db_xref="GOA:A0A454XXW0"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454XXW0"
FT                   /protein_id="ACY30748.1"
FT                   /translation="MIVLKATQDKVLAVLQSVAGIVERRHTLPILANVLIKKTGNALQL
FT                   TTSDLEIQIRTTAELGGDAGDFTTTIGARKLIDILKTMPGDQTVSLETQQSKMILKGGK
FT                   SRFTLQTLPAEDFPLVQESAAFGPAFSVPQKVLKDLLGQVSFAMAVQDIRYYLNGILFV
FT                   AEGNTLSLVATDGHRLAWASATLDVEVPIKQEVILPRKTVLELQRLLSDASGENQPVIE
FT                   MQFANNQAKFTFGGMEFVTKLVEGKFPDYNRVIPRNHTNSVTLGRAPLLASLQRTAIMT
FT                   SDKFKGVRLSVEPGTLRVASNNAEQEEAMDELDIDYGGDTIEIGFNVTYLIDVLTNMSQ
FT                   DMVKIDLQDGNSSALVTIPENESFKYVVMPMRI"
FT   gene            2860..5427
FT                   /locus_tag="CtCNB1_0003"
FT   CDS_pept        2860..5427
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0003"
FT                   /product="DNA gyrase, B subunit"
FT                   /note="COG0187, GyrB, Type IIA topoisomerase (DNA
FT                   gyrase/topo II"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ACY30749"
FT                   /db_xref="GOA:D0J7K9"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR041423"
FT                   /db_xref="UniProtKB/TrEMBL:D0J7K9"
FT                   /protein_id="ACY30749.1"
FT                   /translation="MTEENKPDTQTAADAGGYGEGAIQILEGLEAVRKRPGMYIGDTSD
FT                   GTGLHHLVFEVVDNSIDEALAGYCDDILVTIHADGSLSVIDNGRGIPTGVKMDDKHEPK
FT                   RSAAEIALTELHAGGKFNQNSYKVSGGLHGVGVSCVNALSVWLKLTVSRDGRRHEIDFS
FT                   RGFVQNRLIEVVDGAEVSPMRVVGASDKRGTKVHFLPDQEIFKENFEFRYEILAKRLRE
FT                   LSFLNNGVRIRLKDERDGKEDDFSGAGGVKGFVQFINGTKKVLHPTTFHANGSRPAETY
FT                   GGIPGTEIGVEVSMQWNDSYAEQVLCFTNNIPQRDGGTHLTGLRAAMTRVIGKYIADNE
FT                   MAKKAKVEVSGDDMREGLCAVLSVKVPEPKFSSQTKDKLVSSEVRAPVEDIVAKSLTDF
FT                   LEENPNDAKILCGKIIEAARAREAARKAREMTRRKGVLDGMGLPGKLADCQEKDPALCE
FT                   IYIVEGDSAGGSAKQGRDRKFQAILPLRGKILNVEKARYEKLLSSQEIITLITALGTGI
FT                   GKVSEDSGKSSSDDYNPDKLRYHRIIIMTDADVDGAHIRTLLLTFFYRQMPDLVERGHI
FT                   YIAQPPLYKVKNGKEELYLKDGPALNKYLLKIALNHASVNTGGDNPRTVEGEELAKLAN
FT                   MHLAAETVIERLSNFMDAEALRAIADGVQIKLDTIEEAQECAPILEAKLRELTTTGVPA
FT                   DVTAEIDPNSEHPILRISRHHHGNIKSSILTQEFVRSHDYAALSDEAQNFVGLLGEGAK
FT                   VTRGEGEKAKTEKVGDFRQAMAWLISEAERTTGRQRYKGLGEMNPEQLWETTMDPNVRS
FT                   LLQVKIGDAIEADRVFTMLMGDEVEPRRNFIEDNALRAGNIDV"
FT   gene            5427..5924
FT                   /locus_tag="CtCNB1_0004"
FT   CDS_pept        5427..5924
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0004"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="COG1846, MarR, Transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ACY30750"
FT                   /db_xref="GOA:D0J7L0"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D0J7L0"
FT                   /protein_id="ACY30750.1"
FT                   /translation="MSSGDVGTSMDQDSQEAHALPLMPFVEDYLPALLAQASKLISAEF
FT                   HTVVESEGFSITEWRILASLTGTSGISTGRLAQISVSKQPTVTRLLDRMEAKGYVERFA
FT                   HDTDRRLTMVRIAPAGQTIVADLIRKAKEHELRVLQPFGLKRAEALKVTLRRIIELHLP
FT                   PG"
FT   gene            complement(5939..6871)
FT                   /locus_tag="CtCNB1_0005"
FT   CDS_pept        complement(5939..6871)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0005"
FT                   /product="hypothetical conserved protein"
FT                   /note="COG3181, Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ACY30751"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:D0J7L1"
FT                   /protein_id="ACY30751.1"
FT                   /translation="MTMVGTPALSQAVWPGKPVRFVVAFPPGGLADVLMRLLVPQLSEA
FT                   LGQPVIIDNRSGASGNVAAVEVARNGSDGRTFLVNVTTLESVNPLMFERMPIQPAKDLQ
FT                   HVALLANTQLFLVTRPTLAADTLAEFVAYAKANPGKLSYGSAGNGTTPHVGGELFKQAA
FT                   GITAAHIPYRGAAPAIQSVMAGQVDYALVPGTVFPSVKAGKLKLLAVASRRRPSYAADV
FT                   STIEEAGFGKVYVDTPFAVYAPAAMPAAHVMRMNRELNRLLAQPVIKARFAEVGAEPMT
FT                   LSPAELTAMVGEEAALFGPIVRTQGIKAD"
FT   gene            complement(6951..7679)
FT                   /locus_tag="CtCNB1_0006"
FT   CDS_pept        complement(6951..7679)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0006"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="COG1028, FabG, Dehydrogenases with different
FT                   specificities (related to short-chain alcohol
FT                   dehydrogenases)"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ACY30752"
FT                   /db_xref="GOA:D0J7L2"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D0J7L2"
FT                   /protein_id="ACY30752.1"
FT                   /translation="MGANKVAAVTGGSAGIGKVICEQLLEQGYEVVSLARRRTEIAHPR
FT                   LHSIEVDLADRAATAEAVQAMVRRHEVTTIVHNAGVIRAALLPDVKLSDLDALVDLHLG
FT                   CAVQMLQAALPAMRARRFGRVVLLSSRAALGLATRTSYSATKAGMQGMARTWALELAPE
FT                   GITVNVVAPGPIRTDMFYDVVEQGSDRERQLAASVPVRRLGESADVARAVGFFADAANS
FT                   FVTGQVLYVCGGTSVGSLAL"
FT   gene            complement(7790..8596)
FT                   /locus_tag="CtCNB1_0007"
FT   CDS_pept        complement(7790..8596)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0007"
FT                   /product="putative cyclase"
FT                   /note="COG1878, Predicted metal-dependent hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ACY30753"
FT                   /db_xref="GOA:D0J7L3"
FT                   /db_xref="InterPro:IPR007325"
FT                   /db_xref="InterPro:IPR037175"
FT                   /db_xref="UniProtKB/TrEMBL:D0J7L3"
FT                   /protein_id="ACY30753.1"
FT                   /translation="MQTPLELLGGMALAIATGRIRIVDLTQTLSPDFPAIALPPEMGQC
FT                   QPFRIEQISAYDERGPGWYWNNFSCGEHTGTHFDAPVHWISGRDLPNNAVDSIPPQHFI
FT                   APACVIDCSAQAAADPDYLMGVADIERFEAAHGRIPEGHWVLMRTDWARRWSQARDAEA
FT                   FQNFDASGQHTPGPDTEAVRFLVEQRGVLGFGTESIGTDAGQGYHLRPPYPCHSLMHGA
FT                   GKYGLQCLTNLDQLPPTGALVVAAPLKIENGSGSPLRVLALVEGKT"
FT   gene            complement(8598..9851)
FT                   /locus_tag="CtCNB1_0008"
FT   CDS_pept        complement(8598..9851)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0008"
FT                   /product="short-chain alcohol dehydrogenase"
FT                   /note="COG4221, Short-chain alcohol dehydrogenase of
FT                   unknownspecificity"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ACY30754"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR002878"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022002"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D0J7L4"
FT                   /protein_id="ACY30754.1"
FT                   /translation="MTMPFIKPPRKNPVLRTPQINLPPAARGRVALGLTAAAAEGRFAL
FT                   QVCADCGAVQYPPREACHRCLSPELPWQPQSGAGELLAMTTLAHSNDLYFRERLPWHLG
FT                   MVWLDDGPSVMVHLHGEVGAAPCRVRVQAHLDRAGQAVLIGYPEKGTENMADDPMLREM
FT                   ASDPKYRKVLVTDGKSATGQAVVRAMVKAGADLVWVGHAEPWKKLPGLAELAALPQVAL
FT                   VPLDVTDERSVSTLAGQIGGKVDIVVNTAELHRGFGIAARRGTDVAKAEMEVNYLGLLR
FT                   LAQCFGPALKGRAADGATHATAWVNLLSIYALANFPPHGTFSASKAAALSLAQCLRAEM
FT                   RAAGIRVVNVFPGPIDDEWNQNLPPPKLAPAALASAIVKALKEGVEDIYPGDVAQEWLE
FT                   RWRHNPKVLEREIAAGGY"
FT   gene            complement(9937..11115)
FT                   /locus_tag="CtCNB1_0009"
FT   CDS_pept        complement(9937..11115)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0009"
FT                   /product="hypothetical protein"
FT                   /note="COG0183, PaaJ, Acetyl-CoA acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ACY30755"
FT                   /db_xref="GOA:D0J7L5"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="UniProtKB/TrEMBL:D0J7L5"
FT                   /protein_id="ACY30755.1"
FT                   /translation="MTAYIRRRGYEGVALAVPVTVPYERYSIRGAHWFLGQAVRGLLQG
FT                   SGLAKEQIDGLTVSSFSLVPDTAVGVTQHLGLLPRWLDHIPTGGASGVMALRRAARAVQ
FT                   CGDAEVVACVAADTNHVDSFRQTLGAFSDFARDASYPYGAGGPNSMFAFITASYMRTYG
FT                   AQREDFGRIAVAQRANALCNPNALFKKPLTLDEYMTARPISDPIHLFDCVMPCAGAEAF
FT                   LVMAPERARDLGLPHVLLRGAIERHNAYADDPVMLRGGWRMDCADLYAQAGFAPQDIDL
FT                   LQTYDDYPVIAMMQIEDLGFCDKGEGPAFVRGHDLTHAGDFPHNTSGGQLSCGQAGAAG
FT                   GFLGMTETLRQLTGQAGERGVAGARTGLVGGFGMVTYDRCLCTGAVILETSE"
FT   gene            complement(11118..12095)
FT                   /locus_tag="CtCNB1_0010"
FT   CDS_pept        complement(11118..12095)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0010"
FT                   /product="Twin-arginine translocation pathway signal"
FT                   /note="COG3181, Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ACY30756"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:D0J7L6"
FT                   /protein_id="ACY30756.1"
FT                   /translation="MRALPFLKRSLALLLCSACLVCGAAAQDAYPGKPIRIIVPFPPGG
FT                   GSDLVARTVAARLGERWKVPVMVDNKPGGNTIIAAEAAAKAAPDGYTLFVAIDSTLAMN
FT                   QSLYGKLPYDPARSFAPVTLAITMPMVLAAHPSVSARTVSELLAVARAQPGKLAYAHGA
FT                   MPAQVAGEVFKSATGADLLAVPYKGGAPAMTDTVGGQVPLIFDALGPAMPYIKGGKVRA
FT                   LAVTSAQRNPLLPDVPTLAESGVSGVDLLTWIGFVVPAGTPQPVIARLHQELASILQMP
FT                   QTRELLSGVGMTVVAGTPEQFAQTIQGDTQKFGRIIRAAGIRLD"
FT   gene            complement(12112..13692)
FT                   /locus_tag="CtCNB1_0011"
FT   CDS_pept        complement(12112..13692)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0011"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="COG0318, CaiC, Acyl-CoA synthetases
FT                   (AMP-forming)/AMP-acid ligasesII"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ACY30757"
FT                   /db_xref="GOA:D0J7L7"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:D0J7L7"
FT                   /protein_id="ACY30757.1"
FT                   /translation="MSTAIESFAPVGRTLPAMLEQQCRRFPERTLLVAGDTRWRYADAL
FT                   RTAQAMGAVLQVAGLRAGDRVALMCGNRAEFLQVFLGCAWIGAITVPVNTAVRGATLRH
FT                   ILANSGARLFVAEAEGLAALRGLEDRDGLPLERVWRIDAPQEPGTEPFPAPGDALVDAA
FT                   PVQPGDTLAILYTSGTTGLSKGVCCPHAQFYWWGRHTAELLELGDGEVLLTTLPLFHTN
FT                   AMNAFFQALLTGSTLVVEKRFSASGFWAALVRHQATATYVLGAMVPILLSKEATPHDRA
FT                   HRVRIALAPGVPPRFHAQFSERFGMRLLDGYGSTESNFVIGLDAEQRPGSMGRIVPGFT
FT                   ARVADEHDEDVPPGTPGELLLRADEPFAFATGYFGMANKTVEAWRNLWFHTGDRVVRDA
FT                   DGFFTFLDRLKDAIRRRGENISSYEVEQVLLSHPAVAVAAVFPVKSELAEDEVMAAIVP
FT                   REGTALNPVDLVRFCEPRMAYFAVPRYLEFMAALPATENGKVQKFKLRERGITAQTWDR
FT                   EAAGIQLKR"
FT   gene            complement(13704..14195)
FT                   /locus_tag="CtCNB1_0012"
FT   CDS_pept        complement(13704..14195)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0012"
FT                   /product="Small subunit of phenylpropionate dioxygenase"
FT                   /note="COG5517, Small subunit of phenylpropionate
FT                   dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ACY30758"
FT                   /db_xref="GOA:D0J7L8"
FT                   /db_xref="InterPro:IPR000391"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:D0J7L8"
FT                   /protein_id="ACY30758.1"
FT                   /translation="MNTLPPTDRQLIDFVLDEAALLDEQRWGDWLALFTEDGRYWMPLA
FT                   HGQTDPRLHASLLYEDRLLLQVRIERLRGTRTFSQQPASRCHHLLQTPRVTARDDAAGT
FT                   YTCRTAFHYIETRQDEQTLYAGWASHELVWQGDGALRMRLKRVDLVNCDAAFGNMQLFM
FT                   "
FT   gene            complement(14192..15535)
FT                   /locus_tag="CtCNB1_0013"
FT   CDS_pept        complement(14192..15535)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0013"
FT                   /product="HcaE, Phenylpropionate dioxygenase-like
FT                   ring-hydroxylating dioxygenases, large terminal subunit"
FT                   /note="COG4638, HcaE, Phenylpropionate dioxygenase and
FT                   related ring-hydroxylating dioxygenases"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ACY30759"
FT                   /db_xref="GOA:D0J7L9"
FT                   /db_xref="InterPro:IPR001663"
FT                   /db_xref="InterPro:IPR015879"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:D0J7L9"
FT                   /protein_id="ACY30759.1"
FT                   /translation="MSEYRDNPAAIRALVRDTEVHKDCYIHPEIFALEMEQLFANTWIY
FT                   VGHASQVPQPGDYFATTVGDQPVVMVRHTDQSIKVLYNRCAHKGVKVAPDGCGSTGKFF
FT                   RCPYHAWTYRTDGKLLSIPLKKGYENTGLESCEASKGLAAVSAVQVYRDFVFCRLNPEG
FT                   MGFEEFFGPSLSTLDNMVDRSPEGRLEVAGGVMRYMHRCNWKMLVDNQTDTCHPMVAHE
FT                   SSAGTAVKVWENAPEGTPKPMAVELFAPFVNPYEFFENMGIRVWPNGHGHTGVSDSIHA
FT                   AYSPAPGYWESMVATYGEERAKDILGDVRHNTVYFPNIMVKGPIQTLRIFRPLAADRTL
FT                   VESWTFRLVGAPDLLLERTLMYNRLVNAPTSVVGHDDLEMYERAQQGLASRGSQWVNVG
FT                   RLFDPAEKVQEDAQAGAVTNGTNEWQMRSQMRAWVRFMTAGMREGAEA"
FT   gene            complement(15546..16517)
FT                   /locus_tag="CtCNB1_0014"
FT   CDS_pept        complement(15546..16517)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0014"
FT                   /product="hypothetical conserved protein"
FT                   /note="COG3181, Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ACY30760"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:D0J7M0"
FT                   /protein_id="ACY30760.1"
FT                   /translation="MKSTTLSRRQVLSLLPLAAAPSLALADGKPIEWVVGYAPGGGSDT
FT                   VARMLAEAMGRSMGRSIIIINKPGAGSNIAGDYVAKARDAEHMVFTADSAVIAANPFLY
FT                   SKLTYSAEKDFASVGTIARFPLVLVVQPNAKPRNLKDFMAWVRSDPAGMSYGSPGTGSP
FT                   HHLATELFRQQTGLTLTHVPYRGAAPAIADVVGGQLPFMFVDTSSGGAFITSGKVRAIG
FT                   VASAQRLASMPDIPTLSEQGLSGFEASAWQALVAPAGVSAATVKTLNKHLVDALSSADI
FT                   RARMQTLGIEPLPGTPQELARFAAQERERWGRVVREANIKLD"
FT   gene            complement(16571..17560)
FT                   /locus_tag="CtCNB1_0015"
FT   CDS_pept        complement(16571..17560)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0015"
FT                   /product="oxidoreductase FAD/NAD(P)-binding protein"
FT                   /note="COG1018, Hmp, Flavodoxin reductases
FT                   (ferredoxin-NADPH reductases)family 1"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ACY30761"
FT                   /db_xref="GOA:D0J7M1"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:D0J7M1"
FT                   /protein_id="ACY30761.1"
FT                   /translation="METIAVEIVAADQLNPLIRRFTLRAADGGLLPGFAAGAHVRVQVG
FT                   LPGKAQGEVQDWRHYSLVNTDAGADTGLPQPHYTIAVRREDEGRGGSRWMHGLQPGQCI
FT                   AIEPPKNDFPLGAHVGCAVLVAGGIGITPLASMAAARHAAGLPVRMLYAGRSRALMAFL
FT                   PELQALLGESLAVHADEDRGAALDVATLLDGCAGEDQLYVCGPRAMLDAVLAATDARGW
FT                   PRERVHFELFTTPVAAVGDQPIDLVLAQSGRQLTVPAGQSILDCLIEHGCDPLFDCKRG
FT                   ECGVCAAEVIEGEIDHRDAVLSAAERAGGKVMQICVSRARSARLVLDL"
FT   gene            complement(17573..19069)
FT                   /locus_tag="CtCNB1_0016"
FT   CDS_pept        complement(17573..19069)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0016"
FT                   /product="PorG, Pyruvate:ferredoxin oxidoreductase-like
FT                   2-oxoacid:ferredoxin oxidoreductases, gamma subunit"
FT                   /note="COG1014, PorG, Pyruvate:ferredoxin oxidoreductase
FT                   and related 2-oxoacid:ferredoxin oxidoreductases"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ACY30762"
FT                   /db_xref="GOA:D0J7M2"
FT                   /db_xref="InterPro:IPR019752"
FT                   /db_xref="UniProtKB/TrEMBL:D0J7M2"
FT                   /protein_id="ACY30762.1"
FT                   /translation="MKTQPIKIAILAMGGEGGGVLADWIVDLAEHSDYIAQTTSVPGVA
FT                   QRTGATIYYVELYPAEQARRDGAQPVLALMPLPGDVDVVLASELMEAGRAVQRGLVTPD
FT                   RTTLISSTHRVYAIAEKTAMGDGRVDDAQLLAHAGRAARRFVRFDMAAAAQASGSVVSA
FT                   VLFGALAGTGVLPFNRAQFGATIERGGVGVKASLRAFGGACDQAQQADSASPATATAAA
FT                   AVATPRDPQVAALLQRVEQGFAADARPVIIDGVRRMLDYQDPDYAALYLDRLERVQALA
FT                   EGSGLLLRETARHLALWMSYEDTIRVADLKTRAQRFARVQSEVGVQQGQQLAINEFMHP
FT                   RIEEICETLPAGLGRWLQRPHAVHRLLARFTREGRVVVTSSLRGYLLLWGLSRLRGMRR
FT                   RTLRYEIENTRIEQWLAHIEAAAQHNPALAVEVAQCQRLVKGYSDTHARGLANYLHLMD
FT                   AVRAAGRRLAPATLRELREAALADEHGKALRAALARHALA"
FT   gene            complement(19082..21247)
FT                   /locus_tag="CtCNB1_0017"
FT   CDS_pept        complement(19082..21247)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0017"
FT                   /product="Indolepyruvate ferredoxin oxidoreductase, alpha
FT                   and beta subunits"
FT                   /note="COG4231, Indolepyruvate ferredoxin oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ACY30763"
FT                   /db_xref="GOA:D0J7M3"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:D0J7M3"
FT                   /protein_id="ACY30763.1"
FT                   /translation="MAERSFVEEVKKLRLGAGEVFHGEGILAVTKALLESGVNYVAGYQ
FT                   GAPISHLMDVLADAQDILAEHGIRFENSASEATAAATLAASVNYPLRGAVTFKATVGTN
FT                   VASDALANLASGGVKGGALVIVGEDYGEGSSIMQERSHAFAMKSQIWLLDPRPNLPGIV
FT                   QAVKDGFELSEASNTPVMLQLRIRACHVHGQFTASDNRRPAYTIEQAMARPQRDVDRIV
FT                   LPPASFLHEQEKLKQRWPAAVRFIEERGLNEFFAEGADDIGIACQGGSYNTLIRALQQL
FT                   DLADAYGNTQIPLYVMNVAYPLVDGELLRFCEGKRALLVVEEGQPNFVEQNVATILRQA
FT                   GSATQLHGKDVLPAAGEYTTAAVLKGLRAFLEAHGRLQPQPAPRKIIPLQPASPEPERP
FT                   IEASVQARPPGFCTGCPERPIFTAMKLVERELGEHHVSADIGCHLFSILPPFNLGNTTM
FT                   GYGLGAAGAAAFNPQQPKEGGKRVISVMGDGGFWHNGLTSGIANAVFNKSDNLTIVVDN
FT                   SYTSATGGQDILSSAAQNPTRSTNHAIEKAVRGVGVNWVKTVRRTYDLKAMVGTLREAL
FT                   TTKEQGPKVLVAQSECMLNKQRRVKPQQRAAAARGERVVRERFGVDSDTCTGDHSCIRL
FT                   SGCPSLSIKPNPDPLRTDPVATVIDSCVGCGLCGEVSHAAVLCPSFYRAQIVSNPTRWD
FT                   RLRQRLRGAVIGWLQGRDQRRLDRHAF"
FT   gene            complement(21793..22014)
FT                   /locus_tag="CtCNB1_0018"
FT   CDS_pept        complement(21793..22014)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0018"
FT                   /product="hypothetical protein"
FT                   /note="COG4242, CphB, Cyanophycinase and related
FT                   exopeptidases"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ACY30764"
FT                   /db_xref="UniProtKB/TrEMBL:D0J7M4"
FT                   /protein_id="ACY30764.1"
FT                   /translation="MDRCRKRKKAYSAEIIEKVNGVFEVELTDGDQLLYVGGVLKDQLL
FT                   EEQMLIKRSARSSSTAHRICAIRCATPS"
FT   gene            complement(22246..22863)
FT                   /locus_tag="CtCNB1_0019"
FT   CDS_pept        complement(22246..22863)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0019"
FT                   /product="Putative GSH-dependent dehydroascorbate
FT                   reductase"
FT                   /note="COG0625, Gst, Glutathione S-transferase"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ACY30765"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="UniProtKB/TrEMBL:D0J7M5"
FT                   /protein_id="ACY30765.1"
FT                   /translation="MASQTTLYYAAGTCAQAVLIALYEADAQFTLKTLSFADNEQRSPE
FT                   YLSINPKGRVPALATERGVLTETPALLLYVAQTHPQARLAPLEDPFALAQMQEFNAYLA
FT                   STAHIAHAHRPRASRWADDEAAQAAMRAKVPQNMRECFAVIEQHYLGDKTWVMGEQFTV
FT                   ADGYLYTVAGWLKGDGVDIAEFPRVAAHFERVKARASVQRLG"
FT   gene            23020..23427
FT                   /locus_tag="CtCNB1_0020"
FT   CDS_pept        23020..23427
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0020"
FT                   /product="Predicted Fe-S-cluster oxidoreductase"
FT                   /note="COG0727, Predicted Fe-S-cluster oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ACY30766"
FT                   /db_xref="InterPro:IPR005358"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454Y3Q2"
FT                   /protein_id="ACY30766.1"
FT                   /translation="MKSSIRIVDVDRLETWSKYKAGMCDSCAANCCTMPLEVRLPDLVR
FT                   LELVDPFEVENIEPKLIAKRLLKMRLIDHFNPKHEIFTMARRAGGDCNFLDKNTRRCTV
FT                   YEKRPETCRLHPKKGPKPGFCAYGNKALSQI"
FT   gene            complement(23446..24843)
FT                   /locus_tag="CtCNB1_0021"
FT   CDS_pept        complement(23446..24843)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0021"
FT                   /product="periplasmic sensor signal transduction"
FT                   /note="COG0642, BaeS, Signal transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ACY30767"
FT                   /db_xref="GOA:D0J7M7"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D0J7M7"
FT                   /protein_id="ACY30767.1"
FT                   /translation="MMRSRPWSSLAFRLALSYGGLLVLTMAIVLAVFYVQTVGVVRVRL
FT                   DKQAENHVRRLTEHSAKYGPGALESEILQTIRDGVNTDTEILILMNPQGETIVSNAEVY
FT                   PPRKLSIMGVRELTVKRNGRLMVGRVAVVEMPNGNLLAVGSDMQLQRDMEELFGQASLL
FT                   AAVAACIMALIGAMVFRRVVDERAAAIRNTMSRVAAGDLRQRIPVDQRGDEFTLLNRDI
FT                   NAMLDRLEQLMEGIRHVSNSIAHNLRTPLTRILLRLRNAQQASPEMQSATLALVAEEVA
FT                   ELGVVFEKLLQIAEVESGASRKSFAPVDLQALLVDVVDFYEPLVEDAGGILRLDVQQGV
FT                   QALGDGDLLASAVSNLVDNAIKYGASSSDIHGADVLLRAAPAQEQGSDGAWGVEITVQD
FT                   QGPGADPQTLEKMTTRFYRAESDRPGYGLGLASVLAIVQLHGGKLSFHNANPGMVARIW
FT                   LPAVADV"
FT   gene            complement(24843..25547)
FT                   /locus_tag="CtCNB1_0022"
FT   CDS_pept        complement(24843..25547)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0022"
FT                   /product="two component transcriptional regulator"
FT                   /note="COG0745, OmpR, Response regulators consisting of a
FT                   CheY-likereceiver domain and a winged-helix DNA-binding
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ACY30768"
FT                   /db_xref="GOA:A0A454XJR5"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454XJR5"
FT                   /protein_id="ACY30768.1"
FT                   /translation="MYRYLIIEDDALNARYIAEGLRQQGAHVSVCGDGVQGIAQAVGEN
FT                   WDVIILDRMLPNGFDGLQILQTLRSMGKQTPVLVLSALSATDERVRGLKAGCDDYLTKP
FT                   FAFSELSARLEALVRRAQIPAPTREMQVADLRVNLISRSAERAGQPLSLQPREFRLLAF
FT                   LMQHAHQIVTRTMLLESVWDYRFDPQTNVIDVHISRLRSKVDKGFATPLIHTVRGVGYS
FT                   LSDQPQDLPEVV"
FT   gene            complement(25670..26950)
FT                   /locus_tag="CtCNB1_0023"
FT   CDS_pept        complement(25670..26950)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0023"
FT                   /product="outer membrane efflux protein"
FT                   /note="COG1538, TolC, Outer membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ACY30769"
FT                   /db_xref="GOA:D0J7M9"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="UniProtKB/TrEMBL:D0J7M9"
FT                   /protein_id="ACY30769.1"
FT                   /translation="MNKWHSLAMAAALCCGAFSGTGHAAEAMDAAAQSNAAAGRLAAPA
FT                   QPVTLQEYLRIVVQNQPNLAADRMQLDLAKADSKTAATIPNPAMHYSSKRGEKEWGVEQ
FT                   AIPIFGQRGMRIENARLGEKAAAANADVAVAVTMSDAAHAFNELLVAQQRYQVWLAARD
FT                   ELEKAGNIVKGQIEAGTRSRYDGARLNLQQAQMSMQVSKAQAALRDAASRVASIAALPQ
FT                   WQVRVEGSLQATDIRKAASYEQLWNQAQTQLPSLRAAQAELDRSRQKIKLEQREALPTP
FT                   SFGLARIRNSVDGSFNQVGVSVEIPLFDRRQGPIERAKVEADQAELRRDAAVLAAQSEL
FT                   QRALQQLSLRRTAVRDYEKEGLAQIAPLHQMAQDAYKLGKGTILELIDALGSITEHRLE
FT                   HLELVKDMLDAEWEVRLASGDLPQVQP"
FT   gene            complement(26943..30056)
FT                   /locus_tag="CtCNB1_0024"
FT   CDS_pept        complement(26943..30056)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0024"
FT                   /product="cobalt-zinc-cadmium resistance protein,CzcA"
FT                   /note="COG3696, Putative silver efflux pump"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ACY30770"
FT                   /db_xref="GOA:A0A454XRX3"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR004763"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454XRX3"
FT                   /protein_id="ACY30770.1"
FT                   /translation="MLRSFIAFVVHRRLLALCATLAIAIYGVYAYLQTAIEAYPDVTNV
FT                   QVGVITQAPGLAPEEVERQITQPLERELNGTPGLISLRSESYFGLSMINLVFNDDAKSF
FT                   TARAEVSQRLPQADLPNGVTPEMAPDYTPLGKIFYYRLQSDRHTLAQLRTEQEWHVVRV
FT                   LKQVQGVADVVSIGGFVKEFHVEVDPEKLYSLGLSLDDVSDALSKSNRNVGGGLMRRGE
FT                   QSFIIRGIGLLRNPQEIQDVVVAMRGKAPVTIGDVARVAQSHTPRQGSVGMDDQNDVVQ
FT                   GIVLLKRGANPSIVLDDIHAKVDELNSGGLPEGMHMVTNYDRSDLVGHTLKTVQHNLLF
FT                   GATLIVAVLWLFLRSLRGSLIVATVIPLSLLVAFIGLHWLGMPANLISMGAIDFGIMVD
FT                   GAVVLAENIIRNARQRKPQTANDMRHIIVDSAVAVAKPTLFAMAIVIAALIPVFSLQSI
FT                   EGRIFRPLAMTYSFALLGALVFAMGLVPALCALMLKPKHVMVEEPKIFDRAHHGYQHWI
FT                   AKVLGAAKRRTAVIAVFVSVLVVAGVSAKWLGTEFLPELDEGDAYVLVQMPASISLEKG
FT                   QEVLRDVRLRLKVFPEVITVTTEQGRPESGTDNETLNLAKVLVRLKPHGDWRKGLTKPA
FT                   LIEEMRATLGEIPGVAFNFAQPIRDSVEESTSGARGQVVLKLFGPDIPTLRGILQQTKS
FT                   LVKGIDGVVDLDLYRDAPAPQVHVQFDRQALARQGIAMEDAQKTLEVALAGNVATTLWE
FT                   GEFPVPVRVRLPYVDRMDEERIRNIAIPLPDGGSVPLGSVGTVSMKIGNSSIFREGNAR
FT                   YMALKFNVEGRDIGSVVKDTLATFKQNVKLPEGYQAVWGGEWENQQRAAARLKVVVPLS
FT                   LVIVYALLFGALGQARSAGIILLCAPFAMVGGIAALHLAHIELSISAAIGFIALLGQVA
FT                   LAGLLVVSAVEDLRRQGMPLMQALIEGAAERMRSIILVALLALLGLLPMALSTGVGSET
FT                   QRPFASVIVGGMVVLPLVALVLLPVLYALLGPKNMLTQEERDESAQDE"
FT   gene            complement(30077..31240)
FT                   /locus_tag="CtCNB1_0025"
FT   CDS_pept        complement(30077..31240)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0025"
FT                   /product="nickel and cobalt resistance protein CNRB"
FT                   /note="COG0845, AcrA, Membrane-fusion protein"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ACY30771"
FT                   /db_xref="GOA:D0J7N1"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:D0J7N1"
FT                   /protein_id="ACY30771.1"
FT                   /translation="MNKSLVGLPGAAHLPNWTWARLPVVAAAIAVAGLLGGCDASKATE
FT                   EAKKPVAQLPKGFIQVKPESVKMLEIAPVADPQGVQMAWAPAHVAFVEDRVASIAVPLS
FT                   ARVVAVNAHVGDMVKAGDLLATLVSPDALRTRYDVAAAKTAHDVAVVEAQRQQTMVDKG
FT                   VGVEVDLRAAQAKLRETSQELGRAQGTAALLGSGGGDRIELRAPRAGIVAERKAVVGTA
FT                   AEPGAALFMIGDPQAMNVVAEVFESDLPGIRLGSSVQVEVPQLPKPIKGTVRHLGATLD
FT                   KESRRAAVVVELSEQNPVLRPGMQAKVGVQLSNLQEMLIPVTAVLIKDESRSVVYVQHE
FT                   NNQFEARVVTLGRPSRGMVPVISGLKVGEKIVVRGGLLLDGAASQLL"
FT   gene            32256..34427
FT                   /locus_tag="CtCNB1_0026"
FT   CDS_pept        32256..34427
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0026"
FT                   /product="Helicase c2"
FT                   /note="COG1199, DinG, Rad3-related DNA helicases"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ACY30772"
FT                   /db_xref="GOA:D0J7N2"
FT                   /db_xref="InterPro:IPR006555"
FT                   /db_xref="InterPro:IPR010614"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014013"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR039000"
FT                   /db_xref="UniProtKB/TrEMBL:D0J7N2"
FT                   /protein_id="ACY30772.1"
FT                   /translation="MHEKKWAEEALNSFDAVVGAMPGFRSRDGQRKMAAQIAQTLSQAQ
FT                   LGKVDEGEPEPRRAIAVVQAGTGVGKSLAYSIPAIRMALSRGTRVLISTATVALQEQLV
FT                   NKDLPALAQKLDQPFKFALAKGRGRFVCKLKLERLASTGEAQDEMDDLFGDEQGQTKFS
FT                   RPQHELQARMQFYKSMADALATEAWNGDRDSLETPPEAEAWSPVAAESSSCTGKHCPAF
FT                   GNCVYYERRKDLVAAQVIVANHDLLLSSLGSKLLPELDNCLLVLDEAHHLPSTALDQFA
FT                   GEMDLSRLGWIDKLASRALRVNQVAEVEELADVPKHAGQLRQQMQELARLVMEHYGETL
FT                   KSQKDSYGPARVRAPRGMLPEALLEPLGQIAHHADGFLDALRAVSKALRAEIKEQPEEA
FT                   QRLSTVYAQVGALAPRLEAIFNTTQLLLQNNESDGDGKMVPHAKWFTLEMDGEFIVVKA
FT                   HASPIQPGSTLRQHLWSQVRGAVLTSATLTSCGHFDFFLREAGLANDDSVTTLEVPSPF
FT                   DYARQGTLVARETASDPREAARFTEEMVEALLNDLSRIEAGALVLFTSREQMRQAVDAL
FT                   STSMRNQVLVQTALPRQTLLARHREAVAMGEPSIIFGMQSFGEGLDLPGALCESLFITK
FT                   LPFAPPDDPVGEARAEWLRSSGRNPFNELVVPATAIRLAQWVGRAIRTEEDQAHVYCYD
FT                   RRLTGTSYGQLLIKGLPPFTLQRSPVSMP"
FT   gene            complement(35894..36469)
FT                   /locus_tag="CtCNB1_0027"
FT   CDS_pept        complement(35894..36469)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0027"
FT                   /product="conserved hypothetical protein"
FT                   /note="COG5640, Secreted trypsin-like serine protease"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ACY30773"
FT                   /db_xref="GOA:D0J7N3"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="InterPro:IPR018550"
FT                   /db_xref="UniProtKB/TrEMBL:D0J7N3"
FT                   /protein_id="ACY30773.1"
FT                   /translation="MAIDMKKLQLATNLVVPMLIGLTSPMLHAQPVQASTTGLYLQYGS
FT                   AEHSTDSWTGGVILPWNWSYALGSGRMTGYWDLSVSRWSADYQGGNRSTWVLGAQPTLR
FT                   WRPSQGQSPWFLQAGLGVSYAINHRFITDHKEFSTRYNFASHIGIGYLFGEQLKNEISL
FT                   RFEHQSNAGIKRPNPGENFLQLRYARHF"
FT   gene            complement(36675..37292)
FT                   /locus_tag="CtCNB1_0028"
FT   CDS_pept        complement(36675..37292)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0028"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ACY30774"
FT                   /db_xref="GOA:A0A454XIM3"
FT                   /db_xref="InterPro:IPR012899"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454XIM3"
FT                   /protein_id="ACY30774.1"
FT                   /translation="MPIQEQDQAATSSTSTEKETDMTRFRQTLTSAAVATALLASLSLP
FT                   SFAQTTAAAEQPAAAQKAPEPHKHQRGDKRGDRMEHMKQRMEKLKADLKLTPAQQTAWT
FT                   TYTQAMKPGERPAPGDREAFAKLTTPERIDKMREMRGKRMAEMDRRAEATKAFYAQLNA
FT                   EQKKTFDAATLHMHHQRGEHHHGHHGGKPGQERPAAPAPAAK"
FT   gene            37492..38529
FT                   /locus_tag="CtCNB1_0029"
FT   CDS_pept        37492..38529
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0029"
FT                   /product="putative exonuclease, RdgC"
FT                   /note="COG2974, RdgC, DNA recombination-dependent growth
FT                   factor C"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ACY30775"
FT                   /db_xref="GOA:D0J7N5"
FT                   /db_xref="InterPro:IPR007476"
FT                   /db_xref="UniProtKB/TrEMBL:D0J7N5"
FT                   /protein_id="ACY30775.1"
FT                   /translation="MFKNMIVYRIAESWQGDLQLLEDALQKTVFEECGATQERSVGWVP
FT                   PRGEAHGPLAESVAGQWVMRFMSESKMLPASVLNRKVNEKAEHIEKTEGRKPGKKEKKE
FT                   LKDEAKLDLLPMAFTKQGSMWVWIDAQARTLVLDTSAQGRADEIVTLLVEGLPGFAVAL
FT                   LDTQTSPQAAMAHWLMTQEPPAGFSIDRECELKAADESKAVVRYARHPLDIDEVRQHIE
FT                   HGKLPTKLAMTWDDRVSFVLSEGLQIKKIALLDAVMDGNSQDDGGFDTDVAIATGELSR
FT                   LIPDLIEALGGEGRTGLGDGLPASLSSAPAAETLPVRLAQGRGQGTFTGPATAPADTAP
FT                   EEAPF"
FT   gene            complement(38693..39880)
FT                   /locus_tag="CtCNB1_0030"
FT   CDS_pept        complement(38693..39880)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0030"
FT                   /product="acetyl-CoA acetyltransferase"
FT                   /note="COG0183, PaaJ, Acetyl-CoA acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ACY30776"
FT                   /db_xref="GOA:A0A454XL83"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020610"
FT                   /db_xref="InterPro:IPR020615"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454XL83"
FT                   /protein_id="ACY30776.1"
FT                   /translation="MSTRDIFVVSAARTAIGTFGGSLKDVPNAQLATTVVKAAIARAGI
FT                   AADTVGHVVMGNVIPTDTRDAYLSRVAAVDAGCPIETPAFNVNRLCGSGLQAIVSAAQS
FT                   IALGDCEVAIGAGSESMSRGPYFDMSARWGARMGDAKSIDYMLGILHDPWQKMHMGITA
FT                   ENVAERYKISRVMQDELAVISQQRAAAAIEAGRFKEQIVPVEIASRKGVVLFDTDEHVR
FT                   AATTLDTLAGMKPAFKKEGGTVTAGNASGINDGAAAVLMMSEQALKSSGAKPIARLVGY
FT                   AHAGVEPAYMGIGPVPATQKVLARTGLKIEQMDVIEANEAFAAQACAVIQELALDPAKV
FT                   NPNGSGISLGHPVGATGAIITTKALYELQRTGGRYALVTMCIGGGQGIAAIFERV"
FT   gene            complement(40060..40566)
FT                   /locus_tag="CtCNB1_0031"
FT   CDS_pept        complement(40060..40566)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0031"
FT                   /product="transcriptional regulator, MerR family"
FT                   /note="COG0789, SoxR, Predicted transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ACY30777"
FT                   /db_xref="GOA:D0J7N7"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR011789"
FT                   /db_xref="InterPro:IPR015358"
FT                   /db_xref="UniProtKB/TrEMBL:D0J7N7"
FT                   /protein_id="ACY30777.1"
FT                   /translation="MPNHPSTQKIAQNWPVVIGEAARRAGVSARMVRHYESLGLLPPVH
FT                   RTDSGYRQYTEADVHALRFIRRGRDLGFSMDEIATLLGLWQDQGRASSQVKAIAQKHIA
FT                   TLTERIAAMQSMQRTLQTLVHCCHGDDRPDCPILDDLASADTDLTPAHHEPMAPTPRSR
FT                   RRTAA"
FT   gene            complement(40643..40837)
FT                   /locus_tag="CtCNB1_0032"
FT   CDS_pept        complement(40643..40837)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0032"
FT                   /product="copper-transporting ATPase"
FT                   /note="COG2608, CopZ, Copper chaperone"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ACY30778"
FT                   /db_xref="GOA:A0A454XLN8"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454XLN8"
FT                   /protein_id="ACY30778.1"
FT                   /translation="MQQVFEVQGMTCGHCERAVTNAIQGVDAQAQIKIDRAANRVEVET
FT                   GASREAVAAAIAEEGYKVA"
FT   gene            41110..42798
FT                   /locus_tag="CtCNB1_0033"
FT   CDS_pept        41110..42798
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0033"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="COG0840, Tar, Methyl-accepting chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ACY30779"
FT                   /db_xref="GOA:D0J7N9"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR024478"
FT                   /db_xref="UniProtKB/TrEMBL:D0J7N9"
FT                   /protein_id="ACY30779.1"
FT                   /translation="MSLLEMMRGFTIRTRMLGAIGVVMVLLSLLGGAGMLGMFRIQDMS
FT                   QEFLSNAFVKSGHMAQLRTELGGIRSSEKDMVIQYEKPEEVRKAYQQWVMFIDKSKVTL
FT                   GKFVTDQNAQDAQLTKSIIGHIDAYRKLFEPVARQLEAGGYDSATTANRMSGKALAEVM
FT                   EADKLLAQLDNLLREQANALAAAERDVADQTRWMFVAAVILALVVVIPLTLLNMLSICR
FT                   PLEVARQMALTIAGGDLSHRAEVSGKDELTDLQRALDQMQQSLSTTVAQVRDASGNIAT
FT                   ASQEIATGNQDLSARTEQTASNLQETVASLAQLTATVQQTASSSQLANQLAASASSTAV
FT                   QGGEIVGQAVNSMQEISASSRKIGDIIGLIDSIAFQTNILALNAAVEAARAGEQGRGFA
FT                   VVAAEVRSLAQRSAQAANEIKSLISTSVQTVDVGARQVESAGKAMQETVDSAQRVGDII
FT                   GEITAASSEQSLGIGQVNQAVGDIDRMTQQNAALVEESAAAAESLREQAARLAQLVSQF
FT                   KLAGGAMHAVMRSPRGAAHPGMAPAVPASAQAALPGQKAQLLEHA"
FT   gene            complement(42933..44051)
FT                   /locus_tag="CtCNB1_0034"
FT   CDS_pept        complement(42933..44051)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0034"
FT                   /product="NADH:flavin oxidoreductase/NADH oxidase"
FT                   /note="COG1902, NemA, NADH:flavin oxidoreductases"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ACY30780"
FT                   /db_xref="GOA:D0J7P0"
FT                   /db_xref="InterPro:IPR001155"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D0J7P0"
FT                   /protein_id="ACY30780.1"
FT                   /translation="MTSLFEPIEAGSLRLPNRIAMAPLTRNRAPDAIPTPLMQTYYVQR
FT                   ASAGLLISEGTAISHQGQGYADVPGLYDEEQLRAWKKVTDAVHAKGGRIVTQLWHVGRI
FT                   SHNVLQPDSQSPVAPSALTARSKTYVIDKQTGQGQFVATSAPRALRQQELPGIVHSFAT
FT                   AAREAVQSAGFDGVELHAANGYLLDQFLKTGTNQRSDDYGGSIENRARLVLECVRSVAD
FT                   AIGAGKVGIRISPVTPANDIVDENPQVLFEYLVRQLAPLGLSYVHVIEGATGGPRELAD
FT                   RPFDYQALKQAYRSAGGKGAWMVNNGYDRQLAARAVESGYADVVAFGKAYISNPDLVHR
FT                   LRDDLPLNAWNSERFYGGGADGYTDYPSVASQ"
FT   gene            complement(44119..44727)
FT                   /locus_tag="CtCNB1_0035"
FT   CDS_pept        complement(44119..44727)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0035"
FT                   /product="glutathione S-transferase-like protein"
FT                   /note="COG0625, Gst, Glutathione S-transferase"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ACY30781"
FT                   /db_xref="GOA:A0A454Y642"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="InterPro:IPR040079"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454Y642"
FT                   /protein_id="ACY30781.1"
FT                   /translation="MKLYYSPGACSMSPHIVLHEAGLPHETVMVSTKSHKLQDGTDYYG
FT                   INPLGYVPFLVLDNGDTLHEGPAIVQYLADLAPEKNLAPANGTVARYHLQEWLNFISTE
FT                   VHKGFSPLFSPATPEDFKPVLLGNLFKRLSWVNEQLANKSYLMGDQFTVADAYFFTVTG
FT                   WAQFVGLDISELQHLQAYRERILARPAVQAAMKAEGLLK"
FT   gene            complement(44833..45444)
FT                   /locus_tag="CtCNB1_0036"
FT   CDS_pept        complement(44833..45444)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0036"
FT                   /product="NADPH-dependent FMN reductase"
FT                   /note="COG0431, Predicted flavoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ACY30782"
FT                   /db_xref="GOA:D0J7P2"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:D0J7P2"
FT                   /protein_id="ACY30782.1"
FT                   /translation="MKNAIALCCNHCMQILIFAGSTRQDSYNRKLAKVAASIAEQQGAQ
FT                   PSLLELSDYDIPLYNADLEAQGTPADVIRLKQAMHSHAAWIVCSPEYNGSYPALLKNAI
FT                   DWASSPVKGDAQWSDGVLPFRNKVVGMASASPGGLGGLRAQSHLAALLLNLECWVAPRS
FT                   HAVSHAAEAFDAQGHLLRTQNQQGMEALVQQVLWAAGRLG"
FT   gene            45665..47626
FT                   /locus_tag="CtCNB1_0037"
FT   CDS_pept        45665..47626
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0037"
FT                   /product="glucose inhibited division protein A"
FT                   /note="COG0445, GidA, NAD/FAD-utilizing enzyme apparently
FT                   involved in celldivision"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ACY30783"
FT                   /db_xref="GOA:D0J7P3"
FT                   /db_xref="InterPro:IPR002218"
FT                   /db_xref="InterPro:IPR004416"
FT                   /db_xref="InterPro:IPR020595"
FT                   /db_xref="InterPro:IPR026904"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D0J7P3"
FT                   /protein_id="ACY30783.1"
FT                   /translation="MYPQEFDVIVVGGGHAGTEAALAAARMGSKTLLLTHNIETLGQMS
FT                   CNPSIGGIGKGHLVKEVDALGGAMALATDKGGIQFRILNSSKGPAVRATRAQADRILYK
FT                   AAIREMLENQPNLWLFQQAVDDLMVEGDRVVGAVTQVGLKFRSRTVVLTAGTFLDGKIH
FT                   VGLNNYAAGRAGDPPAVSLSARLKELKLPQGRLKTGTPPRIDGRSIDFSQCEEQPGDGM
FT                   PGGVNEGEVPVFSFMGNRAMHPRQMPCWITHTNARTHEIIRSGFDRSPMFTGKIEGVGP
FT                   RYCPSVEDKINRFADKENHQIFLEPEGLTTHEFYPNGISTSLPFDIQYELVRSMKGLEN
FT                   AHILRPGYAIEYDYFDPRSLKSSFETKQIQGLFFAGQINGTTGYEEAAAQGLFAGLNAA
FT                   LQCRGEGPWMPRRDEAYLGVLVDDLITKGVTEPYRMFTSRAEFRLQLREDNADMRLTEA
FT                   GRQMGLVDDARWDSFSRKRDAVSRETERLKSTWVNPRVVAAEESERVLGKAMEREYNLF
FT                   DLLRRPGVDYDKLMGMNQGKYASADVQPEALGELSAPVIEQVEIAAKYSGYIDRQKDEV
FT                   ERAAHFERLRLPLDFDYMQVAALSFEVRQKLQKHRPETLGQASRISGVTPAAISLLMVH
FT                   LKKGGFKGFANQNEEASA"
FT   gene            47623..48285
FT                   /locus_tag="CtCNB1_0038"
FT   CDS_pept        47623..48285
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0038"
FT                   /product="methyltransferase GidB"
FT                   /note="COG0357, GidB, Predicted
FT                   S-adenosylmethionine-dependentmethyltransferase involved in
FT                   bacterial cell division"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ACY30784"
FT                   /db_xref="GOA:D0J7P4"
FT                   /db_xref="InterPro:IPR003682"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D0J7P4"
FT                   /protein_id="ACY30784.1"
FT                   /translation="MSQVLRTQLEQGVQALKLELAPAQIDLLMSFMDLLQKWNKVYNLT
FT                   SVRDPQEMLTHHLLDSLAAVPALLRHVNRLPLEEGKRLPLLDVGSGGGLPGVVFAICCP
FT                   QIDVNCVDTVGKKAAFIQQVAAALRLPNLRGIHDRVENLKTRYPVISCRAFASLVDFTT
FT                   WSRKALAEDGIWFAMKGKHPDEEIAALPADVKVFHVEPLQVPGLDAERCVIWLKLAS"
FT   gene            48429..49040
FT                   /locus_tag="CtCNB1_0039"
FT   CDS_pept        48429..49040
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0039"
FT                   /product="Lysine exporter protein (LYSE/YGGA)"
FT                   /note="COG1280, RhtB, Putative threonine efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ACY30785"
FT                   /db_xref="GOA:A0A454XWD9"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454XWD9"
FT                   /protein_id="ACY30785.1"
FT                   /translation="MFGISDYGAFAAAVTVFLLIPGPGNLALITSTGKGGWRAGVACCL
FT                   GVMAADQVLMWLAVAGVAAVLAAYPAAFHAVQWVGAAYLAWLGYKLLTAKPGDAPAIEI
FT                   QPRQYFRQGALITLMNPKAIVFYMAFFPMFVDPARHQGAITFGVMAATVAAITFIYSVI
FT                   VVMLTTVLAERLRANPAVVKWLEKTAGVFLIGFGLKLAAN"
FT   gene            49053..49823
FT                   /locus_tag="CtCNB1_0040"
FT   CDS_pept        49053..49823
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0040"
FT                   /product="Cobyrinic acid a,c-diamide synthase"
FT                   /note="COG1192, Soj, ATPases involved in chromosome
FT                   partitioning"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ACY30786"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454XNH0"
FT                   /protein_id="ACY30786.1"
FT                   /translation="MAKIFCVANQKGGVGKTTTTVNLAAGLAKVGQRVLLIDLDPQGNA
FT                   TMGSGVDKRALELTVYDVLLENASVKEVAQKSEQVGYDVLGANRELSGAEIELVSLERR
FT                   NERLKTALQAVAADYDFVLIDCPPSLSMLTLNGLCSAHGVIVPMQCEYFALEGLTDLVN
FT                   TIKQVHANMNPDLQIIGLLRVMFDPRTTLQQQVSDQLKEHFGDKVFDTVIPRNVRLAEA
FT                   PSYGLPGVVFDASAKGSKAFVEFAEEMVRRIKKM"
FT   gene            49876..50424
FT                   /locus_tag="CtCNB1_0041"
FT   CDS_pept        49876..50424
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0041"
FT                   /product="predicted esterase"
FT                   /note="COG3545, Predicted esterase of the alpha/beta
FT                   hydrolasefold"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ACY30787"
FT                   /db_xref="GOA:D0J7P7"
FT                   /db_xref="InterPro:IPR010662"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D0J7P7"
FT                   /protein_id="ACY30787.1"
FT                   /translation="MTSEALNPQQVWLLPGWQNSDPGHWQSLWQDRYGYQRLEQHSWQH
FT                   PLRGDWSIRLQETVLDAPAPVTLVAHSLGCVLVAWWAAHSAVARSKVRGALLVAPGDTE
FT                   QESLHGVLPGWSPVLLQKLPFPSILVGSENDPNCSVARAQAMAQGWGSRFVNAGAAGHI
FT                   NTASGLGLWEAGHELLLSL"
FT   gene            50440..51369
FT                   /locus_tag="CtCNB1_0042"
FT   CDS_pept        50440..51369
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0042"
FT                   /product="parB-like partition protein"
FT                   /note="COG1475, SpoJ, Predicted transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ACY30788"
FT                   /db_xref="GOA:D0IV52"
FT                   /db_xref="InterPro:IPR003115"
FT                   /db_xref="InterPro:IPR004437"
FT                   /db_xref="InterPro:IPR036086"
FT                   /db_xref="InterPro:IPR041468"
FT                   /db_xref="UniProtKB/TrEMBL:D0IV52"
FT                   /protein_id="ACY30788.1"
FT                   /translation="MVTKKPKGLGRGLEALLGPKVSEAEQVAASGQQANLPSSLALNVM
FT                   VAGQYQPRTRMDEGALYELAESIKAQGIMQPILVRQLSRGDNAGKYEIIAGERRFRAAH
FT                   IAGLSEVPVLVREVPDEAAAAMALIENIQREDLNPLEEAQGLARLVKEFGLTHEQTAQA
FT                   VGRSRSAATNLLRLLNLAEPVQTMLMAGDIDMGHARALLTLDRATQITAGNQIAAKKMS
FT                   VREAESLVKKIGAEFNLTRQKAKKDGKSRDVKRIEEELSDLLTADVEVRIKKTVRRHGK
FT                   QQEMGEIAIQFGSLEELNGIIEKLRGEV"
FT   gene            complement(51435..52208)
FT                   /locus_tag="CtCNB1_0043"
FT   CDS_pept        complement(51435..52208)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0043"
FT                   /product="class II aldolase/adducin-like protein"
FT                   /note="COG0235, AraD, Ribulose-5-phosphate 4-epimerase and
FT                   related epimerases and aldolases"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ACY30789"
FT                   /db_xref="InterPro:IPR001303"
FT                   /db_xref="InterPro:IPR036409"
FT                   /db_xref="UniProtKB/TrEMBL:D0IV53"
FT                   /protein_id="ACY30789.1"
FT                   /translation="MNQEPLNIPSVQHLVSPEEWQLRVDLAACYRLVALYGWSDLVFTH
FT                   ISARLPGPGHHFLINPYGLMFDEITASSLIKVDLGCNKLMDSPFPVNPAGFVIHSAVHE
FT                   ARADAQCVIHTHTRAGVAVAAQKQGLLPISQQSTFVLGSLAYHVYEGVAFREDEKPRLL
FT                   ADMGEANFLMLRNHGLLTCGPTIADAFLSMYVFESACQIQISAQSGGAELTEVDPQILQ
FT                   GIAHAMKVQTGGMGGQFAWPALLRKLDRIDPGYRS"
FT   gene            complement(52477..53763)
FT                   /locus_tag="CtCNB1_0044"
FT   CDS_pept        complement(52477..53763)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0044"
FT                   /product="peptidase M20"
FT                   /note="COG0624, ArgE, Acetylornithine
FT                   deacetylase/Succinyl-diaminopimelatedesuccinylase and
FT                   related deacylases"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ACY30790"
FT                   /db_xref="GOA:D0IV54"
FT                   /db_xref="InterPro:IPR001261"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR017150"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:D0IV54"
FT                   /protein_id="ACY30790.1"
FT                   /translation="MRWNTPSAPLLRALPLALVLAFGSAQAAPQAEWLEHAKKEQQPYL
FT                   DTLRDLVHIESGSKDVAGVKKIAEYIAGKLRAQGGKVEVIEPSDIYRLDDTPEKVGPMV
FT                   HAEFKGKGSSRIMLIAHMDTVYLPGMIKDQPFRIDGDKAYGLGIADDKQGVALIMHIVP
FT                   LLKKLGIEDYGTLTVLINGDEEISSPGARSTITRLGAEQDAVFSFEGGGTDGSLRLATS
FT                   GIGAAYLKVTGKASHAGAKPEDGVNALYELSHQLLQMKDLSQPQEGLKLNWTVSKAGTN
FT                   RNVVPAEATAQADARALRVADFTALEKAMQDKIGNKLLPASKVELKFEVRRPPLEANAT
FT                   ARKLAAHAQGIYEQELKLPMKVMDKATGGGTDAAFAALKAKGGVIEGFGLSGYGAHSND
FT                   AEYVQINTIAPRLYLAARMIQDLSRGQIK"
FT   gene            complement(53975..55261)
FT                   /locus_tag="CtCNB1_0045"
FT   CDS_pept        complement(53975..55261)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0045"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="COG2814, AraJ, Arabinose efflux permease"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ACY30791"
FT                   /db_xref="GOA:D0IV55"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D0IV55"
FT                   /protein_id="ACY30791.1"
FT                   /translation="MRHMNRPASTTPQNQAPETLRSDARTISLIGLAHGSSHFFHLLLP
FT                   PLFPWLIKDFGYSYAELSVMVSLFFIVSGTGQALAGFAVDRFGARPILFAALGSFVVAG
FT                   LIASTAQGYSMLLAASFFAGLGNAPFHPVDFTILNKRVSQQRIGHAFSVHGLSGNLGWA
FT                   LAPLFMAGITTATGSWRLACLGGALCAAVVLAIMVFNRDALDDRAESAGAAAKPAAGAI
FT                   AAPQEHPMAFMKLPSVWLCFSFFFWSTCALSAIQSFASPALQSMYGLPLSVTALIVTGY
FT                   MLCGAAGMVVGGFLVGRVQRLEKVISICMLGSGLLLFVVGTGWLPGMAAVVVASIAGLG
FT                   TGLAGPSRDMLIKRAAPPGATGRVYGTVYSGLDLGFCLAAPVFGYMLDHQMTNAVFYGS
FT                   AIALVLSVVSAVIVGDGVSKKTKSHLAAA"
FT   gene            55331..56212
FT                   /locus_tag="CtCNB1_0046"
FT   CDS_pept        55331..56212
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0046"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="COG2207, AraC, AraC-type DNA-binding
FT                   domain-containing proteins"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ACY30792"
FT                   /db_xref="GOA:D0IV56"
FT                   /db_xref="InterPro:IPR003313"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="UniProtKB/TrEMBL:D0IV56"
FT                   /protein_id="ACY30792.1"
FT                   /translation="MSSLHDPEPLRAGKATAYVETLTPHLYIPTAQRPVRAKCRWLEAD
FT                   TQVKPHRHSWGQLAISTTGTIRLTVAQGTYIVPPSRVLWVPPGMEHAVTMVESADLRTL
FT                   YFFQTQGRCGPDVAPGEEAAWRQCRVLNASDLLRAVVRELPTLPDDSQQLCEQDRAREH
FT                   HLSQLLLDELRRASAVQLGVNLPQDKRLRQLCEAVLADPTRNETLEDWARDTGASPRTV
FT                   ARLFRQQLECSFTQWRQQVVLAHAVSLAARNWPIQRIAAELDYSPSAFSAMVRRTVGMP
FT                   PAQFFGMHAQNV"
FT   gene            56331..56891
FT                   /locus_tag="CtCNB1_0047"
FT   CDS_pept        56331..56891
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0047"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /note="COG1595, RpoE, DNA-directed RNA polymerase
FT                   specialized sigmasubunit"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ACY30793"
FT                   /db_xref="GOA:D0IV57"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:D0IV57"
FT                   /protein_id="ACY30793.1"
FT                   /translation="MIFSAESRYNQWVREHYRFLLRSAWALTGSRATAEDVVQDCFTSA
FT                   WRFRHQLRDQSMARAWLFQIMRRHAFRHFDPVQSQTESLDEACEQGVNHHDALDAQLDV
FT                   VKALSRIAPIHREVLVLYYFDDMPTAQMAEALDIAPGTVLSRLARAREALKTALQEPAR
FT                   HPAGAATESSAAASVIPLRKRAP"
FT   gene            56888..57475
FT                   /locus_tag="CtCNB1_0048"
FT   CDS_pept        56888..57475
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0048"
FT                   /product="hypothetical protein"
FT                   /note="COG1062, AdhC, Zn-dependent alcohol dehydrogenases"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ACY30794"
FT                   /db_xref="UniProtKB/TrEMBL:D0IV58"
FT                   /protein_id="ACY30794.1"
FT                   /translation="MKHQDRPEDTDFDLRARAELALAFEPGEPPAYLLRHTPWHARRGL
FT                   QALCAAVIVGSVAAGSVLSLRPPQMVRSAIEHEYYERTLRGQFIPEAEIARHMDWPVDQ
FT                   KLPGYTQLMRPCDIDGSRAYHLTTFFEKGGIVTVLAFEQPQRMADGQGWWANSYWKVVR
FT                   SREGRPLVLIAQKKQALAVASRALGAPEKVDG"
FT   gene            57524..58735
FT                   /locus_tag="CtCNB1_0049"
FT   CDS_pept        57524..58735
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0049"
FT                   /product="Twin-arginine translocation pathway signal"
FT                   /note="COG2041, Sulfite oxidase and related enzymes"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ACY30795"
FT                   /db_xref="GOA:D0IV59"
FT                   /db_xref="InterPro:IPR000572"
FT                   /db_xref="InterPro:IPR005066"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR008335"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR036374"
FT                   /db_xref="UniProtKB/TrEMBL:D0IV59"
FT                   /protein_id="ACY30795.1"
FT                   /translation="MQQPTSLPRRRLLAGSASALAAAGLASFQSQAMAQAAAPAAKPLP
FT                   GYAGFKNADAVIVHSSTTIETKRSAFGSSVVTPTNQLYVRNNLPTPSESIVADRDAWAV
FT                   QIDGVKKPAKLTVGELKKLGLETVTMVLQCSGNGRAFFPTKPSGTQWTVGAAGCVVWSG
FT                   VPVREVVKALGGVADGMVYMTGTGGEVLPAGLDPKSVLVERSVPLSAMEDALLAWEMNG
FT                   EPVPLAHGGPLRLIVPGYTGVNNIKYIKQLAFTVKESEAHIMSHGYRISPPGSKGDPSQ
FT                   PSVQEMSVKSWINSPIPEDGNQASGLVQIQGVAFGGMNAVKGVEVSIDGGKTWKQARLI
FT                   GPDMGKYAWRQFVLQVQLPKGTHTLASRATDVKGNVQPETRGENQSGYNNTSWADHAVT
FT                   VTVA"
FT   gene            58828..59160
FT                   /locus_tag="CtCNB1_0050"
FT   CDS_pept        58828..59160
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0050"
FT                   /product="conserved hypothetical protein"
FT                   /note="COG2010, CccA, Cytochrome c"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ACY30796"
FT                   /db_xref="GOA:D0IV60"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:D0IV60"
FT                   /protein_id="ACY30796.1"
FT                   /translation="MKTNHTLAALLLTAFAGTAAHADQAAQMARGKELFTTAAVPACAV
FT                   CHTLKDAGAEGAIGPVLDELQPDAARVARALKDGIGSMPSFKATMSEADIAAVALYVSK
FT                   ASGAAK"
FT   gene            complement(59167..59919)
FT                   /locus_tag="CtCNB1_0051"
FT   CDS_pept        complement(59167..59919)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0051"
FT                   /product="methyltransferase type 12"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ACY30797"
FT                   /db_xref="GOA:D0IV61"
FT                   /db_xref="InterPro:IPR026170"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D0IV61"
FT                   /protein_id="ACY30797.1"
FT                   /translation="MTKKWLASTWPLPALLVWLLAWVIFAGLARLLPWWLALLVGGGFS
FT                   TAASLYGPNWWRRLIIAAGFPLSFLVLSASQLPAWGWLLPLALLLLIYPLNAWRDAPVF
FT                   PTPLNALKGLAEVVQLPGQALVLDAGCGMGDGLRALRSALPQARLNGLEWSWPLAIASA
FT                   LRCPWARVRRGDIWLADWSGYQLVYLFQRPESMGRAAVKAATEMQPGSWLVSLDFQLPG
FT                   VEATVCLQGNSRHKVWIYAIPLDGAERS"
FT   gene            60117..60719
FT                   /locus_tag="CtCNB1_0052"
FT   CDS_pept        60117..60719
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0052"
FT                   /product="Sel1-like repeat protein"
FT                   /note="COG0790, FOG: TPR repeat"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ACY30798"
FT                   /db_xref="InterPro:IPR006597"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454XRW7"
FT                   /protein_id="ACY30798.1"
FT                   /translation="MRLLAPTFSLAALALTACAVQTPQEQLAPASPTVRLCEGNNCSEL
FT                   PRNVATFRGEPVNPEAERRLAALVQKAEADPRAAYDLGLRYLRGDGVERNSYQAIEWMR
FT                   KAGDAGNGQAQFALGRLYLLGFEEMGPDPAEAEAWLSRAAAKGFKEAKRLLPQAQAAKQ
FT                   NAHARYQAIEDERKSWNGWYVGAPYYMVWGSSGWYYR"
FT   gene            60767..61594
FT                   /locus_tag="CtCNB1_0053"
FT   CDS_pept        60767..61594
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0053"
FT                   /product="conserved hypothetical protein"
FT                   /note="COG1462, CsgG, Uncharacterized protein involved in
FT                   formation ofcurli polymers"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ACY30799"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454XQG9"
FT                   /protein_id="ACY30799.1"
FT                   /translation="MSKKTTLRLAAIASALALGGCVTPGGGTISTGTAPTAATGAAGGA
FT                   TSVNANSTLERCDAPLGTLAVDDGRGKEWYASFGAATKITTIEPLIRLAVQQSNCFVIT
FT                   SIGNNRTESKMSAITDKQRNSGEFRAGSKQQKGQRVAADYYMEPSIIIDNDATGQLAAG
FT                   VGGLFGNVGTLIGGAMQSKASVVTLSMFDIRSGVQISISEGNSTATNFGAAMGAFGGGV
FT                   GGGLGGFSRSPEGKATVAAFMDAYNNMVISLRNYKAQEVKGGLGRGGQLKVGK"
FT   gene            complement(61679..63106)
FT                   /locus_tag="CtCNB1_0054"
FT   CDS_pept        complement(61679..63106)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0054"
FT                   /product="FAD linked oxidase-like protein"
FT                   /note="COG0277, GlcD, FAD/FMN-containing dehydrogenases"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ACY30800"
FT                   /db_xref="GOA:D0IV64"
FT                   /db_xref="InterPro:IPR004113"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016171"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:D0IV64"
FT                   /protein_id="ACY30800.1"
FT                   /translation="MNAPVAHTSLQPDFVQRPIPEEFLQALQTRFGGQCSTALAVREQH
FT                   GRDEGAISAPPPAAVVFAESTQDVQDAVRLCDQYGVPVIAYGAGSSLEGHLLAVQGGIT
FT                   IDVSRMSRVLSVNTEDLTITVQPGITRKALNEAIKDTGFFFPIDPGADASIGGMTSTRA
FT                   SGTNAVRYGTMRENVLALEVVTASGEVVRTGNRAKKSAAGYDLTRLLVGSEGTLGIFTE
FT                   ITLRIYPLPEAVSAAICSFSSIENAVHTVIQTIQMGIPIARVELVDVNSVRMVNAYSKL
FT                   SLREEPMLLMEFHGSPTGVKEQAEMVQDIAHEFGGNAFEWAERPEDRTRLFTARHNAYF
FT                   AAVSSVPGCRCITTDACVPISRLADALLECVTEADASGIPYFLVGHVGDGNFHFGYLID
FT                   PDNDAQRQQAEQLNHTLVARAIALGGTCTGEHGIGIHKQGFLLEEAGVGAVQMMRAIKQ
FT                   ALDPKNILNPGKIFQLQ"
FT   gene            63406..64404
FT                   /locus_tag="CtCNB1_0055"
FT   CDS_pept        63406..64404
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0055"
FT                   /product="Twin-arginine translocation pathway signal"
FT                   /note="COG3181, Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ACY30801"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454XNT9"
FT                   /protein_id="ACY30801.1"
FT                   /translation="MRDTGRRSFIQGLAGVSAAGMLGAAWHVRAAQTQAWPARPIKLVV
FT                   TFPPGGSSDIVARVLAPALAEKLGQSVVIDNKPGAGSSIGAQIVAHSANDGYTLLVSNS
FT                   AALSIAPSLLQSPGYDPLRSFEHLAYIGAVPTVFAVHPSVPANSLSELVSWIKEQPAPV
FT                   AFGSGGAASVGHLVGEQFAQTLKLSMEHVPYRGAGPMRADLLSGHIKLAIDALPQNIAL
FT                   HKQGRLKLLALTSPRRVAQAPAVPSVAELGLAQLVSENFVGISAPAGLPRALAERIASA
FT                   VRQISARPEFAQTLEAQGFVTRDMESKAFTQLIADQHLAWGDIAKKTGAKL"
FT   gene            64420..65391
FT                   /locus_tag="CtCNB1_0056"
FT   CDS_pept        64420..65391
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0056"
FT                   /product="basic membrane lipoprotein"
FT                   /note="COG1744, Med, Uncharacterized ABC-type transport
FT                   system"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ACY30802"
FT                   /db_xref="GOA:D0IV66"
FT                   /db_xref="InterPro:IPR003760"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:D0IV66"
FT                   /protein_id="ACY30802.1"
FT                   /translation="MSSEKLYSPRKPRYAVVLFGPEGQGSFNESGLRGAHKARDAGHEV
FT                   DVLWVAGQSAQQRAAEMSALCGGRYALILAHGGQGDGPVQILAERWPEQAFAVTQGSWA
FT                   APNVARYEVLQEQSAFLAGVLASQWSKTGKVGHFSGEKVPPGLRGRAAYADGLRRAGFE
FT                   GQLVTQFCGHQHRPGWARTCVSAMIEQTGLDIVFAMLDGGRPGVTQACRAHGVAQIGNV
FT                   LNWVERDPEVFVASAICDSGEALFRAVEDHARGLLPLGGYRAFGLEEPSLVRLEMGGRV
FT                   SAAQRSLVEDWAQRLLRREFEIHLDYAGAEFALPQEELGAAA"
FT   gene            complement(65416..65784)
FT                   /locus_tag="CtCNB1_0057"
FT   CDS_pept        complement(65416..65784)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0057"
FT                   /product="Calcium-binding EF-hand"
FT                   /note="COG5126, FRQ1, Ca2+-binding protein (EF-Hand
FT                   superfamily)"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ACY30803"
FT                   /db_xref="GOA:A0A454XK72"
FT                   /db_xref="InterPro:IPR002048"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454XK72"
FT                   /protein_id="ACY30803.1"
FT                   /translation="MNKKNLLNCKVSSFEVVSVVLFSALTLGGGMAFAQTGGGNAGNNK
FT                   EPARIVQSGSATGVQQAPTAKSSVQAAFERADANRDGQLSAQEARQLPVISQRFEEIDS
FT                   DRNGQLSRAEFDKGAQQY"
FT   gene            65969..66535
FT                   /locus_tag="CtCNB1_0058"
FT   CDS_pept        65969..66535
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0058"
FT                   /product="ATP--cobalamin adenosyltransferase"
FT                   /note="COG2096, Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ACY30804"
FT                   /db_xref="GOA:A0A454XVJ2"
FT                   /db_xref="InterPro:IPR016030"
FT                   /db_xref="InterPro:IPR029499"
FT                   /db_xref="InterPro:IPR036451"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454XVJ2"
FT                   /protein_id="ACY30804.1"
FT                   /translation="MGNRLTQIATRTGDDGTTGLGDNTRVSKNSGRPHAMGDVDELNSH
FT                   IGLLLCEPMPQEVRDLLIDIQHQLFNLGGELSMPGYELLKDDALLQLDNALAHYNAQLP
FT                   RLQEFILPAGTRAAAQAHVCRTVARRAERQVVALEQAEAMRAAPRQYLNRLSDLLFVLA
FT                   RVLNRLDGGDDVYWKSERLARAQSE"
FT   gene            66557..67465
FT                   /locus_tag="CtCNB1_0059"
FT   CDS_pept        66557..67465
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0059"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="COG0583, LysR, Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ACY30805"
FT                   /db_xref="GOA:D0IV69"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D0IV69"
FT                   /protein_id="ACY30805.1"
FT                   /translation="MRLRHIEVFNAVMQTGSVSAAARLINVTQPAVSRTLQHAELQMGF
FT                   ALFQRARGRLTPTNEALALFPHIEKLFEQLDEVQRLAANLRHGQSADRLNVLTVFALSR
FT                   EVLPRAVAGFRRRHPQVQVHVQALHTPQVVSALLLQEADVGFVISSVGQPVLEHELLAE
FT                   VDMFCVLPKGLLPPSRVRAEGMELKDLADLPVVALDARDPLGMRLGQACREHGVGLSPV
FT                   VTVQTYHAALSMAEYGLGAAIMDGCTALAADRRRVHVVPLLPRISVGVNALSLPQRPGS
FT                   VLARAMTQEMRKALQELLRES"
FT   gene            complement(67477..68700)
FT                   /locus_tag="CtCNB1_0060"
FT   CDS_pept        complement(67477..68700)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0060"
FT                   /product="FAD dependent oxidoreductase"
FT                   /note="COG0665, DadA, Glycine/D-amino acid oxidases
FT                   (deaminating)"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ACY30806"
FT                   /db_xref="GOA:D0IV70"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D0IV70"
FT                   /protein_id="ACY30806.1"
FT                   /translation="MHVCIVGAGIVGLATAYALQRAGCRVTVLERGPGPAAGASGGNGA
FT                   QLSYSYVQPLADPGIWKMLPQLLLEKDSPLALRLRADPAQWAWGLRFLGACNARASMAG
FT                   TQALLRLAAESRQAFERLQAQESLSCALHTPGKLVLYHTQQGLDAAARQVALQSRLGGA
FT                   SQQVVDATAAVRLEPALAGYAGRMAGAVHTPSESAADCRQLCEQLAALLAARGAELRYD
FT                   TEVLGFERQGDAVTGLRTAAGLLQAEHYVLASGWESPAHARQLGLRIPVYPLKGYSITV
FT                   DIASDHRQAAPRVSVTDTARKVVFARLGERLRVAGMVEIIGRDTRIDPARIDSLRRSTQ
FT                   QVFAQLPLQGSLHPWSGMRPATPTGLPITGRQRGGPRNLWLQTGHGALGLTLAFGSAQR
FT                   LVAQMHAA"
FT   gene            68981..69697
FT                   /locus_tag="CtCNB1_0061"
FT   CDS_pept        68981..69697
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0061"
FT                   /product="amino-acid ABC transporter bindingprotein ybeJ
FT                   precursor"
FT                   /note="COG0834, HisJ, ABC-type amino acid transport/signal
FT                   transductionsystems"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ACY30807"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:D0IV71"
FT                   /protein_id="ACY30807.1"
FT                   /translation="MQLHSTVLCAALGLGFLGAAHADTLAKVRDSGRITLAYRESSVPF
FT                   SYLDNGKPIGMTVELSQTVAEAVKKQLNLPALEVRWQAVTSQNRMPLLANGTIDLECGS
FT                   TTNNTVRAKEVGFAINHFYTGTRLLVKKSSGIQSYADLKGKTAAITTGTTNLQVLRKAN
FT                   AEQGWGMNIVMAKDHADGFLLVENDRAAAFGMDDILLYGLIANAKNPRDFHVVADALQV
FT                   EPYACMLRSSSSWWMA"
FT   gene            69694..69849
FT                   /locus_tag="CtCNB1_0062"
FT   CDS_pept        69694..69849
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0062"
FT                   /product="amino-acid ABC transporter bindingprotein ybeJ
FT                   precursor"
FT                   /note="COG0834, HisJ, ABC-type amino acid transport/signal
FT                   transductionsystems"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ACY30808"
FT                   /db_xref="UniProtKB/TrEMBL:D0IV72"
FT                   /protein_id="ACY30808.1"
FT                   /translation="MIGDMMKSGAFARLYDKWFMQPIPPKNAALGLPMSEQLQRNLQER
FT                   GDKPAF"
FT   gene            69851..70579
FT                   /locus_tag="CtCNB1_0063"
FT   CDS_pept        69851..70579
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0063"
FT                   /product="aspartate racemase"
FT                   /note="COG1794, RacX, Aspartate racemase"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ACY30809"
FT                   /db_xref="GOA:D0IV73"
FT                   /db_xref="InterPro:IPR001920"
FT                   /db_xref="InterPro:IPR004380"
FT                   /db_xref="InterPro:IPR015942"
FT                   /db_xref="UniProtKB/TrEMBL:D0IV73"
FT                   /protein_id="ACY30809.1"
FT                   /translation="MQAVGILGGMGPAAGADFVRLFVQACTRHLQDQGLPVHDQAYPEH
FT                   WLVQLPMPDRTQALRRDPQSPEGPAAHLLQGAGRLAALGVRSVALACNTAHAWHGQIQA
FT                   LFPQLRVLHIAQQTALYLKAGGARQALVLATDGTYDSGLYDAALADCGIAALRPGQAGR
FT                   ARLMQGIYEGVKQGDMPLAVQCFGEALAPLLQRHGAVPVIMGCTEIPLALPQAPQARGA
FT                   ELVDPAWILACALAQDAYAH"
FT   gene            complement(70720..71322)
FT                   /locus_tag="CtCNB1_0064"
FT   CDS_pept        complement(70720..71322)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0064"
FT                   /product="HD phosphohydrolase-like protein"
FT                   /note="COG4341, Predicted HD phosphohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ACY30810"
FT                   /db_xref="GOA:D0IV74"
FT                   /db_xref="UniProtKB/TrEMBL:D0IV74"
FT                   /protein_id="ACY30810.1"
FT                   /translation="MNARAKFLRMQDSTREDWQLIGGEFAQFSQGLPERVMAHLKLLEG
FT                   DYGGFPVDRYTHSLQTATRALRDGRDEEYVVCALLHDIGDTLGSFNHPDIAAAILQPFV
FT                   SEANHWMVQHHGIFQGHYFFHHIGLDRDMREQFREHPHYQRTAEFCELYDNPAFDPRAE
FT                   TLPLSEFEPMLRRLMQRPRQSIYKAAMDSEMRDARRS"
FT   gene            complement(71461..72762)
FT                   /locus_tag="CtCNB1_0065"
FT   CDS_pept        complement(71461..72762)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0065"
FT                   /product="benzoyl-CoA oxygenase/reductase, BoxA protein"
FT                   /note="COG0369, CysJ, Sulfite reductase"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ACY30811"
FT                   /db_xref="GOA:D0IV75"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR001709"
FT                   /db_xref="InterPro:IPR008333"
FT                   /db_xref="InterPro:IPR015701"
FT                   /db_xref="InterPro:IPR017634"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:D0IV75"
FT                   /protein_id="ACY30811.1"
FT                   /translation="MSTITLIENGILKQHLIDPEICIRCNTCEATCPVDAITHDDNNYV
FT                   VMADKCNGCMDCISPCPTGSIDNWRLVSASKPYSVAEQLGWESLPEELSADVLAAAQTA
FT                   ENAGDVQDLSQAQAVIAAAAGLAESGAAQVFRAASYGATTPPWSAAHAYTNLHGPKAAV
FT                   TATVVGNLNCTEAGFDNETHHIVLDFGAMPFPVLEGQSLGIVPPGVDAGGKPHVARQYS
FT                   IASARNGERPGYNNLALTVKRVVEDHQGQPVRGVASNYLCDLQVGDKVQVIGPFGSSFL
FT                   MPNHPRSHIVMICTGTGSAPMRAMTEWRRRLRKSGKFDSGKLLLFFGARTPQELPYFGP
FT                   LQNLPKDFIDINFAFSRVAGQPRRYVQDAMRERSADLMELLRDDNTHIYVCGLKSMEDG
FT                   VVLALRDVAQQAGLGWEELGARLKREGRLHLETY"
FT   gene            complement(72871..74295)
FT                   /locus_tag="CtCNB1_0066"
FT   CDS_pept        complement(72871..74295)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0066"
FT                   /product="benzoyl-CoA oxygenase component B"
FT                   /note="COG3396, Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ACY30812"
FT                   /db_xref="GOA:D0IV76"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012348"
FT                   /db_xref="InterPro:IPR017635"
FT                   /db_xref="UniProtKB/TrEMBL:D0IV76"
FT                   /protein_id="ACY30812.1"
FT                   /translation="MSSIDYSQKIPNNVDLSGDRTLQRALESWQPNFIRWWDDVGPEGS
FT                   TNYDVYLRTAVSVDPQGWAQFGYVKMRDYRWGIFLNPADQERSIHFGDHKGEKAWQDVP
FT                   GEHRANLRRIIVTQGDTEPASVEQQRHLGLTAPSMYDLRNLFQVNVEEGRHLWAMVYLL
FT                   HKHFGRDGREEAEALLERQSGDENNPRILGAFNEKTPDWLAFFMFTYFTDRDGKFQLAA
FT                   LAESAFDPLARTTKFMLTEEAHHMFVGESGVSRVLARTCQVMNELKTDDVNKLRSAGVI
FT                   DLPTIQRYLNFHYSVTIDLFGADQSSNAATFYSSGLKGRYEEGKREDDHRLHDQNYKVL
FT                   EVVDGKLQEKEVPMLNALNEVLRDDYIKDSNAGVGRWNKVMEKAGIDFRLTVPHKAFNR
FT                   QIGALAGVRISPDGRPVSEQEWLARKNEWLASDDDRNFVASLMKPCLEPGKFAGWIAPP
FT                   VMGINRQPVDFEYVKF"
FT   gene            complement(74338..75996)
FT                   /locus_tag="CtCNB1_0067"
FT   CDS_pept        complement(74338..75996)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0067"
FT                   /product="Enoyl-CoA hydratase/isomerase"
FT                   /note="COG1024, CaiD, Enoyl-CoA hydratase/carnithine
FT                   racemase"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ACY30813"
FT                   /db_xref="GOA:D0IV77"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR017633"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:D0IV77"
FT                   /protein_id="ACY30813.1"
FT                   /translation="MQQQTNVDYRTEPSQYRHWSFEVDGNIARLKLDIAEDAGIRPGYK
FT                   LKLNSYDLGVDVELHDALNRIRFEHPQVRSVIVTSGKERIFCSGANIFMLGVSSHAWKV
FT                   NFCKFTNETRNGMEDSSRHDGLKFVAAVNGACAGGGYELALACDDIVLIDDRSSSVSLP
FT                   EVPLLGVLPGTGGLTRVTDKRHVRHDLADIFCTSVEGVRGQRAVDWRLVDAIAKPAQFA
FT                   DVVQQRATALGESSPRPASAQGIQLARLQREQSPDGLHYRHVSVQIDRSKRSATITVKA
FT                   PKGEQPASLEAIEGAGAAWWPLAMGRELDDAILHLRTNELDVGTWILKTEGDARAVLAA
FT                   GQTLVTYRDHWLVQQTTGLLRRTFARLDVSSRSLFALIEPGSCFVGMLAELVFCADRAY
FT                   MLVLPDEPEREPVIELDAFNFGLLPLVNDQSRLQRRFYEESGPLEAARAAVGKPLNGDA
FT                   AQQLGLVTAALDDIDWEDEIRIAMEERAAMSPDALTGLEANLRFASQENMVTRIFGRLS
FT                   AWQNWIFNRPNAVGEKGALKLYGTGQKAGFDFNRV"
FT   gene            76274..77500
FT                   /locus_tag="CtCNB1_0068"
FT   CDS_pept        76274..77500
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0068"
FT                   /product="threonine dehydratase"
FT                   /note="COG1171, IlvA, Threonine dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ACY30814"
FT                   /db_xref="GOA:D0IV78"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR005789"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:D0IV78"
FT                   /protein_id="ACY30814.1"
FT                   /translation="MSCLQNGSTMLTFADIQAAAARLNGAVLQTPFVESRTLSQITGAQ
FT                   VYLKFENLQFTASFKERGALNKLLMLSDAERARGVVAMSAGNHAQGVAYHAQRLGLRAV
FT                   IVMPRFTPGVKVERTRGFGAEVVLHGDTLAEARAHAYQLAQEQQLTFVHPYDDEAIAAG
FT                   QGTLALEILQAQPDLDALIIAIGGGGLIAGIATAAKAIKPEMEIVGVQTQRFPSMVNAL
FT                   RHTDLPMGTSTIAEGIAVTQPGIITQEVVQRCVDDLLLVDEGDIEQAVLMLLEIEKTLV
FT                   EGAGAAGLAALLRYPARFKGRKIGLVLSGGNIDPMLLAAIIERGMVRSGRLARVRVSAR
FT                   DVPGVLAQITATVAGAGANIEEVHHQRAFTMLAAQNVEIEFVLQTRGHAHVSEVLEQLR
FT                   RAGMEAALV"
FT   gene            complement(77523..78293)
FT                   /locus_tag="CtCNB1_0069"
FT   CDS_pept        complement(77523..78293)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0069"
FT                   /product="hypothetical protein PH1511"
FT                   /note="COG0330, HflC, Membrane protease subunits"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ACY30815"
FT                   /db_xref="GOA:A0A454XN86"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR001972"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454XN86"
FT                   /protein_id="ACY30815.1"
FT                   /translation="MVSASFLFWLILLMLVIGLGTASIRIFREYERGVVFTLGRFWKVK
FT                   GPGLIFIIPAIQQVVRVDLRTVVLEVPAQDVISRDNVSVKVNAVIYLRVVDAEKAVIQV
FT                   VNYLEATSQLAQTMLRSVLGKHQLDEMLAERESLNLDIQQALDAQTDTWGIKVSNVEIK
FT                   QVDLTESMIRAIARQAEAERERRAKVIHAEGELQASEKLSQAAKVLAQEPQAILLRYLE
FT                   TLTVIGADRNTTVVFPLPMDLVTPLIKKITPLQA"
FT   gene            78597..78734
FT                   /locus_tag="CtCNB1_0070"
FT   CDS_pept        78597..78734
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0070"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ACY30816"
FT                   /db_xref="GOA:A0A454XQ54"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454XQ54"
FT                   /protein_id="ACY30816.1"
FT                   /translation="MSDDSAVNHEAQDAAEAVVPYIPIIIPAAGAVMMFLLAFIAVNMA
FT                   "
FT   gene            79056..80912
FT                   /locus_tag="CtCNB1_0071"
FT   CDS_pept        79056..80912
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0071"
FT                   /product="phosphoenolpyruvate carboxykinase (GTP)"
FT                   /note="COG1274, PckA, Phosphoenolpyruvate carboxykinase
FT                   (GTP)"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ACY30817"
FT                   /db_xref="GOA:D0IV81"
FT                   /db_xref="InterPro:IPR008209"
FT                   /db_xref="InterPro:IPR008210"
FT                   /db_xref="InterPro:IPR013035"
FT                   /db_xref="InterPro:IPR018091"
FT                   /db_xref="InterPro:IPR035077"
FT                   /db_xref="InterPro:IPR035078"
FT                   /db_xref="UniProtKB/TrEMBL:D0IV81"
FT                   /protein_id="ACY30817.1"
FT                   /translation="MNAAVQSLNIQAPDYVKNPKLIAWVAEMAALCKPAQIHWCDGSQA
FT                   EYDALCQQLVDAGTFKPLAKRPGSFLAWTDPSDVARVEDRTYICSAKKEDAGPTNNWME
FT                   PAEMRATLNPLFDGCMAGRTMYVVPFSMGPLGSPIAHVGIELSDSPYVAVNMKIMTRMG
FT                   KAVYDVIGTSGEFVPCVHTIGAPLAAGQKDETTWPCSKTKYIVHYPETREIWSYGSGYG
FT                   GNALLGKKCFALRIASTMGRDQGWLAEHMLILGVTNPEGKKYHVAAAFPSACGKTNFSM
FT                   LVPPKAFDGWKVTTIGDDIAWIKPQADGSLRAINPEAGYFGVAPGTNMLTNPNCMLSLD
FT                   KNVIFTNVALTDDGDVWWEGMEKDQGKLPDHLIDWQGKDWTPQIAKETGAKAAHPNARF
FT                   TVAATNNPALDEAWDDPAGVKIDAMIFGGRRSTTVPLVTEARDWTEGVYMAATMGSETT
FT                   AAAFGAQGVVRRDPFAMLPFAGYNMSDYFQHWLDLGAKIEGQGATLPKIFTTNWFRKNA
FT                   EGKFVWPGYGENMRVLKWMIDRLEGQVQGQETAFGIAPQYAEINWTGLDFDAAQFDSVT
FT                   NIDKAAWAEEMKLHGEHFDKLAYNLPKAMLDTKAELEKRLSA"
FT   gene            complement(81224..81652)
FT                   /locus_tag="CtCNB1_0072"
FT   CDS_pept        complement(81224..81652)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0072"
FT                   /product="conserved hypothetical protein"
FT                   /note="COG2084, MmsB, 3-hydroxyisobutyrate dehydrogenase
FT                   and related beta-hydroxyacid dehydrogenases"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ACY30818"
FT                   /db_xref="GOA:A0A454XLX2"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454XLX2"
FT                   /protein_id="ACY30818.1"
FT                   /translation="MSNFIYNSYCVEHPGVVRIYQASDERMAAIAAEHEAQSQSRSYWM
FT                   VLAVVLAALAAGVFQATETWSDGHMMAAWMVLWAMAFASIALFSTPARRAINLVRTGYR
FT                   AWVKSRQQAAADERVWNAALQDARLMADLARAMDRQSR"
FT   gene            81776..82768
FT                   /locus_tag="CtCNB1_0073"
FT   CDS_pept        81776..82768
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0073"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="COG0583, LysR, Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ACY30819"
FT                   /db_xref="GOA:A0A454XV74"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037402"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454XV74"
FT                   /protein_id="ACY30819.1"
FT                   /translation="MGDAMSLNFRSLDLNLLRVFDEVMSERSLTRAAHKLSITQPAVSN
FT                   AMRRLREVLGDELLVRQGQGVEPTPRAQALWPVIREALQHLEGALAPDEFDPETAATTF
FT                   VIAMADATAATLIPPLYPILAREAPGLGIRLLPLTTRDPRPLLDDGEADMAVGYFPAVL
FT                   ADLTARAQAGGLVAFDSRRLYEGEYLCVMRKGHPLAHVPLTLDNYCAARHMLVSFSGRS
FT                   FGFIDEALASLGRSREVVLTVNQFFTAARVVLNSDLLTILPRHFVPVTGMSDQLELRDL
FT                   PFDVTPVHVDALWRRRGPHPQAYDWLLKTLTRSAEITFANGSAQVTHHG"
FT   gene            82782..83660
FT                   /locus_tag="CtCNB1_0074"
FT   CDS_pept        82782..83660
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0074"
FT                   /product="metallophosphoesterase"
FT                   /note="COG2908, Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ACY30820"
FT                   /db_xref="GOA:A0A454XQL2"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454XQL2"
FT                   /protein_id="ACY30820.1"
FT                   /translation="MKIQLLSDLHLEVHPQFVAQPAAGADVLVLAGDIGSYQSSTQVDG
FT                   ENFGLERFSPLPQYANWPTPVLFVPGNHEYDMQDFDEARLRLQRVCDRLGLIWLDRETV
FT                   VMDGVRFIGTTLWSDFDAMAMHEGVSDATRLHKLREKAFRAANFYLQKTGGSRQGEPFL
FT                   AAPMREESLLCQDWLRAALQQPFDGPTVAVTHFAPSLRSADPRYGLVPGTAGFCNVMDD
FT                   FLPHAQLWLHGHLHCASDYIACGQREDGSEWQCRVVANPLGYARKGEQDDFLPASTIDL
FT                   SQVKMLTVPSP"
FT   gene            83690..84112
FT                   /locus_tag="CtCNB1_0075"
FT   CDS_pept        83690..84112
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0075"
FT                   /product="UspA"
FT                   /note="COG0589, UspA, Universal stress protein UspA and
FT                   related nucleotide-binding proteins"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ACY30821"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454XMB5"
FT                   /protein_id="ACY30821.1"
FT                   /translation="MKILLAVDGSAYTQKMLAYLTSHQEMLGTGHEYTIITVQPLLPPR
FT                   ARAALGKEVVEQYYDEESAKILQPVLEFLKGRGVEAQSIAKVGPIADTIIHAAQDGKFD
FT                   LIAMGTHGHGALGRLVMGSVSSQVLAGCTIPVLLIR"
FT   gene            complement(84274..85188)
FT                   /locus_tag="CtCNB1_0076"
FT   CDS_pept        complement(84274..85188)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0076"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="COG0583, LysR, Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ACY30822"
FT                   /db_xref="GOA:D0IV86"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR017685"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D0IV86"
FT                   /protein_id="ACY30822.1"
FT                   /translation="MSSWDPVALECLAAIVEEGGFERAAQRLHITQSAVSQRLRALEAQ
FT                   VGSVLVERTRPVKPTSAGRLLLKHAKQLRLLRADLAHELQELAPQTGQSLAGEIVSIAI
FT                   NADSIATWAMTALDELVKSGLPLEVVVDDQDFTQELLRSGQVMGCVTTLSQALRGCTVQ
FT                   PLGAMRYVAVASREFAQQRLPQGLTRKNFNQLPYLSFNRKDDMQAEFVARCLGLRNVSL
FT                   QHQILLPSCEAQVRAVRAGWGVGVLPQLLVQPALDAGELIDVATGHALSIALFWHCWNL
FT                   ESRVLARVSQALLGKARQVLQAV"
FT   gene            85231..86607
FT                   /locus_tag="CtCNB1_0077"
FT   CDS_pept        85231..86607
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0077"
FT                   /product="FAD dependent oxidoreductase"
FT                   /note="COG0665, DadA, Glycine/D-amino acid oxidases
FT                   (deaminating)"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ACY30823"
FT                   /db_xref="GOA:D0IV87"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D0IV87"
FT                   /protein_id="ACY30823.1"
FT                   /translation="MLLLFGRKSADTGRMNIIVLGAGIIGISTAWHLRERGHQVTVVDR
FT                   QSGPALETSYANGGQISVSYCEPWANRQAPWKALKWMFDKEAPLLLRPQADSAQWRWCL
FT                   QFLAQCNDRAFARNVQQIVALGAYSHLALKDMVQKTGVEFERLERGIAHFYSSPQAFAE
FT                   AAEGVELMRQYGVQRRLVSREELLAIEPAFTPYAAQIAGGTFTATDESGDARLFTEKLA
FT                   GLCAQAGVQFLYGHDILSLQPARRGRPAQVQIRDGSDGAPRMLSADAVVVACGSYTPLL
FT                   LKPLGVKVPIYPGKGYSATLPLLRPEKAPMVSTIDDSRKVAMSRLGNRLRVAGTIELGG
FT                   FDLSLDTPTARARCEMLVRRVEELMPGVCDTRLPEQGGDPQFWCGLRPATPSNIPCIGA
FT                   TQARGIWVNAGHGTLGWTHGAGSGKAMAALMSGERPALDFRFWDEPAPEVARGARIASA
FT                   "
FT   gene            86721..87212
FT                   /locus_tag="CtCNB1_0078"
FT   CDS_pept        86721..87212
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0078"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="COG1846, MarR, Transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ACY30824"
FT                   /db_xref="GOA:A0A454XSM6"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR012712"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454XSM6"
FT                   /protein_id="ACY30824.1"
FT                   /translation="MIQHDITPALETSRSFARSLPMALLKAREAVMVRFRPSLRAHGLT
FT                   EQQWRVLRIMWVADKRLRPMELSQLTFISMPSLSRLLKTLEGRLLIKRGRHVADLRGSE
FT                   FALTPAGQEMVAQIVPHFETIYTEIEEQLGSAESEQLFRILEHVVQSLGLPGEDELGQD
FT                   "
FT   gene            87236..87880
FT                   /locus_tag="CtCNB1_0079"
FT   CDS_pept        87236..87880
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0079"
FT                   /product="DNA polymerase III, epsilon subunit"
FT                   /note="COG2176, PolC, DNA polymerase III"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ACY30825"
FT                   /db_xref="GOA:D0IV89"
FT                   /db_xref="InterPro:IPR006054"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:D0IV89"
FT                   /protein_id="ACY30825.1"
FT                   /translation="MMSAAIAVIDFETTGMTPAQGARATEVAIVLLEQGRVVDRFQSLM
FT                   QTGAWVSPFITELTGITNAMLRTAPPAAEVMRDAARFVGAAPMVAHNASFDSKFWQAEL
FT                   ALAGEAAPQLFACTVLLSRRIYPQAPSHSLGNLARYLHLPSTGRAHRALADAEMAAALL
FT                   ARMQQDLCERHALPWPEHELLMQLQRCSKAKVGGWLAQQAGQGLLAAQTQD"
FT   gene            88117..88602
FT                   /locus_tag="CtCNB1_0080"
FT   CDS_pept        88117..88602
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0080"
FT                   /product="flavin reductase-like, FMN-binding protein"
FT                   /note="COG1853, Conserved protein/domain typically
FT                   associatedwith flavoprotein oxygenases"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ACY30826"
FT                   /db_xref="GOA:D0IV90"
FT                   /db_xref="InterPro:IPR002563"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:D0IV90"
FT                   /protein_id="ACY30826.1"
FT                   /translation="MPFSQREFRDALGQFATGVTIITARSAEGHAVGSTVSSFNALSLA
FT                   PSLVLWSLGLKANSLPVFRHCTHYAIHVLAASQKPLAELFARKGADRFSHTQHHDSEHG
FT                   VPLLEGCSAVFECRNLRQHEEGDHLLFIGEVERCEHHADRAPLLYHSGHMHAHGFVR"
FT   gene            88734..89645
FT                   /locus_tag="CtCNB1_0081"
FT   CDS_pept        88734..89645
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0081"
FT                   /product="Taurine catabolism dioxygenase TauD/TfdA"
FT                   /note="COG2175, TauD, Probable taurine catabolism
FT                   dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ACY30827"
FT                   /db_xref="GOA:D0IV91"
FT                   /db_xref="InterPro:IPR003819"
FT                   /db_xref="InterPro:IPR042098"
FT                   /db_xref="UniProtKB/TrEMBL:D0IV91"
FT                   /protein_id="ACY30827.1"
FT                   /translation="MIDCEDRPAHTQLKVAAASRTGIELRRISPAIGVEVSGIDLRQPM
FT                   SEEQARELRQALVAHKVLVFREQNITPAQHVAFARRFGELELHPVFPHHPDHAELVLLG
FT                   GNSKIPGTENVYHTDVSWRETPSMASVLRCVECPEVGGDTVWINMEQAYEQLPETRKQQ
FT                   IAGLYAVHDILPSFGARMTPAEQAQARGKYPPVVHPVVRTHPESGQKILYVNETFVTHF
FT                   ANFSSNFDSFRSANEIHAQQQDLMNYLLRQPAILEYQMRLHWESNTIAMWDNRSTQHYA
FT                   IQDYFPAVRRMHRATVVGDKPF"
FT   gene            89775..91139
FT                   /locus_tag="CtCNB1_0082"
FT   CDS_pept        89775..91139
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0082"
FT                   /product="pyridine nucleotide-disulphide oxidoreductase"
FT                   /note="COG1249, Lpd, Pyruvate/2-oxoglutarate dehydrogenase
FT                   complex"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ACY30828"
FT                   /db_xref="GOA:D0IV92"
FT                   /db_xref="InterPro:IPR001100"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR012999"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D0IV92"
FT                   /protein_id="ACY30828.1"
FT                   /translation="MQQQDFDYDFLVIGGGSGGVRASRVAAGLGARVAVVEAAQLGGTC
FT                   VNVGCIPKKLLSHAAHFSQLAEEARGFGWQLEQPRFDWPTLIANKDREIERLNGVYGRM
FT                   LAGAGITLIHGRAALSGPHSVLVNGQTIHARHILIATGGTPSLPDIPGVEHAISSDEAF
FT                   HLPHLPRRVVVVGGGYIAVEFASIFNGLGAETTLLHRRQQLLRGFDADLGLHLGQEMAQ
FT                   LGVNFRWGEEIQAISKQADGLHLQLKSGEQLAVDCVMYATGRVPLIEGLGLEAAGVKVN
FT                   DKGAIEVDQHFCSNVPSIHAVGDVVDRMALTPVALAEGTVLAHHLFGQGGKSAPDYELV
FT                   PTAVFSHPQVGTVGLSEEVARERFGAVQVFQSGFRPLTNRMGAEPENVFLKLIVSKADQ
FT                   RVRGVHMVGEGAGELMQGFAVALQCGATKQQFDATIGIHPTVAEELVTMREPVRE"
FT   gene            complement(91264..91530)
FT                   /locus_tag="CtCNB1_0083"
FT   CDS_pept        complement(91264..91530)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0083"
FT                   /product="cell division topological specificity factor"
FT                   /note="COG0851, MinE, Septum formation topological
FT                   specificity factor"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ACY30829"
FT                   /db_xref="GOA:A0A454XX80"
FT                   /db_xref="InterPro:IPR005527"
FT                   /db_xref="InterPro:IPR036707"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454XX80"
FT                   /protein_id="ACY30829.1"
FT                   /translation="MSMLSFLLGEKKKSASVAKERLQIILARERVGGESGKPDYLPALQ
FT                   KELMAVISKYVDINPNDIKVQLERQENLEVLEVKIELPDAARG"
FT   gene            complement(91536..92348)
FT                   /locus_tag="CtCNB1_0084"
FT   CDS_pept        complement(91536..92348)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0084"
FT                   /product="septum site-determining protein MinD"
FT                   /note="COG2894, MinD, Septum formation inhibitor-activating
FT                   ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ACY30830"
FT                   /db_xref="GOA:A0A454Y6J5"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR010223"
FT                   /db_xref="InterPro:IPR025501"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454Y6J5"
FT                   /protein_id="ACY30830.1"
FT                   /translation="MAKIVVVTSGKGGVGKTTTSASFASGLALRGHKTAVIDFDVGLRN
FT                   LDLIMGCERRVVYDLINVIQGEANLNQALIKDKQCENLFVLAASQTRDKEALTQEGVKK
FT                   VLDDLSAMDFEFIICDSPAGIESGALMAMHYAEEALVVTNPEVSSVRDSDRILGMLSSK
FT                   TERAVKGERIKEHLLITRYNPNRVEDGQMLSLEDIQDILRIELIGVIPESETVLQASNQ
FT                   GIPAVHMQGTDVAEAYQDVVARFLGEEKPMRFTEAVKPGFFKRMFGGR"
FT   gene            complement(92407..93141)
FT                   /locus_tag="CtCNB1_0085"
FT   CDS_pept        complement(92407..93141)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0085"
FT                   /product="septum site-determining protein MinC"
FT                   /note="COG0850, MinC, Septum formation inhibitor"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ACY30831"
FT                   /db_xref="GOA:D0IV95"
FT                   /db_xref="InterPro:IPR005526"
FT                   /db_xref="InterPro:IPR007874"
FT                   /db_xref="InterPro:IPR013033"
FT                   /db_xref="InterPro:IPR016098"
FT                   /db_xref="InterPro:IPR036145"
FT                   /db_xref="InterPro:IPR038061"
FT                   /db_xref="UniProtKB/TrEMBL:D0IV95"
FT                   /protein_id="ACY30831.1"
FT                   /translation="MSVESTGAERPSFDLKSAQLPVLSVVLRSTDMQALAQDLARRLAD
FT                   DPDFFDNDPVLIDLSQVREAEEEIDFPALIEALRNHRTVPVAVRSGSEAQMEAAKAFGL
FT                   SAAPDAMPTRRAEPEIHEIIREVEVEVPAPLADAVIVDRPLRSGQRVYAKGTDIVVLDM
FT                   VSYGAEVIADGNVHVYAPLRGRAVAGASGNTSARIFSTCMEAQLLSIAGIYRTIETDLP
FT                   KDVAGKAAKVRLEGERIVIEPV"
FT   gene            93291..94040
FT                   /locus_tag="CtCNB1_0086"
FT   CDS_pept        93291..94040
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0086"
FT                   /product="Enoyl-CoA hydratase/isomerase"
FT                   /note="COG1024, CaiD, Enoyl-CoA hydratase/carnithine
FT                   racemase"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ACY30832"
FT                   /db_xref="GOA:D0IV96"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:D0IV96"
FT                   /protein_id="ACY30832.1"
FT                   /translation="MSPELLIQGACASITLRRPEVANKLLPEDLIVLRRQIDEVNASPA
FT                   VLVLTLQAVGRHFCSGYDIGEIANSQNEGSSFGEMVDAIENCRPVTIAAIQGGVFGGAT
FT                   DMALACDFRVGGANSQMFMPAARLGLHFYLSGLERYVTRLGVDTAKRLFLSCEKLQAQA
FT                   MKDCGFLTDLVDGTDIGERVMQLQTTLAGMAPLALLGMKKHLNAIARGVHDKAGIDAAV
FT                   QATIASADLKEGGAAWREKRAARFQGH"
FT   gene            complement(94113..96200)
FT                   /locus_tag="CtCNB1_0087"
FT   CDS_pept        complement(94113..96200)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0087"
FT                   /product="acetoacetyl-CoA synthase"
FT                   /note="COG0365, Acs, Acyl-coenzyme A
FT                   synthetases/AMP-(fatty) acid ligases"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ACY30833"
FT                   /db_xref="GOA:D0IV97"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR005914"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR032387"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:D0IV97"
FT                   /protein_id="ACY30833.1"
FT                   /translation="MSSAPQHPAPYIPQIRLYQNWLHETRGLSFADYDSLWRWSTSDLD
FT                   AFWQSIWDYFDLQSPTPHSAVLARNTMPGAQWFPGAQVNYVQQVLRHVQPAHAAGMPAV
FT                   ISRNEQGLQRELSWPELQRQVAALALHLRAQGVAKGDRVAAYLPNIPEAIVAFLACASL
FT                   GAIWSICAPDMGTHAVLDRFKQIAPKALIAVDGVHYAGKDIDRREVLQELRQGLPSVQH
FT                   VVLVPNLDTSIKIADTADYTSVTARNDAETAAFTAEWLPFDHPLWIVYSSGTTGLPKPI
FT                   VHGHGGMVLVALQLKALHNDIGCSYESNSWGERYHWYSSTGWVMWNAQVSGLLGGTSCV
FT                   IFDGSPGGSKDKPDWGTLWRFAAETGVTSFGSGAAFYANCMKAGLELSSCGDLSRIRGL
FT                   GSTGSPLSAEVQQWGTDQFEKLGRANIWWNNLSGGTDFAGAFIGGNRDLPLVPGVMQCR
FT                   QLGAAVEAWNEQGQPVMDEVGELVCTQPIPSMPLFLWGDADGKRYLSSYFDMYPAGHGR
FT                   QPGGGDGDAEMGPVWRHGDWIKLLGEGGCIIYGRSDATINRHGLRMGTSEIYSAVEALP
FT                   EVLDSMVVDLEYLGKDSYMPLFVALRPGVELDAALRERINKAIRSALSPRFVPDDIFAV
FT                   AEIPRTLSGKKQELPIKKLLLGQPLAKVVNKDAMANPGCLDWYEGFAREYLARTEAGTV
FT                   S"
FT   gene            96374..98284
FT                   /locus_tag="CtCNB1_0088"
FT   CDS_pept        96374..98284
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0088"
FT                   /product="Radical SAM"
FT                   /note="COG1032, Fe-S oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ACY30834"
FT                   /db_xref="GOA:A0A454XKZ0"
FT                   /db_xref="InterPro:IPR006158"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454XKZ0"
FT                   /protein_id="ACY30834.1"
FT                   /translation="MSALPTRVLAVIPPMTQLNTPYPSTAYLTGFLRSRGITAMQEDLA
FT                   LALVLQLLSPDGLRAVAERIQSLPARQHTPAVQSFVAQQERYLATIAPTIAFLQGRDST
FT                   LAHRIVGRHFLPEGPRFATLDVYEDEEGGDPLGWAFGALGLQDKAKHLATLYLNDLADV
FT                   LRDAVDERFEFVRYAESLAGSQPSFDPLASALAAEPNLVDEVLERLTLEAVERHQPTVV
FT                   LLSVPFPGSAYAAFRIAQTIKRRFPQIATVLGGGFVNTELRELAEPRVFDYFDFVTLDA
FT                   GERPLLALLEHLRGERGRSRLVRSFVRGDDGKVQYVNMMESDIAFAEVGTPTWDGLPLD
FT                   RYLSLLDMLNPMHRLWSDGRWNKLTVAHGCYWKKCSFCDVSLDYIGRYEGASAAVLADR
FT                   IEAIVAETGQTGFHFVDEAAPPKALKALSQELIARNAGISWWGNVRFEKTFTPELAELM
FT                   ADSGCIAISGGLEVASDRLLALMKKGVTVDQVARVTKAFSEAGILVHAYLMYGFPTQTV
FT                   QDTVDALEYVRQLFLNGCIQSGFFHRFSCTVHSPVGLNPEEYGIELPPLPEGNFAKNDR
FT                   PFIDPTGVDHDALGAALKKAIYNFMHGIALEEDVRMWFPFKVPKPTVKRDRIARALQQK
FT                   Q"
FT   gene            98517..99839
FT                   /locus_tag="CtCNB1_0089"
FT   CDS_pept        98517..99839
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0089"
FT                   /product="putative pyrimidine permease"
FT                   /note="COG2233, UraA, Xanthine/uracil permeases"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ACY30835"
FT                   /db_xref="GOA:A0A454XIK8"
FT                   /db_xref="InterPro:IPR006042"
FT                   /db_xref="InterPro:IPR006043"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454XIK8"
FT                   /protein_id="ACY30835.1"
FT                   /translation="MGMFQWTERSSDVLQGGGVIGPDERLPWTQTGLMGIQHVIAMFGS
FT                   TVLAPILMGFDPNLAVLMSGIGTLIFFLITGGKVPSYLGSSFAFIGVVNIATGYVASQG
FT                   PANANIGVALGGIIACGFVYMLVGLLVQMVGTAWIERFMPPVVTGAVVAIIGLNLASIP
FT                   IKNMASNNFESWMQALTFVSVALVAVFTRGMLQRLLILIGLIIASVLYAVFTNGLGWGK
FT                   PVDLSGVLNAAWFGIPSFHAPVFTSNAMLLIVPVVIILVAENLGHIKAVTAMTGKNLDQ
FT                   YMGRAFIGDGVATMVSGAAGGTGVTTYAENIGVMAATRIYSTAVFFVAALLAVLLGFSP
FT                   KFGALIQAIPLPVMGGVSIVVFGLIAIAGAKIWVDNKVDFSDTKNLIVAAITLILGTGE
FT                   FTLRFGEFALGGIGCATFGAIILYALLTMGERKSETKVQAK"
FT   gene            100077..101591
FT                   /locus_tag="CtCNB1_0090"
FT   CDS_pept        100077..101591
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0090"
FT                   /product="acetyl-CoA hydrolase/transferase"
FT                   /note="COG0427, ACH1, Acetyl-CoA hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ACY30836"
FT                   /db_xref="GOA:A0A454XXA9"
FT                   /db_xref="InterPro:IPR003702"
FT                   /db_xref="InterPro:IPR017821"
FT                   /db_xref="InterPro:IPR026888"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="InterPro:IPR038460"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454XXA9"
FT                   /protein_id="ACY30836.1"
FT                   /translation="MSIADRVRYPEFLSRVMTAEEAAALIPHGVNVGMSGFTGAGYPKA
FT                   LPQAIAARAKAEHAQGKPYKINVWTGASTAAECDGVMAEAHALGQRLPFNTDPIARKAV
FT                   NSGEIDFIDMHLSHVAQHAWFGFLGHMNIAVIEVLGVTADGLLIPSTAVGNNKTWLEIA
FT                   DKVILEVNTKPPARMEGMHDIYYGTAIPPRRMPINMTHADDRIGDAYLKVDPAKVVAVV
FT                   ETHKGDRDNVFATPDENSQKIAGYIIDFLAHEMKMGRLPKEMLPIQSGVGNVANAVLAG
FT                   LLTGPFENLLGFTEVLQDGMLDLLRAGKMSKASATSISLSAAAYKDFEDNIDFYRERII
FT                   LRPQEISNHPELVRRLGIIAMNSMIEADIYGNINSTHVMGTGMMNGIGGSGDFARNGYL
FT                   SFFVTPSVAKDGKISCIVPMCSHVDHTEHDTQIIVTEQGLADLRGLSPKQRAQVIIDRC
FT                   AHPDYRAQLQDYFDRSRQQGAQHTPHILTEALSWHQRFMDKGDMRG"
FT   gene            101816..102289
FT                   /locus_tag="CtCNB1_0091"
FT   CDS_pept        101816..102289
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0091"
FT                   /product="hypothetical conserved protein"
FT                   /note="COG2050, PaaI, Uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ACY30837"
FT                   /db_xref="InterPro:IPR003736"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:D0IVA1"
FT                   /protein_id="ACY30837.1"
FT                   /translation="MAIWTRELDLKALNAGSANTAISHLGIEFTEYGDDYVCARIHVDE
FT                   RTCQPYGILHGGVSVVLAETLGSMAAACSIPEGYRCVGLGVTANHVRAGRKGSWITATA
FT                   RPTHLGRTTHVWAVELRDEEGKLTCNCSLTMAILPPEVAKNVRLDAASLGGVQ"
FT   gene            complement(102449..103150)
FT                   /locus_tag="CtCNB1_0092"
FT   CDS_pept        complement(102449..103150)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0092"
FT                   /product="high-affinity branched-chain amino acidtransport
FT                   ATP-binding protein livF"
FT                   /note="COG0410, LivF, ABC-type branched-chain amino acid
FT                   transportsystems"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ACY30838"
FT                   /db_xref="GOA:D0IVA2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D0IVA2"
FT                   /protein_id="ACY30838.1"
FT                   /translation="MFSLQEVHSFYGDSHILHGISLDLPQGQAVGLLGRNGMGKTTLIR
FT                   TLMGYVAARSGRVFADGKEVTNSAPEKMARLGIGYVPEGRGVFPNLSVKENLLMSARAG
FT                   LDGSRGWTYERVLETFPRLKERLSNGGDQLSGGEQQMVSIGRALMTNPRLMILDEATEG
FT                   LAPLVVAEIWRVIAQIRETGISTLIVDRDYKKVLAHTDKAVVMEKGRLALQAESADLLQ
FT                   QPQKLSALLGV"
FT   gene            complement(103293..104063)
FT                   /locus_tag="CtCNB1_0093"
FT   CDS_pept        complement(103293..104063)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0093"
FT                   /product="high-affinity branched-chain amino acidtransport
FT                   ATP-binding protein livF"
FT                   /note="COG0411, LivG, ABC-type branched-chain amino acid
FT                   transportsystems"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ACY30839"
FT                   /db_xref="GOA:D0IVA3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032823"
FT                   /db_xref="UniProtKB/TrEMBL:D0IVA3"
FT                   /protein_id="ACY30839.1"
FT                   /translation="MANADNAPQMSVRGLTRRFGGLVAVNNVDLDLHQGEVHAVIGTNG
FT                   AGKSTLINMLSGEIAASGGSIALEGRDVTQMPQPQRAKAGIGRSYQRTTIFPEFTVLEN
FT                   CRLTAQAQALPRPWHIWESAQHCAASMQRAQSALQRAGLAQHAERIAGSLSHGAKRQLE
FT                   VAMCLATAPRVLLLDEPLAGMGAEETERMLELLQELKSAHAVLLVEHDMDAVFRIADRI
FT                   TVMVNGSVVATGTPDQIRNDPVVRTAYLGEEEHA"
FT   gene            complement(104056..105150)
FT                   /locus_tag="CtCNB1_0094"
FT   CDS_pept        complement(104056..105150)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0094"
FT                   /product="inner-membrane translocator"
FT                   /note="COG4177, LivM, ABC-type branched-chain amino acid
FT                   transport system"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ACY30840"
FT                   /db_xref="GOA:D0IVA4"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:D0IVA4"
FT                   /protein_id="ACY30840.1"
FT                   /translation="MSDTSYTPLPQSNQAYAEAPAVTNQSRPIRAKSVWVAVVLPLAVA
FT                   ALLAAAQPFWSAYLSDLVVKIMILSIFALSLHILVGGAGLVSLGHAAYFGLGAYAAVKA
FT                   AGQDGSNFLVMLGAAVGVSGLYALVVGALSLRTKGVYFIMVTLAFAQLAFFVVHDVGYF
FT                   GGSDGIYLMQRPATGALDMESSSTQYFVVLAALVLVYAFIAMLRHSRFGHALAGIRVNE
FT                   QRMRAAGFATYGYKLAGFVIAGALAGLAGFLLAARDAVVNPELLAWHHSGEVLLMLILG
FT                   GVGSLRGAVLGTITFVLLKELLSTHAIVGNAADHWQLTLGISIIALVALLPKGLVGIND
FT                   KWQKKAAAQKSQSTSAGQQGADHG"
FT   gene            complement(105310..106179)
FT                   /locus_tag="CtCNB1_0095"
FT   CDS_pept        complement(105310..106179)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0095"
FT                   /product="UrtA"
FT                   /note="COG0559, LivH, Branched-chain amino acid ABC-type
FT                   transport system"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ACY30841"
FT                   /db_xref="GOA:A0A454XMZ0"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454XMZ0"
FT                   /protein_id="ACY30841.1"
FT                   /translation="MDLATFLVQCLNSVQYGLLLFLLASGLTLIFGIMGVINLAHGSFY
FT                   MIGAYVAFSLAPYLGQHFIIMLLAGVVLAVVLGYFLEWAFFSFLYERDHLQQVLMTYGL
FT                   ILVFEGLRAILVGNDVHGVEKPAWLAGSFPLMGMMQYPWYNVFAAAACLLVALLMYYTV
FT                   NRTRLGMMIRAGASNRDMVRGLGINIKRLYRIVFAVGVALAALAGMIAAPMSSVYPNMG
FT                   SSVLIICFVVVVIGGIGSITGALIASLLVGFVDTFGKVFFQELSGMSIYLLMAVILVWR
FT                   PEGLMGKR"
FT   gene            complement(106334..107497)
FT                   /locus_tag="CtCNB1_0096"
FT   CDS_pept        complement(106334..107497)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0096"
FT                   /product="extracellular ligand-binding receptor"
FT                   /note="COG0683, LivK, ABC-type branched-chain amino acid
FT                   transportsystems"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ACY30842"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:D0IVA6"
FT                   /protein_id="ACY30842.1"
FT                   /translation="MSKQWAIWSAIALAAAASGSSAIAQEKIKVGFMLPFSGTYAALGV
FT                   AIENGFRMQVAEQGGKLGGREIEYFKVDDESDPAKATDNVNRLIKRDKVDVIIGTVHSG
FT                   VAMAMAKAAKESGTVLIVPNAGADAVTGPMCAPNIFRSSFSNWQTAYPMGVVAAKEGKK
FT                   NAMTLTWKYAAGEEAVNGFKEGFEKSGGKVSKQLTLPFPNVEFQALLTEIAAAKPDAVF
FT                   SFFAGAGAVKFVKDYHASGLSKTIPLYGPGFLTDGTLDAQGEAAQGMLTTLHYADELGT
FT                   ARDQAFRTNYAKNYKLQPDVYAVQGYDAAQMLAVGLKAAGGDIGKKDVFRTAIEKATIA
FT                   SPRGDFTLSKAHNPVQDIYLRKVDGKENKKISVAVKALADPARGCRM"
FT   gene            complement(107688..109253)
FT                   /locus_tag="CtCNB1_0097"
FT   CDS_pept        complement(107688..109253)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0097"
FT                   /product="benzoate-CoA ligase family"
FT                   /note="COG0365, Acs, Acyl-coenzyme A
FT                   synthetases/AMP-(fatty) acid ligases"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ACY30843"
FT                   /db_xref="GOA:D0IVA7"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR011957"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="UniProtKB/TrEMBL:D0IVA7"
FT                   /protein_id="ACY30843.1"
FT                   /translation="MTDFSQPFNFAQHLFDLNQGRGDKNAYTDDQGTLSYAQLQEQARR
FT                   LAHGLLAAGIHREERVLLVMHDMREWVISFLGAMYAGVVPVAVNTLLTAADYAYMLEHC
FT                   RAQAIVTNGALVAVVQQALEQAQHEVNHIWVARPDEAPQGLPPAFEPLQPWLQQQTPLA
FT                   HAARTMGDDPGFWLYSSGSTGKPKGAVHTHANPYWTAELYGKPVLGLNENDICFSAAKL
FT                   YFAYGLGNALTFPLSVGASVVLMAERPTPEATFRRWTEHQPTVFFGAPTGFAGMLAHPT
FT                   LPAREQVSLRMCSSAGEALPAEIAQRFKTHFGADIVDGIGSTEIAAISSSPTARTIYAT
FT                   AAPANLCPASAVELRSEDGQPVADGEIGDLYIKGPSAALMYWANRDKTRDTFQGAWLKS
FT                   GDKYVRDADGYYTYAGRSDDMLKVSGIYVSPFEVESTLQQHPAVLEAAVIGVTDEQGLT
FT                   KTKSYVVCKPGQSASEAELKAFVKNRLAAYKYPRFIEFVDELPKTATGKIQRFRLRELE
FT                   SKSR"
FT   gene            complement(109257..110852)
FT                   /locus_tag="CtCNB1_0098"
FT   CDS_pept        complement(109257..110852)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0098"
FT                   /product="aldehyde dehydrogenase"
FT                   /note="COG1012, PutA, NAD-dependent aldehyde
FT                   dehydrogenases"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ACY30844"
FT                   /db_xref="GOA:D0IVA8"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniProtKB/TrEMBL:D0IVA8"
FT                   /protein_id="ACY30844.1"
FT                   /translation="MLIRTALQETPMTELLANHVAGRWQTGSGPGSLLRDPVLGAELVR
FT                   VDATGLDLGAAFAFARDTGGKALRALSYARRASLLADIAAVLQSRRDAYYEISTANSGT
FT                   VRNDTAVDVDGGIYTLNQYARWGAALGDARHLSDGEAVALAKDGAFLSRHIQVPTRGVA
FT                   LFINAFNFPAWGLWEKAAAALLSGVPVIVKPATATAWLTQRMVKDVIDAGILPPGALSI
FT                   VCGSAAGLLDQLQPMDVVSFTGSAETASAIRSHAAIARHSVRSNIEADSVNCALLLPGH
FT                   GPDSEAAALLAREVVREMTVKSGQKCTAIRRVLVPQALYDEVAQAVGAQLAKIAVGNPR
FT                   NDAVRMGSLVSREQYDSVQQGLGRLLEHTTALHDGRRNALIDADPAIAACAQPVLLGTQ
FT                   DPDGSALVHDMEVFGPVATLMPYRDLAHGLALAHRGQGSLVCSIYGDDDQALAAAATDL
FT                   AASHGRVHVVTPAVARLHTGHGNVMPQSLHGGPGRAGGGSELGGLRALDFYHRKSAIQA
FT                   APQLLQALAETTGA"
FT   gene            110988..111890
FT                   /locus_tag="CtCNB1_0099"
FT   CDS_pept        110988..111890
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0099"
FT                   /product="transcriptional regulator, XRE family with"
FT                   /note="COG0703, AroK, Shikimate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ACY30845"
FT                   /db_xref="GOA:D0IVA9"
FT                   /db_xref="InterPro:IPR000623"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031322"
FT                   /db_xref="UniProtKB/TrEMBL:D0IVA9"
FT                   /protein_id="ACY30845.1"
FT                   /translation="MDQLDMASASVAEGDEAGKSPLLQALGERVRNLRARRGLTRRGLA
FT                   SAAVVSERHLANLEYGTGNVSILVLQQIAHALQCSMAELLGDVTTASAEWLLLRELLEG
FT                   RSEADLKRVRLAAGEILGTAPMGDPHRASRIALIGLRGAGKSTLGRMLAEQLNVPFLEL
FT                   NQEIERVAGCSVREIYDLYGAGAYRRYERRALEEAVQIYSDVVIATPGGIVSDPATFNE
FT                   LLSHCTTVWLQAQPDEHMSRVVAQGDTRPMAANPEAMDDLRRILDGRSAFYSKADHVLD
FT                   TSGKSVAQSLKQLKVLVAA"
FT   gene            complement(111897..113573)
FT                   /locus_tag="CtCNB1_0100"
FT   CDS_pept        complement(111897..113573)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0100"
FT                   /product="acyl-CoA dehydrogenase-like protein"
FT                   /note="COG1960, CaiA, Acyl-CoA dehydrogenases"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ACY30846"
FT                   /db_xref="GOA:D0IVB0"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR041504"
FT                   /db_xref="UniProtKB/TrEMBL:D0IVB0"
FT                   /protein_id="ACY30846.1"
FT                   /translation="MQALETHDVFNQFDELTGINLLQADAALQEVLQRQQAQSFAPALN
FT                   RFAQQLGEKQNWEHAELANRHTPELQRFDARGRVLDAVEFHPSWHRLMELYRKQGLISL
FT                   PFESPSRGRWSAWAAGFYLHGQVEQGTLCPATMTTAAIPVLQKEPQLWSQLQARLFSHE
FT                   YDARDLPLDQKKSIWIGMGMTEKQGGSDVRANTTVARPVHEGGRGGEYLLRGHKWFFSA
FT                   PMCDAHLVVARMATASGELGGHACFFVPRWRPDGSKNPVRVQRLKDKVGNRSNSSSEVE
FT                   LQDAWGILMGEEGRGIPTIIEMASYTRLNCVLGSAAILRSATVQSIAYARQRSAFGRHL
FT                   ADQPLMATVLADLALESEASMQLAMHLAQAYESEAEGDLLARAWKRIMTPAAKFWVCKR
FT                   SVEITGEAMEVFGGNGYVQDSIVARLFREAPVNSIWEGSGNVMCLDVLRAMGREPEATR
FT                   LLLQDLGDMAADQPLLTAMAQSLAKRLSDSPEALEPQARRLVQDLCLLAQACLLHRHAP
FT                   EHMADGFIHTRLGAQNGAMVVGAFDPAGLDIAAVLERALPL"
FT   gene            complement(113669..114502)
FT                   /locus_tag="CtCNB1_0101"
FT   CDS_pept        complement(113669..114502)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0101"
FT                   /product="peptidase M48, Ste24p"
FT                   /note="COG4783, Putative Zn-dependent protease"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ACY30847"
FT                   /db_xref="GOA:D0IVB1"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="UniProtKB/TrEMBL:D0IVB1"
FT                   /protein_id="ACY30847.1"
FT                   /translation="MHALISSLRLPATRNCLLPALVCAALMHAPAQAQVEVGKASVMRQ
FT                   LVPAETLESSATQQYQELLQKAKAQGALADAGNPQLQRLRSIAQRLIPYAAQWNPRASQ
FT                   WRWEVNLIGSKQINAFCMPGGKIAFYTGIIDQLKLTDDEIAMIMGHEMAHALREHSREQ
FT                   LAKNQATSIGISLGAQLLGLGDIGNAAARLGGQLLSLKFSRNDESDADLVGLELAARAG
FT                   YNPQAAVSLWRKMGQATGEGGIGFLSTHPTGPDRIRQLEGNVPRVMGLYEQARRR"
FT   gene            complement(114540..115412)
FT                   /locus_tag="CtCNB1_0102"
FT   CDS_pept        complement(114540..115412)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0102"
FT                   /product="hypothetical membrane protein"
FT                   /note="COG5006, Predicted permease"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ACY30848"
FT                   /db_xref="GOA:D0IVB2"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:D0IVB2"
FT                   /protein_id="ACY30848.1"
FT                   /translation="MGPVGLVLAAAMLWGTTGTAQHFAPAQLSPYWVGGLRMVMAALFF
FT                   GALALLLDRGHARQPMRWARIVFCGLCMAIYNLSFFAGVKASGVALGTALAIGSGPIWA
FT                   GLMQAVVQKRMPSPQWWLGTCTGVGGGIVMALAATDRQHLPWAGMALCLLAGLSYAAYA
FT                   LVNQALVLQSRVATVNAWVFACAALLSLPVSAWLGGPLQISAGGWAVVIYLGMVATGFA
FT                   YLLFSVGLRGMSAATGVALSKAEPITAFALSLLVVGERPAWWSVIGLFGVIGGLWLVVQ
FT                   AERKTAETV"
FT   gene            complement(115526..116221)
FT                   /locus_tag="CtCNB1_0103"
FT   CDS_pept        complement(115526..116221)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0103"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="COG2207, AraC, AraC-type DNA-binding
FT                   domain-containing proteins"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ACY30849"
FT                   /db_xref="GOA:D0IVB3"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="UniProtKB/TrEMBL:D0IVB3"
FT                   /protein_id="ACY30849.1"
FT                   /translation="MSRDTASPRPVLDQAQTSVRSYSGEHQAHAHDHAQILFALQGRME
FT                   LEVGGRPSFVDSACGMVIPAGTGHGYLAAPQTQVLVIDAPMTQGLDKLRRFAVPPALRF
FT                   PQSSLSAAAQMALVLQAPTLLQRRGMDLLWLQRQVQAALHESWPTARLADLVHLSVAQF
FT                   HARFVELTDRTPQDWLRGLRLDAAVLQLRKGAALEATALRCGYASASALAYALRRERGL
FT                   TSRQLRERH"
FT   gene            116298..117683
FT                   /locus_tag="CtCNB1_0104"
FT   CDS_pept        116298..117683
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0104"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="COG2270, Permeases of the major facilitator
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ACY30850"
FT                   /db_xref="GOA:D0IVB4"
FT                   /db_xref="InterPro:IPR004752"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D0IVB4"
FT                   /protein_id="ACY30850.1"
FT                   /translation="MPSASENQTMTESSQTSRNPSSEDVVSKPKRSWSQAFKVYAQPTS
FT                   LRMLALGFSAGLPLLLVLGTLSFWLREADIDRTTIGFLSWVGLAYAFKWVWSPLVDRLP
FT                   LPALTRMLGRRRSWLLFSQLLIVAGLLGMSFMDPKQSLQPLVLCAVLVAFGSATQDIAL
FT                   DAYRIESAKVDDQAALAATYQTGYRLAMIWAGAGVLWVAAQVQGDVQGYMVQAWHVAYT
FT                   AMAASMLVGMITVLLSPEPEARPMAPARNAAEWIKGALIAPFADFIGRYRWQALLLLAL
FT                   IGLYRVSDVVMGIMANPFYVDMGYTKEEVAAVTKVFGVIMTLLGGFVGGTMAVRWGVMR
FT                   VLMLGAVLSACTNILFAWLATRGHDVSALVWVVSADNLAGGIASAAFIAYLSGLTNVQY
FT                   SATQYALFSSMMLLAPKWLAGFSGAFVDAYGYEAFFHTTALMGFPVLLLIFLASRVKIG
FT                   SDA"
FT   gene            117826..118557
FT                   /locus_tag="CtCNB1_0105"
FT   CDS_pept        117826..118557
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0105"
FT                   /product="two component transcriptional regulator, winged"
FT                   /note="COG0745, OmpR, Response regulators consisting of a
FT                   CheY-likereceiver domain and a winged-helix DNA-binding
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ACY30851"
FT                   /db_xref="GOA:D0IVB5"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:D0IVB5"
FT                   /protein_id="ACY30851.1"
FT                   /translation="MSTHQLLMIEDDVRLAQMVSDYLGNNGLEVTHMADGKSGLEQLQP
FT                   SDGGSVELPDLVILDLMLPDMDGLEVCRRIRSMPGTPAQVPVLMLTAKGDPMDRIIGLE
FT                   LGADDYLPKPFEPRELLARIRAILRRKGSESQATPANAVMRFGSLEIDRDARTVSVGEQ
FT                   QADLTSYQFDLLVALAERAGRVLTRDQIMEAVRGRELEAFDRSIDVHMGRIRAAIEADP
FT                   KAPKRILTVRGVGYVFAKQQD"
FT   gene            118557..119777
FT                   /locus_tag="CtCNB1_0106"
FT   CDS_pept        118557..119777
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0106"
FT                   /product="periplasmic sensor signal transduction"
FT                   /note="COG0642, BaeS, Signal transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ACY30852"
FT                   /db_xref="GOA:D0IVB6"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D0IVB6"
FT                   /protein_id="ACY30852.1"
FT                   /translation="MKLLHAFSQRLYLRIWLAVVVGVAVLTLCVAWAWNIAEEQRAQNS
FT                   TTPPSREMVLKGPEGEVLVEGRGNRISGSPVDGVRFEIAARDGQVYELWMAPREWREGR
FT                   PPPRDGAVAFWLRPPFGFLWMLGLVGVAVVVGVFPIIRRLLKRLENLQRGVKRFGEGDL
FT                   SVRVPEHGHDEVADLAHQFNAAAARIETLMTSHKSLLANASHELRSPLTRIRMGLEFMG
FT                   DDPASARAKAEIQRNIGELDQLVDEILLASRLDSSEVDVGTVESVDLIGLAAEECARID
FT                   ADLEMQTDGPLEVQGIAKLLRRAVRNLLENARRYSEGEITLSLSKQDGMALIRVEDHGP
FT                   GVPKAQRERIFEKFYRLPGASERSGGVGLGLSLVRSIAERHGGTVHCEARQDGRSGASF
FT                   VICLPLS"
FT   gene            complement(119830..121167)
FT                   /locus_tag="CtCNB1_0107"
FT   CDS_pept        complement(119830..121167)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0107"
FT                   /product="UDP-glucose/GDP-mannose dehydrogenase"
FT                   /note="COG1004, Ugd, Predicted UDP-glucose 6-dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ACY30853"
FT                   /db_xref="GOA:D0IVB7"
FT                   /db_xref="InterPro:IPR001732"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR014026"
FT                   /db_xref="InterPro:IPR014027"
FT                   /db_xref="InterPro:IPR017476"
FT                   /db_xref="InterPro:IPR028357"
FT                   /db_xref="InterPro:IPR036220"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D0IVB7"
FT                   /protein_id="ACY30853.1"
FT                   /translation="MKVTVFGTGYVGLVQGAVLADVGHQVLCVDVDEKKVAALKAGQIP
FT                   IHEPGLDALVINNQQLGRLQFTTNAAEGVAHSELIFLAVGTPPDEDGSADLQYVLAVAR
FT                   TIAQHMDGPRIVINKSTVPVGTADKVSAVIAEGLAQRNLQHPFDVVSNPEFLKEGAAVG
FT                   DCQRPDRIIIGTGNPASEAKLRELYAPFNRNRDKIVMMDVRSAELTKYAANAMLATKIS
FT                   FMNEIANLAEKLGANVEAVRRGIGSDPRIGYHFIYPGVGYGGSCFPKDVKALIHTAREV
FT                   EFEPLLLNAVEDRNHAQRNVLFERISAFYSGQLKGKTIAVWGLAFKPNTDDMREAPSRN
FT                   LLESLWAAGAKVKAYDPVAMKEARRIYGERADLELVDSPLAAVQDSDSLAIVTEWQIFR
FT                   APDFDLLAATLNDRMIFDGRNLYEPALPASHGLGYVSIGRPAQQPR"
FT   gene            complement(121164..122174)
FT                   /locus_tag="CtCNB1_0108"
FT   CDS_pept        complement(121164..122174)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0108"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="COG0451, WcaG, Nucleoside-diphosphate-sugar
FT                   epimerases"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ACY30854"
FT                   /db_xref="GOA:D0IVB8"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D0IVB8"
FT                   /protein_id="ACY30854.1"
FT                   /translation="MNPVLITGCAGFIGMHCAKRLLEQGVPVLGIDNLNNYYDVALKHA
FT                   RLAELRPHAHFRFVELDLADRQGMADLFAEAAPSKVLHLAAQAGVRYSIDQPDDYTDSN
FT                   LLGFGNILQGCRKHQVEHLVYASSSSVYGGNTRMPFAESDAVDHPISYYAATKKANELM
FT                   AHSYAHLYGIPTTGLRFFTVYGPWGRPDMALFKFTKAMLAGESIDVYGEGKLVRDFTYI
FT                   DDIVEGIMRVLDKPATPDAGYDSRNPNPGTSTAPYRIFNIGNNSPTVLMDYIAALEGAL
FT                   KITARKQMLPIQPGDMHSTSADTRALQAWVGFSPAMPVATGVQHFVDWYRSFYRV"
FT   gene            complement(122171..123676)
FT                   /locus_tag="CtCNB1_0109"
FT   CDS_pept        complement(122171..123676)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0109"
FT                   /product="4-amino-4-deoxy-L-arabinose transferase and"
FT                   /note="COG1807, ArnT, 4-amino-4-deoxy-L-arabinose
FT                   transferase and related glycosyltransferases of PMT family"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ACY30855"
FT                   /db_xref="GOA:D0IVB9"
FT                   /db_xref="InterPro:IPR038731"
FT                   /db_xref="UniProtKB/TrEMBL:D0IVB9"
FT                   /protein_id="ACY30855.1"
FT                   /translation="MASNSSTSIRPDWQQTLYAKPWIWLALLVFAHIVSRISISAGMKW
FT                   DESEQILWAQQLQLGYGPQPPLYTWMQWAVCQLLGPSVLALALLKHLLIALAYCLAWLA
FT                   GRQLLGQKGAWWVAAGLLLMPPFGWDSLRDQTHTVMVTAMTMGLWWAVLRQVQKPQAVN
FT                   FVLIGLFCGLGMLSKYSYAMLIGALFLASMTVAQVRSAIFARGWWLAPLVGLLVFAPHG
FT                   FWLASHWGMATTETVQKMSISTEASHLKGLGNLLKALLSTLGLWLIAALISYRSRLWRP
FT                   GINASLPAQVWARPLLRNYLLIIAVCLLAMVLAADVTDFKQRWMLPLTAAAPLALYVWR
FT                   PALLEQGVGRMFTVFVIVFALIFLIMATLRPWQGGRKNDPDELNHPVKTLAQELHQAGY
FT                   SGKGVIVGSDHMLAAMLHSQFPQTYALGCSDGALLRQCLSQAGADTTGGLLLITRADKP
FT                   VAGWWDGIFTTQAKTALQTLSMPFEKMPASATPAQYQYLWIAP"
FT   gene            complement(123862..124794)
FT                   /locus_tag="CtCNB1_0110"
FT   CDS_pept        complement(123862..124794)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0110"
FT                   /product="transposase, IS4"
FT                   /note="COG3039, Transposase and inactivated derivatives"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ACY30856"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:D0IVC0"
FT                   /protein_id="ACY30856.1"
FT                   /translation="MRETSWGRVKYRTTNWKAYNAALKARGELTIWLDRDMQWLARPTG
FT                   KRGRCQKFSDAAIQFCLTIKCLFGQPLRQTLGLVESLLGMAGLHWPVPDYSTVCRRQKS
FT                   LDVQVRYRASDKGLHMLADSTGIKFLGEGEWKTKKHGAESRRQWRKVHLGIDAQTLQIR
FT                   AIAVTTNEVGDSPMAADLLGQIPSNEEIASFTGDGAYDTQDVHKACYLRGAIPIIPPRK
FT                   GAKLRKGLAFAHRNEAVKACRQLGRAIWKRWSGYHRRSLVETKMNCFKRLGEKVMARTF
FT                   ERQVTELHIRASILNQFTALGTPQTVAAA"
FT   gene            124867..125874
FT                   /locus_tag="CtCNB1_0111"
FT   CDS_pept        124867..125874
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0111"
FT                   /product="glycosyl transferase, family 2"
FT                   /note="COG0463, WcaA, Glycosyltransferases involved in cell
FT                   wallbiogenesis"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ACY30857"
FT                   /db_xref="GOA:D0IVC1"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D0IVC1"
FT                   /protein_id="ACY30857.1"
FT                   /translation="MHDSNPEVSIVVPVYNEFDNLPDLVARIDEAMRTQPLSYELIAVD
FT                   DGSTDGSARRLRELAEQHPWVRAVCLVRNYGQSSALQAGFDRVRGRYVVTLDADLQNEP
FT                   GDIPLLLERLENDPDVDMISGWRKNRQDKALSRRLPSVLANRLISKFTNVQLHDYGCAL
FT                   KAYRREIIDRIRLYGEMHRFIPSLARDAGARITEIPVRHHARTRGVSKYGIDRTFRVIL
FT                   DLIFIVFFMRFRQRPLHAFGGMGLWMATPGVLILLWLLAQKIMGESIGGRPLLMAGVML
FT                   VLMGMQFIAAGLIGELLTRIYYESGSGLQYYAKDYGAVEHKPADKAAKTETAVL"
FT   gene            125907..126806
FT                   /locus_tag="CtCNB1_0112"
FT   CDS_pept        125907..126806
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0112"
FT                   /product="conserved hypothetical protein"
FT                   /note="COG0392, Predicted integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ACY30858"
FT                   /db_xref="GOA:D0IVC2"
FT                   /db_xref="InterPro:IPR022791"
FT                   /db_xref="UniProtKB/TrEMBL:D0IVC2"
FT                   /protein_id="ACY30858.1"
FT                   /translation="MGIALLAAVVYLANPVQLWGRLQQASPWWLLGGLGISIASNAVSA
FT                   WRWRAMARWLGAEMSLASGMRWYFQAIGLNVLLPGAVVGGDVYRAIALQKTGQTKAASN
FT                   LSVILDRVSGLWMLCAIGGLGAVACASTLAPWVHLNTALFITLLLAVTVIWLLLPWALL
FT                   QGLRSHWFRLPGAWLEPVRTAANRPDFLSQLWLQAASSALVQLLSAAALACGAIALGLY
FT                   LPLVVWAFVIAPVFLMAALPVSVGGWGTREAAAVAALAPFGVPAVLAVGVGLLYGVFAL
FT                   GQGALGALALGLPGRSQD"
FT   gene            complement(126797..127888)
FT                   /locus_tag="CtCNB1_0113"
FT   CDS_pept        complement(126797..127888)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0113"
FT                   /product="O-antigen polymerase"
FT                   /note="COG3307, RfaL, Lipid A core - O-antigen ligase and
FT                   related enzymes"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ACY30859"
FT                   /db_xref="GOA:D0IVC3"
FT                   /db_xref="InterPro:IPR007016"
FT                   /db_xref="UniProtKB/TrEMBL:D0IVC3"
FT                   /protein_id="ACY30859.1"
FT                   /translation="MLVGLLLVLGLLWSLSFDHWFSAAGWGYGAKYALAALCLWYLSKT
FT                   GLRLTAIVWGLALGSVGALAIAAYQAGVLKMPRVSGFTNAIQYGGIAMYMGFATLSLAL
FT                   LGRWSKSQTAALGLMAACGIYASFLSDSRGSWVVIPLLIAAIWLMAWLNGYKRLASMTA
FT                   GAMLLLGLIMAVPAYPKLEQRSAEAAREVSQYLQDPQKYAVTSVGQRLEQWRLAIHLIE
FT                   QRPFSGWGLAGYPAAKKQMVDQGLAHPSVMEYGHAHNEILDMWVKRGLPGLILLLAFYA
FT                   VPAAIFWPTQRRLAHADEAQRSKLLALRVAATLLPLAYFGFGWTQVFFAHNSGNMFYIF
FT                   SLAVLWGGICRMETQSAVTKTQS"
FT   gene            128172..128936
FT                   /locus_tag="CtCNB1_0114"
FT   CDS_pept        128172..128936
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0114"
FT                   /product="glycosyl transferase, family 25"
FT                   /note="COG3306, Glycosyltransferase involved in LPS
FT                   biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ACY30860"
FT                   /db_xref="GOA:D0IVC4"
FT                   /db_xref="InterPro:IPR002654"
FT                   /db_xref="UniProtKB/TrEMBL:D0IVC4"
FT                   /protein_id="ACY30860.1"
FT                   /translation="MSSLPIVFINLSKDAERRERMTAQFAQMGLTASRLPAVWWADLSE
FT                   AEQKAFFCAPQSHGRYFKPLSNGEKGCYASHLRSWQQLLGGDAPAMVVFEDDVRLLPQL
FT                   PQALAAIEALPADGSWDMIKLYGREPEKIANQGPLVAGALQLISYQRVPSFAAGYVISR
FT                   SGARKMLETRMPFDRPVDVDIRFWFENDLRVYGVYPSVIALDDTSEVSSIWAQKEAPAD
FT                   LAQRLRKFKMKLELTWGNSLARTPHVAEVLKI"
FT   gene            complement(128933..130009)
FT                   /locus_tag="CtCNB1_0115"
FT   CDS_pept        complement(128933..130009)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0115"
FT                   /product="glycosyl transferase, group 1"
FT                   /note="COG0438, RfaG, Glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ACY30861"
FT                   /db_xref="GOA:D0IVC5"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:D0IVC5"
FT                   /protein_id="ACY30861.1"
FT                   /translation="MRILHFVTGGFSGATQVAVDLSLAALRTPGHEVLLVLRHKPSTDE
FT                   RKIEALRQQGLQVIVVSNWLHALTVWELRKIIRGFRPDAVFAHGFSDHIWGRRAAVAEG
FT                   VPRIFHVEHNTRERYTRRRLAQAQALMPYTEACIGVSEGVRISLIERGFDPAKCIAIPN
FT                   GIDLERFPESILMPWHEREPAIIMASRFARQKDHATLIQALALLKEQGITPKLYLAGGG
FT                   KQRLQHKARLLVDRLRLQEQVQFLGNVADLPQRLGSVQIFVLSTHWEGQGLATVEAMAA
FT                   GCACIATDVPGAREVIEPNITGFRVPESDAGALAARLRQLLETPQQAYLVGLAARKHAL
FT                   KHYGRERMWTQYQQLLQS"
FT   gene            complement(130090..130299)
FT                   /locus_tag="CtCNB1_0116"
FT   CDS_pept        complement(130090..130299)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0116"
FT                   /product="conserved hypothetical protein"
FT                   /note="COG4391, Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ACY30862"
FT                   /db_xref="InterPro:IPR019401"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454Y4K1"
FT                   /protein_id="ACY30862.1"
FT                   /translation="MTTNAVVELAAKDLNAQGGVFCPSPKADMKLWNSHPKVYLDVAKT
FT                   GDAKCPYCGTTYRLKAGEVFAGGH"
FT   gene            complement(130428..131366)
FT                   /locus_tag="CtCNB1_0117"
FT   CDS_pept        complement(130428..131366)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0117"
FT                   /product="branched-chain amino acid aminotransferase"
FT                   /note="COG0115, IlvE, Branched-chain amino
FT                   acidaminotransferase/4-amino-4-deoxychorismate lyase"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ACY30863"
FT                   /db_xref="GOA:D0IVC7"
FT                   /db_xref="InterPro:IPR001544"
FT                   /db_xref="InterPro:IPR005785"
FT                   /db_xref="InterPro:IPR018300"
FT                   /db_xref="InterPro:IPR033939"
FT                   /db_xref="InterPro:IPR036038"
FT                   /db_xref="UniProtKB/TrEMBL:D0IVC7"
FT                   /protein_id="ACY30863.1"
FT                   /translation="MSPVVPSMSDRDGKIWMDGQLVEWRDAKIHVLTHTLHYGCGAFEG
FT                   VRAYETAQGTAIFRLEEHTKRLFNSAKILRMQIPFSQEQINQAQVEVVKANGLKSCYLR
FT                   PLTWIGDRKLGVSPKGNTIHLMVAAWAWGAYLGEEGMQRGIRTKISSYTRHHVNITMSQ
FT                   AKAVSNYTNSILANTEALDDGYDEAILLDASGFVSEGSGENIFVIKDGVIYTPDLSAGA
FT                   LNGITRNTVLHICKDLGLEVVQKRITRDELYISDELFFTGTAAEVTPIREVDRVQIGEG
FT                   RRGPITEKIQAAYFDIVNGRNPKYAHWLTLV"
FT   gene            complement(131448..131903)
FT                   /locus_tag="CtCNB1_0118"
FT   CDS_pept        complement(131448..131903)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0118"
FT                   /product="conserved hypothetical protein"
FT                   /note="COG0370, FeoB, Fe2+ transport system protein B"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ACY30864"
FT                   /db_xref="GOA:A0A454XJ84"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454XJ84"
FT                   /protein_id="ACY30864.1"
FT                   /translation="MNLRNILVPLGLIVLVIAAYNSAGWPGVAAVAGGIIMWVLLHFTR
FT                   LMSIMKKASDRPIGYVGSAVMLNAKLKPKAPLVHVVAMTRSLGQRLSEEGQSPEIYRWT
FT                   DGTQSHVTCEFVAGRLMKWELQRPEQKEDSAAADAQATDRTSEPTSP"
FT   gene            complement(132084..133469)
FT                   /locus_tag="CtCNB1_0119"
FT   CDS_pept        complement(132084..133469)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0119"
FT                   /product="DNA repair protein RadA"
FT                   /note="COG1066, Sms, Predicted ATP-dependent serine
FT                   protease"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ACY30865"
FT                   /db_xref="GOA:D0IVC9"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004504"
FT                   /db_xref="InterPro:IPR008269"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020588"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041166"
FT                   /db_xref="UniProtKB/TrEMBL:D0IVC9"
FT                   /protein_id="ACY30865.1"
FT                   /translation="MAKEKTTFTCNACGGTSPRWLGKCPGCGAWNTLVETVADSASGGK
FT                   NRLSQPQGYAGLANAQPVTPLSAIEAQDVARTPSGIEELDRVLGGGVVEGGVVLIGGDP
FT                   GIGKSTLLLQAMDALHRIGLPTLYVTGEESGAQVALRSRRLGLDNSQVNVLAEIQLEKI
FT                   LATVEATQPAVVVIDSIQTVYSDQLSSAPGSVAQVRECAAHLTRAAKTTGITIILVGHV
FT                   TKDGALAGPRVLEHMVDTVLYFEGDTHSNFRLVRAIKNRFGAVNEIGVFAMTEKGLKGV
FT                   TNPSAIFLSQHSEPVPGSCVLVTLEGTRPMLVEIQALVDQGGPAARRLSVGLDRDRLAM
FT                   LLAVLNRHAGVACADQDVFVNAVGGVRINEPAADLAVMLAITSSLRGKSLPKGFIAFGE
FT                   VGLAGEVRPAPRGQERLKEAAKLGFTIAVVPKANAPKKPIAGLTIHAVERVDEAINIVR
FT                   GIG"
FT   gene            133651..133727
FT                   /locus_tag="CtCNB1_R0001"
FT   tRNA            133651..133727
FT                   /locus_tag="CtCNB1_R0001"
FT                   /product="tRNA-Met"
FT   gene            complement(133891..135198)
FT                   /locus_tag="CtCNB1_0120"
FT   CDS_pept        complement(133891..135198)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0120"
FT                   /product="Glu/Leu/Phe/Val dehydrogenase, C terminal
FT                   protein"
FT                   /note="COG0334, GdhA, Glutamate dehydrogenase/leucine
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ACY30866"
FT                   /db_xref="GOA:D0IVD0"
FT                   /db_xref="InterPro:IPR006095"
FT                   /db_xref="InterPro:IPR006096"
FT                   /db_xref="InterPro:IPR006097"
FT                   /db_xref="InterPro:IPR014362"
FT                   /db_xref="InterPro:IPR033524"
FT                   /db_xref="InterPro:IPR033922"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D0IVD0"
FT                   /protein_id="ACY30866.1"
FT                   /translation="MQAKDSSALSTAHALPSYLNPDHLGPWGIYLQQVDRVTPYLGSLA
FT                   RWVETLKRPKRILVVDVPIEMDDGRIAHFEGYRVQHNLSRGPGKGGVRFHQDVTLSEVM
FT                   ALSAWMSIKNAAVNVPYGGAKGGIRVDPRKLSKAELERLTRRYTSEIGLLIGPTKDIPA
FT                   PDVNTNGQVMAWMMDTYSMNTGATATGVVTGKPVDLGGSLGRVEATGRGVFTVGVEAAK
FT                   LTGLNVHGARVAVQGFGNVGGTAGKLFADAGAKVVAVQDHTGTIQNANGLDVTALLEHV
FT                   GNTGGVGGFAGGEAMDAAAFWGVDCDILIPAALEGQITEENAGQIKAKLVIEGANGPTT
FT                   PEADDILSEKGVLVLPDVIANAGGVTVSYFEWVQDFSSFFWTEDEINARLVRIMQEAFA
FT                   GVWAVAQEHKVTLRTATFIVACKRILHAREARGLYP"
FT   gene            135408..136331
FT                   /locus_tag="CtCNB1_0121"
FT   CDS_pept        135408..136331
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0121"
FT                   /product="2-keto-4-pentenoate hydratase-like protein"
FT                   /note="COG3971, 2-keto-4-pentenoate hydratase"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ACY30867"
FT                   /db_xref="GOA:D0IVD1"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/TrEMBL:D0IVD1"
FT                   /protein_id="ACY30867.1"
FT                   /translation="MSENNDCKSGWCGPAPFANTPPIGLAPELQTQDEVLPDWKTLCPD
FT                   LPEDSYATADALWWSHKLGTAQAQGADVAALMRDAADAHAVQSALARTWNWWPADRAPR
FT                   YWKSGGPGRNAALLHVPLPEDGIRQGVNPVPAPDTVFNLRCAEAEIALRIGRDVSADQA
FT                   AALDYDSALALVDAACVAVEWVDVRWRDGLKAPALALLADGQCHGGLALGEWQSASVIA
FT                   GRDWARQLCTVTVNDGPPQRFTGTHSLGDPAWLLVDWLQHVAREYGSVPAGTVVTTGTW
FT                   CGCMPLQAGDRFEMEFDGLGALGWQF"
FT   gene            complement(136486..137595)
FT                   /locus_tag="CtCNB1_0122"
FT   CDS_pept        complement(136486..137595)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0122"
FT                   /product="hypothetical conserved protein"
FT                   /note="COG2326, Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ACY30868"
FT                   /db_xref="GOA:D0IVD2"
FT                   /db_xref="InterPro:IPR016898"
FT                   /db_xref="InterPro:IPR022300"
FT                   /db_xref="InterPro:IPR022488"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D0IVD2"
FT                   /protein_id="ACY30868.1"
FT                   /translation="MPRQPAKAAPATSSAAQAEPDRQPARKRLPFPTSESVQATKAARP
FT                   SPSRPVSRKKPAAKTVSRTAAPTAKAPALSLVYPFETKDKALRKLWQPWQPGQPRDSRL
FT                   TTGHPRPAVELQKFDPSAKPFSSDKGKQYDKDSVNQLAEALDGLQNIFYADRRFKLLVI
FT                   LQGMDAAGKDGTLRAVFGRMSPLGVRTVGWKAPTETEKAHDYLWRIHQQLPSAGEIVLF
FT                   NRSQYEDVLVPVVNGWLTPEQQNQRYAQINDFERMLSETGTVIVKFMLHISKDEQRERL
FT                   QQRLDDPCKHWKFDENDLKVRAQWDDYQQAYGQLLGATHTPWAPWTIVPADSKTHRNLM
FT                   VATVLREVLGNLELKYPPGAPALDHIKVR"
FT   gene            complement(137722..138633)
FT                   /locus_tag="CtCNB1_0123"
FT   CDS_pept        complement(137722..138633)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0123"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="COG0583, LysR, Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ACY30869"
FT                   /db_xref="GOA:D0IVD3"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D0IVD3"
FT                   /protein_id="ACY30869.1"
FT                   /translation="MPFSADQVPLFLAVLDAGSFSAAARKLGRVPSAVSMAIAQLEAEL
FT                   ELQLFDRSGREPVPSAAARALEPQARLLAEQLQLLNWQAQALHAGLEERLTLAIAPELL
FT                   ATHWSEPLNRLVREFPALPIEVLAAPQADALELLHAGRAHLALVFERPAIDGREGFQEM
FT                   GRETLVAVMSPQFELWQQALAEHEQGRTTRPQLTVEQLAATRQVLVASRDPQQTDPRFV
FT                   FARQLWRTDSHQAALSLISAGLAWGWLPKGLVESHIGSGALMEIPVLNISNGTTLFVDW
FT                   VWSKERAQGLAARRFVQLLRER"
FT   gene            138727..139230
FT                   /locus_tag="CtCNB1_0124"
FT   CDS_pept        138727..139230
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0124"
FT                   /product="transmembrane pair"
FT                   /note="COG4125, Predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ACY30870"
FT                   /db_xref="GOA:D0IVD4"
FT                   /db_xref="InterPro:IPR007896"
FT                   /db_xref="UniProtKB/TrEMBL:D0IVD4"
FT                   /protein_id="ACY30870.1"
FT                   /translation="MASASSSAVSLKNTAAFATPAKAKGLQGPKRRILYVGLYEIIAII
FT                   VSSLIFMAIGQKASDSGVMAVAASVIAICWNLSFNHLFEKWESRQSVRGRSLMRRVVHA
FT                   IGFEGGIAAMLIPLMAWWFGISLWEAAVMEAGLLVFFMVYTFAFNWAFDRIFGLPASAQ
FT                   AVAA"
FT   gene            complement(139340..140578)
FT                   /locus_tag="CtCNB1_0125"
FT   CDS_pept        complement(139340..140578)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0125"
FT                   /product="sodium/glutamate symporter"
FT                   /note="COG0786, GltS, Na+/glutamate symporter"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ACY30871"
FT                   /db_xref="GOA:D0IVD5"
FT                   /db_xref="InterPro:IPR004445"
FT                   /db_xref="UniProtKB/TrEMBL:D0IVD5"
FT                   /protein_id="ACY30871.1"
FT                   /translation="MNVTFGAYYTLIMAVLVLMLGKLMTRHIRFLRDFNIPEPVSGGLV
FT                   VAAIIFMLHQTTGLALSFEGSLQSAFMLVFFSSIGLSANFAKLREGGSALFLFLGVIAV
FT                   FIIMQNIVGVSLASVLGLDPLIGLVAGSITLVGGHGTAGAWGSVLENQYGLTGATTLGI
FT                   ACATFGLIIGGLVGGPLAKRLITRHQLAQPLTESEQLRADAPTVSEGSEVANFESPNKA
FT                   PRLITADAAVETLALFAGCLAFAEFMTGLTMGTVIQLPTFVWALGGGVIIRNVLDYMFG
FT                   FKVFDRAIDVFGNASLSMYLAIALLSLKLWELTDLAGPLMVILAAQAIVMTLYAAFVTF
FT                   RIMGKNYDAAVLAAGHCGFGMGATPTAVANMQAITNQYGPSHKAFLIVPLVGAFFIDII
FT                   NAFVLQAMLSILR"
FT   gene            141178..143901
FT                   /locus_tag="CtCNB1_0126"
FT   CDS_pept        141178..143901
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0126"
FT                   /product="methionine synthase"
FT                   /note="COG1410, MetH, Methionine synthase I"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ACY30872"
FT                   /db_xref="GOA:D0IVD6"
FT                   /db_xref="InterPro:IPR000489"
FT                   /db_xref="InterPro:IPR003759"
FT                   /db_xref="InterPro:IPR004223"
FT                   /db_xref="InterPro:IPR006158"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="InterPro:IPR011822"
FT                   /db_xref="InterPro:IPR033706"
FT                   /db_xref="InterPro:IPR036594"
FT                   /db_xref="InterPro:IPR036724"
FT                   /db_xref="InterPro:IPR037010"
FT                   /db_xref="UniProtKB/TrEMBL:D0IVD6"
FT                   /protein_id="ACY30872.1"
FT                   /translation="MRLSGLEPVFIGDETLFVNVGERTNVTGSKAFARLILNEQYEEAL
FT                   AVARQQVENGAQVIDVNMDEAMLDSKAAMVRFLNLIASEPDIAKVPVMVDSSKWDVIEA
FT                   GLRCLQGKGIVNSISMKEGVEEFKKHAKLVKRYGAAAVVMAFDEKGQADTFARKIEICE
FT                   RAYRILVDEVGFPPEDIIFDPNIFAVATGIEEHNNYGVDFIEAVRWIKQNLPGAKVSGG
FT                   VSNVSFSFRGNDPVREAIHTVFLYHAIAAGMDMGIVNAGMVGVYDDLEPQLRERVEDVV
FT                   LNRRPDAAERLLEIADSAKGAAKDDSKKLEWRGTPEAPKTVGERLSHALVHGITDFITE
FT                   DTEEAYQQIVVQGGGRPLHVIEGPLMDGMNIVGDLFGAGKMFLPQVVKSARVMKQAVAH
FT                   LVPYIEEEKRQQEAAGMDVTSKGKIVIATVKGDVHDIGKNIVTVVLQCNNFEVINMGVM
FT                   VPCHEILARAKAEGADIIGLSGLITPSLEEMQYVAGEMDKDDYFRIKKIPLLIGGATCS
FT                   RVHTAVKIAPKYDGPVVYVPDASRSVSVAQSLLGDGKQAYLDELSADYDKVRTQHANKK
FT                   KTPLWTLEQARANAAVVGHAPVVPRTLGRRVFKNFDLAEIAQYIDWGPFFQTWDLAGPY
FT                   PAILDDEVVGVEARKVLADAKLMLQKIIDGRWLQANGVMGLFPANRVGDDIVFYTDESR
FT                   SQVLTTWYGMRQQTEKQAVDGPDGRPVMRPSRCLADFVAAKESGIADYAGLFAVTAGIG
FT                   AEKKDKEFEAALDDYSGIMFKALADRLAEAFAECLHQRVRKDLWGYAEDEDLSNEELIK
FT                   EAYKGIRPAPGYPACPDHTAKIDLFKALQADEIGMTLTESLAMNPASSVSGFYIGNPEA
FT                   SYFNVGQIGEDQLADMAQRRGMDVEELRRYLAPNLG"
FT   gene            complement(143977..144669)
FT                   /locus_tag="CtCNB1_0127"
FT   CDS_pept        complement(143977..144669)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0127"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="COG1802, GntR, Transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ACY30873"
FT                   /db_xref="GOA:D0IVD7"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D0IVD7"
FT                   /protein_id="ACY30873.1"
FT                   /translation="MTPASPQHIAERVVEAILAQKLAPGERLGEQELANNFDVSRTVVR
FT                   EALMQLQARGFVQVQARRGWYVVQPSAAEAMDAFSARRIIETGILQEAGKPLQRVITRL
FT                   RRHIAQEQKAIAGADSATRAFLLADFHVCLAEQMGHRLLADTLRDLTARTTLAATLYQS
FT                   THSASQSCAEHERIVAALERGDTEGAKALLLEHIGMVERSLEIRATETEEPGDRLRATL
FT                   APVLKQHL"
FT   gene            complement(144678..146018)
FT                   /locus_tag="CtCNB1_0128"
FT   CDS_pept        complement(144678..146018)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0128"
FT                   /product="sodium:dicarboxylate symporter"
FT                   /note="COG1301, GltP, Na+/H+-dicarboxylate symporters"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ACY30874"
FT                   /db_xref="GOA:A0A454XQY6"
FT                   /db_xref="InterPro:IPR001991"
FT                   /db_xref="InterPro:IPR018107"
FT                   /db_xref="InterPro:IPR036458"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454XQY6"
FT                   /protein_id="ACY30874.1"
FT                   /translation="MRRFVRSLFGQVVIALILGVLAGLLAPEWAVKLKPLGDGFIKLIK
FT                   MIIPILVFCVVVHGIAGAGDLKRVGRVGVKALIYFEVLTTIALGMGLVLAFVFEPGVGM
FT                   NVDTSKLDASAMAAYASNADKLTSGGTVDFLMKLIPTTVVEAFAKGDVLQVLLFAVLFG
FT                   CALTMLGERGKPVSALVDALSMALFKVMGIIIKLAPLGVLGAIAFTVGQYGIGSLKQLG
FT                   MLVALFYVSVLIFVFVVLGLVMRLSGFSLIKLLRYLREELTIVFATTSSDSVLPQIMAK
FT                   LRNMGVRDSTVGLVIPTGYSFNLDAFSIYITLAAVFIAQATNTPISMSDLLTILAIALV
FT                   TSKGAHGVPGSAIVVLAATLHAIPAIPAIGLVLVLSVDWFMGIARALGNLIGNCVATVA
FT                   IAAWEGDIDRERAHAVLDGKAEPLTEEEDHASAIVPPVVVPIPHSSH"
FT   gene            complement(146264..147706)
FT                   /locus_tag="CtCNB1_0129"
FT   CDS_pept        complement(146264..147706)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0129"
FT                   /product="phospholipase D/Transphosphatidylase"
FT                   /note="COG1502, Cls,
FT                   Phosphatidylserine/phosphatidylglycerophosphate/cardiolipi
FT                   n synthases and related enzymes"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ACY30875"
FT                   /db_xref="GOA:D0IVD9"
FT                   /db_xref="InterPro:IPR001736"
FT                   /db_xref="InterPro:IPR022924"
FT                   /db_xref="InterPro:IPR025202"
FT                   /db_xref="InterPro:IPR027379"
FT                   /db_xref="UniProtKB/TrEMBL:D0IVD9"
FT                   /protein_id="ACY30875.1"
FT                   /translation="MTWLLLTLHVLLIAGFGLRILLRRDMRPDVRLAWLMVIVLLPYVS
FT                   CLLYYLFGEVALGRVPGRRRLNVREFCQTRGSALASAPGPMSQARPAIPDQWLPAFRYA
FT                   SSINGFVPLPGHRAELMRDGAHARAQMLADMDAARHEINVLYYIWLDDSTGTDVAHALM
FT                   RAAQRGVTCRAMVDGLGSRALTRSPLWQQMRQAGVHLAIALPISNLLKVMLTSRIDLRN
FT                   HRKITLIDGRINYCGSQNCADEGFRIKARYAPWVDIMLRLQGPVVMQMQQAFASDWAQS
FT                   DACLAPPTTEAGAAADDGFHAVAIAEGPTERARSTPQLVASLLACAQREVVISTPYFVP
FT                   DSTVLDALCAAALRQVQVTLILPARNDSWIVGAVSRSHYWRLLSAGVHIHEFRPGLLHA
FT                   KTLCLDGSVSLIGSTNLDLRSFDLNFENNVLLHDEAITEAIRRRQQSYLHESDVVTLAQ
FT                   VHSAPWWKRIWDNLLGALSPLL"
FT   gene            147916..149148
FT                   /locus_tag="CtCNB1_0130"
FT   CDS_pept        147916..149148
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0130"
FT                   /product="ammonium transporter"
FT                   /note="COG0004, AmtB, Ammonia permease"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ACY30876"
FT                   /db_xref="GOA:D0IVE0"
FT                   /db_xref="InterPro:IPR001905"
FT                   /db_xref="InterPro:IPR018047"
FT                   /db_xref="InterPro:IPR024041"
FT                   /db_xref="InterPro:IPR029020"
FT                   /db_xref="UniProtKB/TrEMBL:D0IVE0"
FT                   /protein_id="ACY30876.1"
FT                   /translation="MEMVPLTAIDKADTGWVMVASAQVLLMTLPGIALFYAGLVRRKNV
FT                   VNTMVAVFAVACVVTLTWFGLGYSLAFTAESAWLGNLGRAWFASLHFDGRRSVISVSHL
FT                   APHLPEAAYALFQAAFAIITTSLIVGAVVERMRFAALLVFAALWSVVVYAPVAHWVWES
FT                   GGWLNQLGALDFAGGAVVHVNAGVAALVCAFMMGRRRGYGTEPFEPHSLGWTAMGTALL
FT                   LFGWFGFNAGSALSADGRAALAFAVTLVAAAAAGLAWMVVEWLVRGAPTLLGLLSGMVG
FT                   GLVAITPAAGFVQVGSAVWIGLIAGAVCFWGATWLKRRLGADDSLDVFGVHGVGGIAGS
FT                   ILTAVFADPLIAGTGATVMNQLIAVAAVAAYSGAATAGVLVLIRLLMPLRVDAVQEMEG
FT                   LDISLHLERQH"
FT   gene            149175..149495
FT                   /locus_tag="CtCNB1_0131"
FT   CDS_pept        149175..149495
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0131"
FT                   /product="hypothetical protein"
FT                   /note="COG4585, Signal transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ACY30877"
FT                   /db_xref="UniProtKB/TrEMBL:D0IVE1"
FT                   /protein_id="ACY30877.1"
FT                   /translation="MEDSDRVAVAAHLHVVLRRRTGRVTDTEWMACNQAYAQAMVAFAL
FT                   EHAREQQDEELARLARRLQDSWSGDKPRHAAPAETARSDSSVTTKAAEILRTSARYIGG
FT                   LR"
FT   gene            complement(149562..150938)
FT                   /locus_tag="CtCNB1_0132"
FT   CDS_pept        complement(149562..150938)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0132"
FT                   /product="glycerophosphoryl diester phosphodiesterase"
FT                   /note="COG0584, UgpQ, Glycerophosphoryl diester
FT                   phosphodiesterase"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ACY30878"
FT                   /db_xref="GOA:D0IVE2"
FT                   /db_xref="InterPro:IPR017946"
FT                   /db_xref="InterPro:IPR030395"
FT                   /db_xref="UniProtKB/TrEMBL:D0IVE2"
FT                   /protein_id="ACY30878.1"
FT                   /translation="MPEPMSHTRHPVFALTLLAAFALSACGGGDGPTPAPAPQFLTLDG
FT                   KQPQVIAHRGYSGLYPEQTQMAYEKAIDAGADMIELDMHMTRDCQLVARHNAWLSDSTN
FT                   IADVAKSNSYVAARKRTTPGVWVDVKYPATPDNGPARYLSDRIDPNNQKSVLQALVVDG
FT                   EDHTNDWSISDFSLHELRTLLGGTILDNRADRPTEWNGKLPLISAQDVIDIALAKGKAA
FT                   GRTIAVYAETKNPYWNNQQAIANSCGTGEHPFEDAVMALLERNQLNRKDAPIYIQSFDP
FT                   DSLKYLRKAGMKAKGVQLIDGNDYNFRDGSVGYITSDEWTFISGRPYSWTLAGDARTFA
FT                   VMQTPAGLAEIKTYADGIGPWKPQVLAHSVVPYKDGAGLKDVNTLKDTGLIANAHKAGL
FT                   VVHSFTFRSEASRLAGIFKGDPAQEYLAYYRLGIDGVFTDFTAAGIKAREAYIAELKKP
FT                   "
FT   gene            complement(151059..152303)
FT                   /locus_tag="CtCNB1_0133"
FT   CDS_pept        complement(151059..152303)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0133"
FT                   /product="tryptophan synthase, beta subunit"
FT                   /note="COG0133, TrpB, Tryptophan synthase beta chain"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ACY30879"
FT                   /db_xref="GOA:D0IVE3"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR006653"
FT                   /db_xref="InterPro:IPR006654"
FT                   /db_xref="InterPro:IPR023026"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:D0IVE3"
FT                   /protein_id="ACY30879.1"
FT                   /translation="MNAALLHHTPRRQAMTQNPQAMPDAQGFFGPYGGQLVPPELKRCM
FT                   DEIAAAYEEIVKRQDFQDELAALFADYVGRPSPIFHARRLSDQLGGAQIHLKREDLNHT
FT                   GAHKINHCLGEALLAKFMGKKKVIAETGAGQHGVALATACALVGIPCEIHMGQVDIEKE
FT                   HPNVTKMRILGCNLVPVTRGAATLKEAVDSAFEVYLQDPVNTIYAIGSVVGPHPFPMMV
FT                   RDFQSIVGREAREQFQTRHGKLPDHVAACVGGGSNAMGIFTAFLGDESVHLVGVEPAGE
FT                   GVDKPGRHAATLSVGKPGEIHGMKCYVLENADGTPAAVHSIASGLDYPGVGPQHSYLKD
FT                   IGRVDYQSVDDKECLNAFMTLSRVEGIIPALESAHAVAWAMREAPGLGKDQHILVNLSG
FT                   RGDKDADYVARKLGL"
FT   gene            152449..153897
FT                   /locus_tag="CtCNB1_0134"
FT   CDS_pept        152449..153897
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0134"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ACY30880"
FT                   /db_xref="GOA:D0IVE4"
FT                   /db_xref="InterPro:IPR021296"
FT                   /db_xref="UniProtKB/TrEMBL:D0IVE4"
FT                   /protein_id="ACY30880.1"
FT                   /translation="MKASSARDIVFAHALETAAPHEALPTTERCTAITQECLHAQGKAK
FT                   GGGRAAFESFLQERAQRVIAAAQLPADIRAVARQRAGISRWLVLAVMTAAFALGFAGHA
FT                   ITDPHRVDLLSASLIGIVLWNLLVYVLLLLSWLRSLVRRRQTVIASLEPEPGQGAAAQR
FT                   PVAAPGGWLQKLQTKRWSVSRGTGLRKMALNFERNWWQVNQRPRHAQWLVCLHLGAAML
FT                   ALGALASLWLTGLTKAYQVGWESTFLSPSAVQTCLNMLFAPVQHLLGQAPWSLAQIQAL
FT                   QGWSAGDAADAGPRWVQLYSWLLGLMVVAPRLLLALWQGARGWWLSQHLTLPLQQPYFQ
FT                   KLQRDWAGRATALLVQPYSLDITPEREAALRSHVAQSYGAGAQLALLPVLAYGSPLPDA
FT                   SAVDAQQVLLLNLAATPEAEIHGVLLAQVLNRWGAHTDVWLWAADFRARNSGAPARVQE
FT                   REQLWREFVRGAGLNATLVPGAGV"
FT   gene            153897..155456
FT                   /locus_tag="CtCNB1_0135"
FT   CDS_pept        153897..155456
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0135"
FT                   /product="hypothetical protein"
FT                   /note="COG3596, Predicted GTPase"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ACY30881"
FT                   /db_xref="GOA:D0IVE5"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR021871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D0IVE5"
FT                   /protein_id="ACY30881.1"
FT                   /translation="MMSESNELVPIDSSIQWCLLSHTNIGKTTLTRTLMADDVGEIDDA
FT                   AHVTTQSQRYLLQKTQQGDELWLWDTPGFGDSVRLYERLRQQGNPLGWFLSNVWDRWRD
FT                   RPFYLSQRALLAARDHADVMLYLVNAAEDPADAGYWSAEMNILAWMNKPVIVLLNQIGS
FT                   DTTAEQTQEDLRRWQQATQSFQSVVRDVLVLDAFTRSWWHERKMMQSIAPLLPQSKQSA
FT                   YQRLLAQRALLQQQREQASLGVMADQLIAATGLYEKLDPEQGKLLARAWQSLSQLTAKL
FT                   GKSAEGEERLGAQAKAAVQRLMQALRQADVQATQRLLEIHGLDGQAASQIQEQLRSQLQ
FT                   ITTPVDAQAASLWGALTAGAATGLGADLMAGGLTLGAGALVGALLGAITFGGAAWGANK
FT                   MFDQEQQSFQLSTDYLNAAAAQVLLKYLLISHFGRGRGRYTSPAAPSQWSELAQGTVQT
FT                   HAAQWAALWAQLREARAAGAAADAQRVAMMELLSQSLQQIMADLYPGLNAECSVRDGES
FT                   AR"
FT   gene            complement(155431..156603)
FT                   /locus_tag="CtCNB1_0136"
FT   CDS_pept        complement(155431..156603)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0136"
FT                   /product="periplasmic sensor signal transduction"
FT                   /note="COG0642, BaeS, Signal transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ACY30882"
FT                   /db_xref="GOA:D0IVE6"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D0IVE6"
FT                   /protein_id="ACY30882.1"
FT                   /translation="MALGLNRIWVRFGLWITAAVLLAIASLAIGVLAFSELQYREFYRH
FT                   LPSPVRTELEALKSQDLEDSPRALQIYSEYWEGDRLFGEKWSLVIGLAVSLPFGMAVGF
FT                   WISRRITSPLASMVEVAARVERGDLASRAVKGNAHGEMAEMIDAFNGMVDSLETLEAER
FT                   LATAASISHELRTPLTVLQARLHAICDGVIDSSQAEMKTLLAQVEHLGRLVGDLHTLSM
FT                   ADAGQLSLRKERIDLAALVGDVVEDLHPQLQKLDMALSLDLPMQDGDGSTDIKADTDRL
FT                   RQITTNLISNVLRHASSGHWLSIRVYASSDHQNQSWVILEVGDAGPGLADEVQAHPFQR
FT                   FVQAPGKRRREGSGLGLSIVKALVTSQGGTVSTGVSERGGALFTVRFPRL"
FT   gene            complement(156588..157337)
FT                   /locus_tag="CtCNB1_0137"
FT   CDS_pept        complement(156588..157337)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0137"
FT                   /product="two component transcriptional regulator, winged"
FT                   /note="COG0745, OmpR, Response regulators consisting of a
FT                   CheY-likereceiver domain and a winged-helix DNA-binding
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ACY30883"
FT                   /db_xref="GOA:D0IVE7"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:D0IVE7"
FT                   /protein_id="ACY30883.1"
FT                   /translation="MHDFAAHKTMTTFTQPASTPMVLVVEDEPGIAGVLSAYLERDGLR
FT                   IRMAQDGEEALQSFRQLRPDLVLLDIHLPKVDGVDVLRMIRNDSDVPVIMVTALADDVD
FT                   KLLALRLGADDYVVKPFNPPEVVARVRAVLRRTQAKPAPVAAPIRVGPIEIDVEAHSAA
FT                   VYDDAGQAVPLALTLTEFRLLACLAAQPRRCFSRAYLIENCLPESDALERVIDSHLSKL
FT                   RRKLQLAGQDGLIETVRGIGYRLWPWD"
FT   gene            157540..158961
FT                   /locus_tag="CtCNB1_0138"
FT   CDS_pept        157540..158961
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0138"
FT                   /product="RND efflux system, outer membrane lipoprotein"
FT                   /note="COG1538, TolC, Outer membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ACY30884"
FT                   /db_xref="GOA:D0IVE8"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="InterPro:IPR010131"
FT                   /db_xref="UniProtKB/TrEMBL:D0IVE8"
FT                   /protein_id="ACY30884.1"
FT                   /translation="MIFPSHVSRLRMGSLCLCVLSLLAGCAAPEAVKLDRTTPPQWQQQ
FT                   ESAQKSDPAELAQWWRAWNDPALNALVDEALAQNLDVAQAVLRLRQQRLLAGTADAAFR
FT                   PIVSTGARTLQDIAAVDTYFHASIDVSWDLGLFGDSAAARRAGAAGVLDAQAQLHAARV
FT                   ALVADVVHRYLDIRLAQVQRSLVERQLQQAQRQLQLLQIRHEQRLTDAQSLEQQQLQLR
FT                   TAESQLSTLNEAQARAAHALAALLGRERAEPQWLQPRTDAALPAMQALAVLPADLLRNR
FT                   PDIQSAEAAVEQAAAEVGVSRAALYPRLTLTGSLLYAYNLTRNHRTTSDSIPMVGPQID
FT                   IPLFDWGRRRAVADGKELALQASIKAYRQAVLNGIAEAETALAAVAAQQQRQQQLKSQQ
FT                   QIHAGREKAQAVRQQLGLSSELAGIDSARASLQNQSELATARAAEALAYVALYKAVGAA
FT                   PVDAALVTRTTEAQP"
FT   gene            158958..160106
FT                   /locus_tag="CtCNB1_0139"
FT   CDS_pept        158958..160106
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0139"
FT                   /product="membrane protein spanning subunit"
FT                   /note="COG0577, SalY, ABC-type antimicrobial peptide
FT                   transport system"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ACY30885"
FT                   /db_xref="GOA:D0IVE9"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="UniProtKB/TrEMBL:D0IVE9"
FT                   /protein_id="ACY30885.1"
FT                   /translation="MIALARKTLIHEWRRFVPSVFAVGFSGVLLAMQAALVLGIFGSAA
FT                   IYVTASSADLWVGYPGTQSVNFGRNIGSDVEMRLRMDPDVAAVESYVWVDGDWRARAGA
FT                   QGTTGGGVSVYLSGVSTADNSMMFTKVLTSWQRQLLREPGAVIVDRADLGTLGAQEGST
FT                   AWINNHAVKIVAAVDGLRGLGGVNVIASLSTAREIAETSAEHGSTYFVARLKQGAKAGE
FT                   AQARLSQSSSSFGPYEVWTADAFARRSQRYWMLDTGAGAGVLFMAVIVCLVGAIVTSQS
FT                   LKAVVAGSAREYAVLNALGVSRAALGRVVVEQACWIGGLGFVLAALASAVLLSIASSYR
FT                   VPVALNLSAVLACGFLVAVLSLLSGLGAMRSLLRADPATLLR"
FT   gene            160117..160872
FT                   /locus_tag="CtCNB1_0140"
FT   CDS_pept        160117..160872
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0140"
FT                   /product="macrolide-specific ABC-type efflux carrier"
FT                   /note="COG1136, SalX, ABC-type antimicrobial peptide
FT                   transport system"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ACY30886"
FT                   /db_xref="GOA:D0IVF0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D0IVF0"
FT                   /protein_id="ACY30886.1"
FT                   /translation="MQAETMERIKNSAAVKDAAPSLEAVRLDKSFVSGIVQVHVLQGLS
FT                   VSLYAGELSLISGPSGCGKSTLLSLMSGLQKPDAGHAIALGEDLAKLGTAALEKFRLRH
FT                   TGFVFQGFNLFPALTALEQVQLPLGYMGLKNAETLRRAKEALDEVGLSHRSHMRPAQLS
FT                   GGEKQRVAIARAMAKQPRLLFADEPTSALDAESGQRVIDLLHRAARTHGTTVLCVSHDP
FT                   RLVRHADRVLGMEDGAIRSDWRQNSPIKE"
FT   gene            160875..161810
FT                   /locus_tag="CtCNB1_0141"
FT   CDS_pept        160875..161810
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0141"
FT                   /product="secretion protein HlyD"
FT                   /note="COG1566, EmrA, Multidrug resistance efflux pump"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ACY30887"
FT                   /db_xref="InterPro:IPR039562"
FT                   /db_xref="UniProtKB/TrEMBL:D0IVF1"
FT                   /protein_id="ACY30887.1"
FT                   /translation="MNPSPFRLSIVSGAPLLAAAVLMLGGCSPSQDAASVITPAAAQIK
FT                   PQSQVAVARGKIDVEGGLLDLSSAASGVVQQLLVKEGQSVQKGQPVLRLVDDAARADLA
FT                   VAESELQLAQTKLKTRQDRLPALKATLTRWQSAAKQGAADLQSVDEAVQALRDAQSEVD
FT                   IAAAEVTVAKRKAEQLRALLQRHELRAPEAAVVVRLQAQGGSMLQSGSPVAVLLPKRPF
FT                   IVRAEVNESFVTAIREGMKALVTVDADGSAARQEFPAATVLRISPVYGAAKLQDDAQRG
FT                   PVRVVECVLAFDQPPANVKVGQNVRVSFHE"
FT   gene            161860..162516
FT                   /locus_tag="CtCNB1_0142"
FT   CDS_pept        161860..162516
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0142"
FT                   /product="2,3-diketo-5-methylthio-1-phosphopentane"
FT                   /note="COG4359, Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ACY30888"
FT                   /db_xref="GOA:D0IVF2"
FT                   /db_xref="InterPro:IPR006384"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:D0IVF2"
FT                   /protein_id="ACY30888.1"
FT                   /translation="MVQSDFDGTISLLDVTDTLLNRFGKPGWEELEDAWERGDIGSREC
FT                   MKGQVALLDMSEVELQNHLDSIEIDEHFAGFVAEARLHGIKVQVVSDGIDYAIRHVLAR
FT                   HGLGDLEVIANHLVQTGERSWRLDSPWASNRCTRASGNCKCERLAEQQAVHGRVLYIGD
FT                   STSDFCVSGKADFVLAKYKLIDYCESQGIAHARFEHFAQATQLLEQVLLGMEQIA"
FT   gene            162513..163421
FT                   /locus_tag="CtCNB1_0143"
FT   CDS_pept        162513..163421
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0143"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /note="COG1647, Esterase/lipase"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ACY30889"
FT                   /db_xref="GOA:D0IVF3"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D0IVF3"
FT                   /protein_id="ACY30889.1"
FT                   /translation="MNAADGLGLLQQPDLQQLCVTPHEFVMPGEGRNARTGVLLIHGLT
FT                   GTPAEMRLLAKGLNKQGFTVYGVQLAGHCGSMEDLVAARWTDWLASVESGLQRFSLHVD
FT                   HVVVGGLSMGALLSLAVAERHPDKVAGVCALSTTFRYDGWSIPAYTKLAFLLPLFRLLG
FT                   IGRNSVFMEAPPYGIKDEALRARVVEQMNSGDSSAAGLPGNPWWSVIELRALSANVQAG
FT                   LAQLRSPCLVIHAREDDISSVSNAHDIQRGAVNAHVDLVLLDNCYHMITIDRERRTVIA
FT                   KLNEFIARIASSAAPARGANG"
FT   gene            163408..163782
FT                   /locus_tag="CtCNB1_0144"
FT   CDS_pept        163408..163782
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0144"
FT                   /product="conserved hypothetical protein"
FT                   /note="COG2076, EmrE, Membrane transporters of cations and
FT                   cationic drugs"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ACY30890"
FT                   /db_xref="GOA:D0IVF4"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:D0IVF4"
FT                   /protein_id="ACY30890.1"
FT                   /translation="MRMGSDLSPLVVTLWILNVLVDSGGQLAFKAAASEPGHRNGTERW
FT                   RFMLARPWLWVGIACYVAEFLVWLAFLSLVPLSDGVLLGSINIVAIMILGRVLFREKLA
FT                   PMRVAGIVLVSVGVAIVGLH"
FT   gene            163795..164181
FT                   /locus_tag="CtCNB1_0145"
FT   CDS_pept        163795..164181
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0145"
FT                   /product="quaternary ammonium compound-resistance protein"
FT                   /note="COG2076, EmrE, Membrane transporters of cations and
FT                   cationic drugs"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ACY30891"
FT                   /db_xref="GOA:D0IVF5"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:D0IVF5"
FT                   /protein_id="ACY30891.1"
FT                   /translation="MKRFYIVGFLVLMAFDTLAQLSFKQAGDSALPLEFSTGWLLRVFS
FT                   QPWIYGAFVGYIGAFFTWMSLLKHAPIGPAFAASHLEIISVLAISYWLFNEPIGWPQII
FT                   GCLFIVAGIMCLAVSEKPEAEQAA"
FT   gene            164183..165388
FT                   /locus_tag="CtCNB1_0146"
FT   CDS_pept        164183..165388
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0146"
FT                   /product="DegT/DnrJ/EryC1/StrS aminotransferase"
FT                   /note="COG0399, WecE, Predicted pyridoxal
FT                   phosphate-dependent enzymeapparently involved in regulation
FT                   of cell wallbiogenesis"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ACY30892"
FT                   /db_xref="GOA:D0IVF6"
FT                   /db_xref="InterPro:IPR000653"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D0IVF6"
FT                   /protein_id="ACY30892.1"
FT                   /translation="MRQPTVPPTAGLPLQLGDLWPSGAGSLAGQLAAWLGVEAVQLECS
FT                   GTSALMVALRSLQALSPGRSEVVAPAYTCPLVALAIAQCGLQLRLCDLRADALDMDPVC
FT                   LQRLCSDRTLAVLPTHLCGRVADVDATLQCARAVGAYVIEDAAQALGARSGGASVGLKG
FT                   DIGFFSLAVGKGLSTFEGGVLMAREPSMRAALSAAGAATRFSLWWELRRSIELLGYAML
FT                   YRPSGLRMAYGKPLEKSLSRGDWVEAAGDDFDDLIPQHSLGRWRQSVGARALRRLEAFQ
FT                   QQASGQARLRIAQLQACGLDVVQDAVPRVQGVWPVILLRMPSQQARDAVLRAHWGGGCG
FT                   LSLPFVHVLPDYGRYDHVLGAARDDAVSQARDWAQRLLAISNSPWLDDERFADLLDTLA
FT                   AR"
FT   gene            165485..167158
FT                   /locus_tag="CtCNB1_0147"
FT   CDS_pept        165485..167158
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0147"
FT                   /product="L-aspartate oxidase"
FT                   /note="COG1053, SdhA, Succinate dehydrogenase/fumarate
FT                   reductase"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ACY30893"
FT                   /db_xref="GOA:D0IVF7"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR015939"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR037099"
FT                   /db_xref="UniProtKB/TrEMBL:D0IVF7"
FT                   /protein_id="ACY30893.1"
FT                   /translation="MACCPADQGTRSGENGSRKTLKASAVKRGGACQHDVDVLVIGAGP
FT                   AGAWAAISAASQGANVLLVDKGYCGTSGATAPSGCGVWHVDNTGDLREKAKASRYTMGG
FT                   MLAEQAWMDRVLEQTWNNIELLTEWGYPFPVDVEGKLRRNSLQGPEYMRLMRKQVKAAG
FT                   VRILDHSPALELLVDDAGTVCGATGVRRQAEDTWVVHASATIIATGGCAFLSRALGCNV
FT                   LTGDGYLMAAEVGAQLSGMEFSNAYGLGPAFSSVTKSLFYNWASFYYADGSLIDGAGSS
FT                   RGRSIIAQTLQTQPVFARLDKADASIQAWMRTAQPNFFVSFDRKGINPFHEMFPVSLRL
FT                   EGTVRGTGGLNVVDADCATSVAGLYAAGDAATRELICGGFTGGGSHNAAWALSSGFWAG
FT                   AGAARFALHNPMKKRQLYRAGSPGLEEQGQARLDSSQLIQAVQAEVFPYERNWNRQSDE
FT                   LQQSLQNLDALWLRLRTGVQFQSIEERLRLREATAMLATSRWMYRSALQRTETRGMHRR
FT                   RDHQELDPGQRHRLISGGLDEVWVRRQRVKELPSSEGVLA"
FT   gene            167155..167484
FT                   /locus_tag="CtCNB1_0148"
FT   CDS_pept        167155..167484
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0148"
FT                   /product="electron transport complex, RnfABCDGE type, B"
FT                   /note="COG1146, Ferredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ACY30894"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454XT63"
FT                   /protein_id="ACY30894.1"
FT                   /translation="MIEIISSERCTGCNICVHACPTNVFDMVKGQAPRIARQSDCQTCF
FT                   MCELYCPEDALYVAPVADAAAHVDELSPATQALLGSYRASVGWGKGRQSTAALDASYEL
FT                   LARAH"
FT   gene            167499..168503
FT                   /locus_tag="CtCNB1_0149"
FT   CDS_pept        167499..168503
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0149"
FT                   /product="aliphatic sulfonates family ABC transporter"
FT                   /note="COG0715, TauA, ABC-type
FT                   nitrate/sulfonate/bicarbonate transportsystems"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ACY30895"
FT                   /db_xref="InterPro:IPR015168"
FT                   /db_xref="UniProtKB/TrEMBL:D0IVF9"
FT                   /protein_id="ACY30895.1"
FT                   /translation="MSEHEIRLSEAGSCAAFNRRQWLLGALAASIPMLGEAQSQSAAQT
FT                   LRIGYIGPGKKPAYATGWALQQGILQRELSTLGFSQVVTRVFPNGPDLNEAFIADHLDI
FT                   GIYGDTPAVVAHAQGFQGKLLGFDCVGMNTWLLTPKAGIKTVEELKGKVVGVALGSYMH
FT                   RFVLGLLRQHGLSGRVKVVHMLPRDGAPALERGDVAAFAAPINMGPLLAQQGFPVLAEA
FT                   AQYPTLLGTSVIVISPKLLARLPQFPATWGRARSIALGEIRSDSAAYLAFHAEASGFPV
FT                   PAVKASVALSNLPAQAYPEQGLHLISEAKRFLLNEKLVRKDFSVESWKIPGFS"
FT   gene            complement(168531..169832)
FT                   /locus_tag="CtCNB1_0150"
FT   CDS_pept        complement(168531..169832)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0150"
FT                   /product="Cyclopropane-fatty-acyl-phospholipid synthase"
FT                   /note="COG2230, Cfa, Cyclopropane fatty acid synthase and
FT                   related methyltransferases"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ACY30896"
FT                   /db_xref="GOA:D0IVG0"
FT                   /db_xref="InterPro:IPR003333"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D0IVG0"
FT                   /protein_id="ACY30896.1"
FT                   /translation="MLDRLTEKLLQQVFAPLVKTGRLEVTTPSGKALIFGDGGQPQARL
FT                   RFADRRAVIALLRDPDLNFGELFMQQRLLVEQGTVYDVLELVLRGARHVPVSATVRLLD
FT                   AWRMKLRPLLQNNLRGKSRANVAHHYDLDDRLYQLFLDSERQYSCAYFEQGNEDLETAQ
FT                   LAKKRHIAAKLLIEPGQRVLDIGCGWGGLSRYLAEVGGAGHVTGITLSTEQLAGAQSRA
FT                   SQSIHGERLEYRLEDYRDTQGPFERIVSVGMFEHVGTRFHDAFFRKCHELLSEDGVMLL
FT                   HFIGNSDVPDFNNPWIERYIFPGGHIPSMSEFTPAIERAGLVICDIEVLRLHYAQTLRL
FT                   WRERFMARRAEAAVLYDERFCRMWEFYLSMSETAFRYQDIAIFQVQLARRQDAVPLTRS
FT                   YIAERETALKARESGQKCRVSAMTDPTEARENIA"
FT   gene            complement(169880..170779)
FT                   /locus_tag="CtCNB1_0151"
FT   CDS_pept        complement(169880..170779)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0151"
FT                   /product="hypothetical protein"
FT                   /note="COG0010, SpeB,
FT                   Arginase/agmatinase/formimionoglutamate hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ACY30897"
FT                   /db_xref="InterPro:IPR023696"
FT                   /db_xref="UniProtKB/TrEMBL:D0IVG1"
FT                   /protein_id="ACY30897.1"
FT                   /translation="MMQQTPVVLDVDGSVGPLLQEKRLALAQWQELVRFGCGLRSFRRF
FT                   SLAMQEQLPAQHGTVLMGSGDFHHLSWPLIERCIAQKGFSAKHPLRVVVLDNHPDNMRF
FT                   PWGVHCGSWVRRLAMHPAVSQVHVAGITSQDIGSGHAWENYLRPLRAGKLTYWSCGVDT
FT                   GWARRLGAGKAFRSFANISELVQALSSHLHDWPQDTYLSIDKDVFAAEVVRTNWDQGRM
FT                   LEEQAVQLIDALRGQITGSDITGDVSSWHYGTWWKRLMSAGDGQDTQIDAATLAGWQAG
FT                   QHALNQRLIQHIALSSTS"
FT   gene            complement(170776..171837)
FT                   /locus_tag="CtCNB1_0152"
FT   CDS_pept        complement(170776..171837)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0152"
FT                   /product="ATP synthase subunit alpha"
FT                   /note="COG3146, Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ACY30898"
FT                   /db_xref="InterPro:IPR007434"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D0IVG2"
FT                   /protein_id="ACY30898.1"
FT                   /translation="MATENFRNQLEPSGLLQQFSNHPPEGFALLKEWPAPAFTAPFDLL
FT                   TTAEDALKARLLSLPGGRWLSSRLRLKTDFIGSTVSEYAPLPQGVDAATLARQLRAVAG
FT                   RTMLTIVKDLPQESPLLSASDNDFAKALSQALAEQGFVALEGQALAYVPLGFASTDEYL
FT                   AGLSKNRRSSLRRKLKSRAGLDIRRLPTGAAFADENRIDAYYALFEAVYEQSEIHFDKL
FT                   SRSFLAGLLRDEDNGGIVFEYRDRQSDALLGWNLCFEHDGRLIDKYIGLCYPAAREANL
FT                   YFVSWMVNLEYALERGLSHYVAGWTDPEVKAQLGASFTMTQHLVFIRNPVLRALGRRFS
FT                   GLFESDRQWSEKP"
FT   gene            complement(172026..173399)
FT                   /locus_tag="CtCNB1_0153"
FT   CDS_pept        complement(172026..173399)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0153"
FT                   /product="aminotransferase class-III"
FT                   /note="COG0160, GabT, 4-aminobutyrate aminotransferase and
FT                   related aminotransferases"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ACY30899"
FT                   /db_xref="GOA:D0IVG3"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D0IVG3"
FT                   /protein_id="ACY30899.1"
FT                   /translation="MINTAQLLADEAKYCSFGDTVHYVNPPKIFTGCEGSYMYDDAGTS
FT                   YLDLQMWYSAVNFGYKNKRLEAKMIEQLQELPQVASQYLHPTKIELAKFIAEDAKGKWG
FT                   HDGRVHFNVGGAQAIEDSLKVVRNASGGKSLMFAFEGGYHGRTLGASSITSSYRYRRRF
FT                   GHFSDRAQFIPFPYPFRRPKGMTAEEYAESIVADFRRKFENEYHAVWDPKTNQCEYAAF
FT                   YIEPIQGTGGYVIPPANFFTGLKKVLDDHGVLLVVDEIQMGFWRTGKLWSVENFGIQPD
FT                   VLVFAKALTNGLNALSGLWAREELINPTVFPPGSTHSTFASNPLGTALGLEVMKMTHEM
FT                   DFGRQVRESGAYFLEGLKELQKRHKEIGDVDGLGLALRAEICTEDGFTPNKALLDKMVD
FT                   IGLEGGLEYQGQKRGLVLDVGGYYKNVITFAPSLMISRSEIDEAMVLLDQLLTKAKKA"
FT   gene            complement(173665..175575)
FT                   /locus_tag="CtCNB1_0154"
FT   CDS_pept        complement(173665..175575)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0154"
FT                   /product="ATP-dependent DNA helicase RecQ"
FT                   /note="COG0514, RecQ, Superfamily II DNA helicase"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ACY30900"
FT                   /db_xref="GOA:D0IVG4"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR002121"
FT                   /db_xref="InterPro:IPR004589"
FT                   /db_xref="InterPro:IPR006293"
FT                   /db_xref="InterPro:IPR010997"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR018982"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:D0IVG4"
FT                   /protein_id="ACY30900.1"
FT                   /translation="MSSAQSILQAVFGYEQFRGPQQAIVSHVINGGDALVLMPTGGGKS
FT                   LCYQVPAIARQQLGHGVTIVVSPLIALMHDQVGALHEAGISAAYLNSTLSYDETQEVEL
FT                   RLQSGDITLLYAAPERLNTPRFLGLLDDLHAQGKLSLFAIDEAHCVSQWGHDFRPEYRA
FT                   LSVLHQRYADVPRIALTATADALTRADIIERLQLEAAQHFISSFDRPNIRYKIAEKKDV
FT                   SNQLLRFIEREHEGEAGVIYCQSRKRVEELAQTLVQNGINALPYHAGLPQEMRQNHQDR
FT                   FLREEGVVMCATIAFGMGINKPDVRFVAHVDMPKNIEGYYQETGRAGRDGLPADAWMAY
FT                   GLSDVVNQRRMIDESPAEEQFKQVMRGKLDALLGLAEATDCRRVRLLAYFGEQYGQEPS
FT                   LDGKPLQAVARTHCGNCDNCLEPPALWDGTDAARKLLSTIFRVHEASGLTYGAGHIMDV
FT                   LRGKETDKVTQYGHDKVSTFGIGKEYSEPQLRAVMRQLLATGALGLHKVVSENSGHVFD
FT                   TLCLAAGSRAVLKGEVQVQLREAVAASRSKKQGKKSAANAAAVNLGPDAQVRFINLKAW
FT                   RAEVAKSHNLPAYVIFHDATLASIAELNPQSLQELQGVSGMGTKKLDAYGAEVLRVVAL
FT                   G"
FT   gene            complement(175713..176429)
FT                   /locus_tag="CtCNB1_0155"
FT   CDS_pept        complement(175713..176429)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0155"
FT                   /product="transcriptional regulator, histidine"
FT                   /note="COG2188, PhnF, Transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ACY30901"
FT                   /db_xref="GOA:A0A454XSY7"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR010248"
FT                   /db_xref="InterPro:IPR011663"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454XSY7"
FT                   /protein_id="ACY30901.1"
FT                   /translation="MSLHGKILTEIEQNILSGRWPPGYRIPSEMELTVHYQCSRMTVSK
FT                   VLNKLAEAGLLVRKRKAGSFVTRPQTSSAVLEIPDLRQVVLGMGQEYSSRLLGRTQRRS
FT                   TREDMEAMRMARPASIVHVLCLHMAGSRPFCIEDRLINLESVPDAEHEPFTEHSPSSWM
FT                   VNHVPWSSAEHRIRAEAASEETAGLLEIKPGFPCLVIDRRTWTGQLPITFVRLTYPADL
FT                   YELDAHFSPSTIGQAG"
FT   gene            complement(176493..177641)
FT                   /locus_tag="CtCNB1_0156"
FT   CDS_pept        complement(176493..177641)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0156"
FT                   /product="acyl-CoA dehydrogenase-like protein"
FT                   /note="COG1960, CaiA, Acyl-CoA dehydrogenases"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ACY30902"
FT                   /db_xref="GOA:D0IVG6"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:D0IVG6"
FT                   /protein_id="ACY30902.1"
FT                   /translation="MSLIRLGATEEDQAVADAVARFAEETLAPVAQAMDEEAFSATRHV
FT                   PGLSALGVMGMNLPERFGGPGVTPTAMLMSLVAISRACAATSSMIGAHYLGTDAVLIAG
FT                   DETQREQWLPRCASGEWLAAFALTEPRGGSHPADMRTRAVRDGDDYLITGVKHFISNAA
FT                   EARFMVVFAKTDAEAAARGVSAFIVPRDLPGIQVSSPEKLMGIRGGHAFEVSLDSVRVP
FT                   AANRLGAEGSGFKTAMKVLDNSRLDVAATSLGIAEAALKAAADWANQRLVGGEPIAVKQ
FT                   GIQFKLADMKLRLEAAWALTMQALALRQQGQPFTQQSAMAKLFASEMVGFVTDEALQIH
FT                   GGYGYTREMPLERYVRDARILRIYEGSSEIQRTIIARSVLNA"
FT   gene            complement(177674..178963)
FT                   /locus_tag="CtCNB1_0158"
FT   CDS_pept        complement(177674..178963)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0158"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="COG1804, CaiB, Predicted acyl-CoA
FT                   transferases/carnitinedehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ACY30904"
FT                   /db_xref="GOA:D0IVG7"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="InterPro:IPR023606"
FT                   /db_xref="UniProtKB/TrEMBL:D0IVG7"
FT                   /protein_id="ACY30904.1"
FT                   /translation="MGNEYFPLIHVLGSMQASLQINSRTPMLASTEKTASHPLDGIRIL
FT                   DFTRVLAGPMSTALLADLGAEVVKVEPPQGDDYRAIGPMKNGQSALFTVMNRNKQSLVL
FT                   DLKHADAVAVVHELARQVDVVVENFRPGVAERLGIGPETLRALNPRLVYVSVSGFGQTG
FT                   PLAHRPAYDIIVQAMSGLMEATGEPQGAPTLVGEAVSDVVAGLFASWATLAALLQAQRT
FT                   GVGQHVDVAMFDTTLSFLATSMSRYLFTGQPARRVGNRHPLSAPFGVYRARDGHYALAV
FT                   LNKKLFDATAAAMDQPELASDPRFSSDETRSANEPALRAALEGWSTQHDVADVVARLEA
FT                   AGVPAAPIWNIEQALNSEQIRSRGLLCEVEDERLPGLQLPTQPVHFNGALPNRAQRAPA
FT                   LGEHTELLLQSWLGRSTDAIAALREAGALG"
FT   gene            178942..179877
FT                   /locus_tag="CtCNB1_0157"
FT   CDS_pept        178942..179877
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0157"
FT                   /product="L-carnitine dehydratase/bile acid-inducible"
FT                   /note="COG0583, LysR, Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ACY30903"
FT                   /db_xref="GOA:D0IVG8"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D0IVG8"
FT                   /protein_id="ACY30903.1"
FT                   /translation="MENIHFPFTGFKKLIQINLRQLEYFVAAARHGSTAKAALAINVSQ
FT                   PSISKAIADLEAQWGEQLFVRRHARGMDLTAAGSARQREAQALIERARLLQGPRTQAMA
FT                   GLLRLGYLSTLGPRWVPAIVAQMRKSHPQVEIELVDGDIESLTRRLERGELDAALQYDL
FT                   GLARPRLDMAHVADLTPYALLPWGHALADKATVRLTDLALCPLVLIGLPHSREYFLSLF
FT                   REAGATPQIAFETGSLEMARSLVAHGLGVGLLTTRPVVDKSQDGKRLGCRRLRGPVARQ
FT                   SVVVAFPRDMASPLIQPLLPVARSVFARAG"
FT   gene            180186..180992
FT                   /locus_tag="CtCNB1_0159"
FT   CDS_pept        180186..180992
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0159"
FT                   /product="putative phytanoyl-CoA dioxygenase"
FT                   /note="COG5285, Protein involved in biosynthesis of
FT                   mitomycinantibiotics/polyketide fumonisin"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ACY30905"
FT                   /db_xref="GOA:D0IVG9"
FT                   /db_xref="InterPro:IPR008775"
FT                   /db_xref="UniProtKB/TrEMBL:D0IVG9"
FT                   /protein_id="ACY30905.1"
FT                   /translation="MQLSEEDITAFERDGVIVIRQAFNDWMEPLREGVRRLMADPGPME
FT                   RSVVPADGSAAFFQDLCNWQRIPEFSDFVLRSPAGSLAAQLMRSRTARFFHDHVLVKQP
FT                   GGSTVTPWHQDQPYYCVDGRQSVSFWTPLDPVVRSVVMECVRGSHRWGQDFRPMRFDGT
FT                   RLYENDNYAALPDIDAARDQFDIAGWDMEPGDVIAFNFRTVHGAPGNRSQIARRVFSAR
FT                   WVGDDAVYADRGGKGSPPIKGLTMKHGDPFDDPMFPVVWRDGAPAV"
FT   gene            181066..182028
FT                   /locus_tag="CtCNB1_0160"
FT   CDS_pept        181066..182028
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0160"
FT                   /product="extracellular solute-binding protein, family 3"
FT                   /note="COG0715, TauA, ABC-type
FT                   nitrate/sulfonate/bicarbonate transportsystems"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ACY30906"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR015168"
FT                   /db_xref="UniProtKB/TrEMBL:D0IVH0"
FT                   /protein_id="ACY30906.1"
FT                   /translation="MSMMKKTVLALSLAAGLSGAVLAQETKVSVAMSGWTGFGPLTLAK
FT                   DAGIFKKLGLDVSIRKIPQKDRHLAIASGDVQCAATSTETWIVWNANGVATTQIFKMDQ
FT                   GMGADGIVARPGIEKVEDLKGKTIGVSAPGTNPYFSLAWILKKHGMTLKDVKMVTLEPA
FT                   QAANALIAGNSGLDAAMTYEPYLGLVRSQPDKGKLIADSKQYSMVFDTFGCTPKFLKDN
FT                   PKAAKALTEGYFEALDMIEKDRTKAFTIMGADLKQTAEQFETSQSKIKWADREANIRFF
FT                   NGEIQAFNKEAATLLLETGVIRAIPANLDSLFDTQFLRK"
FT   gene            182031..182888
FT                   /locus_tag="CtCNB1_0161"
FT   CDS_pept        182031..182888
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0161"
FT                   /product="taurine transport system permeaseprotein tauC"
FT                   /note="COG0600, TauC, ABC-type
FT                   nitrate/sulfonate/bicarbonate transportsystem"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ACY30907"
FT                   /db_xref="GOA:D0IVH1"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D0IVH1"
FT                   /protein_id="ACY30907.1"
FT                   /translation="MVSVSSIDKQAVAGEPAAAPASHGPRKMKLLHPVEPRVRLFLGVA
FT                   FFALFLLFWTFLTVAGIVAPHFLASPLQALKAAWKLFTEFGFLNDVGMTVWRVMGGFVL
FT                   AAVIAVPLGIAMGAYKPIEAIFEPFVSFARYLPASAFIPLLIMWVGIGEAQKLSIIFIG
FT                   CFFQLTLMVMMIVGNARRDLVEAAYTLGSTDSSVIRRVLLPGAAPEIAEALRQVLGLGW
FT                   TYVVVAELIGAASGIGHMIMDSQALMATDNIIAGIVIIGLVGLTSDLLFKKLNQLLFPW
FT                   SLMR"
FT   gene            182885..183670
FT                   /locus_tag="CtCNB1_0162"
FT   CDS_pept        182885..183670
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0162"
FT                   /product="taurine transport ATP-binding protein tauB"
FT                   /note="COG1116, TauB, ABC-type
FT                   nitrate/sulfonate/bicarbonate transportsystem"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ACY30908"
FT                   /db_xref="GOA:D0IVH2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D0IVH2"
FT                   /protein_id="ACY30908.1"
FT                   /translation="MSRLSIRQVTKVFQGTARGASPTTALQPTSLEVADNDFITVLGPS
FT                   GCGKSTLLRLVAGLETPTGGEILLDGHRVEGPGADRGVVFQSYTLFPWLNVRQNICFGL
FT                   REKGVPEAQQKEISEYFIASVGLRGFEQHFPKQLSGGMQQRVAIARALANDPKILLLDE
FT                   PFGALDNQTRVVMQELLLGIWEKHRKTVIFVTHDIDESIFMASRVAVFSARPGRIKADI
FT                   PVNLPHPRHYTVKTSSEFMELKARLTEEIRAEALAAAAH"
FT   gene            183751..184464
FT                   /locus_tag="CtCNB1_0163"
FT   CDS_pept        183751..184464
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0163"
FT                   /product="transcriptional regulator, histidine"
FT                   /note="COG2188, PhnF, Transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ACY30909"
FT                   /db_xref="GOA:D0IVH3"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR010248"
FT                   /db_xref="InterPro:IPR011663"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D0IVH3"
FT                   /protein_id="ACY30909.1"
FT                   /translation="MALYQQVKDHVLRKIGDGSLAAGARVPSEQELVNEFGVARMTVNR
FT                   ALRELAEQGVIVRVAGVGSFVAEEKPQSTLLRIANIGEEITQRGHDHRFELLDMRRESA
FT                   SPEVAAALDLAVGASVFHLHGVHFENELPVQIEDRYVNPRLVPDFMDQDFSAVQPSVYL
FT                   VRNVQYDQIEHVVDAILPTAEQARLLQMALDQPCLMLTRRTWLRGVPITWVHCVHPGMR
FT                   YRLGSRFRTDSVHGG"
FT   gene            184532..186091
FT                   /locus_tag="CtCNB1_0164"
FT   CDS_pept        184532..186091
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0164"
FT                   /product="histidine ammonia-lyase"
FT                   /note="COG2986, HutH, Histidine ammonia-lyase"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ACY30910"
FT                   /db_xref="GOA:D0IVH4"
FT                   /db_xref="InterPro:IPR001106"
FT                   /db_xref="InterPro:IPR005921"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR022313"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="UniProtKB/TrEMBL:D0IVH4"
FT                   /protein_id="ACY30910.1"
FT                   /translation="MNTTTTQELSNSELELHPGELTLAQLRRIQDGGVQLSMAQAAYAA
FT                   MRKAEAHVQHIVDEDQVVYGINTGFGKLASTKIAHERLAELQRNLVLSHSVGTGDPLPD
FT                   HVVRLVLATKAVSLARGHSGARTALVDALLALANADVLPVIPSKGSVGASGDLAPLSHL
FT                   ACVLIGEGQAKVGGKLVSGREAMQHIGLEPFVLGPKEGLALLNGTQVSTSLALAGLFQA
FT                   ESVLAAGLVAGCLTLEAIQGSIKPFDARIHAARGQHGQIAVAAAVRSLLDGSAIDPSHP
FT                   NCGRVQDPYSIRCVPQVMGACLDNLSHAARVLVIEANAASDNPLVFDNGDVISGGNFHA
FT                   EPVAFAADIMALAIAEIGAISERRMALLLDTGLSRLPAFLIEDSGVNSGFMIAQVTAAA
FT                   LAAENQCLAHPSSVTSLPTSANQEDHVSMATYGARRLADMVRNTAVIVGVEAMAAVQGM
FT                   DFDRRLKSSPLIEEQYALIRSQVPYLDKDRYLAPDIEIMRLWALETAWPEVLQSILPSN
FT                   AV"
FT   gene            complement(186185..186901)
FT                   /locus_tag="CtCNB1_0165"
FT   CDS_pept        complement(186185..186901)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0165"
FT                   /product="transcriptional regulator, histidine"
FT                   /note="COG2188, PhnF, Transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ACY30911"
FT                   /db_xref="GOA:D0IVH5"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR010248"
FT                   /db_xref="InterPro:IPR011663"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D0IVH5"
FT                   /protein_id="ACY30911.1"
FT                   /translation="MSRTDTTAAVPAFQRIKDHVLQQIQSGVWQEGQAIPSEAALVKQF
FT                   NVARMTVNRALRELSDEKTLTRVQGSGTFVAQQKYQATLVELRNIADEIGARGHRHRGE
FT                   LQRLERCKVDAALLRQFELSTATHLFHSVVVHFENDVPIQVEDRYVNPAVAPDYLSQDF
FT                   ASQTPNAYLVRVAPLQGVNFSIEASMPTAEVAELLRMEVTEPCLVLRRRTRSQGQVASV
FT                   SALWHPASRYQFAGSF"
FT   gene            187031..188515
FT                   /locus_tag="CtCNB1_0166"
FT   CDS_pept        187031..188515
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0166"
FT                   /product="cytosine/purines/uracil permease"
FT                   /note="COG1457, CodB, Purine-cytosine permease and related
FT                   proteins"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ACY30912"
FT                   /db_xref="GOA:D0IVH6"
FT                   /db_xref="InterPro:IPR001248"
FT                   /db_xref="InterPro:IPR026030"
FT                   /db_xref="InterPro:IPR038271"
FT                   /db_xref="UniProtKB/TrEMBL:D0IVH6"
FT                   /protein_id="ACY30912.1"
FT                   /translation="MTEQFMSIDTATLGSSGAIETRTIDMVPESERHGSPSSQFTLWFG
FT                   ANCQITAIVDGALAIVFGAEAMTAIIGLLIGNILGGIVMALHSAQGPRLGLPQMISSRV
FT                   QFGVKGAALPLLLVILMYLGFAATGTVLSGQAINRMFDFSAPQTGMIIFGTLTAIVAVV
FT                   GYRLIHVLGRVATVIGLLGFAYLAVRLGMQYDVASAFGQKPFTWASFLLTIALSAGWQM
FT                   TFAPYVADYSRYLPSNTPTSRAFTTTFMGSVIGAQIAMTLGVLVAALGGQFLKNQVGFI
FT                   GDLAGPAAIVIYLVIVSGKLTVNCLNAYGGFMTILTTVSGFNNKTQISPVARIAYIVGF
FT                   VLLSLVVALLASADFLNNFKNFVLLLLAVFVPWSAVNLVDYYLVSKERVDIPALYDPQG
FT                   RYGSYNFMALGCYVLGILVQIPFLNQALYKGPLASMLGGADISWIVSLLVTSLVYYPLA
FT                   KRSMKVPAAMIYPKCSPAPAVEPDFYAEATRFRAEP"
FT   gene            188558..190255
FT                   /locus_tag="CtCNB1_0167"
FT   CDS_pept        188558..190255
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0167"
FT                   /product="urocanate hydratase"
FT                   /note="COG2987, HutU, Urocanate hydratase"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ACY30913"
FT                   /db_xref="GOA:D0IVH7"
FT                   /db_xref="InterPro:IPR023636"
FT                   /db_xref="InterPro:IPR023637"
FT                   /db_xref="InterPro:IPR035085"
FT                   /db_xref="InterPro:IPR035400"
FT                   /db_xref="InterPro:IPR035401"
FT                   /db_xref="InterPro:IPR036190"
FT                   /db_xref="InterPro:IPR038364"
FT                   /db_xref="UniProtKB/TrEMBL:D0IVH7"
FT                   /protein_id="ACY30913.1"
FT                   /translation="MTTPNDSRIDPTRVIRAPRGNQLSCKNWLTEAAYRMIQNNLDPEV
FT                   AENPQALVVYGGIGRAARNWECYDQILASLKELNEDESLLVQSGKPVGVFKTHPGAPRV
FT                   LIANSNLVPKWATWEKFNELDRKGLFMYGQMTAGSWIYIGSQGIVQGTFETFVEAGRQH
FT                   YNNDLTGKWILTAGLGGMGGAQPLAATLAGACSLNIECKQSSIDFRLRTRYVDKQAKDV
FT                   DDALALIKHHTEKGEAVSIALLGNAAEILPELVKRAKAGGPKPDIVTDQTSAHDLINGY
FT                   LPVGWTVAQWEAAAADPSQHAKLTKAAAQGCAVHVQAMLDFQAMGIPTVDYGNNIRQVA
FT                   FDEGVKNAFDFPGFVPAYIRPLFCEGKGPFRWVALSGDPEDIYKTDAKIKELFPENKHT
FT                   HRWLDMARERIAFQGLPARICWLGLGERHKAALAFNEMVKNGELKAPIVIGRDHLDTGS
FT                   VASPNRETEAMKDGTDAVSDWPLLNALLNTAGGATWVSLHHGGGVGMGYSQHSGMVIVA
FT                   DGTDEAAARLARVLVNDCGSGVMRHADAGYELAIETARKQGLKLPMVK"
FT   gene            190309..191607
FT                   /locus_tag="CtCNB1_0168"
FT   CDS_pept        190309..191607
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0168"
FT                   /product="amidohydrolase"
FT                   /note="COG1473, AbgB,
FT                   Metal-dependentamidase/aminoacylase/carboxypeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ACY30914"
FT                   /db_xref="GOA:D0IVH8"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR017439"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:D0IVH8"
FT                   /protein_id="ACY30914.1"
FT                   /translation="MLRGVALAAALLVPGWAAAQEPAAIDRLLGQMYPQLDTLYKDLHA
FT                   HPELGFAETRTAARLAKELRGLGFEVTEQVGKTGVVALLRNGTGPTVMVRTDMDALPME
FT                   EKTGLPYASRAKTTWNGRETFVAHSCGHDVHMAAWVGVARTLSALKSQWRGTLMLVAQP
FT                   AEETGAGARAMLADGLFTRFPKPDVALALHTDPRPIGTVSYAVGPMTSAANEVQITFKG
FT                   RGGHGSAPHKALDPVMIAARFIVDVQSVVSRDKDPMEFGVVTIGAMQAGSSGNIIPDRV
FT                   VLRGTIRSYAPAVRAQLLDGVRRVALASAAAAGAPEPDIALPDTSSATVNNPAVVAKVE
FT                   SVLKAALGADNVTRTPPLTTSEDFAEYGAEGVPSMFFLVGVTDPQEVAVSQRPGGKPLV
FT                   FNHSPQFAPLPEPSIKTGVKAMSLAALGFLDKP"
FT   gene            191716..192282
FT                   /locus_tag="CtCNB1_0169"
FT   CDS_pept        191716..192282
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0169"
FT                   /product="hypothetical conserved protein"
FT                   /note="COG3758, Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ACY30915"
FT                   /db_xref="InterPro:IPR010282"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:D0IVH9"
FT                   /protein_id="ACY30915.1"
FT                   /translation="MQRFDLNQIAPSPWKNGGGSTREIACWPQGAGMDSFGWRVSVATI
FT                   AQAGPFSAFPGIDRQIMLLDGDGVRLHSAQAGLEHALTERWQPFAFSGDMALDCDLLGG
FT                   PSSDFNVMTRRGQWSASLEQLGGRAEAGLSAAGLCMVLEGGWKCADGRILQAGQGLWWS
FT                   SPQAEPLLAQDEQARLILVSLTPHS"
FT   gene            192422..193684
FT                   /locus_tag="CtCNB1_0170"
FT   CDS_pept        192422..193684
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0170"
FT                   /product="imidazolonepropionase"
FT                   /note="COG1228, HutI, Imidazolonepropionase and related
FT                   amidohydrolases"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ACY30916"
FT                   /db_xref="GOA:D0IVI0"
FT                   /db_xref="InterPro:IPR005920"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:D0IVI0"
FT                   /protein_id="ACY30916.1"
FT                   /translation="MTQVISHPAVSADGCWYNLRLAPELYVSEVADIPEGTLACIVVQQ
FT                   GRMVWVGPQDAMPAEYQALPRHDGAGRLATPGLIDCHTHLVYGGERANEFAMRLAGASY
FT                   EEVARAGGGIVSSVRATREASEDELVALALPRLEQLLAEGVTAIEIKSGYGLALEHERK
FT                   QLRAARRLGELCAVTVCTTFLGAHALPPEYAGRSQEYTDLVCQVMLPALAAEGLIDAVD
FT                   VFCERIAFSLVETEQVFQAAKALGLPVKLHAEQLSNMEGAALAARYGALSCDHIEHLSE
FT                   HGIDEMKKAGTVAVLLPGAFYTLRDTKVPPIEELRAAKVPMAVSTDHNPGTSPCLSLLL
FT                   MANMACTLFRLTVPEALAGITRHAAQALGLQDEQGLIAVGRPANFVLWPVKQAAELAYW
FT                   FGSKPDCTVVRQGLIARQAKA"
FT   gene            193704..195098
FT                   /locus_tag="CtCNB1_0171"
FT   CDS_pept        193704..195098
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0171"
FT                   /product="FAD linked oxidase-like protein"
FT                   /note="COG0277, GlcD, FAD/FMN-containing dehydrogenases"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ACY30917"
FT                   /db_xref="GOA:D0IVI1"
FT                   /db_xref="InterPro:IPR004113"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR016171"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:D0IVI1"
FT                   /protein_id="ACY30917.1"
FT                   /translation="MLMSHEQFLNELISTLGADVVLRGTDTPERSRTDWSGTPPQQPLA
FT                   LVRPRSTEEVSAVMRLCSAHRVAVVPQGGLTGLAGAAVPTEGAVALSLDRMNRIEDIDV
FT                   KTGLMQVQAGVTLQAVQEAAVDVGMVFGVDLGARGSCQIGGNVSTNAGGNGVLQHGMMR
FT                   EQVLGLEVVLADGTVLPMLRPMIKNNTGYDLKQFFIGAEGTLGIITRVLLRLRPAPQAT
FT                   ATTLVAMPDFDSALAVLKRMQSRFGNSVAAYELMWDSFVQASMAWLKLAAPFEQRYPLL
FT                   ALINVDGKDEVQLQGDLQQVLEEAMEAGEVLDAIVAQSVAQVQQLWKLREAPAELNNNM
FT                   HPAINFDVSLPQADIGRFAEACMQAFAARWPGHQALYFGHVGDGNLHVSVDGKTVNGEC
FT                   EQVEELLYRIVGEMQGSVSAEHGIGLHKKPYLGNSRTPAELAAMRAIKLALDPLGLMNP
FT                   GKVFDL"
FT   gene            195095..196237
FT                   /locus_tag="CtCNB1_0172"
FT   CDS_pept        195095..196237
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0172"
FT                   /product="histidinol-phosphate aminotransferase"
FT                   /note="COG0079, HisC, Histidinol-phosphate/aromatic
FT                   aminotransferase andcobyric acid decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ACY30918"
FT                   /db_xref="GOA:D0IVI2"
FT                   /db_xref="InterPro:IPR001917"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR005861"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D0IVI2"
FT                   /protein_id="ACY30918.1"
FT                   /translation="MTNSLVASLARAQVRPLPAYNAGLSNEAVRARYGVTDIARLASNE
FT                   NPFGASASVRRAIAEVANDVGNYPDANCTALREAIAERTGLPAGRLVFGDGSEDLIKIL
FT                   CEVFLAPGDLVVTQRPVFGLHEIYPKMMGAEVELLDLNEELGFDLGAWCAAVAKAPKIA
FT                   FLPNPSNPVGCMMDAAQFAQVLEATPANTVLVVDEAYYEYALHDDDYPDVLAMLEARVG
FT                   PWIVLRTFSKAWGLAGLRVGYGMADSAELVGLMDKVRSPFNVNMAAQRAALAAWNDPAH
FT                   MRSGVATTVALREDLRRQLLALAGPGRPLQGLRIAPSVANFLFLDLGRPNGPVTEALLR
FT                   QGVIVKPWKEPGFEHFLRVSIGTEGDNARFVQALLAALEA"
FT   gene            196241..197470
FT                   /locus_tag="CtCNB1_0173"
FT   CDS_pept        196241..197470
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0173"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="COG2223, NarK, Nitrate/nitrite transporter"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ACY30919"
FT                   /db_xref="GOA:D0IVI3"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D0IVI3"
FT                   /protein_id="ACY30919.1"
FT                   /translation="MKLFRGWTIVAAAHGLLALAFGAAYSFGAFFKSIQTQFDAGRFSV
FT                   GSLFAVTALLYYCVGAVAGPLADRIGLRRVTGAGVLLLATGFALASQTRSLAQLFVVFG
FT                   LFVGGGVGLIYVPALVAVQRWFIRLRSRASGLASAGTGVGTFAAPLFAGWLLELQSWQI
FT                   TMQWFALAILLLGLPAALSMVGQPSQLGLSCDGDPHPAQAAAQAQGMELSQAVRSSSFG
FT                   WFFLAIFLASVSLFAGLVHIAPMAQGLDIDAVSSQWLIALIGAGNVLGRPLLGGLGDRL
FT                   GALRLLMGLSIFLALLHLLWWQAHGWAALAVFALLFGAAHGGCIALFPVLAAQWFGTLR
FT                   LGAILGILYISVGLAAVVGASASGWVFDQTGGYTQAIQVSAALALLAVAALALAARGQR
FT                   LVSSPSGISK"
FT   gene            197467..198894
FT                   /locus_tag="CtCNB1_0174"
FT   CDS_pept        197467..198894
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0174"
FT                   /product="formiminoglutamate deiminase"
FT                   /note="COG0402, SsnA, Cytosine deaminase and related
FT                   metal-dependenthydrolases"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ACY30920"
FT                   /db_xref="GOA:D0IVI4"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR010252"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:D0IVI4"
FT                   /protein_id="ACY30920.1"
FT                   /translation="MIMHSSSSSGTLFAEDALLPTGWARNVLLSWDESGRLAEVLTDVD
FT                   PQSGEAGEVDTAIRAAGPVIPGMPNLHSHAFQRAFGGLTEFRGQAQDSFWSWRKLMYGF
FT                   ANRMTPEALEAIATWLYLEMMEAGYTSVCEFHYVHHDAGGKPYANDASLSLALLRAAQK
FT                   TGIGMTLLPVLYQTSGFGGLPPREDQARFIRSTDNMLSLLQQLEPVTRAQQAALGLAPH
FT                   SLRAVPPDSLKTALAGLHAMLPKAPVHIHIAEQTQEVDDCLAWSGQRPVQWLLEHAPVD
FT                   ARWCLVHATHMTPEEYAGAARSAAVAGICPTTEANLGDGIFDMPAWLRHGGRWGIGSDS
FT                   HATVNAAEELLMLEYSQRLNLRQRNVLGGGAQPQVATSMTLQAVAGGAQASGRAISGLA
FT                   VGQQADFVVLDARHVALNGLPADSGHAAHVFASHRTSAIADVWVRGQQRVQAGRHALHE
FT                   VAQQGFVLARKALLQGA"
FT   gene            198936..199751
FT                   /locus_tag="CtCNB1_0175"
FT   CDS_pept        198936..199751
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0175"
FT                   /product="N-formylglutamate amidohydrolase"
FT                   /note="COG3741, HutG, N-formylglutamate amidohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ACY30921"
FT                   /db_xref="GOA:D0IVI5"
FT                   /db_xref="InterPro:IPR007709"
FT                   /db_xref="InterPro:IPR010247"
FT                   /db_xref="UniProtKB/TrEMBL:D0IVI5"
FT                   /protein_id="ACY30921.1"
FT                   /translation="MSQAIAPFVFHQGTAPLLISMPHTGTHVPADIAARLTPEGREVHD
FT                   TDWHMPQLYDFAKALGASILVATHSRYVIDLNRPPDGASLYPGQSVTGLCPVDGFDSKP
FT                   LYASKDLEPDEAEVARRRELYWQPYHAQLRAELDRIKSQHGVAMLWDAHSIRSVLPRFF
FT                   EGKLPDLNLGTADGKSCAPALAQQLLDIARQAPDHTSVLNGRFKGGFITRNYGQPEQGF
FT                   HAVQLEMTQSSYMQEQMPFDYLPEVAARIQPTMQRLLQAVLAFAQASGR"
FT   gene            complement(199759..200229)
FT                   /locus_tag="CtCNB1_0176"
FT   CDS_pept        complement(199759..200229)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0176"
FT                   /product="transcriptional regulator, MerR family"
FT                   /note="COG0789, SoxR, Predicted transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ACY30922"
FT                   /db_xref="GOA:D0IVI6"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR010211"
FT                   /db_xref="InterPro:IPR015358"
FT                   /db_xref="UniProtKB/TrEMBL:D0IVI6"
FT                   /protein_id="ACY30922.1"
FT                   /translation="MKTEDDPLMSISDFAQRSGVNASALRFYESLGLIESVRSSGGRRR
FT                   YHRSGLRRIAYIVFAQRVGFTLEEIAAQLARLPTRHVPTGGDWQKMSRIWQQRLDERIT
FT                   ELQRLRDSLNQCIGCGCLSLKVCSMYNPGDQCQRGGPGARRWLGDELQAEGH"
FT   gene            200571..201761
FT                   /locus_tag="CtCNB1_0177"
FT   CDS_pept        200571..201761
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0177"
FT                   /product="efflux transporter, RND family, MFP subunit"
FT                   /note="COG0845, AcrA, Membrane-fusion protein"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ACY30923"
FT                   /db_xref="GOA:D0IWA5"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:D0IWA5"
FT                   /protein_id="ACY30923.1"
FT                   /translation="MSVHSTPPLRPLLLAGGLAALVLLSGCDRPGAGDAHAGNGPPPAP
FT                   EVQVVEVALQAIRPWDEFNGRIEAVESVQLRSRVSGYIERIAFVEGQEVKKGQLLFVID
FT                   QRPYRAALASAQAQLERARAAAGLAQTQDQRARQLVAENAVSREEADTRAATLAQATAQ
FT                   VRAAEAELATARLQLDFTEVRSPITGRASRALLTVGNMAQADQSVLTTLVSQDPVYAYF
FT                   DADEHSFLRYQKAGLSGQGRAVRVALVGDSGFAHAGTLDFSDNQLQPGTGTMRLRARLA
FT                   NPDRVLTPGLFARVQMQSGPDPQGAEPQALLIDDKAVLTDQDRKYVYVVGEGNVAERRD
FT                   LTLGRMVDGRRLVEQGLTAGDRLVVGGVQRIYYPGMPVNPRPVAAAAVQPAPAAAQ"
FT   gene            201773..204967
FT                   /locus_tag="CtCNB1_0178"
FT   CDS_pept        201773..204967
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0178"
FT                   /product="hydrophobe/amphiphile efflux-1 transporter"
FT                   /note="COG0841, AcrB, Cation/multidrug efflux pump"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ACY30924"
FT                   /db_xref="GOA:D0IWA6"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR004764"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:D0IWA6"
FT                   /protein_id="ACY30924.1"
FT                   /translation="MDFSKFFIDRPIFAVVLSIIMFAVGLVAIPQLPVGEYPEVVPPSV
FT                   VVRATYPGANPKEVAESVAVPLEEAINGVEGLMYMKSVAASDGSLQVVATFRPEIDPDT
FT                   AAVRVQNRVSQAQSRLPEEVRQFGVTTQKQASTPLMYVGLVSRDGAHDALYLRNHVTLK
FT                   IKDVLARIPGVGDVGIYGAGDYAMRVWLDPHKVAARQLTAGEVIAAIREQNIQVSAGQL
FT                   GAEPSAQKSDKLLSINVRGRLKTTEEFGSIVLKSGEGGQVVRLADVARIELGASDYTLR
FT                   SWSDTKNMAAVGIFLSPGANALGVAEQVYAAMDRLSKDLPEGVAFESVWDPTVFVRDSI
FT                   KAVQSTLIEAVILVVLVVIVFLQTWRASIIPLLAVPVSIIGTFAGLYLLGYSINTLTLF
FT                   GLVLAIGIVVDDAIVVVENVERYIEQGHSPQEAAHLAMKEVSGPIIAIALVLCAVFVPM
FT                   AFLSGVTGQFYQQFAVTIAISTVISAINSLTLSPALAAKLLQPHGAPRDALARVIDKGL
FT                   GWFFRPFNRFFDRSAHGYQNSVGRSLRRRGLVFAVYAALLAGTAVLFHAVPGGFIPMQD
FT                   KLYLFAGAKLPEGASLNRTDAVTRQMVETAKSVDGVDMVAAFAGFNALQSTTTPNLTSS
FT                   YIMLKPFGERTRSAEAINAELGAKFAQIEGGFAYALMPPPIQGLGNGSGYSLFLQDRAG
FT                   LGYAALQQALEAFQAEIAKTPGMTYPVSSYQSNIPQLEVKVDRIKAKAQGVALTDLFQT
FT                   LQAYLGSVYVNDFNAFGRVWRVMLQADADYRQAVEDIAQLRTRNARGEMVPIGSMVTVV
FT                   PSYGPDPVLRYNGFPAADLIGDSDPRLLSSAEVLTKLQEIAQRTLPRGIELAWTDLSYQ
FT                   QVEQSHAAAVVFVIAVMLVFLVLAALYESWTLPLAVILIVPVCICAALFGVWLAGGDNN
FT                   VFVQVGLVVLMGLACKNAILIVEFARELEMRGSPTVDAALQACRLRLRPIVMTSIAFIA
FT                   GAVPLLIGGGAGSEVRAATGVTVFSGMLGVTLFGLFLTPVFYVTLRRLSGRSLATRTPV
FT                   QPASTVAPTSLEGRHV"
FT   gene            204996..206432
FT                   /locus_tag="CtCNB1_0179"
FT   CDS_pept        204996..206432
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0179"
FT                   /product="RND efflux system, outer membrane lipoprotein"
FT                   /note="COG1538, TolC, Outer membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ACY30925"
FT                   /db_xref="GOA:D0IWA7"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="InterPro:IPR010131"
FT                   /db_xref="UniProtKB/TrEMBL:D0IWA7"
FT                   /protein_id="ACY30925.1"
FT                   /translation="MAYAVAGLATLLAGCAVGPDFRTPELPQAGAQFARAEPSAVLKQA
FT                   SPETGSDAAFWRQFQDAQLTQLVEQALRANQDLRAALARLDAAQALLRESRLDQLPTLT
FT                   LSGQALQQRRSESQAMGGPRSQRSYSAGINASWELDLFGRVRRNIEAGSAELRASAADM
FT                   AALQVAIAAQVAASYADLRGWQQRLQLAEANAANQQDTMRLVQLRLAHGSGTDFDLARA
FT                   QAQLETTRSRIPVLQARIAVAQHRLAVLTGQVPEALIAALNAPAALPQLPETIAPGTPA
FT                   ELLRRRPDVAAAEARLHAATARVGVTTAELFPRLSLGGLLGSSALSTGALFEAGSASRS
FT                   VFLGVDWSFLDVGRVRARIAASEAGAQVALAQYQQSVLLALEDTENALVLLTRTRSEDA
FT                   HLAQAAEQRARAEQLAQRRYRLGSVGLYEVLDAQRDLYAAQDAAADSRARGLRAAVALY
FT                   QALAGGWEGQSPARPMMALQ"
FT   gene            206429..207103
FT                   /locus_tag="CtCNB1_0180"
FT   CDS_pept        206429..207103
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0180"
FT                   /product="2OG-Fe(II) oxygenase"
FT                   /note="COG3145, AlkB, Alkylated DNA repair protein"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ACY30926"
FT                   /db_xref="GOA:D0IWA8"
FT                   /db_xref="InterPro:IPR004574"
FT                   /db_xref="InterPro:IPR005123"
FT                   /db_xref="InterPro:IPR027450"
FT                   /db_xref="InterPro:IPR037151"
FT                   /db_xref="UniProtKB/TrEMBL:D0IWA8"
FT                   /protein_id="ACY30926.1"
FT                   /translation="MTLSLFPADSLPAEIIDDGAVLLRGFAAAEEQRWVAEVTALQTGA
FT                   AFRTMQVPGGKFMSVAITNAGGWGWISDLQGYRYSAVDPQTGKPWPAIPAFLGEQAARA
FT                   AALAGYPGFAPDACLINRYQPGARMGLHRDQDEHDFAAPIVSVSLGLPCRFLWGGLTRQ
FT                   SPTRRLALTHGDVLVWGGPSRLVFHGVAPLREGQHPLLGNERWNLTFRMAKARYPAGQP
FT                   SE"
FT   gene            207170..208246
FT                   /locus_tag="CtCNB1_0181"
FT   CDS_pept        207170..208246
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0181"
FT                   /product="homocysteine S-methyltransferase"
FT                   /note="COG0646, MetH, Methionine synthase I
FT                   (cobalamin-dependent)"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ACY30927"
FT                   /db_xref="GOA:D0IWA9"
FT                   /db_xref="InterPro:IPR003726"
FT                   /db_xref="InterPro:IPR017226"
FT                   /db_xref="InterPro:IPR036589"
FT                   /db_xref="UniProtKB/TrEMBL:D0IWA9"
FT                   /protein_id="ACY30927.1"
FT                   /translation="MSQSHPTPAYTRAQELPATLAKRLVILDGAMGTMIQRFKLGEAQY
FT                   RGEGYAGAEGAGERFKDFAHDVKGNNELLSLTRPDVIRDIHEKYLAAGADLIETNTFGA
FT                   TTIAQEDYHMADLAYEMNLKSAQLARAACDKYSTPDHKRYVAGALGPTPKTASISPDVN
FT                   DPAARNITFEQLRQAYLEQTLALIEGGADVILVETIFDTLNAKAALFAVDEAFEQTGER
FT                   LPIMISGTVTDASGRILSGQTVTAFWHSVRHSNPLSVGLNCALGATLMRPYVQELAKAA
FT                   PDTFISCYPNAGLPNPMSDTGFDETPEITSRLVHEFAAEGLVNIVGGCCGTTPDHIGAI
FT                   AKAVQATATRKLFYPAEA"
FT   gene            208435..209577
FT                   /locus_tag="CtCNB1_0182"
FT   CDS_pept        208435..209577
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0182"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ACY30928"
FT                   /db_xref="UniProtKB/TrEMBL:D0IWB0"
FT                   /protein_id="ACY30928.1"
FT                   /translation="MTAPLQPVASVLPVSVPTGQAAAQAGNVAAAAVSGLPAAQQPPVA
FT                   QTAPPVTSMVQWSPQTLQNLKLQAFEHLIAQLALQVQAQPGAPAASWPSQGLPAAVQQF
FT                   VQSLLAQVQVSLQGQAQPLQLLAGQQGSVALMQALAQAAASGAQPHSSALQTAAALSPT
FT                   AAVALEQAQQGMAAAPAGAAAPRLPQLQNWLVQQGTLVTPQGERSFSLTLQVPAAWVQA
FT                   VGAPSIPTAQGPGTALRLPIAEPGVLSSGPLALVVQPQSLVATSTLATSALLWLELQPV
FT                   TASTAQATPAQMAGLPLAMPAPALAQEVQQLLQNRSDPWLMMAAAQAANALPVPRRSGE
FT                   HRSHLCMTEGCQYQGLAPCAQPFCSEMNRIWAASGVARSG"
FT   gene            209836..210831
FT                   /locus_tag="CtCNB1_0183"
FT   CDS_pept        209836..210831
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0183"
FT                   /product="gram-negative type outer membrane porin protein"
FT                   /note="COG3203, OmpC, Outer membrane protein (porin)"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ACY30929"
FT                   /db_xref="GOA:D0IWB1"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="InterPro:IPR033900"
FT                   /db_xref="UniProtKB/TrEMBL:D0IWB1"
FT                   /protein_id="ACY30929.1"
FT                   /translation="MRLRTGIACSTCFTLLSAVLPAAAQSSNVSIGGLIDGGIYRGFDG
FT                   TAQAGTIQRSNLAIAGWEDLGGGLKATFRLSARFDIDTGRLEDQGRKPFWHDESTVGLQ
FT                   GGFGHLRLGRALSAMWSQDWKFDPWANFNRISSPAWYQWHYLTPTDRYSNNGTAEYGRM
FT                   ANGIFYDSPTVAGFTLHLSASPERTEVPLTLRREGRGYSASLNYDSDSLSGMLAFERNG
FT                   SGDKDTFVAGKYRFGAAAVMAAWDYSRVAQTALSAKAVTLGATYQMGQTTLKAGYGRQR
FT                   MQEQTNHFYSMGADYALSKRTTLYASLGRKSYEYGADSGTSFGVGMAHAF"
FT   gene            211296..212369
FT                   /locus_tag="CtCNB1_0184"
FT   CDS_pept        211296..212369
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0184"
FT                   /product="biotin synthase"
FT                   /note="COG0502, BioB, Biotin synthase and related enzymes"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ACY30930"
FT                   /db_xref="GOA:D0IWB2"
FT                   /db_xref="InterPro:IPR002684"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010722"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR024177"
FT                   /db_xref="UniProtKB/TrEMBL:D0IWB2"
FT                   /protein_id="ACY30930.1"
FT                   /translation="MSYSVPEQDNPVRAADAQQAAACGSQTMHWHAPAKPAAASEAQRW
FT                   PVEAVQSLLDLPFLDLLHRAQSVHRENWPAGEIELATLLSVKTGGCPENCGYCPQSAEF
FT                   DTGVKAEKLMSVEEVTRAAKAAQDAGATRFCMGAAWRAPKDRDIEKMNELIGAVKGLGM
FT                   QTCATLGMLQPHQAASLRDAGLDYYNHNLDTAPEYYKDVVSTRQYQDRLDTLAAVRDAG
FT                   ISVCCGGIIGMGETEVHRAGLIAQLANMEPYPESVPINSLVPVPGTPLADSEPVDPLDF
FT                   VRVIAVARITMPKARVRLSAGRQQLGEAVQTLCFMAGANSIFYGDKLLVTGNPDVEADT
FT                   TLMRKLGLKGLGASAAS"
FT   gene            212417..213844
FT                   /locus_tag="CtCNB1_0185"
FT   CDS_pept        212417..213844
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0185"
FT                   /product="adenosylmethionine-8-amino-7-oxononanoate"
FT                   /note="COG0161, BioA,
FT                   Adenosylmethionine-8-amino-7-oxononanoateaminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ACY30931"
FT                   /db_xref="GOA:D0IWB3"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR005815"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D0IWB3"
FT                   /protein_id="ACY30931.1"
FT                   /translation="MHGPASGAGQAALRLRFDKAGDSPQEFLMEHSLASRSVRHVWHPC
FT                   TQMKRHEAAPPIAIDHATGPWLVDTEGRRYLDGISSWWVNLFGHSHPHIRAALTEQMRK
FT                   LDHVMLAGFTHAPVVELSERLAGLTGLGHAFYGSDGASATEIALKMSAHYWRNQGHPAK
FT                   HRFVGLAGGYHGETVGALSVTDIALFRDAYGPLLRLSATVPSPDARQARPGETAADVAR
FT                   RAAEGLESWLQAHHQETAALILEPLVQCAAGMAMHDAEYLRLARALCDRYSVHLVVDEI
FT                   AVGFGRTGSLFAHQQAGIRPDFICLSKGLTGGTLPLSAVLTTDAVYAAFYDDDAARGFL
FT                   HSHSYTGNPLACRAAVATLELFEQLDQLAANRQLARKISAAFAGLNAHPRVSNARQQGM
FT                   IWAWDIDTSLPDFAQRYHQAALDLGLLLRPIGRTLYCMPPYVLNDTDIAHLGQAALAAL
FT                   NTTLQQEAELAAQKGKA"
FT   gene            213841..214524
FT                   /locus_tag="CtCNB1_0186"
FT   CDS_pept        213841..214524
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0186"
FT                   /product="dethiobiotin synthase"
FT                   /note="COG0132, BioD, Dethiobiotin synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ACY30932"
FT                   /db_xref="GOA:D0IWB4"
FT                   /db_xref="InterPro:IPR004472"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D0IWB4"
FT                   /protein_id="ACY30932.1"
FT                   /translation="MIGCFVTGTDTGVGKTLASCALLHALAGHHARVVGMKAVAAGAEP
FT                   DGHGGWVNEDTVALRAASTLAVPAALDNPVLLPDPMSPHIAARRAGVEVRLAPILDAYR
FT                   QLAAQADAVVVEGAGGWRVPLSETLCIADLAVALQLPVVLVVGLKLGCLNHAVLTAEAI
FT                   RAAGLPLAGWVASRVEPQMLVPEENMDWLRNQLGRLGAPLLADIPWQATPDPRLTSFSL
FT                   PKEWQ"
FT   gene            214521..215717
FT                   /locus_tag="CtCNB1_0187"
FT   CDS_pept        214521..215717
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0187"
FT                   /product="8-amino-7-oxononanoate synthase"
FT                   /note="COG0156, BioF, 7-keto-8-aminopelargonate synthetase
FT                   and related enzymes"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ACY30933"
FT                   /db_xref="GOA:D0IWB5"
FT                   /db_xref="InterPro:IPR004723"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR022834"
FT                   /db_xref="UniProtKB/TrEMBL:D0IWB5"
FT                   /protein_id="ACY30933.1"
FT                   /translation="MTASSNFWLQDIPQQLAALDAAALRRTRRTVAPLQGARILVDGQP
FT                   MLQFCSNDYLGLAQHPAMIEAACAGAQDFGVGSGGSPMVNGHSSANAALEEELARFVQL
FT                   PRALYFYAGFATNASIIPALVGAGDAIFSDALNHASLIDGCRLSRGQIHRFEHGDLAAL
FT                   EQLLAACPVQRKLVVSDAVFSMDGNVADIEGLLALCERYDALLLLDDAHGFGVLGPQGR
FT                   GSLAAAGLTGVKASPRVLYMATLSKAAGVSGAFVAGHELLIEWLLQKTRSYTFATAAPA
FT                   MLARALQTSLQLIEEQSALREQLQARIAQLRAGLQPLLQGKGWRLLPSDTAVQALVVGG
FT                   NDAALGLMEGLRRHGLWVPAIRPPTVPVGTARLRIALSALHTEADVKQLLAALQELAG"
FT   gene            complement(215753..217234)
FT                   /locus_tag="CtCNB1_0188"
FT   CDS_pept        complement(215753..217234)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0188"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="COG1167, ARO8, Transcriptional regulators containing
FT                   a DNA-bindingHTH domain and an aminotransferase domain
FT                   (MocR family)and their eukaryotic orthologs"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ACY30934"
FT                   /db_xref="GOA:D0IWB6"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D0IWB6"
FT                   /protein_id="ACY30934.1"
FT                   /translation="MFKHAQLESVKAWIGDPAHGALPLHVRIQRAIRQLILDGALDVGR
FT                   RLPASRALAQSLGVSRDTVEAAYGQLHAEGFIERRTGSGSFVSEQVQRLPGRGLMQSPL
FT                   ARVPALRLSQRGAAMFADGGLRDFLAPRAFAPGVPETRNFPLQTWERLQRQVLKEHGTR
FT                   ALLHSPPQGTEALRQAIAAYVNLERGARATPERVLVLTSSQQALTLCANVLLDAGDRIF
FT                   IEDPVYHGARKAFDAAGLECVPVPLDGDGMRVDLLQTLPAARAVFLTPSHQFPTGTTLA
FT                   LDRRLAAIAWAQQEQAWIIEDDYDSEFHYAGKPMACVQGLDQHERTIYVGTFTKSMFPG
FT                   LRIGYMVLPASLVAPMTVARTLLDGHSAAIAQLTLARFIEGGHLGAHVRTMRAVYAERR
FT                   DVLARLVREHLGDFLEPRVPAGGMQMPCTLLHGIAERAAVDGARRAGIDLLGLTQLHAS
FT                   SPQQTGFLMGFAAHAPHELEVAARKLAQVLQALRH"
FT   gene            217400..218572
FT                   /locus_tag="CtCNB1_0189"
FT   CDS_pept        217400..218572
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0189"
FT                   /product="benzoate transporter"
FT                   /note="COG3135, BenE, Uncharacterized protein involved in
FT                   benzoatemetabolism"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ACY30935"
FT                   /db_xref="GOA:D0IWB7"
FT                   /db_xref="InterPro:IPR004711"
FT                   /db_xref="UniProtKB/TrEMBL:D0IWB7"
FT                   /protein_id="ACY30935.1"
FT                   /translation="MAGLISVIVNYGGTFILVFQAAKVAGLGPELTASWVWSISIGVGL
FT                   TGLLLSWVTREPVITAWSTPAAAFLVTALASTPYAEAVGAYMVSALAFVVLGLSGYFER
FT                   VIRLIPAGIAAGLLAGILLQFGIKAFGGMSVDPMLAGLLIATYVVLKRISARYAVVGIL
FT                   VLGLVFLLSQNRVNLSGLELQLAAPVFTRPEFSLNALLSVALPLFLITLTGQYMPGMLV
FT                   LRNDGFKTSANPIVTITGLGSLLMAPFGSHAFNIAAITAAIATGPQAHEDPSRRWIAGV
FT                   AAGMCYILVGVFGVTLAAVFMAFPATFITTLAGLALLGTIGASLATALADAKVREAALI
FT                   TFLAAAANITLLGIGGAFWGLVIGLLAYAVLNGRLPWSAQPGAIAAMEKG"
FT   gene            218574..219401
FT                   /locus_tag="CtCNB1_0190"
FT   CDS_pept        218574..219401
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0190"
FT                   /product="hypothetical conserved protein"
FT                   /note="COG0325, Predicted enzyme with a TIM-barrel fold"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ACY30936"
FT                   /db_xref="GOA:D0IWB8"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR011078"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:D0IWB8"
FT                   /protein_id="ACY30936.1"
FT                   /translation="MMPMTSETPTRHDQHGLYPEAGTVEDFRRNLATVQERIAAACQRV
FT                   GRDPASVRLLPVSKTKPQASLRLAYAAGCRLLGENKVQEAFGKWESMQDLADLRWSVIG
FT                   HLQTNKARLVARFASEFQALDSLRVAEALDRHLQAQGRSLDVFVQVNTSGEASKYGLSP
FT                   EAVPDFIQQLPVFSALRVRGLMTLALFSAETERVRRCFILLRELRDRLQQSAPAGIELD
FT                   ALSMGMSGDFEIAIEEGATVVRVGQAIFGARPLPDSYYWPTGSDPDTPESVSD"
FT   gene            219620..220819
FT                   /locus_tag="CtCNB1_0191"
FT   CDS_pept        219620..220819
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0191"
FT                   /product="acetylornithine and succinylornithine"
FT                   /note="COG4992, ArgD, Ornithine/acetylornithine
FT                   aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ACY30937"
FT                   /db_xref="GOA:D0IWB9"
FT                   /db_xref="InterPro:IPR004636"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D0IWB9"
FT                   /protein_id="ACY30937.1"
FT                   /translation="MPQTDSHLMRAYARQPVSFVRGRGASLWDEQGVEYLDAIAGVAVT
FT                   SLGHAHPEIAAVMAEQAATLLHTSNVFRIDWQEQLGVRLCALADMEKVFFCNSGAEANE
FT                   TALKLARLHGHRKQVAVPQILVMENAFHGRTLATLAATGNAAKQQGFEPQMPGFVRVPY
FT                   DDIDAVRRAAQEVPGIVAVLVEPVQGEGGIRVASPGYLRALRELCDSQGWLLMLDEIQT
FT                   GLGRTGAWFAHRHAGITPDVMTLAKALGNGVPIGACLARGSAANLFCPGQHGSTFGGNP
FT                   LACRVACAVLDIMERDGIAQRAAQLGERLLAGLRRALGGHPGVQAIRGLGLMAGIELNR
FT                   NCQELVGRALAEQRLLITVTRERTIRLLPPLICDEAQIDDIVVRVASLCQDSAPSRHAV
FT                   "
FT   gene            complement(221008..222114)
FT                   /locus_tag="CtCNB1_0192"
FT   CDS_pept        complement(221008..222114)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0192"
FT                   /product="alanine racemase"
FT                   /note="COG0787, Alr, Alanine racemase"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ACY30938"
FT                   /db_xref="GOA:A0A454XJD6"
FT                   /db_xref="InterPro:IPR000821"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR011079"
FT                   /db_xref="InterPro:IPR020622"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454XJD6"
FT                   /protein_id="ACY30938.1"
FT                   /translation="MPRPITATIHPEAVRHNLERVRQAVPDAKLWSVIKANAYGHGIEN
FT                   VFEGLRATDGFAMLDLDEAQRVRNLGWRGPILLLEGVFELRDLEICSRLGIWHAVHCDE
FT                   QIDWLAAHKTQVGHRVFLKMNSGMNRLGFTPERFRAAYARLNALPQVDEISFMTHFSDA
FT                   DVEHGLDHQLRVFHETTLDLPGERSVSNSAATLLHGDENNVRCDWVRPGIVLYGSSPDF
FT                   PTHDAAHWGLEPTMTLSSKIIGTQELHAGDTVGYGSRFQCDGPLRLGVVACGYADGYPR
FT                   VCPTGTPVLVDGVRTRTLGRVSMDMMAVDLSPVPKARLGSEVTLWGRASNGAVLPIDEV
FT                   AAAAGTLGYELMCAVAPRVPKQVEGAGK"
FT   gene            222248..223549
FT                   /locus_tag="CtCNB1_0193"
FT   CDS_pept        222248..223549
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0193"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="COG2814, AraJ, Arabinose efflux permease"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ACY30939"
FT                   /db_xref="GOA:D0IWC1"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D0IWC1"
FT                   /protein_id="ACY30939.1"
FT                   /translation="MKRGFYTIMSAQFFSSLADNALFVTAVELLRANGAPEWQRAALVP
FT                   MFALFYVVLAPFVGAFADALPKGRVMFISNAIKVMGCLMMLFGHHPLIAYAVIGLGAAA
FT                   YSPAKYGILTELLPASQLVKANGWIEGLTITSIILGVLVGGQLVGPTVSQHLLGFDFPY
FT                   FNTGVDTPAEAAIALLILIYVIAAWFNLHIPLTGVAMRPLREDPNKSLLANLLGLLPDF
FT                   WQCSKRLWADKLGQISLSTTTLFWGASGNLRYIVLAWGAAALGYSTTQASALVGVVAIG
FT                   TAVGAVLASMRMRLDNATRVIPLGVLMGLLVVCMIFIDNLWVAVPFLILLGGLGGFLVV
FT                   PMNALLQHRGHNLMGAGRSIAVQNFNEQLAILAMGGFYSLSTKMGLTAFGAITVFGLLV
FT                   AASMVLIGIWHWNNCRRHPAEVEKLLEVARRDCH"
FT   gene            223637..224521
FT                   /locus_tag="CtCNB1_0194"
FT   CDS_pept        223637..224521
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0194"
FT                   /product="hypothetical transmembrane protein"
FT                   /note="COG2962, RarD, Predicted permeases"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ACY30940"
FT                   /db_xref="GOA:D0IWC2"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:D0IWC2"
FT                   /protein_id="ACY30940.1"
FT                   /translation="MHSPLPVFALLLNALIWGLSWWPFRLMHEAGLHPLWATAAMYALV
FT                   LAGLLILRPASLRQAWQYPVLLLLAASSGLNNVAFNWAVTVGDVVRVILLFYLMPAWAV
FT                   LLAWKLLGEKPTPMALLRLLLAFGGVVLVLLPADASLSGLFAGLTLADALAVFGGFMFA
FT                   LTNVLLRRFQGIPAQARMLAMFAGCMSMGLLTALSASSAGMVPGFPAFDSSWAFLAVGL
FT                   AVVLMFGNWALQFGAARLPSGVTSVVMLSEVVFASISSVLIAHEQLSARTLAGGALIMG
FT                   AALLATLGRAPRK"
FT   gene            complement(224634..225149)
FT                   /locus_tag="CtCNB1_0195"
FT   CDS_pept        complement(224634..225149)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0195"
FT                   /product="AmiS/UreI transporter"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ACY30941"
FT                   /db_xref="GOA:A0A454XM11"
FT                   /db_xref="InterPro:IPR003211"
FT                   /db_xref="InterPro:IPR038523"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454XM11"
FT                   /protein_id="ACY30941.1"
FT                   /translation="MWLGLSLFYVGAVLFLNGLWMLGKIADKEIWVINIFTGVVSLCIG
FT                   LASIFGPAADAASVKSGALTLLFAFTYLWVAFNRFSGADGRGLGWFSLFVAITAVPVAL
FT                   DTLTSASSGLDWWMGVNWAAWAVLWALFFALLALRKSIERPTGWLCIAQGVLTGWVPGY
FT                   LILAGKLM"
FT   gene            complement(225274..226416)
FT                   /locus_tag="CtCNB1_0196"
FT   CDS_pept        complement(225274..226416)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0196"
FT                   /product="putative GAF sensor protein"
FT                   /note="COG3284, AcoR, Transcriptional activator of
FT                   acetoin/glycerolmetabolism"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ACY30942"
FT                   /db_xref="GOA:D0IWC4"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="UniProtKB/TrEMBL:D0IWC4"
FT                   /protein_id="ACY30942.1"
FT                   /translation="MDALQQCFSSTGAERALQARRQFFEAGIRPSGLVSEAVIQSWLRS
FT                   QRQHCNGRRLALAPVSPSRLHATQERCRGLLQALQHELPTLEQALAGTGTRVMLTDDKG
FT                   IVLHVSPASMRPRDERVGLNMSEQAMGTNAPGIVAATGQACTVTNGEHYFDELHAFRCA
FT                   AAPIRDVHGRLAGVLNLMVEEQHFSFDAGPVVGMYATTIENTLLQAQSHEHLVLRFQVT
FT                   PALLHTPLQALMGVAADGRVAWMNGTAAQLIGQPLDTACSAQELLGHDLSRLLQLSARP
FT                   GPVPLRLASGLGVWMQAQLQTSHGLGTHLDTSSAEDLACPVAPEATPVAEAQPLATLRE
FT                   HSAQLIRETLDQHGGNVSQAARALGISRGTLYRRLRGGRD"
FT   gene            226578..228704
FT                   /locus_tag="CtCNB1_0197"
FT   CDS_pept        226578..228704
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0197"
FT                   /product="Pyrrolo-quinoline quinone"
FT                   /note="COG4993, Gcd, Glucose dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ACY30943"
FT                   /db_xref="GOA:D0IWC5"
FT                   /db_xref="InterPro:IPR001479"
FT                   /db_xref="InterPro:IPR002372"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="InterPro:IPR017512"
FT                   /db_xref="InterPro:IPR018391"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:D0IWC5"
FT                   /protein_id="ACY30943.1"
FT                   /translation="MKRLIDNSHGWPGRMAWMLAASLGSAAALAQADPAAQAAAAVQRV
FT                   DGAFIRANAAKTTDWPTIGVDYAETRYSRLDQINAANVKDLGLAWSYNLESTRGVEATP
FT                   VVVDGIMYVSASWSVVHAIDTRTGNRIWTYDPQVDRSTGFKGCCDVVNRGVALWKGKVF
FT                   VGAWDGRLIALDAATGKEVWQKNTFEGQKGSLTITGAPRVFKGKVIIGNGGAEYGVRGY
FT                   ITAYDAETGEQKWRWFSVPGDPSKPFEDESMKRAARTWDPSGKWWEAGGGGTMWDSMTF
FT                   DAELNTMYVGTGNGSPWSHKVRSPKGGDNLYLASIVALDPDTGKYKWHYQETPGDNWDY
FT                   TSTQPMILADIKIAGKPRKVILHAPKNGFFFVLDRTNGKFISAKNFVPVNWASGYDKNG
FT                   KPMSIAAARDGSKPHDAVPGPYGAHNWHPMSFNPQTGLVYLPAQNVPVNLMDDKKWEFN
FT                   QAGPGKPQSGTGWNTAKFFNAEPPKSKPFGRLLAWDPVAQKAAWSVEHVSPWNGGTLTT
FT                   AGNVVFQGTADGRLVAYHAASGEKLWETPTGTGVVAAPSTYMVDGKQYVSVAVGWGGVY
FT                   GLAARATERQGPGTVYTFVVGGKARMPEFVAQRTGQLLQGVKYDPAKVEAGTMLYVANC
FT                   VFCHGVPGVDRGGNIPNLGYMDASYIENLPSFVFKGPAMARGMPDFTGKLSGDDVESIK
FT                   AFIQGTADAIRPKP"
FT   gene            228825..230255
FT                   /locus_tag="CtCNB1_0198"
FT   CDS_pept        228825..230255
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0198"
FT                   /product="aldehyde dehydrogenase"
FT                   /note="COG1012, PutA, NAD-dependent aldehyde
FT                   dehydrogenases"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ACY30944"
FT                   /db_xref="GOA:D0IWC6"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniProtKB/TrEMBL:D0IWC6"
FT                   /protein_id="ACY30944.1"
FT                   /translation="MQDHLQFYIDGQWVNPVSPRSLEVINPSNEQAIARISMGSAADVD
FT                   KAVAAARLAFESYSRTSREERLALLAKVLEVYQSRYGDFVQTISQEMGAPLWLSKAAQA
FT                   AMGVAHLSSTIEVLKNFAFEHVQGSTAVVHEPVGVVGMITPWNWPINQIMCKVAPALAA
FT                   GCTMVLKPSEVAPLNALLVAEVLHEAGVPAGVFNLVNGDGPGVGEAMSSHPGIDMMTFT
FT                   GSTRAGIAVAKAAADSVKRVAQELGGKSANIVLDDANLQKAVTQGVQAVLMNSGQSCNA
FT                   PTRMFVPRALHGQAVEIARSVAGAATVADALAEGMHMGPVVSEAQWGKIQALIRKGIEE
FT                   GATLVAGGTGRPEGLVQGYFVKPTVFADVSNDMSIAREEIFGPVLVMIPYDDEEDAIRM
FT                   ANDTVYGLSGYVQSGSLERARRVAARLRTGMVHLNGAGPDFNAPFGGYKQSGNGREWGE
FT                   HGFRDFLETKAVMGYGAA"
FT   gene            complement(230312..231118)
FT                   /locus_tag="CtCNB1_0199"
FT   CDS_pept        complement(230312..231118)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0199"
FT                   /product="conserved hypothetical protein"
FT                   /note="COG3109, ProQ, Activator of osmoprotectant
FT                   transporter ProP"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ACY30945"
FT                   /db_xref="GOA:D0IWC7"
FT                   /db_xref="InterPro:IPR016103"
FT                   /db_xref="InterPro:IPR023529"
FT                   /db_xref="InterPro:IPR036442"
FT                   /db_xref="UniProtKB/TrEMBL:D0IWC7"
FT                   /protein_id="ACY30945.1"
FT                   /translation="MQCWHDWGFCFPRPTGFAMTEIVSESQEQKASQAASQHSVQDSQP
FT                   GSRSRRGGRGRQNPAPAAKAAPQAARPQHPLLEQLAQWHPALFGEQLLPFKRGIFEDLL
FT                   AAHPELDKDALKSALQQHTRSGRYLAAMASGQQRHDLSGQPVEATLPEHVHHALIEVFR
FT                   RRQQRTQEDLTPKLRNRIVIAYEASGLTREEYAERVQGRDEKTNALVVDALAEADARAA
FT                   KDEALLRSFQLSGQTSEQEFAEMYGMNPRQVVQQLERARRRQQNIQ"
FT   gene            complement(231141..232394)
FT                   /locus_tag="CtCNB1_0200"
FT   CDS_pept        complement(231141..232394)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0200"
FT                   /product="heterodisulfide reductase"
FT                   /note="COG0247, GlpC, Fe-S oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ACY30946"
FT                   /db_xref="GOA:D0IWC8"
FT                   /db_xref="InterPro:IPR004017"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR012257"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:D0IWC8"
FT                   /protein_id="ACY30946.1"
FT                   /translation="MQTNLAPEYRATPEGQEAEAILRKCVHCGFCTATCPTYQTLGDEL
FT                   DGPRGRIYLIKQVLEGQTPTRATQLHLDRCLTCRNCESTCPSGVQYGHLVDIGRKIVDE
FT                   QVERPTGEKLQRWLLKEGMNSPLFAPALKLGRAVKGLLPESLGEKIPAAQEAGAWPSRE
FT                   HARKVLLLAGCVQPAMMPRINYATARVLDAVGVQTVIADKAGCCGAVKFHLNDQDGGKA
FT                   QMRANIDAWWPLVERGEVEAIVMNASGCGVTVKEYGHLLRLEPQYADKAARISALTRDL
FT                   SELLPDMLPELVDKLKDRITVPRAPVAYHPPCTLQHGQKLRGGVEAGLRELGFDLRVAR
FT                   TESHLCCGSAGTYSVLQPEISHQLRDRKIAALDEPFAPEKPAAILSANMGCIVHLQNGT
FT                   EVPVMHWVELLDQALAAG"
FT   gene            complement(232413..233561)
FT                   /locus_tag="CtCNB1_0201"
FT   CDS_pept        complement(232413..233561)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0201"
FT                   /product="FAD linked oxidase-like protein"
FT                   /note="COG0277, GlcD, FAD/FMN-containing dehydrogenases"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ACY30947"
FT                   /db_xref="GOA:D0IWC9"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:D0IWC9"
FT                   /protein_id="ACY30947.1"
FT                   /translation="MQAMDSATSQINQLGERIRAAASDKTPLRICGGGSKDFYGLRLQG
FT                   EPLSTRALSGIVSYEPSELVVTVRAGTPLAELEATLASQGQCLAFEPPHFGAASTVGGM
FT                   VAAGLSGPSRASVGAVRDFVLGLEMINGQGELLRYGGQVMKNVAGYDVSRLMTGSWGTL
FT                   GLITEISLKVLPVAPAEATLRFDACSQEQALDWLNHWGGQPLPLNASNWLEEDGKGTLY
FT                   LRLRGARAAVQAATLRLGGERLDSDVVAADWSASRDLSLPWFQQRAADHCLWRLSVPAT
FT                   TAPLQLPQGAAGPFIDWHGAQRWVQAPRSAATALQQLAQAAGGSASLFRAEDANQTSAN
FT                   SDLDVHAQASPAGRTSAQLHARLKQAFDPAGILNVNRLSAHW"
FT   gene            complement(233694..235046)
FT                   /locus_tag="CtCNB1_0202"
FT   CDS_pept        complement(233694..235046)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0202"
FT                   /product="ammonium transporter"
FT                   /note="COG0004, AmtB, Ammonia permease"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ACY30948"
FT                   /db_xref="GOA:D0IWD0"
FT                   /db_xref="InterPro:IPR001905"
FT                   /db_xref="InterPro:IPR002229"
FT                   /db_xref="InterPro:IPR018047"
FT                   /db_xref="InterPro:IPR024041"
FT                   /db_xref="InterPro:IPR029020"
FT                   /db_xref="UniProtKB/TrEMBL:D0IWD0"
FT                   /protein_id="ACY30948.1"
FT                   /translation="MIKKLLSAGLGLGLLAAGVTGFAQEAATAAAAAAPVAEAAAEAVP
FT                   TLSAGDTAWMLTSTMLVILMVIPGLALFYGGLVRSKNMLSVLAQVFVIFSLITVLWAIY
FT                   GYSLAFGGEGKFFAGFDKLFLMGITPDTLSSMLKTIPEYVFVAFQSTFAAITVALIVGA
FT                   FAERIKFAAVIVFSVLWFTFSYIPMAHMVWGGGLLGADGALDFAGGTVVHINAAVAGLV
FT                   GAYMLGKRIGFGKEALPPHSLTLTMVGASLLWVGWFGFNAGSAGAANGAAGLAFINTIL
FT                   ATGAAAISWIVAEALLRGKASMLGAASGAVAGLVTITPAAGFVGPMGSIVMGIIAGPLC
FT                   FWGVSGLKRLLKVDDVCDVFGVHGVGGILGAILTGVFCAKGLGGIEPEGYNMAHQLWVQ
FT                   VESVLVTIVWSGVVSFLAYKIADLTVGLRVSEESERQGLDITSHGEVAYTR"
FT   gene            complement(235086..235424)
FT                   /locus_tag="CtCNB1_0203"
FT   CDS_pept        complement(235086..235424)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0203"
FT                   /product="nitrogen regulatory protein P-II"
FT                   /note="COG0347, GlnK, Nitrogen regulatory protein PII"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ACY30949"
FT                   /db_xref="GOA:A0A454Y1F6"
FT                   /db_xref="InterPro:IPR002187"
FT                   /db_xref="InterPro:IPR002332"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="InterPro:IPR017918"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454Y1F6"
FT                   /protein_id="ACY30949.1"
FT                   /translation="MKMVIAIIKPFKLDEVREALSQIGVQGITVTEVKGFGRQKGHTEL
FT                   YRGAEYVVDFLPKLKIEAAIADDLVDAAIDAIEGAARTGKIGDGKIFVQALEQSIRIRT
FT                   GETGDAAL"
FT   gene            complement(235442..235948)
FT                   /locus_tag="CtCNB1_0204"
FT   CDS_pept        complement(235442..235948)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0204"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ACY30950"
FT                   /db_xref="InterPro:IPR010239"
FT                   /db_xref="UniProtKB/TrEMBL:D0IWD2"
FT                   /protein_id="ACY30950.1"
FT                   /translation="MDWLPGNSLETDFYGGYKFKAADVDWDVGMLTYVYSGNANGNTTE
FT                   IYGSGTYGPFTAKYSHTVSKDYFGWAGAKAGSGLKGRNTGYLQFSYSQEVMPKVTLKAS
FT                   VGYTHFSSDIKDLGVPNYVDYSVGGAYDLGDGFSAGAAVTGANKKAYFGDVNKARLILT
FT                   LSKTF"
FT   gene            complement(236571..237899)
FT                   /locus_tag="CtCNB1_0205"
FT   CDS_pept        complement(236571..237899)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0205"
FT                   /product="sulfatase"
FT                   /note="COG3119, AslA, Arylsulfatase A and related enzymes"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ACY30951"
FT                   /db_xref="GOA:D0IWD3"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR024607"
FT                   /db_xref="UniProtKB/TrEMBL:D0IWD3"
FT                   /protein_id="ACY30951.1"
FT                   /translation="MTDSRPNLIFILADDLGYADLGCTGARDAHNNATDVSPRLDAMAA
FT                   QGLRFTRGYSNSSVCSPTRFALATGRWQYRLRGAAEEPIASVHGDKVLGLPPDHPTVAS
FT                   LLRDAGYATALVGKWHLGYPPHFGPRLSGYEEFYGFHAGGADYFAHCDPRGRPDFWINE
FT                   EPHTEDGYLTDLLSRRAVDFVKRQSAEQPFYLSLHYSAPHWPWLTRDDLEESRRIGGFG
FT                   KHIDGGSIDTYQRMIHHMDEGIGWLLDALEENGLSENTLIVFTSDNGGERFSNTWPFVG
FT                   QKMDLLEGGIRVPLLARWPARMTAGAVCDTPSLTMDWSATFLAAAGVDAHADYPLDGIS
FT                   LLPLMQDQSWMPERDLAWRMKHREQKALIRDDWKYLQIEGIEYLFNIASDPRERANLRD
FT                   REPRKLAELRSAWEHWNQELPPIPEEAKVSLVFTKADLPQASF"
FT   gene            complement(238013..239005)
FT                   /locus_tag="CtCNB1_0206"
FT   CDS_pept        complement(238013..239005)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0206"
FT                   /product="TctC"
FT                   /note="COG3181, Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ACY30952"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:D0IWD4"
FT                   /protein_id="ACY30952.1"
FT                   /translation="MQRRIFGKLAAGLGLSAGLLGGGALQAQESHALFPSKTPLRIVVG
FT                   YPPGGATDRVARIVADRLQARLGSPVIVENKPGAGGRLSAQYVKNAPASQPAVLLANPA
FT                   VMVVAPLVFPDSGYEPEKDFRPISEVNRYEFGLAVASAVPVKELPHLLAWLKANPQQAN
FT                   FGVPATGSLPHFFALMLGETAKVPVEVVGYKGSGPLLTDLMGGQVPIAVDTLDTQIAQH
FT                   EAGKLRVLATSGERRSTMAPGIPTLKELGVNLVGTGWNTLFAPQSMAPATVQRLSQLVQ
FT                   EVMKEADTQHKFAASNLVPVVSSAQDTEKMLKAYRAQWAPVVQRSGFKP"
FT   gene            complement(239146..240117)
FT                   /locus_tag="CtCNB1_0207"
FT   CDS_pept        complement(239146..240117)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0207"
FT                   /product="conserved protein"
FT                   /note="COG3181, Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ACY30953"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:D0IWD5"
FT                   /protein_id="ACY30953.1"
FT                   /translation="MPCTRIARRTLAGLAAAALLTASHAADNWPAKPIRIIVPTPPAGP
FT                   SDIAVRPLAAAVQKALGQAVIVENRAGANGNIGAAEVARAPADGYTWLWAMDPVLTVNK
FT                   HIYKNIGYSSDAIVVLNAAARFSQTLICNPGLGFKSVKDMLEAAKSRELTYATGGAGSP
FT                   GHLVMESLLSSTGVKMVHVPYKGPAPAMQDLMGGQVNCGFLAAPTVLPQIQSGRVTALA
FT                   TSGRTRSPLLPTLPTIAESGYPDFDGTYWLLLAAPKGVPAEIQKRFLAAMDAAIRSPQQ
FT                   QERVKAVDIEMVGSSPEQAQARVREISDKWEALTRKINLKPD"
FT   gene            240210..240758
FT                   /locus_tag="CtCNB1_0208"
FT   CDS_pept        240210..240758
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0208"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="COG1846, MarR, Transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ACY30954"
FT                   /db_xref="GOA:D0IWD6"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D0IWD6"
FT                   /protein_id="ACY30954.1"
FT                   /translation="MTKAQRHPWRQPSELDDLFLYHLARLMSSAGTMVVRLCEGGFGIT
FT                   RREWRMIGLLATKGAMQPSQLAELAQLDRTRTSRTISTLIAKGLLHKQGMAGDGRQAMV
FT                   QLTDAGLALHTQLFPQIQAINQELLGDVSDAELEVLSQVFERVRTRAALMQEQGSFPKA
FT                   ERRRGRAAGKQPARDDAAG"
FT   gene            240843..242381
FT                   /locus_tag="CtCNB1_0209"
FT   CDS_pept        240843..242381
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0209"
FT                   /product="Mg chelatase, subunit ChlI"
FT                   /note="COG0606, Predicted ATPase with chaperone activity"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ACY30955"
FT                   /db_xref="InterPro:IPR000523"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004482"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR025158"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D0IWD7"
FT                   /protein_id="ACY30955.1"
FT                   /translation="MGLALVQSRALLGLQAPAVTVEVHLANGLPSFTLVGLADVEVKEA
FT                   RERVRAAIVNAGLEFPNNQRITVNLAPADLPKDSGRFDLPIALGILAASGQIDARRLAD
FT                   YEFAGELSLTGALRPVRGALATALALQRQQQRVRLVLPPDSALEAAFVPAIEVFGAAHL
FT                   LDVVRQFIAHDATLSEHGDGVEGWQRVHSRPAEASLPSLDLREVRGQMQAKRALEIAAA
FT                   GAHGVLMIGPPGSGKSMLAQRFAGLLPGMTDEEALEAAAIASLSGRFTPQLWRQRPFAA
FT                   PHHTASSIALVGGGSPPRPGEISYAHCGALFLDELPEFARSALEALREPLETGRITIVR
FT                   AVQRAEFPARFQLVAAMNPCPCGFWGSRARACRCSPDQVARYQARISGPLLDRIDLHVE
FT                   VAALSPEELLAAPEGESSAAVQQRVSAARDKALQRQGLPNHQLQGAQLDTHLQLEPEAL
FT                   TFAHKAAARLGWSARGTHRALKVARTIADLADSDAITQTHLAEALQYRRALMQP"
FT   gene            complement(242395..243324)
FT                   /locus_tag="CtCNB1_0210"
FT   CDS_pept        complement(242395..243324)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0210"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="COG0583, LysR, Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ACY30956"
FT                   /db_xref="GOA:D0IWD8"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D0IWD8"
FT                   /protein_id="ACY30956.1"
FT                   /translation="MQLKSLRMFEAVCESGSFGAAAQLLHTVQSNVTAHIKKLEDEAGV
FT                   QLLMRANPVFPTPAGRTLLESARQMLQSHDQVLAMLQARQFAAGQVKGALRIGSMETTA
FT                   ALRLPPLLAELRRQHPGIDLELDAQPSAALLMELAAGRIDCAFINGAAPQNELQSWPVF
FT                   REELVLVSGQPLTRFPTAAEFSSSVFLAFRQGCSYRQRIELLMASMGVTAIRIMELGML
FT                   DTILGCVAAGMGYALLSRSLVEAQQQRFGVHWMTLPGKSGQELAFVDTCFVTAAVQGWS
FT                   PALHAFAQVLGVNPQATRAQPVALALAA"
FT   gene            243436..244614
FT                   /locus_tag="CtCNB1_0211"
FT   CDS_pept        243436..244614
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0211"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="COG2814, AraJ, Arabinose efflux permease"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ACY30957"
FT                   /db_xref="GOA:D0IWD9"
FT                   /db_xref="InterPro:IPR010645"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D0IWD9"
FT                   /protein_id="ACY30957.1"
FT                   /translation="MIERKELPLLLTGFMATLSGVGLARFAYTALMPQMVHAGWFSGEQ
FT                   VAYLGAANLLGYLIGALVAAPLAERMGALRVLVICWVAVMLSFAGCSLPQPMALFFVWR
FT                   LVSGIAGAALMVLGPSVAMAAAAPQRRATLGPLMFCGIGVGALLAATLVPMFARSSLSA
FT                   VWWALTALSALALYSGRHAARQIPLHAPVAIQPTAVAASSTTPWSLAVILVLVAYACDA
FT                   FGFVPHTVFWVDYLDRELQLGGAYASTQWAFFGLGAMVGPLCAAYCATRWGWWGTTTGA
FT                   YALKAVAIGLPLAWAGFGGHALSGFLVGALSPGMAAITSGYLMQLIGPGQHKKMWGYAT
FT                   AAFALLQASSGYLMAFVYASSGSYRQLFVLGCAALGLGALLVASSRLARTAQ"
FT   gene            244670..245716
FT                   /locus_tag="CtCNB1_0212"
FT   CDS_pept        244670..245716
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0212"
FT                   /product="2-nitropropane dioxygenase, NPD"
FT                   /note="COG2070, Dioxygenases related to
FT                   2-nitropropanedioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ACY30958"
FT                   /db_xref="GOA:D0IWE0"
FT                   /db_xref="InterPro:IPR004136"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D0IWE0"
FT                   /protein_id="ACY30958.1"
FT                   /translation="MTGLGLQHPIIQAPMAGTSTPQLAAAVSNAYALGSVGIGAYGLEQ
FT                   ARQHIEQTRALTNRPFNVNLFCHRAPVADAEREAQWLRYLAPEFERYGASVPSGLRCIY
FT                   ESALGNERLQAMLLELRPAVVSFHFGLPEQGFVDALRAAGITTLACATSLDEARQIEQA
FT                   GVDVIVAQGMEAGGHRGAFVPEQDTLMGTLALVRLLARESRLPVVAAGGIMDGAGIAAA
FT                   LQLGACAVQMGTAFILCPESAASQAYRAELQGDSAQHTAITAAISGRPARGMFNRLHQL
FT                   GRDYAGALPAYPMVYDAGKALHQAASAQGSSDYAAHWAGQGAPLARAMPAAELVRTLAQ
FT                   ELEQAEHA"
FT   gene            complement(245848..247653)
FT                   /locus_tag="CtCNB1_0213"
FT   CDS_pept        complement(245848..247653)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0213"
FT                   /product="long-chain-fatty-acid--CoA ligase"
FT                   /note="COG0318, CaiC, Acyl-CoA synthetases
FT                   (AMP-forming)/AMP-acid ligasesII"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ACY30959"
FT                   /db_xref="GOA:D0IWE1"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:D0IWE1"
FT                   /protein_id="ACY30959.1"
FT                   /translation="MQAIDFLSDPQQVAPPRSLRIDLDDGSFVLRSPVALKPYARCVGE
FT                   WLERWARETPEAPALAERTPDGSGWRMLSWGELREAVGRTAQGLLDLDLPPGPVVILSD
FT                   NAIDHAVLMLAAMHVGRAACSLSSAYSRTARDFGRLRQMLQVLQPALIYASDARLYGPA
FT                   LAACETRAPCVFSAHAPHWPGGLDFGALMARPETVAVRTAYEAIAPDTHAKYLLTSGST
FT                   GTPKVVINTHRMLCANQQQMAQTWRFLEHEKPVLVDWLPWSHTFGGNHNLHLVLAHGGT
FT                   LYIDEGRPAPGLIEKTVRNLREVRPTLWFNVPRGFDMVLPLMEADNALAADMLSRLRLA
FT                   FYAAAALAPSTWKRLEAVAQRVRPGRPLWLTTSWGCTETSPAITSAHWQLDGAGCIGAP
FT                   LPGLELKFVPNGNKQEMRVKGVSVFPGYRDAPRETAAAFDEEGYYRIGDAGFVVDEQRP
FT                   ERGVIFNGRVAEDFKLSSGTWVSVGTLRVELVSRLAPWVQDIVIAGHDRDELGLLVFAT
FT                   PAGAAAPEALAQALRRVMHEQRDAGAGSSQSPGCALVLADPPDAEAGEITDKGYVNQRA
FT                   VLTRRADAVRRLFASKDASVIRCNS"
FT   gene            complement(247674..248621)
FT                   /locus_tag="CtCNB1_0214"
FT   CDS_pept        complement(247674..248621)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0214"
FT                   /product="3-hydroxyacyl-CoA dehydrogenase, NAD-binding
FT                   protein"
FT                   /note="COG1250, FadB, 3-hydroxyacyl-CoA dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ACY30960"
FT                   /db_xref="GOA:D0IWE2"
FT                   /db_xref="InterPro:IPR006108"
FT                   /db_xref="InterPro:IPR006176"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR022694"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D0IWE2"
FT                   /protein_id="ACY30960.1"
FT                   /translation="MSAAATVIRHVAVVGTGVIGASWAAFFLARGLDVTATDPAPGAEQ
FT                   RLREAVQRHWPTMQRMGLADGASLERLRFDAELERALDGCDFVQESGPERADFKADLYA
FT                   RMDAATPPQVLLASSSSGLPVSGMQARCKTPQRVVLGHPFNPPHLIPLVEVGGGDATSP
FT                   DSIQRAMDFYAALGKRPIHVRREIAGHIANRLQAALWREAFHLVEQGVASVSDIDTAIA
FT                   HGPGLRWALMGPFMNLHLSGGQGGMQHLLEHLGGPIESWWRDLGNPAMTEALKAHVVQG
FT                   VAEARGMRREEELERTRDELLTDLIRAKAQGSLF"
FT   gene            complement(248618..249826)
FT                   /locus_tag="CtCNB1_0215"
FT   CDS_pept        complement(248618..249826)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0215"
FT                   /product="putative substrate-binding periplasmic (pbp)"
FT                   /note="COG0683, LivK, ABC-type branched-chain amino acid
FT                   transportsystems"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ACY30961"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454Y7F0"
FT                   /protein_id="ACY30961.1"
FT                   /translation="MNFTCKALAGAVTLAGAATAAAQISDDVIRIGFISDMSGVYRDYD
FT                   GPAGAEAIRMAIADMGGAINGKKIELVAADHQNKADIAAAKARQWFDVERFDMLIGGVN
FT                   SGAAIAMAGVARDKRKPYFVVGSGASSLTNEQCSPYTVMYAYDTVAMARGTASAVLKSG
FT                   GKRWFFVTADYAFGNALQADAAKVLEAGSGNVAGAVKHPLGASDFSSFMLQALAAKPDV
FT                   LALANAGGDTVNAIKSAAEFGLAQKMKLAGMIITIQDVHALGLKTAQGMYLTDSWYWNQ
FT                   SPEASAWARRFFDKHKRMPTSFHAGDYSATLQYLKAVQAAGTDDGTKVMEQLRKTRFND
FT                   MFVKDGWLRADGLMVHDMHLMQVKTPAESREPWDYYKVVETIRGEAAWTTRAETRCAQW
FT                   KTS"
FT   gene            complement(249875..250813)
FT                   /locus_tag="CtCNB1_0216"
FT   CDS_pept        complement(249875..250813)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0216"
FT                   /product="hypothetical conserved protein"
FT                   /note="COG3246, Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ACY30962"
FT                   /db_xref="GOA:D0IWE4"
FT                   /db_xref="InterPro:IPR008567"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D0IWE4"
FT                   /protein_id="ACY30962.1"
FT                   /translation="MSKRKVIVTIAPTGGMAHKSQNPHLPTQPDEIAEDVVRCFNAGAS
FT                   VAAIHARRPDDGATCNADIYRDINTRIRAAGCDIVINNSTGGGVHGDMVRELQGGRWEI
FT                   AWEERIKGMDAGAEMCTLDATTLNLSFGGREILMDTPLSRGRELAVGMKARGIKPEWEV
FT                   FAHTHILQDVTTLIEEDHDAAPHFINLVMNVHRNFQNAMPFSPRYLQQMVDVLPANSIF
FT                   CVSGIGPSQLEANVAALLLGGHARVGLEDNLYYRQGELATNVQLTERIVRLIRELDMEP
FT                   ATPEEARQIMGLQRGGMPLPAFAPAAMAQAA"
FT   gene            251005..251649
FT                   /locus_tag="CtCNB1_0217"
FT   CDS_pept        251005..251649
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0217"
FT                   /product="transcriptional regulator, Crp/Fnr family"
FT                   /note="COG0664, Crp, cAMP-binding proteins - catabolite
FT                   gene activator andregulatory subunit of cAMP-dependent
FT                   protein kinases"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ACY30963"
FT                   /db_xref="GOA:D0IWE5"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR012318"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D0IWE5"
FT                   /protein_id="ACY30963.1"
FT                   /translation="MLDVAVRERVRAEMREVDLPAGTALCRMGDAPRHWYGAIEGLLKW
FT                   SVSSADGRSVTLGGLSVGSWFGEGTVLRGVARTADVIALRDSRVALMPAEVFEWLRGSE
FT                   RSFEAFLLRQINERMHWFLGNFAAHHLLDTDSQVARALVGLFHPWLHPGSDPRLRVSQE
FT                   EIANLSGLSRQRCNAALRRLAAAGQIEIEYGGITVIDLPRLRSRVLAAASF"
FT   gene            complement(251646..252575)
FT                   /locus_tag="CtCNB1_0218"
FT   CDS_pept        complement(251646..252575)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0218"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="COG0583, LysR, Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ACY30964"
FT                   /db_xref="GOA:D0IWE6"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D0IWE6"
FT                   /protein_id="ACY30964.1"
FT                   /translation="MQFDLKDLRLFVLIAQTGSLTRASEQSHLSLAATSARVKALEEQA
FT                   GMPLLIREARGVKLSAPGEAFLHHARAMLQHSQQLQADLQEYGAGLRGHVRVFANTTAV
FT                   TEFMPDILAAYLTQHPHISVDLQERPNAGIAADIRDGRADLGIVAGEVDTHGLRVLHFS
FT                   TDRLVLVTPDTARWADMSSVAFADVLHERFVGMHRGSTLQTFLERLSQQLGTTLKLRIQ
FT                   LSSFDSMCRMVAAGVGVAVVPETVAQRYRGLPRVCRVPLTDAWAVRPRYMLVREEQQVS
FT                   VQLQELMDAIAAYHEHGESNVTQSESGR"
FT   gene            252710..253723
FT                   /locus_tag="CtCNB1_0219"
FT   CDS_pept        252710..253723
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0219"
FT                   /product="Twin-arginine translocation pathway signal"
FT                   /note="COG3181, Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ACY30965"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:D0IWE7"
FT                   /protein_id="ACY30965.1"
FT                   /translation="MPVRSAPPSTPSVSRRSLCAGALLTLGLPTWAQTSYPARPIVLVV
FT                   PQAAGGTNDIVGRIVAQKLGEKLSVGTVVENRPGAGGNIGTQAVAKAARDGHTLLMTIS
FT                   SSQAINPALYKSPGFDPVGDFTPVSMIGAVPNVLLAHPSFPARTVPELLALARSKPGEL
FT                   QYASAGNGTLNHLLGEMLNQMAGVQLQHVPYKGVAPALNDVLGGQLPLLFGSLPSTLQY
FT                   IKSGKLRALAVSSAARSPLLPDVPSLGEFVPGYNGTLWIALFAPRGLPPAVMSRLREGM
FT                   QQAMADKDMRAQLQAQGVELAGTPERQVTPDELAAVLKQDIAKWAHIVKTSGATVN"
FT   gene            253746..254636
FT                   /locus_tag="CtCNB1_0220"
FT   CDS_pept        253746..254636
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0220"
FT                   /product="conserved hypothetical protein"
FT                   /note="COG3777, Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ACY30966"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="InterPro:IPR039569"
FT                   /db_xref="UniProtKB/TrEMBL:D0IWE8"
FT                   /protein_id="ACY30966.1"
FT                   /translation="MNPNTVQIDAATLTKLQSWQERSETMSDIITAAPLRALSATLDRD
FT                   DPVPEDGSAVPALWHWLYFLPHARQSEIGPDGHPRRGGFLPPVPLPRRMWAGGRLRWET
FT                   DNPLRLGQEVQRASTIRSVQHKTGRSGELLFVLVEHRFSNQDGLALTEEHDIVYRAAAR
FT                   PGDPVPPPQQPPLAGQAAWSRSIVPDDVLLFRYSALTFNGHRIHYDRRYVTQVEGYPGL
FT                   IVHGPLIATLLLDLLRRKLPGARVIAFDFKALRPTFDLHPFSVHGKPREDGRTIDLWAQ
FT                   DHDGFLTMQATATVS"
FT   gene            254699..255865
FT                   /locus_tag="CtCNB1_0221"
FT   CDS_pept        254699..255865
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0221"
FT                   /product="acyl-CoA dehydrogenase-like protein"
FT                   /note="COG1960, CaiA, Acyl-CoA dehydrogenases"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ACY30967"
FT                   /db_xref="GOA:D0IWE9"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:D0IWE9"
FT                   /protein_id="ACY30967.1"
FT                   /translation="MIEHTSSNNHHEIRDAIRALCAEFPDEYFRKIDEQRVYPEAFVNA
FT                   LTNAGWLAALIPQEYGGSGLGLTEASVIMEEINRCGGNSGACHGQMYNMGTLLRHGSQA
FT                   QKEKYLPRIASGEWRLQSMGVTEPTTGTDTTKIKTSAVKKDGRYVINGQKVWISRIQHS
FT                   DFMILLARTTPLAEVKKKSEGMSIFMVDLREAEKKGMTVRPILNMVNHETNELFFEDLE
FT                   IPEENLIGEEGKGFKYILDGLNAERTLIAAECIGDGYWFLDRVTNYVKDRQVFGRPIGQ
FT                   NQGVQFPIADAFIEVEAANLMRWKACELFDARESMGAQANMAKYLAAKASWEAANACIQ
FT                   FHGGFGFACEYDVERKFRETRLYQVAPISTNLIYSYVAEHLLGLPRSF"
FT   gene            255865..256062
FT                   /locus_tag="CtCNB1_0222"
FT   CDS_pept        255865..256062
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0222"
FT                   /product="hypothetical protein"
FT                   /note="COG1190, LysU, Lysyl-tRNA synthetase (class II)"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ACY30968"
FT                   /db_xref="UniProtKB/TrEMBL:D0IWF0"
FT                   /protein_id="ACY30968.1"
FT                   /translation="MCDTHLRRCAPSPRSRAVRGQGDDSLAAGRRGRPRPLLAVPGFER
FT                   VSCSGREFRQSAMDFQDEKA"
FT   gene            256109..257245
FT                   /locus_tag="CtCNB1_0223"
FT   CDS_pept        256109..257245
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0223"
FT                   /product="L-carnitine dehydratase/bile acid-inducible"
FT                   /note="COG1804, CaiB, Predicted acyl-CoA
FT                   transferases/carnitinedehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ACY30969"
FT                   /db_xref="GOA:D0IWF1"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="InterPro:IPR023606"
FT                   /db_xref="UniProtKB/TrEMBL:D0IWF1"
FT                   /protein_id="ACY30969.1"
FT                   /translation="MAAPFCTRQLADLGARVIKVERPGSGDFARGYDQRVNGQSSHFTW
FT                   INRSKQSLELDLKRPDALEALMQLLEGADVLVQNLAPGAAARMGLSWEVLNAHNPKLIV
FT                   CDISGYGADGPYRDKKAYDLLIQSEAGFLSVTGTPEVPSKAGISVADIAAGMYAYTNIL
FT                   SALLLRGRTGEGSHIDVSMLEALGEWMGYPMYYAWEGAPPPPRTGASHASIYPYGPFEA
FT                   GDGGTVMLGLQNEREWKLFCEQVLLQPALASDARFDSNAQRNANREELRALILDVFNAL
FT                   NAAQVVQRLDAAGIANARVNDMAGLWAHPQLAARQRWCCVGTPAGPVQALLPPGANSAF
FT                   DYRMEAVPSVGEHSEAILAELGWSAERIRALYAEEATL"
FT   gene            257280..258644
FT                   /locus_tag="CtCNB1_0224"
FT   CDS_pept        257280..258644
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0224"
FT                   /product="MmgE/PrpD"
FT                   /note="COG2079, PrpD, Uncharacterized protein involved in
FT                   propionatecatabolism"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ACY30970"
FT                   /db_xref="GOA:D0IWF2"
FT                   /db_xref="InterPro:IPR005656"
FT                   /db_xref="InterPro:IPR036148"
FT                   /db_xref="InterPro:IPR042183"
FT                   /db_xref="InterPro:IPR042188"
FT                   /db_xref="UniProtKB/TrEMBL:D0IWF2"
FT                   /protein_id="ACY30970.1"
FT                   /translation="MKNETQVSIHPLARFAATLCWEDVPLQVQRRAEDLWVDWFGSALA
FT                   GQNARPVQSITRFALSQGPAAGPCEILGSAATSSPLMAAQANAAASHVAEQDDVHNGSV
FT                   FHPAAVVFPPALAVAQSLGASGVELMQACVAGYEVGIRVGEFLGRSHYRIFHTTATAGT
FT                   LAAAAAVGRLLKLTPEQMQHAFGSAGTQSAGLWEFLRTGADSKQLHTAHAASAGLTAAF
FT                   LAQDGFTGAQDIFTGPQGLAAGMSTDADPARLSDGLGTRWATAETSFKWHASCRHTHPA
FT                   ADALLQVMQDHDLTPADLAQVTCHVHQGAIDVLGPVVRPSTVHQSKFSMGTVLALAARH
FT                   GHAGLTEFDRDYLAQETVALRDKVSMELDAEVDAAYPQRWIGKVSVQTTDGRLLKGRVD
FT                   EPKGDPGNTLSREEITAKALRLIAYGGHVPAEHAQAAVARLWQVAQWPRVRRLLD"
FT   gene            258736..259734
FT                   /locus_tag="CtCNB1_0225"
FT   CDS_pept        258736..259734
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0225"
FT                   /product="TctC"
FT                   /note="COG3181, Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ACY30971"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:D0IWF3"
FT                   /protein_id="ACY30971.1"
FT                   /translation="MQSTNPFRRRLVHAAAAACALAACAGAQASSWPEKPVVLVVPYSA
FT                   GGPTDVVARLLAIPMGQVLGQSVLVENTVGAGGTIAPARVAKAKADGYTILIHHMGMAT
FT                   APALYKKLSYDPLKDFEYIGQVLDVPMTLLSRKDFPASNFAELLDYVRKNQDKVSLANA
FT                   GIGAVSQLCGMLFMHQAGVKLTTVPYKGAGPAMNDLMGGQVDLLCDQTTQTVPVIKDGQ
FT                   RAKVFGVTTPQRLSSLPNIPTLDEQGLKGFDVKVWHGMYAPKGTPKEVVMAINKALNVA
FT                   IKDENVRKRIAELSSDLVSTEKATPEGLRTHLQAEVVRWNKVIKAAGVSAE"
FT   gene            259832..260629
FT                   /locus_tag="CtCNB1_0226"
FT   CDS_pept        259832..260629
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0226"
FT                   /product="HpcH/HpaI aldolase"
FT                   /note="COG2301, CitE, Citrate lyase beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ACY30972"
FT                   /db_xref="GOA:D0IWF4"
FT                   /db_xref="InterPro:IPR005000"
FT                   /db_xref="InterPro:IPR011206"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:D0IWF4"
FT                   /protein_id="ACY30972.1"
FT                   /translation="MDSGADMVIADWEDAVAPADKEGARQALAQAVEALEGAQRARLLV
FT                   RINAEGTPWHAEDLRALAQLVEMGVAGAVVSKAERAQTLHAVARAAGAQAALLPLIESV
FT                   AGLDAAAALAAAPQVVRLAFGHLDFQVDAGMACGLEEEELLPMRMALVLASRRAGIGAV
FT                   VDGVTVETRNPERLALDAARARRMGFGGKLCIHPAQVQPLHAVFDPAPAAVAHAQRLCQ
FT                   ALAEAGGGVCVLDGRMVDAPVLHMAQQTLARHARAQQRMHRKT"
FT   gene            260701..261558
FT                   /locus_tag="CtCNB1_0227"
FT   CDS_pept        260701..261558
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0227"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="COG1028, FabG, Dehydrogenases with different
FT                   specificities (related to short-chain alcohol
FT                   dehydrogenases)"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ACY30973"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D0IWF5"
FT                   /protein_id="ACY30973.1"
FT                   /translation="MNQALVCVVTGASRGVGRGVALALGASGATVYVTGRSVKEGDSPL
FT                   PGTVGRTAADVTAAGGHGIAVACDHGDDVQVAALFERVRREHGRLDILVNCAIAIPDAL
FT                   TVPGPFWQKPLEMTGLLDVGLRSTYVASHCAAGLLIAARGLVVNISSAGSRCYMHGPAY
FT                   GAGKAGTDKMSFDMAHDFKPAGVSVVSLWPGLVRTERSERVCAAEPDKYGDSFDSAETP
FT                   QFIGRVVLALHGDADCLEKRSGGVFYTAELASEYGVQDIDGAQPASPRAYFGAPPEFSP
FT                   VVVE"
FT   gene            261809..262069
FT                   /locus_tag="CtCNB1_0228"
FT   CDS_pept        261809..262069
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0228"
FT                   /product="hypothetical protein"
FT                   /note="COG0528, PyrH, Uridylate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ACY30974"
FT                   /db_xref="InterPro:IPR024267"
FT                   /db_xref="UniProtKB/TrEMBL:D0IWF6"
FT                   /protein_id="ACY30974.1"
FT                   /translation="MRLISARHISKQELAGFESKLRRILTSGQKLINSRGGLLKVEVLE
FT                   RVVSQEEQVTKLRVQVHYRDGSSRRERINLFQEQGVWKVQL"
FT   gene            262066..262656
FT                   /locus_tag="CtCNB1_0229"
FT   CDS_pept        262066..262656
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0229"
FT                   /product="hypothetical protein"
FT                   /note="COG3863, Uncharacterized distant relative of
FT                   cellwall-associated hydrolases"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ACY30975"
FT                   /db_xref="InterPro:IPR024453"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:D0IWF7"
FT                   /protein_id="ACY30975.1"
FT                   /translation="MIFRRLAIAAVMAVSACCAGLALATPQLPPQAAPGDLIFRRGTEN
FT                   VSQLVQAVDRGDFSHVGMLVGRPGQWLVLHATPSEREGQPDAVVLDSLDFFLGVQRAQA
FT                   FRLYQVAADPGARERAVAWAMAQQGKPFQLQGSGQGVYCTTLVWQAWLQSGVDLEVVFT
FT                   EVELPIFGGSYLLPGKLLRSSRLRPLTPLLSLR"
FT   gene            complement(262666..263436)
FT                   /locus_tag="CtCNB1_0230"
FT   CDS_pept        complement(262666..263436)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0230"
FT                   /product="high-affinity branched-chain amino acidtransport
FT                   ATP-binding protein livF"
FT                   /note="COG0410, LivF, ABC-type branched-chain amino acid
FT                   transportsystems"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ACY30976"
FT                   /db_xref="GOA:D0IWF8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D0IWF8"
FT                   /protein_id="ACY30976.1"
FT                   /translation="MNQMHSNQRLMDKGKSPKLLEVQNLDAWYGAAHILHQVSLAVGRG
FT                   EVVALMGRNGAGKSTTLKSIAALVPHREGSIRFMGEAIEKKASHQIAQRGLGYVPEDRR
FT                   IFTELTVLENLEVGKQKPRQWPDGSAMPHWTPEKLFALFPNLGEMPDRLGGRMSGGEQQ
FT                   MLSVARTLMGQPCLVLLDEPSEGVAPLIVEQMARTILELKAQGIGILLSEQNLPFAEVV
FT                   ADRAYVLEKGQIVHAASMAELASDKAARQQYLGV"
FT   gene            complement(263433..264194)
FT                   /locus_tag="CtCNB1_0231"
FT   CDS_pept        complement(263433..264194)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0231"
FT                   /product="high-affinity branched-chain amino acidtransport
FT                   ATP-binding protein livG"
FT                   /note="COG0411, LivG, ABC-type branched-chain amino acid
FT                   transportsystems"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ACY30977"
FT                   /db_xref="GOA:D0IWF9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032823"
FT                   /db_xref="UniProtKB/TrEMBL:D0IWF9"
FT                   /protein_id="ACY30977.1"
FT                   /translation="MNLLQVQNLSKAFGGVKAVQQVSFSLQAGELLALIGPNGAGKSTT
FT                   FNMVGGQLPPDSGQVLLNGRSITGLPPRAIWRKGVGRTFQIAQTFASLSVVENVQMALL
FT                   SADRRIFSWWPRAASHRRADALALLEQVGMAAQADRPCSALAYGDVKRVELAMALAHDP
FT                   LLLLMDEPTAGMAPGERVALMQLTRRIAQQRRMGVLFTEHSMDVVFGQADRVAVLVRGQ
FT                   LLAEGRPQAIRDDARVQQAYLGTGLVLEKQQ"
FT   gene            complement(264191..266116)
FT                   /locus_tag="CtCNB1_0232"
FT   CDS_pept        complement(264191..266116)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0232"
FT                   /product="High-affinity branched-chain amino acidtransport
FT                   system permease protein livM"
FT                   /note="COG0559, LivH, Branched-chain amino acid ABC-type
FT                   transport system"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ACY30978"
FT                   /db_xref="GOA:D0IWG0"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:D0IWG0"
FT                   /protein_id="ACY30978.1"
FT                   /translation="MSASGLLAQLLNGLASASSLFLVSVGLSLIFGVTRTINFAHGSFY
FT                   MLGAFIAYSSVDLLSPHIGFWPALLLAPLACGALGALTETLLLRRIYKAPELFQLLATF
FT                   ALVLVIKDAALWLWGPEELFGPRAAGLEGSVEILGRQFPTYDLFLIAVGPCVLLGLTLL
FT                   LTRTRFGTLVRAATQDREMVGALGVNQAWLFTAVFALGTLLAGLGGALQLPREPASLEM
FT                   DMLTIGAAFVVVVVGGMGSIPGAFIAALLVAELKAVCIWLGVQEIAGLELSFSKLTLVV
FT                   EFLVMAVVLIWRPWGLLGKPQALARSAGEPEQPLHPAGRGAAAAWLGLLTLLVLLPMMA
FT                   SGSEGGSYATVLLADIFVAALFASSLHFILGPGGLHSFGHAAYFGLGAYGAALLVRTLD
FT                   LPMEAALLLGPLAAAAGALLYGWFCVRLSGVYLTMLTLAFAQISWAIVFQWDDFTGGSN
FT                   GLTGVWPPEWASQGSTFYWLALGICALGIYLLRRLLFSPLGYALRASRDSALRADAIGI
FT                   DVRRIQWTAFVIAGLFAGLAGALFAFSKGGVAPDAMSVTKSVDALVMVLLGGVQTLAGP
FT                   VVGAAAFTWLHDTVARNTEYWRALMGATMLILVLLAPQGIAGYAQLLWSRTCGKVCGKD
FT                   KAGART"
FT   gene            complement(266211..267413)
FT                   /locus_tag="CtCNB1_0233"
FT   CDS_pept        complement(266211..267413)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0233"
FT                   /product="Leu/Ile/Val-binding protein"
FT                   /note="COG0683, LivK, ABC-type branched-chain amino acid
FT                   transportsystems"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ACY30979"
FT                   /db_xref="GOA:D0IWG1"
FT                   /db_xref="InterPro:IPR000709"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:D0IWG1"
FT                   /protein_id="ACY30979.1"
FT                   /translation="MQLRWSLPLLTLAALPAWAQGVIKIGEINSYKAQPAFLEPYKKGM
FT                   ELAVEQVNAAGGIAGKKLQLIVRDDNATPGDAVRAAEELYTREKIDVLTGSFLSHVGLA
FT                   LTDYAKQKKRFFLASEPLTDKIVWADGNHYTYRLRGSTYMQTAMLVEEALKLKKKRWAI
FT                   VYPNYEYGQSAVATFKTLMKAKQPDIEFVAEQAPALGKIDAGSVVQALADAKPDAIFNV
FT                   LFATDLGKFVREGNTRGLFKGREVVGLLTAEPEYLDPLKKEAPVGWTVTGYPWYSINTP
FT                   EHAAFLKAYQAKFKDYPRLGTIVGYNAIQSIAAGLRKTKGDPDTEKLIAAFKGLEVATP
FT                   FGPITYRAQDNQSTMGAYIGKTAYDEKLGRGVLINYHYADGKNYQPTDEEVKKLRPTTA
FT                   N"
FT   gene            267812..268585
FT                   /locus_tag="CtCNB1_0234"
FT   CDS_pept        267812..268585
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0234"
FT                   /product="FAD-binding oxidoreductase"
FT                   /note="COG1018, Hmp, Flavodoxin reductases
FT                   (ferredoxin-NADPH reductases)family 1"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ACY30980"
FT                   /db_xref="GOA:A0A454XI44"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR008333"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR033892"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454XI44"
FT                   /protein_id="ACY30980.1"
FT                   /translation="MSAFLEERVLSVHHWTDRLFSFTTTRDTSLRFSNGHFTMIGLKVD
FT                   GKNLLRAYSIASPNYEEHLEFLSIKVPEGPLTSKLQNIQVGDTIIVGKKPTGTLLIDYL
FT                   LPGKNLYLIGTGTGLAPWLAVARDPETYERFDNVVVVHGVRQVQELAYQELFEKELPEH
FT                   EFLGDIVKGKLHYYPTVTREPFRNQGRISAQINNGTFPQNLGLPDLNPETDRVMLCGSP
FT                   AMLSELKELLEKRGFKEGNTTTPGDFVIERAFVEK"
FT   gene            complement(268691..269671)
FT                   /locus_tag="CtCNB1_0235"
FT   CDS_pept        complement(268691..269671)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0235"
FT                   /product="ribonuclease BN"
FT                   /note="COG1295, Rbn, Predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ACY30981"
FT                   /db_xref="GOA:A0A454Y6U3"
FT                   /db_xref="InterPro:IPR017039"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454Y6U3"
FT                   /protein_id="ACY30981.1"
FT                   /translation="MAFDTSGWQHKLRRLAHPLQPLIDSVQLWLQADGLRMSAAMSFYG
FT                   MLSLAPLLLAVVGLLGWWLDRSYVESTLISQIQSVVGERAAQVVKSALASAQNANQGSL
FT                   ASVLGLVMMLSGATGVFVELQASLDKLWSMGEESRPQENKPWWSMAISRLWGLSYVVGL
FT                   GFLLLVSMVLSTAIQMITKWANDELQLVPLGPLMGLINEGLSFGIAVLLFWGLMRMGTG
FT                   IKPVTRYLLLGSLTGAALFTIGKQALAWYLSTAAVVSAYGAAGSLVVVLMWFYFTSAIL
FT                   LFSAATAKACSKSKVQLGIPFVSRKPSSATPMDVQRLPENAGENI"
FT   gene            270075..271574
FT                   /locus_tag="CtCNB1_0236"
FT   CDS_pept        270075..271574
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0236"
FT                   /product="acetyl-CoA hydrolase/transferase"
FT                   /note="COG0427, ACH1, Acetyl-CoA hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ACY30982"
FT                   /db_xref="GOA:D0IWG4"
FT                   /db_xref="InterPro:IPR003702"
FT                   /db_xref="InterPro:IPR017821"
FT                   /db_xref="InterPro:IPR026888"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="InterPro:IPR038460"
FT                   /db_xref="UniProtKB/TrEMBL:D0IWG4"
FT                   /protein_id="ACY30982.1"
FT                   /translation="MLCPVLRECIMTADQAAGLIQSGMTLGMSGFTPAGAPKAVPQALA
FT                   RRIEERNANGGNFRISLWTGASTSPELDGALAKVHGIERRLPYQSDPTVRKEINEGRMQ
FT                   YVDIHLSHVAQHVWFGFLGHLDVAVIEVAGVLPDGRLIPSTSVGNNKTWLEQADKIILE
FT                   VNSAQPAELEGMHDIYYGAAVPPKRKPIPMEHPFDRIGEPYLHCDPSKVIAVVPTAQRD
FT                   RLAAFTAPDEGSMRIAENIIDFLQHEVKAGRLPPELLPLQSGVGNIANAVLAGLNKGPF
FT                   DHLNAYTEVLQDGMLDMLESGKLDTASTTSLALSPAAMERFLANIDYYRQRIMLRPQEI
FT                   SNHPELIRRMGLISMNALIEADMYGNVNSTHVMGSSIMNGIGGSGDFARNAYLSIFMTP
FT                   STAKDGKISCIVPMVSHVDHTEHDVQVIVTEQGLADLRGLAPVQRARLIIEKCVHPDYK
FT                   AAMSEYLERALRDAPGKHTPHLLDQAYDWHQRYLKTGSMQA"
FT   gene            complement(271703..273268)
FT                   /locus_tag="CtCNB1_0237"
FT   CDS_pept        complement(271703..273268)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0237"
FT                   /product="D-galactarate dehydratase/Altronate"
FT                   /note="COG2721, UxaA, Altronate dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ACY30983"
FT                   /db_xref="GOA:D0IWG5"
FT                   /db_xref="InterPro:IPR007392"
FT                   /db_xref="InterPro:IPR013974"
FT                   /db_xref="InterPro:IPR017654"
FT                   /db_xref="UniProtKB/TrEMBL:D0IWG5"
FT                   /protein_id="ACY30983.1"
FT                   /translation="MSTPAPLSITMHPADNVAIVANDGGLPAGTVLPSGLVLADQVPQA
FT                   HKVALVDIPEGGEVRRYNVIIGYALKPIAAGSWVYERLLQMPEARSLEGLPIATVKPPV
FT                   LEPLTGYSFEGYRNADGTVGTRNILAITTTVQCVAGVLDFAVRRIKSELLPRYPHVDDV
FT                   VGLEHSYGCGVAIDAVGAEIPQRTLRNISRNPNFGGEVMVVSLGCEKLQPERLLPPGSF
FT                   PIVDEREPALDVVCLQDEAHVGFMSMIDSIMRQAEQHLRRLDARRRETVPASALVVGVQ
FT                   CGGSDAFSGVTANPAVGFCTDLLVRAGATVMFSEVTEVRDGIDQLTSRAASPEVAEAMI
FT                   EEMAWYDAYLDKGRVDRSANTTPGNKKGGLSNIVEKAMGSIIKSGTAPITGVLSPGQRL
FT                   ADRDISQGLVYAATPASDFICGTLQLAAGMNLHVFTTGRGTPYGLAQVPVIKVATRSDL
FT                   ARRWHDLMDINAGRIADGEATIEDIGWEMFRLMLDVASGRKKTWAEHWQLHNALVLFNP
FT                   APVT"
FT   gene            complement(273453..274451)
FT                   /locus_tag="CtCNB1_0238"
FT   CDS_pept        complement(273453..274451)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0238"
FT                   /product="TctC"
FT                   /note="COG3181, Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ACY30984"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:D0IWG6"
FT                   /protein_id="ACY30984.1"
FT                   /translation="MQRRTLIQHSLASALLLGTALAAMPAAAQGNWPTGKPITYLVPFP
FT                   PGGNTDTLARVIAQPLSKALGTPVVIENKGGAGGSVGSALAARAPADGYTILGGTISSH
FT                   AINVSLYSKLDYDPVKSFTPVAMLGSGPLVLVVPASSPYKTLADVLAGSKAKASSGGLT
FT                   SASPGNGTSNHMALELLAYQTGVKFTHVPYKGSGPAVQDVMGGQVDMMFDTALVVGPHI
FT                   QSGKLRPIAVSSSKRLESLPDVPTIAEAGEKGFDMGSWQAVFAPAGTPKPIVDRLHAEI
FT                   LKIVATPEVQARLKNFGMLPSNMSTVELADYQKAEVSKWAKVIKSAGIKAE"
FT   gene            complement(274502..275797)
FT                   /locus_tag="CtCNB1_0239"
FT   CDS_pept        complement(274502..275797)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0239"
FT                   /product="Mandelate racemase/muconate lactonizing"
FT                   /note="COG4948, L-alanine-DL-glutamate epimerase and
FT                   related enzymes of enolase superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ACY30985"
FT                   /db_xref="InterPro:IPR013341"
FT                   /db_xref="InterPro:IPR013342"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR029065"
FT                   /db_xref="InterPro:IPR034593"
FT                   /db_xref="InterPro:IPR034598"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/TrEMBL:D0IWG7"
FT                   /protein_id="ACY30985.1"
FT                   /translation="MSTSHQIRHIRITPIAFRDPPLLNAAGIHEPWALRSIIEIETASG
FT                   LVGINESYGDQPMLDALAKAAPALVGLSPWALNEMEARVAALVTPPRLTASEFLGQQVS
FT                   LAPGTHVSKTVAKVVSAFEVAMLDLQGQMARAPIVDLLGGAARDRVPYSAYLFYKYAEH
FT                   VGQPYAPDAWGEALTPAQLVTQARRMIDQYGFQSIKLKAGTLPPEQEAAGILALAEAFP
FT                   GTPLRIDPNGNWTVETSLKIVQQLRGVLEYYEDPAPGLDGMAAVARECDVPLATNMVVT
FT                   DFAEFRRNADMGCPVKIVLSDHHYWGGLRATQRLSTLCRTFDLGLSMHSNSHLGVSLVA
FT                   MTHLCASVPLLTYACDTHYPWQDEEVVEGGRLQFEQGSLRVPTTPGLGVSLDREALARL
FT                   HDNYLHCGIRNRDDLGQMRKYDPAFTGHQPRF"
FT   gene            275941..276696
FT                   /locus_tag="CtCNB1_0240"
FT   CDS_pept        275941..276696
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0240"
FT                   /product="GntR-like protein"
FT                   /note="COG2186, FadR, Transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ACY30986"
FT                   /db_xref="GOA:D0IWG8"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D0IWG8"
FT                   /protein_id="ACY30986.1"
FT                   /translation="MPLTEGYALRSKTSKGSRSLANLLSEEFEHKIRQGLLHEGDKLPT
FT                   ESELVRSYDVSRTVVREALSKLQAAGLVETRHGIGTFVLPARQSASPMLSARELSESVD
FT                   VLAVLELRISLETEAAGLAAQRRSEVHLKVMSEALQEFEHHFALGHDTVEHDLAFHLSI
FT                   AQATGNRYFQDILQHFGTLLIPRNRIASMHTPARDPDYLRRVNREHEEIYAAIVRQDAD
FT                   SARAAMRIHLTNSRERLRLAQRLSLSAES"
FT   gene            277000..277977
FT                   /locus_tag="CtCNB1_0241"
FT   CDS_pept        277000..277977
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0241"
FT                   /product="conserved protein"
FT                   /note="COG3181, Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ACY30987"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:D0IWG9"
FT                   /protein_id="ACY30987.1"
FT                   /translation="MVRRTHFLRSLLALAAGGLLSSTLLAADAWPSKPIRLVVPYPPGG
FT                   SSDIIARSIGQLISQELKQTVVIDNKPGANGNLGAEFVARAPADGYTWLLCDLGALAIS
FT                   PSIYTKLSFDPSKALRGAAMLAYSPHMLVVHPSVQASNLKELVELSKKQDLNFAVTASG
FT                   SAPHLAGVELARITGAKWVYVPYKGGVQSVQDTVAGQTQVLMNGMLATYPHVQSGKLKL
FT                   LGISKNTRMPLIADVPTLAEQGAQGFASGTWQGVVLPAKTPEAVVQRVNQVLLAAIRST
FT                   EVRSRLTGQGAEVVTMTPAETDKFFNAERARWRAVVQAAQLQLD"
FT   gene            278020..278931
FT                   /locus_tag="CtCNB1_0242"
FT   CDS_pept        278020..278931
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0242"
FT                   /product="dihydrodipicolinate synthetase"
FT                   /note="COG0329, DapA, Dihydrodipicolinate
FT                   synthase/N-acetylneuraminatelyase"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ACY30988"
FT                   /db_xref="GOA:D0IWH0"
FT                   /db_xref="InterPro:IPR002220"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017655"
FT                   /db_xref="UniProtKB/TrEMBL:D0IWH0"
FT                   /protein_id="ACY30988.1"
FT                   /translation="MTPQDLKDVMSSGLLSFPVTDFDAQGNFNAKGYAARLEWLAPYGA
FT                   SALFAAGGTGEYFSLYGEEYGQIIKTAVDTCRGKVPIIAGAGGPTRNAIAHAQEAERLG
FT                   AHGILLMPHYLTEAGQEGLIAHVEQVCKSVKFGVIVYNRDRSRFTPESLAILAERCPNL
FT                   VGFKDGLGNIETMSSIFMKMGDRFAYLGGLPTAEVYAAAYKALGTPVYSSAVFNFIPRT
FT                   AMQFYEAVRSDDQATQHKLLKEFFMPYLKIRNRVEGYGVSIIKAGAKLVGHDAGPVRAP
FT                   LTDLKPAEMEELKVLIDKLGPQ"
FT   gene            278988..279947
FT                   /locus_tag="CtCNB1_0243"
FT   CDS_pept        278988..279947
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0243"
FT                   /product="TctC"
FT                   /note="COG3181, Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ACY30989"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:D0IWH1"
FT                   /protein_id="ACY30989.1"
FT                   /translation="MKKILITLGATLALAAQAASSFPDKPVNIIVPFPAGGSTDTVARA
FT                   LALSMGEQLGKPFVVENRPGATGTIGAGAVKRAAADGYTLLVASLGPFVVTPHMVKNVP
FT                   YDAGKDFDYITIPVQAPNVLVASPTQKARSVSEVIAALKANPGKISFASSGNGSSDHLS
FT                   AELFWQQTGTEAVHVPYKGGAPAITDLLGGQVDFSFQNVNAVLSHLRSGKLRAIAVTGT
FT                   QRSPVLPDVPTLAESGVKGAEVYSWQGMAAPKGLPVDVKARLSKAAIAAVQQPDIRKRF
FT                   VEQGLEIVGNTPEEFTRFQAQENERWKQLIHTRKITAD"
FT   gene            280055..281011
FT                   /locus_tag="CtCNB1_0244"
FT   CDS_pept        280055..281011
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0244"
FT                   /product="D-isomer specific 2-hydroxyacid dehydrogenase"
FT                   /note="COG1052, LdhA, Lactate dehydrogenase and related
FT                   dehydrogenases"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ACY30990"
FT                   /db_xref="GOA:D0IWH2"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D0IWH2"
FT                   /protein_id="ACY30990.1"
FT                   /translation="MATIRPRVLQYGQMPLAQLDAELAQAYDVHILSQEADPDRFLAEH
FT                   GAQFEYLVTSAAMGLPARVVDALPKLKFVSSFGVGFDALDKDALLRRGARVGYTPGVLD
FT                   DCVADLAFALLLDATRGLSESDRFVRRGDWSRGRFGIRTRASGKRLGIFGMGRIGSTVA
FT                   RRASGFDMEVAYHNRRSVEGSSHQYLPSLLELARWADILVITAAGGEGTRHLVNAEVLA
FT                   ALGPQGFLVNVARGSVVDEAALADALENKRIAGAGLDVFEDEPRPLPALDNVVLAPHIA
FT                   SGTHETRRAMADLVLLNLQQFIATGRPAAEVPWSAAQ"
FT   gene            281049..282386
FT                   /locus_tag="CtCNB1_0245"
FT   CDS_pept        281049..282386
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0245"
FT                   /product="glucarate dehydratase"
FT                   /note="COG4948, L-alanine-DL-glutamate epimerase and
FT                   related enzymes of enolase superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ACY30991"
FT                   /db_xref="InterPro:IPR013341"
FT                   /db_xref="InterPro:IPR013342"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR029065"
FT                   /db_xref="InterPro:IPR034593"
FT                   /db_xref="InterPro:IPR034598"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/TrEMBL:D0IWH3"
FT                   /protein_id="ACY30991.1"
FT                   /translation="MSTTPTITAIEVIPVAGRDGMLMNLSGAHAPYFTRNIVLVHDSAG
FT                   RTGVGEVPGGEGIRQALEDGRQVLIGRSIGQHLQLLQELQKSLEGRDTGGRGLQTFDLR
FT                   IGVHAVTAIESALLDLLGQHLGVPVAALLGEGQQRDRVEMLGYLFFVGPSDKTGLDYVK
FT                   PGEDKLGTDDWTQVRHMTAMTPETIVRQAEAAYARYGFNDFKLKGGVLAGEQEVEAVTA
FT                   LAKRFPEARVTLDPNGGWLLKDAIRLMRDMRGVLAYAEDPCGAEGGFSGREVMAEFRRA
FT                   TGLPTATNMVATDWRQMVHALSLQSVDIPLADPHFWTMAGSVRVGQTCRDWGLTWGSHS
FT                   NNHFDISLAMFTHVAAAVPGKVTAIDTHWIWQDGQYLTQQPLQIKGGFVEVPKTPGLGV
FT                   TVDREALKRANALYLEHGLGARDDAIAMQHLIPGWKFDNKRPCMVR"
FT   gene            282536..283984
FT                   /locus_tag="CtCNB1_0246"
FT   CDS_pept        282536..283984
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0246"
FT                   /product="aldehyde dehydrogenase"
FT                   /note="COG1012, PutA, NAD-dependent aldehyde
FT                   dehydrogenases"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ACY30992"
FT                   /db_xref="GOA:D0IWH4"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:D0IWH4"
FT                   /protein_id="ACY30992.1"
FT                   /translation="MSRYDNLINGQWTAADSYSPNTNPSDLSDVIGEYAQGGASDVQAA
FT                   VSAAAAAFPAWSTSGIQARSDALDKIGTEILARKAELGELLAREEGKTLPEAIGEVGRA
FT                   GQIFKFFAGECLRLSGETLPSVRPGIGVEITREPIGVVGLITPWNFPIAIPAWKIAPAL
FT                   AFGNCVVLKPADLVPGSAWALADIIHRSGIPAGVFNLVMGRGRVIGEALVNHADVAAIS
FT                   FTGSVGVGRGIAEACVKSGKKVQLEMGGKNPQIVLDDADLAQAVELSAQSGFYSTGQRC
FT                   TASSRLIVTDKIYPAFIEALQARMARILVGDARAAGTDMGPVVSQAQLEQDLSYVEIAK
FT                   AEGARLAAGGARVACHTGSGKQGYYMAPTLFVDTEAGMRINREEVFGPVASVIRVKDYE
FT                   EALAVSNDTPFGLSAGIATTSLKHATHFKRHSQAGMVMVNLPTAGVDYHVPFGGRKGSS
FT                   YGPREQGRYAQEFYTTVKTAYTLA"
FT   gene            284137..285000
FT                   /locus_tag="CtCNB1_0247"
FT   CDS_pept        284137..285000
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0247"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="COG0583, LysR, Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ACY30993"
FT                   /db_xref="GOA:D0IWH5"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D0IWH5"
FT                   /protein_id="ACY30993.1"
FT                   /translation="MRAFRRIVELGSIARAADALDLSSAALSKQLRALEAQLGAVLIQR
FT                   TTRRMSLTDTGRAYYAECCRLLDGFDTLEQSVRAQSLQVTGRLRVNAPLSFALSTLAPL
FT                   LARFMQRHPQLQIDLSMEDRLVDAVGQGFDVSIRLSAELADSSLIARRLASLSQMLCAS
FT                   PAYLQQHGRPASVAVLRGHALLNYSLAQVDDGLQVPSEARASVNNSLMLRELLVAGMGI
FT                   GALPSFLARPAIAQGQLEALALQDWAEPPRHVYVVYPTQRHLLPKVRAFVDFLAEELPA
FT                   AMGGDS"
FT   gene            285093..285803
FT                   /locus_tag="CtCNB1_0248"
FT   CDS_pept        285093..285803
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0248"
FT                   /product="DSBA oxidoreductase"
FT                   /note="COG2761, FrnE, Predicted dithiol-disulfide isomerase
FT                   involved in polyketide biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ACY30994"
FT                   /db_xref="GOA:D0IWH6"
FT                   /db_xref="InterPro:IPR001853"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:D0IWH6"
FT                   /protein_id="ACY30994.1"
FT                   /translation="MTQCHDFFCALPAQAAAHPAPDPVLPAAAQAAPTIDFFHDVVCGW
FT                   CYVMSPRLRQVAGELGLRVRQRSFVLQASRAEMVARFGSMEQAKQTILGHWAACARHDD
FT                   TQRIDIEGMRREAFEYPSGLAGALACQAAQILEGDEAHWNLFDAIQHAHMSAHRNIGDA
FT                   EVLLDIATHTGFERNAFARCMESAAAMDLVQEDLALARRLGLRSIPTLIAQGLPPLQTQ
FT                   PLNMLRERLRVLLG"
FT   gene            285864..286892
FT                   /locus_tag="CtCNB1_0249"
FT   CDS_pept        285864..286892
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0249"
FT                   /product="putative cyclase"
FT                   /note="COG1878, Predicted metal-dependent hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ACY30995"
FT                   /db_xref="GOA:D0IWH7"
FT                   /db_xref="InterPro:IPR007325"
FT                   /db_xref="InterPro:IPR037175"
FT                   /db_xref="UniProtKB/TrEMBL:D0IWH7"
FT                   /protein_id="ACY30995.1"
FT                   /translation="MNFSFRARVRRLPTLLLVMAAAFSGLTHAHGGHTLPAGAGQDVGT
FT                   SPWGPGDEIGRLNLITPASRAAILQRIAGGQVYDLATEYYVGMPSWQDAGDPHYQFWMT
FT                   HTPRGTVVDDPMNVGKNMNATRSYTGTAFSMYSHTGTHIDALNHFGIRGRIWNGFSADE
FT                   HLGDRGWQRTGIEKFPPLVARGVLIDVAAAKGLDMLPDQYRITRQDLKDALARQNVTLQ
FT                   KGDVVLIRTGRMKLYEQPQAYMAKPPGLGLDAARFLAEDAGAMIVGADNLSLETFPSEV
FT                   DDDYVPLHSYLLAQQGIPIMELVALDGLSRDKVYEFAFIGGPLKIRGGDAAPLRPIAIP
FT                   VR"
FT   gene            complement(286929..287615)
FT                   /locus_tag="CtCNB1_0250"
FT   CDS_pept        complement(286929..287615)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0250"
FT                   /product="LrgB-like protein"
FT                   /note="COG1346, LrgB, Putative effector of murein
FT                   hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ACY30996"
FT                   /db_xref="GOA:D0IWH8"
FT                   /db_xref="InterPro:IPR007300"
FT                   /db_xref="UniProtKB/TrEMBL:D0IWH8"
FT                   /protein_id="ACY30996.1"
FT                   /translation="MKSSALLSLLATVACYWVNKRLYRKHPHPLLMPIVATPMVLIGLS
FT                   LLTHVSYPQYIAQTHWLVWLLGPTTVAFALPLYENRKLLRKHWMSIATGVVVASLVSIS
FT                   TTIAFADMFGLSEALQKGLAVRSITTPFAIEAEKVLGGPTDLAALFVLLTGVSAMLLGE
FT                   TVLRVLPRIRSKLATGASWGGAAHGSGVARARQAGEVQAVMASLVMMIAGAVNVLAAPW
FT                   VRTLFF"
FT   gene            complement(287629..288165)
FT                   /locus_tag="CtCNB1_0251"
FT   CDS_pept        complement(287629..288165)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0251"
FT                   /product="LrgA"
FT                   /note="COG1380, Putative effector of murein hydrolase LrgA"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ACY30997"
FT                   /db_xref="GOA:D0IWH9"
FT                   /db_xref="InterPro:IPR005538"
FT                   /db_xref="UniProtKB/TrEMBL:D0IWH9"
FT                   /protein_id="ACY30997.1"
FT                   /translation="MEKMKISHFMNIGENPRISPMSQITEAAAPRAQGCSHSFAQTLWQ
FT                   LLKAMLQVCLLSAIWIAMDVLRQHFGWSMPAGLIGFGLLAVGLFSGLVKARWLQSGTNW
FT                   LLAEMLLFFVPAMLVVTEYPDLIRHQGLRILAVIVASTACVMAVTALAVDRVYRFELWL
FT                   ARRKSSRDAAALDEE"
FT   gene            288183..289097
FT                   /locus_tag="CtCNB1_0252"
FT   CDS_pept        288183..289097
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0252"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="COG0583, LysR, Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ACY30998"
FT                   /db_xref="GOA:D0IWI0"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D0IWI0"
FT                   /protein_id="ACY30998.1"
FT                   /translation="MDLRALRYFIEVVRQNGFTRAAETLHVTQPTISKMVKALEDEFGG
FT                   RLLLREGRGVQLTDAGQVVYDRGMEILEQAQLLRRQVAEVDHITRGDLSLGIMPTTGHY
FT                   MAPVIALFQQRYPGVNLQVNEQGARAQYQLIQEGKLDMALGLFAAPDPALERYTVARQK
FT                   TRVVLPAQQVTDPGQPMRWSDLRELPFVLYTSDFALHEHVLQQCEAAGFTPQVKLQTRY
FT                   WDFIGHLVAAQVGVAVMFEHVIARYDPQRVASRPLVEPEIPWDVALMWRPGYLSRAAQA
FT                   WLNCVREVYPQPLLGAAFPDFQN"
FT   gene            289147..289818
FT                   /locus_tag="CtCNB1_0253"
FT   CDS_pept        289147..289818
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0253"
FT                   /product="Pseudouridine synthase, Rsu"
FT                   /note="COG1187, RsuA, 16S rRNA uridine-516 pseudouridylate
FT                   synthase andrelated pseudouridylate synthases"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ACY30999"
FT                   /db_xref="GOA:D0IWI1"
FT                   /db_xref="InterPro:IPR000748"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR018496"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR042092"
FT                   /db_xref="UniProtKB/TrEMBL:D0IWI1"
FT                   /protein_id="ACY30999.1"
FT                   /translation="MPVQVFVAKLAAMPRPFSSNRSSNLRRSTVVRQPAPRPGVTRLLC
FT                   FHKPYGVLSQFTPEGKWQGLKDWIDVPGVYVAGRLDADSEGLLLLTNDGQLQARIADPR
FT                   HKMEKTYWVQVEGIPDEAALQRLREGVELSDGKTLPAKARLIEPQPLMWPRNPPIRVRQ
FT                   NIPDCWIELIIREGRNRQVRRMTAAVGHPTLRLVRMAVGPYSIEGLEPGQWLDVLPLSG
FT                   S"
FT   gene            complement(289815..290900)
FT                   /locus_tag="CtCNB1_0254"
FT   CDS_pept        complement(289815..290900)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0254"
FT                   /product="hypothetical protein"
FT                   /note="COG2855, Predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31000"
FT                   /db_xref="GOA:D0IWI2"
FT                   /db_xref="UniProtKB/TrEMBL:D0IWI2"
FT                   /protein_id="ACY31000.1"
FT                   /translation="MNWLVGLGILLMAALLLWAFSALFISMLAGLAASALLWQPLRWWR
FT                   RRQLLRELEQNPALDVQQQAPCALFYLLSAAVVLLGCAAALTTLIHLPDSLYSPEQLSL
FT                   ICGLIFAISLATLIKLSGNLVSLGEEAAAAAEIRAAWSLAAGIVPMLSLITLIFFVPHT
FT                   AGWMVWREQWRGYDSTQLRIPLKHNDAEHQQALLQLVRPMLEQGSRILSHRARSRSGGS
FT                   YTLSAALPARYRFHNNALELQLAGLMPQEQLNMHLQALISVVEGEASSLPLAYAQCQPS
FT                   PDWLGRQRFFGRGQQAMQSLRECVRTRHSELTTALQLLRGNLQEVQVGWSRFRPWPALP
FT                   RWQAAALPEDEDELLRLDTLR"
FT   gene            complement(291026..291508)
FT                   /locus_tag="CtCNB1_0255"
FT   CDS_pept        complement(291026..291508)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0255"
FT                   /product="conserved hypothetical protein"
FT                   /note="COG5373, Predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31001"
FT                   /db_xref="UniProtKB/TrEMBL:D0IWI3"
FT                   /protein_id="ACY31001.1"
FT                   /translation="MRNLWKICLASALVSSSWASLAQAPAAAPAAPAAKTAPMPAKPAA
FT                   EPAAKAAPAPAAAKTDMQTFVCKDGSTMSAASSKGACSGRKGIDQQATAKAAAGAKPAA
FT                   TAAPGGGAGKVWANEDSKIYHCPGTRFYGTTKNGKYMSEADAKAAGMHGANNKSCS"
FT   gene            complement(291601..292167)
FT                   /locus_tag="CtCNB1_0256"
FT   CDS_pept        complement(291601..292167)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0256"
FT                   /product="beta-lactamase-like protein"
FT                   /note="COG0491, GloB, Zn-dependent hydrolases"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31002"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:D0IWI4"
FT                   /protein_id="ACY31002.1"
FT                   /translation="MDAAVIDPGGDIEQIEWEVERLGLNLKAIWITHAHIDHAGGTSEL
FT                   AAKYELPIIGPHEGDQFWIDGLPQQGAMFGFPHSDPFVPTRWLHDGDTVSIGQETLNVR
FT                   HCPGHTPGHVVFHSPQIDRAFVGDVLFAGSIGRTDFPQGNHQQLIDSIVQRLWPMGDQT
FT                   IFIPGHGPESSFGRERKLNPYVSGT"
FT   gene            292684..294231
FT                   /locus_tag="CtCNB1_0257"
FT   CDS_pept        292684..294231
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0257"
FT                   /product="NAD(P) transhydrogenase, alpha subunit"
FT                   /note="COG3288, PntA, NAD/NADP transhydrogenase alpha
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31003"
FT                   /db_xref="GOA:D0IWI5"
FT                   /db_xref="InterPro:IPR007698"
FT                   /db_xref="InterPro:IPR007886"
FT                   /db_xref="InterPro:IPR024605"
FT                   /db_xref="InterPro:IPR026255"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D0IWI5"
FT                   /protein_id="ACY31003.1"
FT                   /translation="MEKRVATVPDVVEKLIKLGFSVAIESGAGDAANFSDDAYRAVGAE
FT                   VLPNAAAVWAAADILFKVRPPTPQEVALMREGQILIDFIWPAQNPDLMQQLAARKVTVL
FT                   AIDSLPRTLSRAQKMDALTSMAGVSGYRAVIEAANAFGRYFNGQITAAGKVPPAKVFIA
FT                   GAGVAGLSAIGTAANLGAIVRANDTRAEVADQVTSLGGEFVKVDYEEDGGGGGGYAKVM
FT                   SEGFQAAQRQMYAQQAREADIIITTALIPGKPAPKLITAGMVQSMKPGSVIVDMAAEQG
FT                   GNCELTVPNEAVVRHGVTIIGYTDLASRLAKQSSTLYATNLLRLTEELCKAKDGVAVVN
FT                   MQDDAIRGLTVVKDGEITWPAPPLAQAPKPAPKPAAAVVEQKKGGHGHGAAGPLPAKTL
FT                   AIIFAIAALAFWFIGAYAPAAFLGHFTVFVLACFIGYMVVWNVTPALHTPLMSVTNAIS
FT                   SIIAIGALVQIAPPGTAGTARPDDLIRWLAFAALVLTAVNMFGGFAVTRRMLAMFRK"
FT   gene            294259..295674
FT                   /locus_tag="CtCNB1_0258"
FT   CDS_pept        294259..295674
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0258"
FT                   /product="NAD(P) transhydrogenase, beta subunit"
FT                   /note="COG1282, PntB, NAD/NADP transhydrogenase beta
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31004"
FT                   /db_xref="GOA:D0IWI6"
FT                   /db_xref="InterPro:IPR012136"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR034300"
FT                   /db_xref="UniProtKB/TrEMBL:D0IWI6"
FT                   /protein_id="ACY31004.1"
FT                   /translation="MSQSLATVAYLGAAILFILSLGGLSNPETSRRGNLFGLVGMALAV
FT                   LATVFGPRVDAGGIAWIVGALVVGGGIGLYAAKVVKMTQMPELVALMHSLVGLAACLVG
FT                   FASYVDTSIELAGAEKAIHEVEIYVGILIGAVTFSGSLIAFGKLNGRIGGKPLLLPARH
FT                   WLNLLALLVVIWFGREFLHAQTVADGMLPLIVMSVIALLFGVHMVMAIGGADMPVVVSM
FT                   LNSYSGWAAAATGFMLGNDLLIVTGALVGSSGAILSYIMCQAMNRNFISVIAGGFGSGA
FT                   PAKKGDASAAAEPQGEVAPVSAAETAEMLREAKSAIIVPGYGMAVAQAQHTVNEITRTL
FT                   REQGVDVRFAIHPVAGRMPGHMNVLLAEAKVPYDIVMEMDEINEDFPETDVAIVIGAND
FT                   IVNPAAQDDPESPIAGMPVLEVWKAKTSIVMKRSMASGYAGVDNPLFYKDNNRMLFGDA
FT                   KKMLDEVLGALKS"
FT   gene            complement(295813..296439)
FT                   /locus_tag="CtCNB1_0259"
FT   CDS_pept        complement(295813..296439)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0259"
FT                   /product="Lysine exporter protein (LYSE/YGGA)"
FT                   /note="COG1280, RhtB, Putative threonine efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31005"
FT                   /db_xref="GOA:D0IWI7"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:D0IWI7"
FT                   /protein_id="ACY31005.1"
FT                   /translation="MSYAALTAFWAVSFLLVLTPGADWAYVISAGLRGRRLVLPATLGL
FT                   ACGALLATLAVAAGVGALVARNPALLTALTATGALYLAWMGVGLWRSPAAIGSAGDAES
FT                   GTRWHWTIKGASVSGLNPKQLLLLLALLPQFVRPAESWPVFAQIMALGAVHAASCAVVY
FT                   FGVGWGSQSVLRSRPAAALAVSRLSGTLMLVIAAVLLGEIAVQHL"
FT   gene            296545..297000
FT                   /locus_tag="CtCNB1_0260"
FT   CDS_pept        296545..297000
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0260"
FT                   /product="transcriptional regulator, AsnC family"
FT                   /note="COG1522, Lrp, Transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31006"
FT                   /db_xref="GOA:A0A454XJF7"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR019885"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454XJF7"
FT                   /protein_id="ACY31006.1"
FT                   /translation="MNSLDRKILAALENNGRLTVTELAEQVGLSLSPCHRRVRALEESG
FT                   VIRGYRAELDPAALGLDFSSLVFVTLKDSKSVPAFEDAVARLDNVVQAQRLFGDPDYLL
FT                   QVVVRDLPAYQRLYDEQLTRLPGVLRMTSTLVMKHVVSNRPLTSAME"
FT   gene            complement(297168..297623)
FT                   /locus_tag="CtCNB1_0261"
FT   CDS_pept        complement(297168..297623)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0261"
FT                   /product="blue (type 1) copper domain protein"
FT                   /note="COG3241, Azurin"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31007"
FT                   /db_xref="GOA:A0A454XYW9"
FT                   /db_xref="InterPro:IPR000923"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR014068"
FT                   /db_xref="InterPro:IPR028871"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454XYW9"
FT                   /protein_id="ACY31007.1"
FT                   /translation="MKKILMTLALCAVGALSAPAMAAGCEAVVESNDAMQFNVKSIDVP
FT                   KSCKKFSVTLKHVGKMPKTAMGHNIVVSTAADMQAVITDGMAAGAGADYVKAGDARVLA
FT                   HSKVIGGGETTKFDIDASKLKAGTDYAFFCSFPGHSALMKGSLKLGS"
FT   gene            complement(297835..298638)
FT                   /locus_tag="CtCNB1_0262"
FT   CDS_pept        complement(297835..298638)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0262"
FT                   /product="exodeoxyribonuclease III Xth"
FT                   /note="COG0708, XthA, Exonuclease III"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31008"
FT                   /db_xref="GOA:D0IWJ0"
FT                   /db_xref="InterPro:IPR004808"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:D0IWJ0"
FT                   /protein_id="ACY31008.1"
FT                   /translation="MFKLTSLNLNGIRSATTKGAEAWIEATAPDCICVQEIKAQASDMA
FT                   GRFEVLAGMKGYFHFAEKKGYSGVGVYTRHEPSDVVVGFDIEEFDAEGRYVETRFDTPG
FT                   RKFSVISAYFPSGSSGELRQEAKFRFLAKMHSHLMHLKAERDFVLCGDINIAHQKEDLK
FT                   NWRGNQKNSGFLPEERDWMSKLLHKTEAGGGLVDVYRQLQPDTTDACYTWWSNRGQAYA
FT                   NNVGWRLDYHLATPAIAALARTESIYKGEKFSDHAPITIGYDMAI"
FT   gene            298670..299350
FT                   /locus_tag="CtCNB1_0263"
FT   CDS_pept        298670..299350
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0263"
FT                   /product="orotate phosphoribosyltransferase"
FT                   /note="COG0461, PyrE, Orotate phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31009"
FT                   /db_xref="GOA:D0IWJ1"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR004467"
FT                   /db_xref="InterPro:IPR023031"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:D0IWJ1"
FT                   /protein_id="ACY31009.1"
FT                   /translation="MGGADRLAQDFVQFAVDAGVLRFGEFKTKAGRISPYFFNAGLFDD
FT                   GAKMARLSEFYAKAILASGMEFDMVFGPAYKGIPLAATVAVELARQGKNVPFAYNRKEA
FT                   KDHGEGGTLVGAPLKGRVLIIDDVMSAGTAARESIAIIKAAGAEPHAVAIALDRQEMAT
FT                   ENGQDVPHSAVQYVRNQLGMQVCAIAKLADLLLYLEQQGGDAGREHHERVLAYRQRYGV
FT                   EDKE"
FT   gene            299359..300030
FT                   /locus_tag="CtCNB1_0264"
FT   CDS_pept        299359..300030
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0264"
FT                   /product="conserved hypothetical protein"
FT                   /note="COG1196, Smc, Chromosome segregation ATPases"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31010"
FT                   /db_xref="UniProtKB/TrEMBL:D0IWJ2"
FT                   /protein_id="ACY31010.1"
FT                   /translation="MKQALHAKLSLYVIATVWAGAMPAQAQAPANSGGIYACTDANGRR
FT                   ITADRPIASCVDREQRVLGTTGVELRRVGPTLTDQERSAQEAKRRQDQADQQRLREERS
FT                   RDRAMLARFPNQGVHDAARAEAIAQVNDVIGVAQQRQVDLKERRRKLNTELEFYQNDPK
FT                   KAPANLRRQLDDNTESQAEQQRFIKQQEEEKQRINQRFDAELQQLRKLWADLQPAATRS
FT                   H"
FT   gene            complement(300042..300395)
FT                   /locus_tag="CtCNB1_0265"
FT   CDS_pept        complement(300042..300395)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0265"
FT                   /product="hypothetical protein"
FT                   /note="COG1270, CbiB, Cobalamin biosynthesis protein
FT                   CobD/CbiB"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31011"
FT                   /db_xref="GOA:D0IWJ3"
FT                   /db_xref="UniProtKB/TrEMBL:D0IWJ3"
FT                   /protein_id="ACY31011.1"
FT                   /translation="MSLIPLSLWMPLSVAACVLLVLAAVGWLWHTALRIPAGSRDGRNM
FT                   RSMAAIASAGLLLWLAYGLFKGYGALWQADALMLMAQAPLLVQMPLIIAGVAWIATLLL
FT                   GRVMAMHKDGHED"
FT   gene            complement(300482..300742)
FT                   /locus_tag="CtCNB1_0266"
FT   CDS_pept        complement(300482..300742)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0266"
FT                   /product="hypothetical protein"
FT                   /note="COG5656, SXM1, Importin"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31012"
FT                   /db_xref="UniProtKB/TrEMBL:D0IWJ4"
FT                   /protein_id="ACY31012.1"
FT                   /translation="MGSTGLIARKGVAAMDAVFTPNLDKLRNIVQSFGASSFTATQVAT
FT                   EYEGSTASSEITKTFEELLAHHATVLGIQSVPGHHVVWRAN"
FT   gene            complement(300791..301903)
FT                   /locus_tag="CtCNB1_0267"
FT   CDS_pept        complement(300791..301903)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0267"
FT                   /product="CBS domain containing membrane protein"
FT                   /note="COG3448, CBS-domain-containing membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31013"
FT                   /db_xref="GOA:D0IWJ5"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR007065"
FT                   /db_xref="UniProtKB/TrEMBL:D0IWJ5"
FT                   /protein_id="ACY31013.1"
FT                   /translation="MWQRLGPVASRPSWKELIRASIGAGLGLALAGILVGLVEHFFPNT
FT                   LFLFAPLGATAVLVFAVPSSPLAQPWNCVVGNTVPALYTLLLLWAFPTLSQTSLAALAV
FT                   AGAIALMLLLRALHPPGGAVALLTVLAAAQMAPLGWHLLIPMAVLSGVLAAVGVLYHRA
FT                   CGRPYLHQPPQAAKTLRPTTRLALSEQDLEQLLQRFEQSYNLTPEDLGELLAAAEEEAI
FT                   KRRLSSVNCGTVMSAKLLTVSPQTPLEEVAELFHRHLIKSLPVVDAQGELIGRVLRADL
FT                   FDWLWQDHRARQQQNLWQRLRSRPSKVQSVAQELMRAPEMSVQEDTPMGDLLHELASHS
FT                   VQFIAVLRGKTLVGVITRSDVIRTLLSINQ"
FT   gene            complement(302047..302568)
FT                   /locus_tag="CtCNB1_0268"
FT   CDS_pept        complement(302047..302568)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0268"
FT                   /product="nitroreductase"
FT                   /note="COG0778, NfnB, Nitroreductase"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31014"
FT                   /db_xref="GOA:D0IWJ6"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="UniProtKB/TrEMBL:D0IWJ6"
FT                   /protein_id="ACY31014.1"
FT                   /translation="MSPRAFVPEALSAAQIEQLVEAARWAPSASNKQPWHFAYALRDDT
FT                   NWQAFSQIPNEANRRWCLNGGALIVLLSDRQASAAKHSFDAGCAWGYLALQAHAMGLAT
FT                   HAMGGFSADEARKVLNLPEHLVPECVIAVGRRADASTLPDDLREREQPSDRKPLAEMLS
FT                   AGAVQAAATA"
FT   gene            complement(302723..303760)
FT                   /locus_tag="CtCNB1_0269"
FT   CDS_pept        complement(302723..303760)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0269"
FT                   /product="hypothetical protein"
FT                   /note="COG3064, TolA, Membrane protein involved in colicin
FT                   uptake"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31015"
FT                   /db_xref="UniProtKB/TrEMBL:D0IWJ7"
FT                   /protein_id="ACY31015.1"
FT                   /translation="MLTLLRRAEDLLIQVLRLVLLAFSIFVLFGMGHWIWDHYKPKKPD
FT                   IATAGATALNWKDAPYDLKYMEEETGRDLSVLGNAVPMEKRLADPALRPDFRKADGLLR
FT                   GFIYRDTAARKRVETENSSQGLDPIHPLLKGDALPSADDVNRQIKMREARENSCCDKEA
FT                   ADAAAAEVDAAWTARRISLTREDRMARAAADAAADAAIAAAAEASGEDAMLMDPVNLAS
FT                   EINDRAQAAEMEHGEGSYAAYIKGLPVALEKVLGNESLAKKLQQQSAPQIVNTLLTNYT
FT                   LSFDRTAAKLRGDNPDEEKWEFLGMDTAFATLLISCLVMVMMALVMFRMERHLRGIGAQ
FT                   SGQKS"
FT   gene            304019..305266
FT                   /locus_tag="CtCNB1_0270"
FT   CDS_pept        304019..305266
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0270"
FT                   /product="D-isomer specific 2-hydroxyacid dehydrogenase"
FT                   /note="COG0111, SerA, Phosphoglycerate dehydrogenase and
FT                   related dehydrogenases"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31016"
FT                   /db_xref="GOA:A0A454XZC1"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR029752"
FT                   /db_xref="InterPro:IPR029753"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454XZC1"
FT                   /protein_id="ACY31016.1"
FT                   /translation="MDRGWIMGKTSLDKSKIKFLLLEGIHPSALKVLHDAGYTNVEALT
FT                   GALDGEELKRKIADVHFVGIRSRTQLTADVFAAAQKLVAVGCFCIGTNQVDLNAARERG
FT                   VVVFNAPYSNTRSVAELVLGEAILLLRGIPEKNAVSHRGGWKKSAENSFEIRGKTLGIV
FT                   GYGSIGTQLSVLAEGLGMKVIFHDVVTKLPLGNAQQSSGLNELLAQSDIVTLHVPELAS
FT                   TNGMMGAAQIAAMKPGSILINASRGTVVDIEALAESLQSGKLLGAAIDVFPKEPKSNKD
FT                   EFLSPLRGMDNVILTPHIGGSTMEAQANIGLEVAEKLVKYSDNGTTTSAVNFPEVALPE
FT                   HPGNNRILHVHENRPGILSAINQVFADNGINIAGQYLRTDEKVGYVVIDIDAKSSALAL
FT                   EKLAQIAGTIRCRVLF"
FT   gene            305425..307425
FT                   /locus_tag="CtCNB1_0271"
FT   CDS_pept        305425..307425
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0271"
FT                   /product="oligopeptide transporter, OPT family"
FT                   /note="COG1297, Predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31017"
FT                   /db_xref="GOA:D0IWJ9"
FT                   /db_xref="InterPro:IPR004813"
FT                   /db_xref="InterPro:IPR004814"
FT                   /db_xref="UniProtKB/TrEMBL:D0IWJ9"
FT                   /protein_id="ACY31017.1"
FT                   /translation="MNTPIKREFTFRGVLLGALITLAFTAANVYLGLKVGLTFASAIPA
FT                   AVISMALLYRFKDSNILENNLVQTQASAAGTLSSVIFVLPALLMLGLWTGFPFWQTALI
FT                   CAAGGTLGVLYTVPLRRVLVVQSELPYPEGVAAAEVLRVGDEQRHLHDPENLGKPRSSG
FT                   LRELGWGTGLAALFGFLSGGLRLLGDAFNFWIPAGSVAFRVAAGFSPALLAAGYLMGAA
FT                   AGIAVLVGLALCWGVVVPWLTAQASPAAGQALSELSTQLWGSKARFLGAGVIGISALWT
FT                   VATLAKPIVQAIRNQPARSVAEGAGGNETDKDMPRSWMLAIGAAALGVLFLVVNDFIAG
FT                   HMPDLAAGARYGLAALCVLFAALFGFLVAAACGYMAGLVGSSASPISGIGIIATLLMGV
FT                   ALLALHALVPAYASAVAGQMGIALVLFMVSAVLAMAAISNDNLQDLKTGYLVGATPWRQ
FT                   QIVLIIGCLVGALVIPPVLDLLYNAYGFAGSMPRAGMDPNQALAAPQATLMMQIASGIF
FT                   KGSLDWSMLGLGVAVGIAVILIDLTLRKSGKGALPPLAVGLGIYLPPTIGLTLTIGAVL
FT                   GWCIARAIKAYAQRGGKDWTAAAEERGLLLASGLIVGESLMGLLIAALIGFSGKDAPLA
FT                   LVGEGFAPAMWLGLAYFVGLCVFFYRRVLRK"
FT   gene            307422..308246
FT                   /locus_tag="CtCNB1_0272"
FT   CDS_pept        307422..308246
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0272"
FT                   /product="hypothetical protein"
FT                   /note="COG5290, IkappaB kinase complex"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31018"
FT                   /db_xref="UniProtKB/TrEMBL:D0IWK0"
FT                   /protein_id="ACY31018.1"
FT                   /translation="MKTGRFDGEQAEYRQGNFGFAHEWLQEFKTLDEVLQRLDALRAAD
FT                   PAHRYLCTLDDVSQCSYTSGHASQDERLYLDDPEDMDWEDPAQEQALTLALLQHRVAQL
FT                   QRPELEQDWAQVCGTLLLAAEDVDALLQANRRPEVLLDEVVYVQRLPVPDDELMIAGQP
FT                   NGYFSADWDSFQNHAVIRHLAAQYGYRFFGMGAAWMGFVRASLPDAVLIDRLIEDLRML
FT                   YGQGQDEVREHAGWAQLASVLLSRRTLMLGYAEGLAEGLGLDQPSSENTMKS"
FT   gene            308368..308706
FT                   /locus_tag="CtCNB1_0273"
FT   CDS_pept        308368..308706
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0273"
FT                   /product="hypothetical conserved protein"
FT                   /note="COG3422, Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31019"
FT                   /db_xref="InterPro:IPR010879"
FT                   /db_xref="InterPro:IPR036913"
FT                   /db_xref="UniProtKB/TrEMBL:D0IWK1"
FT                   /protein_id="ACY31019.1"
FT                   /translation="MAGHFELSKSSDGQFRFVLKAGNGEIILTSELYKTRAAAENGIAS
FT                   VQTNSPLAERYEKKTASNGKEHFNLKAANHQVIGSSQLYASVASRDAGIESVRKNGATT
FT                   VVKDLTGT"
FT   gene            complement(308748..309569)
FT                   /locus_tag="CtCNB1_0274"
FT   CDS_pept        complement(308748..309569)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0274"
FT                   /product="conserved hypothetical protein"
FT                   /note="COG2945, Predicted hydrolase of the alpha/beta
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31020"
FT                   /db_xref="GOA:D0IWK2"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D0IWK2"
FT                   /protein_id="ACY31020.1"
FT                   /translation="MRSMFSKLLKPLLWLLALCLAVYICICSYMFAQQRQMIFPGGGTQ
FT                   VAAESTDFSLQRADVLLRGWQLHPADGKARNAVIYFGGNAENIAHRRQQLSRSLPHSDI
FT                   YMLAYRGYGASEGEPTQELMELDAAALFDEVRRLHPELPITVIGRSLGTGVAAAVADLR
FT                   QPDQLVLVTPFDSILNTVRGMYGWLPVELLLRDPFDSAAHLRNYHGPILVLRAGRDQVV
FT                   QPERTDALLHSLRDKAVQVQAFAQANHSTIFRANGFWSAIEQFVDGHHKAA"
FT   gene            complement(310690..311382)
FT                   /locus_tag="CtCNB1_0275"
FT   CDS_pept        complement(310690..311382)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0275"
FT                   /product="excinuclease ABC, A subunit"
FT                   /note="COG3583, Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31021"
FT                   /db_xref="UniProtKB/TrEMBL:D0IWK3"
FT                   /protein_id="ACY31021.1"
FT                   /translation="MIFSNASLIESEKERNLCSKFFAGYFFNEFTAGYAKRIVQFNRYI
FT                   QEVTGREDLGIQSPHISFDTHAYLCHERLRSKLADVLISDPARQVFLFIETKYLSNWTY
FT                   AADVAKGLERLDKVFDADKKPHLADTRQHYFVLTSRRKEEAAGRPVQHYAPVNGPIYVP
FT                   SPARAAEVSEGDAAESAKPSFTSLLYWEDLAQMCDRSEVRQYMEARLKLCVSSSRNQHK
FT                   AGYFLPGA"
FT   gene            complement(311540..312997)
FT                   /locus_tag="CtCNB1_0276"
FT   CDS_pept        complement(311540..312997)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0276"
FT                   /product="GatB, Asp-tRNAAsn/Glu-tRNAGln amidotransferase B
FT                   subunit(PET112-like protein)"
FT                   /note="COG0064, GatB, Asp-tRNAAsn/Glu-tRNAGln
FT                   amidotransferase B subunit(PET112 homolog)"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31022"
FT                   /db_xref="GOA:D0IWK4"
FT                   /db_xref="InterPro:IPR003789"
FT                   /db_xref="InterPro:IPR004413"
FT                   /db_xref="InterPro:IPR006075"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR017958"
FT                   /db_xref="InterPro:IPR017959"
FT                   /db_xref="InterPro:IPR018027"
FT                   /db_xref="InterPro:IPR023168"
FT                   /db_xref="InterPro:IPR042114"
FT                   /db_xref="UniProtKB/TrEMBL:D0IWK4"
FT                   /protein_id="ACY31022.1"
FT                   /translation="MTVKLINGYEVVIGFETHTQLATNSKIFSRASTAFGAEPNTQASA
FT                   VDLALPGTLPVMNKKAVECAIKLGLSLGSTIAPRSIFARKNYFYPDLPKGYQISQFEIP
FT                   VVQGGEVSFYLEEGKNNVLKTVRLVRAHLEEDAGKSVHDEFIGQSGIDLNRAGTPLLEI
FT                   VTEPDIRSTAEAVAYAKELHKIVTWIGICDGNMQEGSFRCDANVSVRKPGQPLGTRREI
FT                   KNLNSFRNMQIAIDYEILWQIEQIEDGHKIQQATVLFNPDTGETRAMRTKEDAADYRYF
FT                   PDPDLPPLVVAPEWVEQVKAEMPELPRAMAARFVEQYSLPEYDATTLTQSQAMAAYFEA
FT                   AAKTCGQPKLASNWVMGEISRRLNMEEIGMEQVKVSAEQLGTLIARIHGNVISNNSAKQ
FT                   VFEALWTGEGSDVDAIIEAKDLKQSNDTGALEAIIDEVIAANPANVEQYRAGKDKAFNA
FT                   LVGQVMKASKGKANPGQVNELLKAKLA"
FT   gene            complement(313148..314638)
FT                   /locus_tag="CtCNB1_0277"
FT   CDS_pept        complement(313148..314638)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0277"
FT                   /product="GatA, Asp-tRNAAsn/Glu-tRNAGln amidotransferase A
FT                   subunit"
FT                   /note="similar to other amidases; COG0154, GatA,
FT                   Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunitand
FT                   related amidases"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31023"
FT                   /db_xref="GOA:D0IWK5"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR004412"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/TrEMBL:D0IWK5"
FT                   /protein_id="ACY31023.1"
FT                   /translation="MSQTELHQLSVAELAAQLRAKQVSATEAAQHFLARAKQHQNLGAF
FT                   VAINEDATLAQAKAADALIAEGKGGKLAGVPIAHKDIFVTKDFPTTAASKMLEGYQSPF
FT                   DATVVRKLAESGVVTLGKLNCDEFAMGGANENSAVAPVGFDAAQPVRNPWNNERVPGGS
FT                   SGGSAAAVAARLAPAVTGTDTGGSIRQPASFCGITGIKPTYGRASRYGMIAFASSLDQA
FT                   GPMGRSAEDCALLLSEMCGPDLDRDSTSLDYPAEDFTAKLNNSIEGLRIGVPAEFFGEG
FT                   LSDDVRKAVDAALKEYEKLGAKLVPVSLPRTELSVPVYYILAPAEASSNLSRFDGVKFG
FT                   HRAAKYEDLNDMYKKTRAEGFGDEVKRRIMIGAYVLSEGYYDAYYLQAQKIRRMIADDF
FT                   QAAFKDCDVIAGAAAPTTAWAIGGKADPVSNYLADIFTLPASLAGLPGLSLPAGFGDGG
FT                   MPVGLQLIGNYFSEAKLLNAAHRFQQATDFHLKSPAGI"
FT   gene            complement(314659..314958)
FT                   /locus_tag="CtCNB1_0278"
FT   CDS_pept        complement(314659..314958)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0278"
FT                   /product="GatC, Asp-tRNAAsn/Glu-tRNAGln amidotransferase C
FT                   subunit"
FT                   /note="COG0721, GatC, Asp-tRNAAsn/Glu-tRNAGln
FT                   amidotransferase C subunit"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31024"
FT                   /db_xref="GOA:A0A454XST4"
FT                   /db_xref="InterPro:IPR003837"
FT                   /db_xref="InterPro:IPR036113"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454XST4"
FT                   /protein_id="ACY31024.1"
FT                   /translation="MALNDQDIARIANLARLELSQDESKRMLAQLNNFFGIVEKMQAVD
FT                   TSGVSPLSHPVAAIQDVALRLRDDLVSEGNNRDANMQNAPAAEKGYFLVPKVIE"
FT   gene            315171..316214
FT                   /locus_tag="CtCNB1_0279"
FT   CDS_pept        315171..316214
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0279"
FT                   /product="cell shape determining protein, MreB/Mrl family"
FT                   /note="COG1077, MreB, Actin-like ATPase involved in cell
FT                   morphogenesis"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31025"
FT                   /db_xref="GOA:A0A454XMY6"
FT                   /db_xref="InterPro:IPR004753"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454XMY6"
FT                   /protein_id="ACY31025.1"
FT                   /translation="MFGAFRRYFSTDLAIDLGTANTLIFARDKGIVLDEPSVVAIRHEG
FT                   GPHGKKVIQAVGREAKAMLGKVPGNIEAIRPMKDGVIADFVITEQMIKQFIKMVHPRSV
FT                   LTPSPRIIICVPCGSTQVERRAIKDAAEAAGATAVYLIEEPMAAGIGAGLPVSEASGSM
FT                   VVDIGGGTTEVGVISLGGMVYKGSVRVGGDKFDESIISYIRRNYGMLIGEPTAELIKKQ
FT                   IGSAFPGSEVKELEVKGRNLSEGVPRSFTISSNEVLEALTDPLNQIVSAVKNALEQTPP
FT                   ELGADIAERGMMLTGGGALLRDLDRLLAEETGLPVLVAEEPLTCVVRGCGMALETMDRQ
FT                   GSIFTSD"
FT   gene            316380..317405
FT                   /locus_tag="CtCNB1_0280"
FT   CDS_pept        316380..317405
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0280"
FT                   /product="rod shape-determining protein MreC"
FT                   /note="COG1792, MreC, Cell shape-determining protein"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31026"
FT                   /db_xref="GOA:D0IWK8"
FT                   /db_xref="InterPro:IPR007221"
FT                   /db_xref="InterPro:IPR042175"
FT                   /db_xref="InterPro:IPR042177"
FT                   /db_xref="UniProtKB/TrEMBL:D0IWK8"
FT                   /protein_id="ACY31026.1"
FT                   /translation="MSLDTLDHRAPSLFKQQASRTSQLALYSALALFLMVADARFKITT
FT                   PVRAALSVALSPVQWLVAQPVLAYQNASRYAEVQQQAVAREDAARKELVVMAQRAELAD
FT                   ELIKENEHLRSMLELRERSLTPGQVAEVVYDSPDPYTRRVVIDKGQADNIAPGSPVLDE
FT                   KGVIGQVTRVYPTRAEVTLLIDRDQAIPVFNPRTGARSVAYGDASSTRAGGLELRFMPS
FT                   NSDVQVGDLLTTSGIDGLYPTGLPVAKVVTVDRRADSAFTRIYCEPVGRVQGVRHVMVL
FT                   KPQGRTEHPEAANMQAQADAEKADRAAKARGKKEAAAAEKEKAAAEKAGTKAAKPAKDP
FT                   A"
FT   gene            317402..317920
FT                   /locus_tag="CtCNB1_0281"
FT   CDS_pept        317402..317920
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0281"
FT                   /product="putative rod shape-determining MreD"
FT                   /note="COG2891, MreD, Cell shape-determining protein"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31027"
FT                   /db_xref="GOA:D0IWK9"
FT                   /db_xref="InterPro:IPR007227"
FT                   /db_xref="InterPro:IPR026034"
FT                   /db_xref="UniProtKB/TrEMBL:D0IWK9"
FT                   /protein_id="ACY31027.1"
FT                   /translation="MIMPRGQQLLLPVNPLFIVVTLVIGLAVNMLPLGRIVWLPDMLLL
FT                   LLAFWSLNQPQRVGLGIAFVLGLIMDVDRASLLGQHALAYTLLVFVTGWMSRRLLWFSS
FT                   PVQALHLLPVFAAAHGIQVLLRVATGGIFPGLEFLIAPVIETLLWPVVSALLLAPQRRA
FT                   PDSDENRPL"
FT   gene            318043..319995
FT                   /locus_tag="CtCNB1_0282"
FT   CDS_pept        318043..319995
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0282"
FT                   /product="penicillin-binding protein, transpeptidase"
FT                   /note="COG0768, FtsI, Cell division protein
FT                   FtsI/penicillin-bindingprotein 2"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31028"
FT                   /db_xref="GOA:D0IWL0"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR005311"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR017790"
FT                   /db_xref="InterPro:IPR036138"
FT                   /db_xref="UniProtKB/TrEMBL:D0IWL0"
FT                   /protein_id="ACY31028.1"
FT                   /translation="MMEIRNTEVELQRFRMRAVVMGCVVFLAFCLLVWRLLVLQVERHE
FT                   EFAERAESNRTAVVPIVPNRGQILDRNGVVLATNYSAYTLEITRSKVEDLDETIEGLSG
FT                   VIEITPRDRRKFKRLMDDSKSFESIPIRSRLTDEEVAKFAAQRYRFPGVDIKARLFRTY
FT                   PLKETGSHLIGYIGRINQREKEEIDDSDDAANYRGTEVMGKLGAEKSYELQLHGQTGWE
FT                   EMETSAGGHAVRRLGSRPATPGHSLQLSVDIKLQKMVEDLYGNRRGVAIAMDPRNGEVL
FT                   AMVSKPTYDPNLFVDGIDQESWKALNESLDRPLLNRSMRGTYPVGSTYKPFMGLAGIET
FT                   GKRTPGTVIQDGGSWTFGGHTFRSGHALGPVDLARAIQHSSNVYFYTLANEMGVDAIHD
FT                   FMKPLGFGQITGIDLPGEVRGVLPSKEWKRKTYKRAAQQQWFAGETISLGIGQGYNNFT
FT                   ILQLSHALATLVNNGMSFTPHVGKELIDSVTGTRTAIVQPAPVNLGYKQSNVDAVKRGM
FT                   VGVVTGGTGRGVFGSASYLSGGKTGTAQAVSVGQKEKYNAARLAEYQRDHSLYIAYGPA
FT                   EAPRIAVAVIVENAGFGAAAAAPIARRILDYWLVGNYPSEADIAAVRQGKAGAPIGTPR
FT                   RVEDISVLSDDETAP"
FT   gene            complement(320032..320790)
FT                   /locus_tag="CtCNB1_0284"
FT   CDS_pept        complement(320032..320790)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0284"
FT                   /product="hypothetical protein"
FT                   /note="COG0730, Predicted permeases"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31030"
FT                   /db_xref="GOA:A0A454XP64"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454XP64"
FT                   /protein_id="ACY31030.1"
FT                   /translation="MEWILVSLASALAGFVDAIVGGGGLILVPAMFAAFPTTTPATLFG
FT                   TNKSAAVWGTAISAWQYSKRVHITWATLLPAIGTTLVGAFLGAWAVTLISPDFLRKLLP
FT                   FILLGVLGYTLAKKELGRDHEPRLAGRTEMLTASAIGLLIGFYDGFFGPGTGSFFVFLF
FT                   VRLLGYDFLNASASAKLLNLASNAAALLLFTLKGHVWWHFAIPLAVANVLGSMLGTWMA
FT                   LRHGTGFVRTIFIGVVSLLILKTGYDAFLR"
FT   gene            320789..321148
FT                   /locus_tag="CtCNB1_0283"
FT   CDS_pept        320789..321148
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0283"
FT                   /product="Inner membrane protein ygaZ"
FT                   /note="COG1571, Predicted DNA-binding protein containing
FT                   aZn-ribbon domain"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31029"
FT                   /db_xref="GOA:D0IWL2"
FT                   /db_xref="UniProtKB/TrEMBL:D0IWL2"
FT                   /protein_id="ACY31029.1"
FT                   /translation="MEQMPAIGACREQRALPLGGAAGGGMKKPGESGLECPRMAPALSH
FT                   RSLKLVRRHKKSAHCGALLNASLMLLYVLVWLCRVVSSALHAASWSSESDENVRAAPVW
FT                   CIGEFPWVISKTSDK"
FT   gene            complement(321364..323031)
FT                   /locus_tag="CtCNB1_0285"
FT   CDS_pept        complement(321364..323031)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0285"
FT                   /product="glucose-methanol-choline oxidoreductase"
FT                   /note="COG2303, BetA, Choline dehydrogenase and related
FT                   flavoproteins"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31031"
FT                   /db_xref="GOA:D0IWL3"
FT                   /db_xref="InterPro:IPR000172"
FT                   /db_xref="InterPro:IPR007867"
FT                   /db_xref="InterPro:IPR012132"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D0IWL3"
FT                   /protein_id="ACY31031.1"
FT                   /translation="MSDTQFDYIVIGGGTAGSLLCNRLTRNKNHRILLIEAGGKDDYHW
FT                   IHIPVGYLYCIGNPRTDWLYQTEPDPGLNGRSLRYPRGKTLGGCSSINGMIYMRGQARD
FT                   YEQWAELTGDDTWRWEQVLPAFKQHEDHWRLDAGGSASEEFMRLHGSKSTGGSGEWRVE
FT                   KQRLRWDILDAFAQAAQQAGIPATDDFNRGCNEGVGYFEVNQKSGLRWNTAKAFLRPTC
FT                   YGRPNFEMWTRAQVRRLILEDLPDGSQRCTGAEVWTGEEMVTVQAGREVLLCAGAVNSP
FT                   HILQLSGIGPGELLQRHGMAVRRDLPGVGANLQDHLQIRSVYKVQNAKTLNTMAGSLWG
FT                   KAAIALEYALKRSGPMSMAPSQLGAFTRSNPALAHPNLEYHVQPLSLDAFGEPLHDFAA
FT                   FTASVCNLNPSSRGTVQLQSADFRQAPAIAPHYLSTPEDRQVAADSLRVTRRIVSQPAL
FT                   ARFQPEEFKPGAQYQSDEELARLAGDIATTIFHPVGTTKMGRADDPMAVLDSRFKVRGV
FT                   QGLRVVDAGAMPTITSGNTNSPTLMMAEKAAQWIRDAT"
FT   gene            323344..324471
FT                   /locus_tag="CtCNB1_0286"
FT   CDS_pept        323344..324471
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0286"
FT                   /product="putative inner membrane ABC-transporter
FT                   component"
FT                   /note="COG0767, Ttg2B, ABC-type transport system involved
FT                   in resistance toorganic solvents"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31032"
FT                   /db_xref="GOA:D0IWL4"
FT                   /db_xref="InterPro:IPR003453"
FT                   /db_xref="InterPro:IPR030802"
FT                   /db_xref="UniProtKB/TrEMBL:D0IWL4"
FT                   /protein_id="ACY31032.1"
FT                   /translation="MPSSDQLPQCPLQSREGQQWAVPAGRWSAAELGDRHIWRRLAPQI
FT                   RAVPKGAAWDLQQMVWFDHIGAQLLWEQWGKAWPAQLLTTKTQRSMLERVARFSEVPES
FT                   KPEPSGWMCEVNRLGQMVIDACGHFSNLIQLVGQLLLDCLRLLRNPLRGPWRDISGHLY
FT                   ATGATALPITALVGFLIGVVLAYLMALQLRQFGAESFIVNILGISLIRELGPLLAAILV
FT                   AGRSGSAITAQIGVMRVTEELDAMQVMGISQGYRLVLPRALALAVSMPLVALWTILAAL
FT                   AGGMVAADLTMDITPSYFVQSLPAAVKVGNLVLAMGKSVVFGVLIALIGCHWGLKVEPN
FT                   TQSLGRGTTAAVVSSITMVIIVDAIFAILFRNVGF"
FT   gene            324610..325458
FT                   /locus_tag="CtCNB1_0287"
FT   CDS_pept        324610..325458
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0287"
FT                   /product="putative ATPase component of ABC transporter
FT                   system"
FT                   /note="COG1127, Ttg2A, ABC-type transport system involved
FT                   in resistance toorganic solvents"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31033"
FT                   /db_xref="GOA:D0IWL5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D0IWL5"
FT                   /protein_id="ACY31033.1"
FT                   /translation="MHNRRIEGAVGDYAPPQDVKPLVQAVDLWTEFGEGESRFAVHQDL
FT                   NFDVYPGEILALVGGSGTGKTVLLRQILGLLSPSRGTVTVDGRPSREVISGELAASQVG
FT                   MLFQQGALYSAFNVLDNIAFALREQGTLPDAVVRDAAMVKLQMVGLKPEHASRMPADLS
FT                   GGMIKRVALARALMMDPPLLLLDEPTAGLDPKGSDEFCELLRDIHAELGLTVIMVTHDL
FT                   DTLFALSTRVAVLAEKKVLFTGAPRDVARIKHPFIEHFFQGERGRRAMAPVQGGVAAEE
FT                   S"
FT   gene            325458..326405
FT                   /locus_tag="CtCNB1_0288"
FT   CDS_pept        325458..326405
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0288"
FT                   /product="putative periplasmic protein"
FT                   /note="COG1463, Ttg2C, ABC-type transport system involved
FT                   in resistance toorganic solvents"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31034"
FT                   /db_xref="GOA:D0IWL6"
FT                   /db_xref="InterPro:IPR003399"
FT                   /db_xref="UniProtKB/TrEMBL:D0IWL6"
FT                   /protein_id="ACY31034.1"
FT                   /translation="MENKSHAMAAGIFVLVVATLLAGLAVWLTRDNREYQLYEMSTKDG
FT                   VSGLQPQATVRYKGVPVGKVVRIGFDPQISGNVLIRIAVGEDTPVTPATYAQLGYQGVT
FT                   GLAHIQLDDDSKSSQPLKPGPSGLPRLPMKSSPLNMLADQGPVLLERVDEISRRLNSML
FT                   GEDNQKRVSVALDNIAAASGGIKDLAETMNKTAKDFPQITADAHQTLQSLTKAGNAATG
FT                   VATDLQQTVRKVNAPDGPLQQIAEGTQALSQAAESLGRSTLPRMNGAADDVSRAARSMG
FT                   AAAGRFNDNPQSVIYGQGMGLPGPGEPGFVAPAK"
FT   gene            326512..327195
FT                   /locus_tag="CtCNB1_0289"
FT   CDS_pept        326512..327195
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0289"
FT                   /product="putative lipoprotein"
FT                   /note="COG3218, ABC-type uncharacterized transport system"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31035"
FT                   /db_xref="InterPro:IPR005586"
FT                   /db_xref="UniProtKB/TrEMBL:D0IWL7"
FT                   /protein_id="ACY31035.1"
FT                   /translation="MADTKISLTGRGAWRLLGASSLVLALAACSGLPTAPTQPVRYDLG
FT                   MADLAVPAANAAAPSVAPVPLVLAEVQAPGLPEGLTAMFYRLNYSDSQQLRAYQNARWS
FT                   LPPAQMVEQRMRMRLGLERPVLSGKDNVRPLQADKRSIAQLRVTVDEFSQVFDNASNSR
FT                   ALLRLSASLIGAGESAGNQLLGQKVFTVEVPAASADAAGGAQAMARAVDEAAAQLSRWL
FT                   QGYGR"
FT   gene            327368..327865
FT                   /locus_tag="CtCNB1_0290"
FT   CDS_pept        327368..327865
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0290"
FT                   /product="hemerythrin-like metal-binding protein"
FT                   /note="COG2703, Hemerythrin"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31036"
FT                   /db_xref="GOA:A0A454XQJ3"
FT                   /db_xref="InterPro:IPR012827"
FT                   /db_xref="InterPro:IPR035938"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454XQJ3"
FT                   /protein_id="ACY31036.1"
FT                   /translation="MASLEWNAALILDFPVMDAVHEEFVTLLAQVEAAGDEQLCALWDE
FT                   LIAHTQQHFDQEDRWMQTTGFATGNCHSQQHKVVLAVLREGAVKGGQGDLATIRHMAAE
FT                   LGPWFSHHAQNMDAALALHMRRAGFDPVTGAVLVPEALPAEPITGCGGACGEAEKMEVV
FT                   TA"
FT   gene            complement(327975..328622)
FT                   /locus_tag="CtCNB1_0291"
FT   CDS_pept        complement(327975..328622)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0291"
FT                   /product="multiple antibiotic resistance (MarC)-related
FT                   protein"
FT                   /note="COG2095, MarC, Multiple antibiotic transporter"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31037"
FT                   /db_xref="GOA:A0A454XT53"
FT                   /db_xref="InterPro:IPR002771"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454XT53"
FT                   /protein_id="ACY31037.1"
FT                   /translation="MDIKPLITLVAIINPLAIVPFFIHYTAGFDAEQRWQTIRTAAFAA
FT                   FCVIAVCALLGLQILQFFNISLQSFQVGGGLLLLISAMNMLNARPAEDRPNNATLAAGV
FT                   EKAAEGNSIAVVPLTIPLLTGPAAMSTVVIYADQARTIWQHVALVGYGVVVAAAIMVCF
FT                   SLAHPIARVLGKTGINVMTRLMGLILAALAIEVMAGGLIKIFPILASPAIYP"
FT   gene            328805..329497
FT                   /locus_tag="CtCNB1_0292"
FT   CDS_pept        328805..329497
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0292"
FT                   /product="dienelactone hydrolase"
FT                   /note="COG0412, Dienelactone hydrolase and related enzymes"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31038"
FT                   /db_xref="GOA:D0IWM0"
FT                   /db_xref="InterPro:IPR002925"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D0IWM0"
FT                   /protein_id="ACY31038.1"
FT                   /translation="MGSFVELTAVDGAKTPAYVAMPEGQARGAIVVLQEIFGVNSHIRS
FT                   VADRYAAQGYVAVAPAMFARVKPDVELGYSEEDMKAGFALKTAVEALPEPGALRDVEAA
FT                   VAHAATLVPGGKIGVVGFCWGGLMTWRSACNLASVSAAVCYYGGGMTGELEASRLALCP
FT                   VLAHFGSKDHYISLESVEAFKKAQPKVEVHVYEADHGFNCDQRGSYNEAAAALAGERTL
FT                   AFFAQYLG"
FT   gene            complement(329663..330865)
FT                   /locus_tag="CtCNB1_0293"
FT   CDS_pept        complement(329663..330865)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0293"
FT                   /product="putative magnesium and cobalt transport protein"
FT                   /note="COG0598, CorA, Mg2+ and Co2+ transporters"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31039"
FT                   /db_xref="GOA:D0IWM1"
FT                   /db_xref="InterPro:IPR002523"
FT                   /db_xref="UniProtKB/TrEMBL:D0IWM1"
FT                   /protein_id="ACY31039.1"
FT                   /translation="MRVLHISPLYAQPVDGLPTQAATTGFYWVSCTRSELEAQLPAIQT
FT                   MLVRLGGSALVDLHVSDLLNPAIPSNYDYTSVYDVLVFRRLANAHLPPLSGNHASPASA
FT                   AASPPGLPAVMAGTGSAASSAPPPSHNPAHSGQREAPVLQRVETQPVGFALYDQILLSV
FT                   HPDGCFVLENFWQRLISGPAKTDSRQASTKMPVEPADLMLRMVNGMVDGYLDLRRTLTR
FT                   QIDHWQMALLKPNKRFSNWASVLDVRLALHQLDEICEDQRAAVQDWTEALEGWPPEHTP
FT                   ARQHERELLRVRSRDVLEHIERVTHHIHRMEQSAETAVQMHFSAQSNRANDIMRTLTTV
FT                   TAIFLPLNLIAGIFGMNFEFIPFVHKKDGFIWALVAMVIITVVLVAYFWRRRYLESEEK
FT                   E"
FT   gene            complement(330999..332009)
FT                   /locus_tag="CtCNB1_0294"
FT   CDS_pept        complement(330999..332009)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0294"
FT                   /product="delta-aminolevulinic acid dehydratase"
FT                   /note="COG0113, HemB, Delta-aminolevulinic acid
FT                   dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31040"
FT                   /db_xref="GOA:D0IWM2"
FT                   /db_xref="InterPro:IPR001731"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR030656"
FT                   /db_xref="UniProtKB/TrEMBL:D0IWM2"
FT                   /protein_id="ACY31040.1"
FT                   /translation="MHLSSPTPFPQNRPRRLRRDAFTRNLVRESVLTPHDFIYPVFVHE
FT                   GQNKREAVPSMPGVDRLSLDLLLPVAEECVKLEIPYLALFPAIESSLKTPDGKEALNPD
FT                   GLIPRVVRALKKEFPQLGVMTDVALDPYTSHGQDGILDESGYIINDDTVEVLVGQALAH
FT                   AEAGVDMVAPSDMMDGRIGAIREALELQGHIHTRIMAYSAKYASAFYGPFRDAVGTRGA
FT                   LGKADKNVYQMDPANTDEALREVAQDIAEGADMVMVKPGMPYLDVVRRVKDEFKVPTFA
FT                   YQVSGEYAMLKAAAANGWLDHDAVMMEALLAFKRAGADGILTYFAIDAAKKLRGL"
FT   gene            332154..332570
FT                   /locus_tag="CtCNB1_0295"
FT   CDS_pept        332154..332570
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0295"
FT                   /product="conserved hypothetical protein"
FT                   /note="COG1981, Predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31041"
FT                   /db_xref="GOA:A0A454XPW1"
FT                   /db_xref="InterPro:IPR005265"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454XPW1"
FT                   /protein_id="ACY31041.1"
FT                   /translation="MLWVKAFHIVFVASWFAGLFYLPRIFVNIAMVTPGSVAERERLLL
FT                   MARKLLRFTTMLAVPALGLGLWLWLGWGFAGGWLHAKLAVVLLVIGYHHSCAVLLRKLA
FT                   DNTCHKSHRWFRFYNEVPVLLLIAAVILVVVKPF"
FT   gene            332598..333725
FT                   /locus_tag="CtCNB1_0296"
FT   CDS_pept        332598..333725
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0296"
FT                   /product="VanZ like protein"
FT                   /note="COG5652, Predicted integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31042"
FT                   /db_xref="GOA:A0A454Y0J5"
FT                   /db_xref="InterPro:IPR006976"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454Y0J5"
FT                   /protein_id="ACY31042.1"
FT                   /translation="MSDSAVPVISMRHTSAWPLALVYGLLIVFASLFPFDGWRAQGIDP
FT                   SVFLFARIPPPYWTWFDVNTNIVGYAPLGFFLALALMRSGQPRLAVPLAFLAGTLLSLC
FT                   MEFLQIYLPRRVPSNLDLVLNAGGTLIGALLAALLERLGALSRWSAFRNQWLGEGGAGV
FT                   LVLLALWPFALLFPAAVPFGLGQVLERIDDTLQDWLLNTPFEDWLPLGDFAMTPLSLVT
FT                   EMLCVMLGLWIPCLLAYCAVRHMGRRALAGLLLVAAGVGVTALSAALSWGPAHAWEWVD
FT                   LPVRLGVWGGLGLAVIALPASRSMCAVLLLLVLVLHLSILNQAPTNVYFAQTLQAWEQG
FT                   RFIRFYGLGQWLGWLWPYVTLAYVVIRLSRRQQPA"
FT   gene            333737..334093
FT                   /locus_tag="CtCNB1_0297"
FT   CDS_pept        333737..334093
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0297"
FT                   /product="ferredoxin-like protein"
FT                   /note="COG3411, Ferredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31043"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:D0IWM5"
FT                   /protein_id="ACY31043.1"
FT                   /translation="MSDIQNQDQAGGYYQRHIFFCLNERPNGEDCCALHGAKAGFDHCK
FT                   RKVKEEGLAGKGLVRVNKAGCLDRCAGGPVAVVYPEAVWYTFIDDSDIDEIVESHLKNG
FT                   KVVERLVLPESVGR"
FT   gene            334255..334893
FT                   /locus_tag="CtCNB1_0298"
FT   CDS_pept        334255..334893
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0298"
FT                   /product="putative transmembrane protein"
FT                   /note="COG2945, Predicted hydrolase of the alpha/beta
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31044"
FT                   /db_xref="GOA:A0A454XNJ8"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454XNJ8"
FT                   /protein_id="ACY31044.1"
FT                   /translation="MNSQTERLTLTGTAGAIEALRDAPQLVEGQSPKGVAIIAHPHPLF
FT                   GGTMDNKVVQTLARAFVQCGYTVVRFNFRGVGASAGEYDAGKAELQDLLAVVQQVAPEG
FT                   PVALAGFSFGAFVTSHALAQLWGTGRVQKAVLVGTAASRFEVAPVPAEAHDQTLVIHGE
FT                   ADDTVELSAVMDWARPQILPVTVIPQVGHFFHGQLPLLKSLVVRHLKSL"
FT   gene            335045..335542
FT                   /locus_tag="CtCNB1_0299"
FT   CDS_pept        335045..335542
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0299"
FT                   /product="peptidase S11, D-alanyl-D-alanine"
FT                   /note="COG1686, DacC, D-alanyl-D-alanine carboxypeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31045"
FT                   /db_xref="GOA:D0IWM7"
FT                   /db_xref="InterPro:IPR001967"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR018044"
FT                   /db_xref="UniProtKB/TrEMBL:D0IWM7"
FT                   /protein_id="ACY31045.1"
FT                   /translation="MKPIYSTLRVLAVAAAVAPVFAMAQVAAPVPPEIAARNYLLVDVT
FT                   AGQVLGAKDVDAPVEQASLTKLMSAYVVFDALRSKKITLEQRMPVSERAWKMPGSRMFI
FT                   DPKMQVPVNDLLSGMIIQSGNDATMALAEAVGGTAENFVKMMNDQAKALGMKNTSYKNP
FT                   KD"
FT   gene            335599..336216
FT                   /locus_tag="CtCNB1_0300"
FT   CDS_pept        335599..336216
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0300"
FT                   /product="peptidase S11, D-alanyl-D-alanine"
FT                   /note="COG1686, DacC, D-alanyl-D-alanine carboxypeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31046"
FT                   /db_xref="GOA:D0IWM8"
FT                   /db_xref="InterPro:IPR001967"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR012907"
FT                   /db_xref="InterPro:IPR037167"
FT                   /db_xref="UniProtKB/TrEMBL:D0IWM8"
FT                   /protein_id="ACY31046.1"
FT                   /translation="MHDFPEYMHYYATKQYSYPGTPASNGSNRNALLFRDPTVDGLKTG
FT                   HTNAAGYCLVATAKRDLPNVGQRRLLSIVLGTASEKARANESQKLLNWGYTAFDAVKLF
FT                   DSDQPVATPAVWKGAANAVKIGKADGAVVVTVPSGTGGKLTTEVVRQDPLIAPIAKGQS
FT                   MGVLKVKSGADVVAEVPLVALEAVEQAGFFGRLWDTIRLWIK"
FT   gene            336563..336832
FT                   /locus_tag="CtCNB1_0301"
FT   CDS_pept        336563..336832
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0301"
FT                   /product="ribosomal protein S12"
FT                   /note="COG0048, RpsL, Ribosomal protein S12"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31047"
FT                   /db_xref="GOA:D0IWM9"
FT                   /db_xref="InterPro:IPR005679"
FT                   /db_xref="InterPro:IPR006032"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:D0IWM9"
FT                   /protein_id="ACY31047.1"
FT                   /translation="MYTTTPKKPNSALRKVAKVRLTNGFEVISYIGGEGHNLQEHSVVL
FT                   VRGGRVKDLPGVRYHIVRGSLDLQGVKDRKQARSKYGAKKPKAK"
FT   gene            337001..337474
FT                   /locus_tag="CtCNB1_0302"
FT   CDS_pept        337001..337474
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0302"
FT                   /product="ribosomal protein S7"
FT                   /note="COG0049, RpsG, Ribosomal protein S7"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31048"
FT                   /db_xref="GOA:A0A454XQ48"
FT                   /db_xref="InterPro:IPR000235"
FT                   /db_xref="InterPro:IPR005717"
FT                   /db_xref="InterPro:IPR020606"
FT                   /db_xref="InterPro:IPR023798"
FT                   /db_xref="InterPro:IPR036823"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454XQ48"
FT                   /protein_id="ACY31048.1"
FT                   /translation="MPRRREVPKREILPDPKFGNVELSKFMNVIMEGGKKAVAERIIYG
FT                   ALDLIEKKHPGKDPLEAFVVAINNVKPMVEVKSRRVGGANYQVPVEVRPVRRLALAMRW
FT                   IKEASRKRGEKSMAQRLANELLEATEGRGGAMKRRDEVHRMAEANKAFSHFRF"
FT   gene            337620..339728
FT                   /locus_tag="CtCNB1_0303"
FT   CDS_pept        337620..339728
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0303"
FT                   /product="translation elongation factor G"
FT                   /note="COG0480, FusA, Translation elongation factors
FT                   (GTPases)"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31049"
FT                   /db_xref="GOA:A0A454XMK9"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004540"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005517"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009022"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035649"
FT                   /db_xref="InterPro:IPR041095"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454XMK9"
FT                   /protein_id="ACY31049.1"
FT                   /translation="MARKTPIERYRNIGISAHIDAGKTTTTERILFYTGVTHKLGEVHD
FT                   GAATTDWMEQEQERGITITSAAVTCFWKGMDLSYPEHRFNIIDTPGHVDFTIEVERSMR
FT                   VLDGACMVYCAVGGVQPQSETVWRQANKYKVPRLAFVNKMDRTGANFFKVYEGMKTRLN
FT                   ANPVPVVIPIGAEENFQGVVDLVKMKAIIWDEASQGMKFEYQDIPAELVETANKWRENL
FT                   VEAAAEASEELMNKYLEEGTLTEEEVKLGVRTRTLATEIQPMLCGTAFKNKGVQRMLDA
FT                   VIDYLPAPVDIPDVTGTDPDDEEKKLSRKADDAEKFSALAFKLMTDPFVGQLTFVRVYS
FT                   GVLSKGETVLNAVKGKKERIGRIVQMMANDRVEVEEIRAGDIAACVGLKDVTTGETLCD
FT                   IAAPIVLERMVFPEPVIAQAVEPKSKTDQEKMGIALSRLAAEDPSFRVRTDEESGQTII
FT                   AGMGELHLEIIVDRMKREFNVEANVGKPQVAYRETIRSTVKDVDGKFVRQSGGKGQYGH
FT                   VVLTLEPQEAGKGFEFVDEIKGGVVPREYIPAVEKGVIEALTSGVLAGYPVVDVKVRLT
FT                   FGSYHDVDSNEMAFKMAAIFGFKEAARKANPVILEPMMAVEVETPEDYAGTVMGDLSSR
FT                   RGMVQGMDDMVGGGKAIKAEVPLSEMFGYATSLRSMTQGRASYTMEFKHYAEAPRNVAE
FT                   AIVAARAK"
FT   gene            339909..341099
FT                   /locus_tag="CtCNB1_0304"
FT   CDS_pept        339909..341099
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0304"
FT                   /product="translation elongation factor Tu"
FT                   /note="COG0050, TufB, GTPases - translation elongation
FT                   factors"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31050"
FT                   /db_xref="GOA:D0IWN2"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004160"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004541"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR033720"
FT                   /db_xref="InterPro:IPR041709"
FT                   /db_xref="UniProtKB/TrEMBL:D0IWN2"
FT                   /protein_id="ACY31050.1"
FT                   /translation="MAKEKFERTKPHVNVGTIGHVDHGKTTLTAAIATVLSKHFGGEAK
FT                   DYSQIDNAPEEKARGITINTSHVEYETANRHYAHVDCPGHADYVKNMITGAAQMDGAIL
FT                   VCSAADGPMPQTREHILLSRQVGVPYIIVFLNKADMVDDEELLELVEMEVRELLSKYDF
FT                   PGDDTPIIRGSAKLALEGDQSDKGEPAILKLAEALDTYIPTPERAVDGAFVMPVEDVFS
FT                   ISGRGTVVTGRIERGIVKVGEEIEIVGIKDTVKTTVTGVEMFRKLLDQGQAGDNVGLLL
FT                   RGTKREDVERGQVLCKPGSIKPHTNFTAEVYVLSKDEGGRHTPFFNNYRPQFYFRTTDV
FT                   AGSIELPEGKEMVMPGDNVSITVKLISPIAMEEGLRFAIREGGRTVGAGVVATIIA"
FT   gene            341125..341436
FT                   /locus_tag="CtCNB1_0305"
FT   CDS_pept        341125..341436
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0305"
FT                   /product="ribosomal protein S10"
FT                   /note="COG0051, RpsJ, Ribosomal protein S10"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31051"
FT                   /db_xref="GOA:A0A454Y6P5"
FT                   /db_xref="InterPro:IPR001848"
FT                   /db_xref="InterPro:IPR018268"
FT                   /db_xref="InterPro:IPR027486"
FT                   /db_xref="InterPro:IPR036838"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454Y6P5"
FT                   /protein_id="ACY31051.1"
FT                   /translation="MSKQKIRIRLKAFDYKLIDQSAAEIVDTAKRTGAIVKGPVPLPTR
FT                   MKRFDILRSPHVNKTSRDQFEIRTHQRLMDIVDPTDKTVDALMKLDLPAGVDVEIKLQ"
FT   gene            341637..342311
FT                   /locus_tag="CtCNB1_0306"
FT   CDS_pept        341637..342311
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0306"
FT                   /product="ribosomal protein L3"
FT                   /note="COG0087, RplC, Ribosomal protein L3"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31052"
FT                   /db_xref="GOA:A0A454XI17"
FT                   /db_xref="InterPro:IPR000597"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR019926"
FT                   /db_xref="InterPro:IPR019927"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454XI17"
FT                   /protein_id="ACY31052.1"
FT                   /translation="MSLSNSLGLLGRKVGMMRLFTDDGDAVPVTVVDVSNNRVTQVKTQ
FT                   ENDGYVALQVTFGARKASRVTKPQAGHLAKAGVEAGEVTREFRVTDETAGKYAAGAVLP
FT                   VAELFSVGQKVDVQGTSIGKGYAGTIKRHNFSSQRASHGNSRSHNVPGSIGMAQDPGRV
FT                   FPGKRMTGHMGDETVTTQNLDVVRIDEARQLLLIKGAIPGAKGGFVSVRPAIKAKASKG
FT                   AN"
FT   gene            342311..342934
FT                   /locus_tag="CtCNB1_0307"
FT   CDS_pept        342311..342934
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0307"
FT                   /product="ribosomal protein L4/L1e"
FT                   /note="COG0088, RplD, Ribosomal protein L4"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31053"
FT                   /db_xref="GOA:A0A454Y364"
FT                   /db_xref="InterPro:IPR002136"
FT                   /db_xref="InterPro:IPR013005"
FT                   /db_xref="InterPro:IPR023574"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454Y364"
FT                   /protein_id="ACY31053.1"
FT                   /translation="MQLELLNEQGQAASKVEAPETVFGREFNEDLVHQLVTAYRANARQ
FT                   GTRAQKDREQVRHTTAKPFKQKGTGRARAGMSSSPLWRGGGRIFPNLPEENFSQKINKK
FT                   MYRAGMASILSQLAREGRLAVVESLTLDTPKTKVLADKFKAMNLSSSVMVIAEEIDENL
FT                   YLASRNLKNVFVVEPRYADPVSLVHYKKVLVTKGAIDKLKEMFA"
FT   gene            342931..343245
FT                   /locus_tag="CtCNB1_0308"
FT   CDS_pept        342931..343245
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0308"
FT                   /product="ribosomal protein L25/L23"
FT                   /note="COG0089, RplW, Ribosomal protein L23"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31054"
FT                   /db_xref="GOA:A0A454Y6V8"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR012678"
FT                   /db_xref="InterPro:IPR013025"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454Y6V8"
FT                   /protein_id="ACY31054.1"
FT                   /translation="MSTTKFDEGRLMQVLVAPIVSEKATLVAEKSNAVTFKVLQNATKP
FT                   EIKAAVELMFKVEVAGVSVVNTKGKTKRFGKTVGRRDNVRKAYVMLKPGQELNLSGEAA
FT                   "
FT   gene            343296..344072
FT                   /locus_tag="CtCNB1_0309"
FT   CDS_pept        343296..344072
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0309"
FT                   /product="ribosomal protein L2"
FT                   /note="COG0090, RplB, Ribosomal protein L2"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31055"
FT                   /db_xref="GOA:D0IWN7"
FT                   /db_xref="InterPro:IPR002171"
FT                   /db_xref="InterPro:IPR005880"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR014726"
FT                   /db_xref="InterPro:IPR022666"
FT                   /db_xref="InterPro:IPR022669"
FT                   /db_xref="InterPro:IPR022671"
FT                   /db_xref="UniProtKB/TrEMBL:D0IWN7"
FT                   /protein_id="ACY31055.1"
FT                   /translation="MKVTRDHLHKGEGFAPLLEAQFQKAGRNNNGHITTRHKGGGHKHH
FT                   YRVVDFKRNKDGIPAKVERIEYDPNRTAHIALVCYADGERRYVIAPRNLEVGATIISGS
FT                   EAPIRVGNTLPIRNIPVGSTIHCIELKIGAGAQIARSAGTSATLLAREGIYAQVRMRSG
FT                   EVRKVHIECRATIGEVANEEHSLRRLGKAGVKRWMGIRPTVRGTVMNPVDHPHGGGEGK
FT                   TGEGRHPVDPWGNLTKGYRTRNNKRTQTMIVSRRKK"
FT   gene            344125..344358
FT                   /locus_tag="CtCNB1_0310"
FT   CDS_pept        344125..344358
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0310"
FT                   /product="ribosomal protein S19"
FT                   /note="COG0185, RpsS, Ribosomal protein S19"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31056"
FT                   /db_xref="GOA:D0IWN8"
FT                   /db_xref="InterPro:IPR002222"
FT                   /db_xref="InterPro:IPR005732"
FT                   /db_xref="InterPro:IPR020934"
FT                   /db_xref="InterPro:IPR023575"
FT                   /db_xref="UniProtKB/TrEMBL:D0IWN8"
FT                   /protein_id="ACY31056.1"
FT                   /translation="MLAKVEKAIATKDKKPVKTWSRRSMVLPEFIGLTIAVHNGKQHVP
FT                   VYVTDQMVGHKLGEFALTRTFKGHPADKKAKK"
FT   gene            344369..344701
FT                   /locus_tag="CtCNB1_0311"
FT   CDS_pept        344369..344701
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0311"
FT                   /product="ribosomal protein L22"
FT                   /note="COG0091, RplV, Ribosomal protein L22"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31057"
FT                   /db_xref="GOA:A0A454Y7I1"
FT                   /db_xref="InterPro:IPR001063"
FT                   /db_xref="InterPro:IPR005727"
FT                   /db_xref="InterPro:IPR018260"
FT                   /db_xref="InterPro:IPR036394"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454Y7I1"
FT                   /protein_id="ACY31057.1"
FT                   /translation="MSETRAVLRGVRLSVDKGRLVADLIRGKKVDQALNILQFTQKKAA
FT                   VIVKKVLESAIANAEHNDGADIDELKVKTIYVEQGTTLKRFTARAKGRGNRISKPTCHI
FT                   YVTVGN"
FT   gene            344718..345587
FT                   /locus_tag="CtCNB1_0312"
FT   CDS_pept        344718..345587
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0312"
FT                   /product="ribosomal protein S3"
FT                   /note="COG0092, RpsC, Ribosomal protein S3"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31058"
FT                   /db_xref="GOA:A0A454Y1U9"
FT                   /db_xref="InterPro:IPR001351"
FT                   /db_xref="InterPro:IPR004044"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR005704"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR018280"
FT                   /db_xref="InterPro:IPR036419"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454Y1U9"
FT                   /protein_id="ACY31058.1"
FT                   /translation="MGQKIHPTGFRLAVSRNWASRWYASNRDFAGMLAEDIKVREYLKA
FT                   KLKNAAVARVLIERPAKNARITIFSARPGVVIGKKGEDIEALKKELAARLGVPVAVNIE
FT                   EVRKPEIDAKLIADSICQQLEKRIMFRRAMKRAMQNAMRLGAQGIKIMSSGRLNGIEIA
FT                   RTEWYREGRVPLHTLRADIDYGFSEAKTTYGIIGVKVWVYKGDTLGRNDLPAVETPRPE
FT                   DERRPRGPRRDGRRDGRDGAGRGGRRPAGTNAAPADGSDKPAGAGADSVKRVRKADAPA
FT                   TAADGKGE"
FT   gene            345590..346006
FT                   /locus_tag="CtCNB1_0313"
FT   CDS_pept        345590..346006
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0313"
FT                   /product="ribosomal protein L16"
FT                   /note="COG0197, RplP, Ribosomal protein L16/L10E"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31059"
FT                   /db_xref="GOA:A0A454Y4B9"
FT                   /db_xref="InterPro:IPR000114"
FT                   /db_xref="InterPro:IPR016180"
FT                   /db_xref="InterPro:IPR020798"
FT                   /db_xref="InterPro:IPR036920"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454Y4B9"
FT                   /protein_id="ACY31059.1"
FT                   /translation="MLQPARRKFRKEQKGRNTGIATRGNSVAFGDFGLKSTDRGRLTAR
FT                   QIEAARRAISRHVKRGGRIWIRVFPDKPISTKPAEVRMGNGKGNPEYYVAEIQPGKVIY
FT                   EIVGVPEELAREAFRLAAAKLPLRTTFVSRHIGA"
FT   gene            346017..346214
FT                   /locus_tag="CtCNB1_0314"
FT   CDS_pept        346017..346214
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0314"
FT                   /product="ribosomal protein L29"
FT                   /note="COG0255, RpmC, Ribosomal protein L29"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31060"
FT                   /db_xref="GOA:A0A454XTK1"
FT                   /db_xref="InterPro:IPR001854"
FT                   /db_xref="InterPro:IPR018254"
FT                   /db_xref="InterPro:IPR036049"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454XTK1"
FT                   /protein_id="ACY31060.1"
FT                   /translation="MTKSAELRQKDVAGLEAEVKSLQKAHFGLRMQKATQQLGNTATIK
FT                   ATRRDIARAKTILAEKQAAK"
FT   gene            346224..346493
FT                   /locus_tag="CtCNB1_0315"
FT   CDS_pept        346224..346493
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0315"
FT                   /product="ribosomal protein S17"
FT                   /note="COG0186, RpsQ, Ribosomal protein S17"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31061"
FT                   /db_xref="GOA:A0A454XTB4"
FT                   /db_xref="InterPro:IPR000266"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019979"
FT                   /db_xref="InterPro:IPR019984"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454XTB4"
FT                   /protein_id="ACY31061.1"
FT                   /translation="MTEAKTSLKRTLIGKVVSDKRAKTVTVLVERRVKHPIYDKIMIKS
FT                   SKYHAHDEQGEYKLGDVVEITESRPLSKTKNWVATRLVQKAALV"
FT   gene            346610..347116
FT                   /locus_tag="CtCNB1_0316"
FT   CDS_pept        346610..347116
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0316"
FT                   /product="Redoxin"
FT                   /note="COG0678, AHP1, Peroxiredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31062"
FT                   /db_xref="GOA:A0A454XRW2"
FT                   /db_xref="InterPro:IPR013740"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR037944"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454XRW2"
FT                   /protein_id="ACY31062.1"
FT                   /translation="MIKVGDALPAVTLMEYVEVEGNGCSLGPNPVKLPEALAGKTIAVF
FT                   AVPGAFTPTCSEKHLPGYVAKAEELKAAGVDEIWCLAVNDAFVMGAWGRDQKVAGKVRM
FT                   IADGDAAFAKATGLTLDLNGKGLGLRANRFSMLVKDGKVATLNVEAPGKFEVSDAGTML
FT                   AQAKA"
FT   gene            complement(347233..347721)
FT                   /locus_tag="CtCNB1_0317"
FT   CDS_pept        complement(347233..347721)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0317"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="COG0456, RimI, Acetyltransferases"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31063"
FT                   /db_xref="GOA:D0IXG8"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D0IXG8"
FT                   /protein_id="ACY31063.1"
FT                   /translation="MDKPAVDLLTPSLEEIGAVRQIFQEYADSLNIDLEFQGFESELAA
FT                   LPGEYAAPRGQILLARVDGSIAGCCALRPLDDSDYPNAAEMKRLFVRKAFRGFGLGRQL
FT                   AEAMLDIARQAGYDHVLLDTLDDMESARALYVDLGFEPIEPYYHNPLPGAHYLKADLF"
FT   gene            complement(347805..348539)
FT                   /locus_tag="CtCNB1_0318"
FT   CDS_pept        complement(347805..348539)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0318"
FT                   /product="cytochrome B561"
FT                   /note="COG3658, Cytochrome b"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31064"
FT                   /db_xref="GOA:D0IXG9"
FT                   /db_xref="InterPro:IPR011577"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="UniProtKB/TrEMBL:D0IXG9"
FT                   /protein_id="ACY31064.1"
FT                   /translation="MSGSISHEKAMTESATQASTEIHRIRIWDLPTRLFHWLLAICIVA
FT                   LVVTAKMGGNAMNWHLLLGQVVLALLIFRILWGLVGGYWSRFGSFIPSAAAMSRYMRGT
FT                   STTQDRAGHNPLGSLSVIAMLIVLMAQIASGLMSDDEIAFSGPLTRFVSGELISKATNY
FT                   HAHWGQYLIYALVALHLLALIGYSLKGDKLVPAMVTGDKLLEEPVAASRDTASTRVLAA
FT                   LLAVVASSLSWWVHQLGQSAAF"
FT   gene            348647..349093
FT                   /locus_tag="CtCNB1_0319"
FT   CDS_pept        348647..349093
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0319"
FT                   /product="cytochrome c, class II"
FT                   /note="COG3909, Cytochrome c556"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31065"
FT                   /db_xref="GOA:D0IXH0"
FT                   /db_xref="InterPro:IPR002321"
FT                   /db_xref="InterPro:IPR010980"
FT                   /db_xref="InterPro:IPR012127"
FT                   /db_xref="UniProtKB/TrEMBL:D0IXH0"
FT                   /protein_id="ACY31065.1"
FT                   /translation="MKAFSTLAFAAVVATVALPASAQFAKAEDAIKYRQSALSVLGTHF
FT                   GRLGAMANGKMPFDAKSAQESAEIVAFMSKLPWAGFGAGTEGGKAKPEVWKEQAKFHDL
FT                   SGKMEAEVVKLNAAAKTGNLDNLKTAFGPAANSCKSCHDSFRNK"
FT   gene            complement(349279..349791)
FT                   /locus_tag="CtCNB1_0320"
FT   CDS_pept        complement(349279..349791)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0320"
FT                   /product="Redoxin"
FT                   /note="COG1225, Bcp, Peroxiredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31066"
FT                   /db_xref="GOA:D0IXH1"
FT                   /db_xref="InterPro:IPR013740"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:D0IXH1"
FT                   /protein_id="ACY31066.1"
FT                   /translation="MASKHWIAGIVAAAVIGVGAWVYSGAGQAAAPQSTFVLLDGSQKT
FT                   TADLKGRVTLVNFWATSCTTCVAEMPEIISTYQKYQDKGFDTLAVAMSYDPPSYVVNFV
FT                   ESRKLPFQVALDNTGNVAKAWGDVQLTPTTFIVNKRGEIVKRYIGAPDFEQLHKLIEKL
FT                   LAEPAAA"
FT   gene            349943..350506
FT                   /locus_tag="CtCNB1_0321"
FT   CDS_pept        349943..350506
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0321"
FT                   /product="conserved hypothetical protein"
FT                   /note="COG0318, CaiC, Acyl-CoA synthetases
FT                   (AMP-forming)/AMP-acid ligasesII"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31067"
FT                   /db_xref="UniProtKB/TrEMBL:D0IXH2"
FT                   /protein_id="ACY31067.1"
FT                   /translation="MKKTGLWAATLLVSGALLAACSPALNWRTTQLKDAPLQALLPCDA
FT                   QTASRPVDLGLGQVPLSVVGCEARGATYAVSHFAVAEPARAAEALTFWQQAVLKQLKSA
FT                   DGVATKLNVKGDGPWVPKGALNLPQSLRITFEGQGPSGQKVVGHGLWFARLEGGGARVY
FT                   HAVIYADKAMPAEAELFFSGLQLQ"
FT   gene            350604..351059
FT                   /locus_tag="CtCNB1_0322"
FT   CDS_pept        350604..351059
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0322"
FT                   /product="PTS system fructose subfamily IIA component"
FT                   /note="COG2893, ManX, Phosphotransferase system"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31068"
FT                   /db_xref="GOA:D0IXH3"
FT                   /db_xref="InterPro:IPR004701"
FT                   /db_xref="InterPro:IPR036662"
FT                   /db_xref="UniProtKB/TrEMBL:D0IXH3"
FT                   /protein_id="ACY31068.1"
FT                   /translation="MTTRILLLTHAPLAAALRECALHVFADSADDLLALDVPSDEAPEA
FT                   TLERALAMLVAHGGLDAPTLVLTDLFGATPCNVAQRLTGLLQARLVAGVNLPMLLRSIG
FT                   YRHEPLDALVSRAMVGGSQGVMQVAGSSRQNQSARPSNDQDQYHHQQ"
FT   gene            351061..351297
FT                   /locus_tag="CtCNB1_0323"
FT   CDS_pept        351061..351297
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0323"
FT                   /product="Phosphotransferase system, HPr-related protein"
FT                   /note="COG1925, FruB, Phosphotransferase system"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31069"
FT                   /db_xref="GOA:D0IXH4"
FT                   /db_xref="InterPro:IPR000032"
FT                   /db_xref="InterPro:IPR001020"
FT                   /db_xref="InterPro:IPR002114"
FT                   /db_xref="InterPro:IPR035895"
FT                   /db_xref="UniProtKB/TrEMBL:D0IXH4"
FT                   /protein_id="ACY31069.1"
FT                   /translation="MGLHARASAKLTKLAGSFPCEVWLTKGERRVNAKSIMGVMMLAAG
FT                   IGSELELETDGAQEQEATDALVALINDKFGEGQ"
FT   gene            351581..353278
FT                   /locus_tag="CtCNB1_0324"
FT   CDS_pept        351581..353278
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0324"
FT                   /product="phosphoenolpyruvate-protein phosphotransferase"
FT                   /note="COG1080, PtsA, Phosphoenolpyruvate-protein kinase
FT                   (PTS system EI component in bacteria)"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31070"
FT                   /db_xref="GOA:D0IXH5"
FT                   /db_xref="InterPro:IPR000121"
FT                   /db_xref="InterPro:IPR006318"
FT                   /db_xref="InterPro:IPR008279"
FT                   /db_xref="InterPro:IPR008731"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018274"
FT                   /db_xref="InterPro:IPR023151"
FT                   /db_xref="InterPro:IPR024692"
FT                   /db_xref="InterPro:IPR036618"
FT                   /db_xref="InterPro:IPR036637"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:D0IXH5"
FT                   /protein_id="ACY31070.1"
FT                   /translation="MEVVHYFIRPDQVESEIQRARTARNAVIDELRRLQEEMPKDAPGE
FT                   LDALLDVHLMLLQDQALAEAIRNWISERLYNAEWALTTQLEIVSRQFDEMDDEYLRERK
FT                   ADLEQVVERILRHMKGAASPLAQVAPPLAPMGAVPATDGQQLPLDVTTETPLVLVAQDL
FT                   SPADMLQFKSKVFAGFITAVGGKTSHTAIVARSMDIPAVVGARAASQLIRQDDWVIIDG
FT                   NEGVVIVDPTPIILAEYSFRQRQTELERERLTRLRYTPSLTMDGQKVELLANIEQPSDG
FT                   AAAVRAGAVGVGLFRTEFLFMGRSGNLPGEEEQYRAYREAIDGMQGMPVTIRTLDVGAD
FT                   KPLDKAQPKDYYLNPALGLRAIRWSLADPVMFRTQLRAILRAAVHGQIKLLFPMLAHRS
FT                   EIEQTLAQLRQAQHELDVRGVAYGPVKLGAMIEIPAAALTVRSFLQYFDFLSIGTNDLI
FT                   QYTLAIDRADETVAHLYDPMHPAVLRLVAEVIAAANAAGKEVSVCGEMAGDLSMTRLLL
FT                   GLGLRSFSMHPAQILAVKQEVLRADSSKLAPWASEVLGSECPAQMLAP"
FT   gene            353321..354370
FT                   /locus_tag="CtCNB1_0325"
FT   CDS_pept        353321..354370
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0325"
FT                   /product="conserved hypothetical protein"
FT                   /note="COG3878, Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31071"
FT                   /db_xref="InterPro:IPR015315"
FT                   /db_xref="InterPro:IPR035948"
FT                   /db_xref="UniProtKB/TrEMBL:D0IXH6"
FT                   /protein_id="ACY31071.1"
FT                   /translation="MNYAHSQEIARALEPVLEDAALAQQLAEQARPAVWLQTTAVEDEA
FT                   EIASGSTKLGGCPDLPAGVAWPERGRYPDHEQRVKPHREDSLAPDSRWRWARPEQVLLF
FT                   RKEALQHVARLESTFPLSFVAQINFAEARSAGTLDADFPESGLLSVFYDLMEQPWGFNP
FT                   ADACALKLIFSEGDAELERRPQPPALLELPDHCRLAPMACELHACITALPLESAQWDSQ
FT                   GLALDEEQRDRFVEWWFDDAQNAASSGGEDSGCHRIGGWPTPVQGDMQTECALVAAGHY
FT                   CGNGDAYADEATRAVRDTATQWLLLLQIGSDEKGGMGWGDGGQVYLWMRRDDLRARRFD
FT                   RVRLVLQCC"
FT   gene            complement(354858..355838)
FT                   /locus_tag="CtCNB1_0326"
FT   CDS_pept        complement(354858..355838)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0326"
FT                   /product="lipoic acid synthetase"
FT                   /note="COG0320, LipA, Lipoate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31072"
FT                   /db_xref="GOA:A0A454Y738"
FT                   /db_xref="InterPro:IPR003698"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR031691"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454Y738"
FT                   /protein_id="ACY31072.1"
FT                   /translation="MSTNEVVREAQSAENYNPLAKQKAAAKLARIPVKVEQAEVLKKPE
FT                   WIRVKAGSPSTRFYEIKDILRKNNLHTVCEEASCPNIGECFGKGTATFMIMGDKCTRRC
FT                   PFCDVGHGRPDPLDVNEPLNLARTIAALRLKYVVITSVDRDDLRDGGSGHFVECIKNIR
FT                   ELSPETQIEILVPDFRGRDDRALEILKSAPPDVMNHNLETAPRLYKEARPGSDYQFSLN
FT                   LLKKFKELHPDVPTKSGIMVGLGETDEEILQVMRDMRAHNIDMLTIGQYLAPTNSHLPV
FT                   RRYVHPDTFKMFEQEAYKMGFTHAAVGAMVRSSYHADQQAHAAGV"
FT   gene            complement(355849..356586)
FT                   /locus_tag="CtCNB1_0327"
FT   CDS_pept        complement(355849..356586)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0327"
FT                   /product="lipoate-protein ligase B"
FT                   /note="COG0321, LipB, Lipoate-protein ligase B"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31073"
FT                   /db_xref="GOA:D0IXH8"
FT                   /db_xref="InterPro:IPR000544"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="InterPro:IPR020605"
FT                   /db_xref="UniProtKB/TrEMBL:D0IXH8"
FT                   /protein_id="ACY31073.1"
FT                   /translation="MSNSPIASALQPPEAMDLRFLGRTGYEATVVAMQEFTRTRNSATR
FT                   DEVWMCEHSPHFTQGLAGKIENVLNPGDIPVVATNRGGQVTYHGPGQVVAYPLLDLQRM
FT                   GYFVKEYVYRLEDAVIRTLDHFGVTGHRVAGAPGIYVRLDDPRSHAMLEQRPQHREPGS
FT                   PAPEPHFEGLGKIAALGIKVSRHSTYHGVALNVDMDLEPYLRINPCGYAGLRTVDLSTI
FT                   GVQTTWDEAASVLGRQLKARLSP"
FT   gene            complement(356583..356900)
FT                   /locus_tag="CtCNB1_0328"
FT   CDS_pept        complement(356583..356900)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0328"
FT                   /product="hypothetical conserved protein"
FT                   /note="COG2921, Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31074"
FT                   /db_xref="InterPro:IPR007454"
FT                   /db_xref="InterPro:IPR027471"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454Y4M3"
FT                   /protein_id="ACY31074.1"
FT                   /translation="MSDTPNPSAANENGQQEDPRKDSLIEYPSQFPIKVMGVKNEHLVH
FT                   EITKIAEKFDPSFDASTVELRPSSGGNYLGVTITITATSREQLDDTYRALTSHPLVKVV
FT                   L"
FT   gene            357279..357743
FT                   /locus_tag="CtCNB1_0329"
FT   CDS_pept        357279..357743
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0329"
FT                   /product="putative ATP synthase protein I"
FT                   /note="COG3312, AtpI, F0F1-type ATP synthase"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31075"
FT                   /db_xref="InterPro:IPR005598"
FT                   /db_xref="UniProtKB/TrEMBL:D0IXI0"
FT                   /protein_id="ACY31075.1"
FT                   /translation="MPADFQDEDEVEDFKPLTAQEASAWRSRFPQVSVWRIVIVQTLVG
FT                   VIVALLSWLMTGRAAAGWSAAYGALAVVLPAALFARGVVRQRPGGAGAAMAGIFGWELV
FT                   KLVLCIAMLAAAPKLVPDLSWLALLAGLIVVMKTYWVALLVRSSVRKTEA"
FT   gene            357758..358621
FT                   /locus_tag="CtCNB1_0330"
FT   CDS_pept        357758..358621
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0330"
FT                   /product="ATP synthase F0, A subunit"
FT                   /note="COG0356, AtpB, F0F1-type ATP synthase"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31076"
FT                   /db_xref="GOA:A0A454Y0F4"
FT                   /db_xref="InterPro:IPR000568"
FT                   /db_xref="InterPro:IPR023011"
FT                   /db_xref="InterPro:IPR035908"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454Y0F4"
FT                   /protein_id="ACY31076.1"
FT                   /translation="MAADAHAPTASEYIVHHLQHLQNIKQKSVIDFSVINYDSIVVAGV
FT                   LGLLGIFVLWLAARKATSGVPGRFQAAVEILVEMVDNQAKANIHNAQSRKFIAPLALTV
FT                   FVWIFLMNAMDMLPVDLLPYLWQGATADEHAYLRVVPTADLSTTLGLSFAVLVLCLFYS
FT                   VKIKGMGGWAHELVTAPFGTSKNPVFALILGVVNLLMQVIEYVAKTVSHGMRLFGNMYA
FT                   GELVFMLIALMGGAAAMSLSGVLLPVGHIIAGSIWAIFHILVITLQAFIFMMLTLIYLG
FT                   QAHEAH"
FT   gene            358668..358919
FT                   /locus_tag="CtCNB1_0331"
FT   CDS_pept        358668..358919
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0331"
FT                   /product="ATP synthase F0, C subunit"
FT                   /note="COG0636, AtpE, F0F1-type ATP synthase"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31077"
FT                   /db_xref="GOA:A0A454XYA7"
FT                   /db_xref="InterPro:IPR000454"
FT                   /db_xref="InterPro:IPR002379"
FT                   /db_xref="InterPro:IPR005953"
FT                   /db_xref="InterPro:IPR020537"
FT                   /db_xref="InterPro:IPR035921"
FT                   /db_xref="InterPro:IPR038662"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454XYA7"
FT                   /protein_id="ACY31077.1"
FT                   /translation="MENVLGLVALACGLIVGLGAIGASIGIALMGGKFLESSARQPELI
FT                   NELQTKMFILAGLIDAAFLIGVAIALLFAFANPFQLVA"
FT   gene            358955..359425
FT                   /locus_tag="CtCNB1_0332"
FT   CDS_pept        358955..359425
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0332"
FT                   /product="ATP synthase F0, B subunit"
FT                   /note="COG0711, AtpF, F0F1-type ATP synthase"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31078"
FT                   /db_xref="GOA:A0A454XKK3"
FT                   /db_xref="InterPro:IPR002146"
FT                   /db_xref="InterPro:IPR005864"
FT                   /db_xref="InterPro:IPR028987"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454XKK3"
FT                   /protein_id="ACY31078.1"
FT                   /translation="MSINATLFVQAIVFLILVLFTMKLVWPPIAKALDERAQKIADGLA
FT                   AADKAKTELTAVNKRVEQELAQTRNETASRLADAERRAQAIIEEAKARATEEGNKIVAA
FT                   ARAEADQQAIAAREALREQVAALAVKGAEQILKKEVNAGIHADLLNRLKTEL"
FT   gene            359438..359977
FT                   /locus_tag="CtCNB1_0333"
FT   CDS_pept        359438..359977
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0333"
FT                   /product="ATP synthase F1, delta subunit"
FT                   /note="COG0712, AtpH, F0F1-type ATP synthase"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31079"
FT                   /db_xref="GOA:A0A454XMB7"
FT                   /db_xref="InterPro:IPR000711"
FT                   /db_xref="InterPro:IPR026015"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454XMB7"
FT                   /protein_id="ACY31079.1"
FT                   /translation="MAELATIARPYAEALFKACADKAADLNSTVAWVEELAAIAANPQL
FT                   RQLADNPNVSDAQVFDLITGVAKSALPESARNFLRVVLENGRLDVLPEVAAQFRSLVNS
FT                   KSGSSDAVVYSAFPIEDAALAELGATLEKRFGRKLNLTVKLDESLIGGVRVVVGDEVLD
FT                   TSVKARLEQMKAALTA"
FT   gene            360023..361582
FT                   /locus_tag="CtCNB1_0334"
FT   CDS_pept        360023..361582
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0334"
FT                   /product="ATP synthase F1, alpha subunit"
FT                   /note="COG0056, AtpA, F0F1-type ATP synthase"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31080"
FT                   /db_xref="GOA:D0IXI5"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR000793"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005294"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR023366"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033732"
FT                   /db_xref="InterPro:IPR036121"
FT                   /db_xref="InterPro:IPR038376"
FT                   /db_xref="UniProtKB/TrEMBL:D0IXI5"
FT                   /protein_id="ACY31080.1"
FT                   /translation="MQLNPAEISELIKSRIEGLAASTDVRNQGTVVSVTDGIVRVHGLS
FT                   DVMAGEMLEFPAGADGQPTYGLALNLERDSVGAVILGAYEHIAEGNTVKCTGRILEVPV
FT                   GPELVGRVVNALGQPIDGKGPINAKMTDVIEKVAPGVIARQSVDQPLQTGIKSIDSMVP
FT                   VGRGQRELIIGDRQTGKTAVAIDAIINQKGQGVICIYVAIGQKASSIKNVVRSLEQAGA
FT                   MDYTIVVAATASESAAMQYVSAYAGCTMGEYFRDRGEDALIVYDDLSKQAVAYRQVSLL
FT                   LRRPPGREAFPGDVFYLHSRLLERAARVNADYVEAFTKGEVKGKTGSLTALPIIETQAG
FT                   DVSAFVPTNVISITDGQIFLETSLFNAGIRPAINAGISVSRVGGSAQTKVVKGLSGGIR
FT                   TDLAQYRELAAFAQFASDLDDATRKQLDRGARVTELLKQAQYSPLSTALMAASLFAVNK
FT                   GFMDDIEVKQVLPFESGLHQFLKTSHGALLDRLNEKRAFDKEGKDEAELTAAITAFKKS
FT                   FA"
FT   gene            361601..362467
FT                   /locus_tag="CtCNB1_0335"
FT   CDS_pept        361601..362467
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0335"
FT                   /product="ATP synthase F1, gamma subunit"
FT                   /note="COG0224, AtpG, F0F1-type ATP synthase"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31081"
FT                   /db_xref="GOA:D0IXI6"
FT                   /db_xref="InterPro:IPR000131"
FT                   /db_xref="InterPro:IPR023632"
FT                   /db_xref="InterPro:IPR035968"
FT                   /db_xref="UniProtKB/TrEMBL:D0IXI6"
FT                   /protein_id="ACY31081.1"
FT                   /translation="MAAGKEIRGKIKSVENTKKITKAMEMVAASKMRKAQDRMLAARPY
FT                   SEKIRNIAAHLGEANPEYVHPFMQVNDAKKVGVIVVTTDKGLCGGMNTNVLRVVTNKLR
FT                   ELQDAGVATDAVAIGGKGLGFLNRVGAKVVSHATGLGDTPHLDKLIGPVKVLLDQYAEG
FT                   KLSAVYLAYTKFINTMKQESVVEQLLPLSSEKLQAEKTGTSWEYIYEPDAQSVIDELLV
FT                   RYVESLVYQAVAENMASEQSARMVAMKAATDNAGNVISELKLVYNKTRQAAITTELSEI
FT                   VAGAAAV"
FT   gene            362502..363911
FT                   /locus_tag="CtCNB1_0336"
FT   CDS_pept        362502..363911
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0336"
FT                   /product="ATP synthase F1, beta subunit"
FT                   /note="COG0055, AtpD, F0F1-type ATP synthase"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31082"
FT                   /db_xref="GOA:A0A454Y4Y2"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005722"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR024034"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036121"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454Y4Y2"
FT                   /protein_id="ACY31082.1"
FT                   /translation="MAQVQGKIVQCIGAVVDVEFAHGQVPKVYDALKLEGSALTLEVQQ
FT                   QLGDGVVRTIALGSSDGLKRGLMVTNTGNPITVPVGKATLGRIMDVLGNPIDERGPVDQ
FT                   TLTAAIHRKAPAYDELSPSQELLETGIKVIDLVCPFAKGGKVGLFGGAGVGKTVNMMEL
FT                   INNIAKAHSGLSVFAGVGERTREGNDFYHEMSDAGVVNQENLGESKVAMVYGQMNEPPG
FT                   NRLRVALTGLTMAESFRDEGKDVLFFVDNIYRYTLAGTEVSALLGRMPSAVGYQPTLAE
FT                   EMGKLQERITSTKVGSITSIQAVYVPADDLTDPSPATTFAHLDSTVVLSRDIASLGIYP
FT                   AVDPLDSTSRQLDPQVVGEEHYKVARQVQGTLQRYKELRDIIAILGMDELAPEDKLTVA
FT                   RARKIQRFLSQPFHVAEVFTGAPGKYVPLSETIRGFKMIVNGEADHLPEQAFYMVGTID
FT                   EAFEKAKKLAA"
FT   gene            364062..364478
FT                   /locus_tag="CtCNB1_0337"
FT   CDS_pept        364062..364478
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0337"
FT                   /product="ATP synthase F1, epsilon subunit"
FT                   /note="COG0355, AtpC, F0F1-type ATP synthase"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31083"
FT                   /db_xref="GOA:A0A454XUZ5"
FT                   /db_xref="InterPro:IPR001469"
FT                   /db_xref="InterPro:IPR020546"
FT                   /db_xref="InterPro:IPR020547"
FT                   /db_xref="InterPro:IPR036771"
FT                   /db_xref="InterPro:IPR036794"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454XUZ5"
FT                   /protein_id="ACY31083.1"
FT                   /translation="MNTIHVDVVSAEESIFSGEARFVALPGEAGELGIYPRHTPLITRI
FT                   KPGSVRIEMPDGSEEFVFVAGGILEVQPNCVTVLSDTAIRGKDLDDEKAQKAKAAAEEA
FT                   LKNAKGELDIARAQSELAVMAAQIAALRKYRQKR"
FT   gene            complement(364641..364910)
FT                   /locus_tag="CtCNB1_0338"
FT   CDS_pept        complement(364641..364910)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0338"
FT                   /product="hypothetical protein"
FT                   /note="COG2913, SmpA, Small protein A (tmRNA-binding)"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31084"
FT                   /db_xref="UniProtKB/TrEMBL:D0IXI9"
FT                   /protein_id="ACY31084.1"
FT                   /translation="MQKSLFSLAVISSVLALSACSSISPRGAEAPAEYDYALSCKLKED
FT                   DPKKCEAQIRALCEDPSKAVVRKSRHVDPKDNSVVYGYQAACNG"
FT   gene            365052..365726
FT                   /locus_tag="CtCNB1_0339"
FT   CDS_pept        365052..365726
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0339"
FT                   /product="cold-shock DNA-binding domain protein"
FT                   /note="COG3326, Predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31085"
FT                   /db_xref="GOA:D0IXJ0"
FT                   /db_xref="InterPro:IPR002059"
FT                   /db_xref="InterPro:IPR010718"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:D0IXJ0"
FT                   /protein_id="ACY31085.1"
FT                   /translation="MRYSGTLTQWNDERGFGWIEADGGGERLFVHISAFEPRPPAEQRP
FT                   QPGLRLEFSVGMEQGRKRALQVAWRAGGPVPQARSSSVRRNSPSAGRLQSSRAVPQGWH
FT                   ASSGFSYGVLLVWLLMMLATAVIWGIPRILWLIYAGLSMLTFMAYWQDKWAAQKGQWRT
FT                   PEKTLQTMALAGGWPGALLAQQWLRHKSSKTSFQLQFWLMVLINVAAVLWLCSPYGRHV
FT                   LA"
FT   gene            complement(365771..366310)
FT                   /locus_tag="CtCNB1_0340"
FT   CDS_pept        complement(365771..366310)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0340"
FT                   /product="hypothetical transmembrane protein"
FT                   /note="COG3762, Predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31086"
FT                   /db_xref="GOA:D0IXJ1"
FT                   /db_xref="InterPro:IPR007621"
FT                   /db_xref="UniProtKB/TrEMBL:D0IXJ1"
FT                   /protein_id="ACY31086.1"
FT                   /translation="MSNVFQRLARLVRHRWAEQHLRKALPPATLKELELLIAKSELGHT
FT                   GQVRICVEAGLPWSYIWRDATARERALSQFAKLHVWDTEHNNGALIYLLLADHAIEIVA
FT                   DRALDRTMNAEQWQTLISDMQSAFQGGHFSVGLVSALERVNRQLQAHFPRKSAANTQRN
FT                   LPDTPVIQRHLPGRSR"
FT   gene            complement(366312..367244)
FT                   /locus_tag="CtCNB1_0341"
FT   CDS_pept        complement(366312..367244)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0341"
FT                   /product="methanol dehydrogenase"
FT                   /note="COG1512, Beta-propeller domains of methanol
FT                   dehydrogenase type"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31087"
FT                   /db_xref="GOA:D0IXJ2"
FT                   /db_xref="InterPro:IPR007621"
FT                   /db_xref="UniProtKB/TrEMBL:D0IXJ2"
FT                   /protein_id="ACY31087.1"
FT                   /translation="MQKSHQALIYKALAAIVFASMVLLSALPALAQGGAGAQLQAVPEL
FT                   TARVIDQTGTLSQSDQQALSEQLKKLEDETGAQVAVLMVATTAPEDIAAYAWRVASSWK
FT                   LGRKDIGDGSLIVVAKNDRRMRIEVARKLEGAIPDIQAARIIDGAMKPRFRADDYAGGL
FT                   SAAIEQMSLLIHGEKLPAPQSQARKSGPSWSEHLDFLLPLLFFGFPIGIAVARAIFGRV
FT                   LGSLLIGGIAGAAAYVVTTSLLIAGVAGFLGLIFTLLSNLSRGGGGPYISTGGGGWSSG
FT                   GGGGGFSSGGGFSSGGGGSFGGGGASGDW"
FT   gene            complement(367269..367886)
FT                   /locus_tag="CtCNB1_0342"
FT   CDS_pept        complement(367269..367886)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0342"
FT                   /product="LemA, Uncharacterized conserved protein"
FT                   /note="COG1704, LemA, Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31088"
FT                   /db_xref="InterPro:IPR007156"
FT                   /db_xref="InterPro:IPR023353"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454XIS7"
FT                   /protein_id="ACY31088.1"
FT                   /translation="MKRWLLAIATAASMLSLTGCGYNDFQRLDEKSKAAWSEVLNQYQR
FT                   RSDLIPNIVATVKGEANFEQETLTRVIEARAKATSIQATPELINNPEAFNKFQQAQGEI
FT                   SSALSRLMVVAEKYPELKANQAFRDLRVTLEGTENRITVARNEYIGTVQAYNVLARSFP
FT                   TNITAKVFSYKVKPTFTVQNEAQISQPPAVDFSTPAAPAGSK"
FT   gene            367945..368757
FT                   /locus_tag="CtCNB1_0343"
FT   CDS_pept        367945..368757
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0343"
FT                   /product="conserved hypothetical protein"
FT                   /note="COG0289, DapB, Dihydrodipicolinate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31089"
FT                   /db_xref="UniProtKB/TrEMBL:D0IXJ4"
FT                   /protein_id="ACY31089.1"
FT                   /translation="MCVQGLSPCPLSSGASIAIMSTVSPLDALRGAQRPGPKTEALPRL
FT                   LLAGATGPLGNEVLSRVVGAQNYALVQVLAREPYVQGLRGMELLTQLHGDVQQWPVQSA
FT                   DVGLIMFEPPRPYYQRERALWTPRPDQLQAVAQWMQRCGVHTLAVVLPHDMGSLPQALK
FT                   QGLANLNEQGVAALGFERLIFVRSAREAQKINAGHWLQRTAKTMLSALSYMLPQTERPV
FT                   RAMHVARLVEAALLKAPPGIHVAPPELVWRAAQKDALQSELRSWLGFS"
FT   gene            368754..369725
FT                   /locus_tag="CtCNB1_0344"
FT   CDS_pept        368754..369725
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0344"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /note="COG0429, Predicted hydrolase of the
FT                   alpha/beta-hydrolasefold"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31090"
FT                   /db_xref="GOA:D0IXJ5"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR012020"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D0IXJ5"
FT                   /protein_id="ACY31090.1"
FT                   /translation="MNFEQFRAPWWQPGGHVQTIWAALCAKGGESPAWRRERWDTPDGD
FT                   FIDIDFSSHLASASAPTLVLFHGLEGSSSSHYAKALAQVCAQRGWHLAVPHFRGCSGEP
FT                   NHLLRAYHSGDADEVDWILHRLRQGAGGELLAMGVSLGGNALARWAGLQQQAAAELVKG
FT                   AAVICAPLDLVAGGVNLGQGLNRWIYTPMFMRTLVPKALAKWQQSPGVFDRERLQRART
FT                   LHDFDDVFTAPVHGFRDADDYWRRASAKPLLKQVAVPLLLLNARNDPFVPVHSLPRPDE
FT                   VSATVQLWQPPHGGHVGFASGAWPAHVQAMPLAVTEWLEQWL"
FT   gene            369755..370312
FT                   /locus_tag="CtCNB1_0345"
FT   CDS_pept        369755..370312
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0345"
FT                   /product="conserved hypothetical protein"
FT                   /note="COG4804, Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31091"
FT                   /db_xref="InterPro:IPR021332"
FT                   /db_xref="UniProtKB/TrEMBL:D0IXJ6"
FT                   /protein_id="ACY31091.1"
FT                   /translation="MDDIVKQAMLKWPNVPACSGWLGLDARGQWWLRDEQAQVCGAFAS
FT                   GKPGSRGNLLRHEKLAEFIGRNYLVEADGRWYFQNGPQRVYVELESAPWIWRLRYAEHG
FT                   LQLHSHTGQELAAEQVQQVLLDELGRLFLALPQGLGMVHSLDMLDAANALESGALPEAQ
FT                   AIESALLPLQFGFVPSPEGYQV"
FT   gene            complement(370399..371262)
FT                   /locus_tag="CtCNB1_0346"
FT   CDS_pept        complement(370399..371262)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0346"
FT                   /product="cytochrome c, class I"
FT                   /note="COG3245, CycB, Cytochrome c5"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31092"
FT                   /db_xref="GOA:D0IXJ7"
FT                   /db_xref="InterPro:IPR002323"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:D0IXJ7"
FT                   /protein_id="ACY31092.1"
FT                   /translation="MSEQHHEEAHTGPIKKPKQLLLAVFFSFVVPIFVIIGLVKFVTSS
FT                   DTTGAGTANAEMAKAMRLQKVGTVEIRDANRPLRGGAEVFKSQCAACHETGVAGAPKFQ
FT                   DAAAWGPRIKQGLETLVHSALAGKGAMAAQGGGEFNDTEIARGVVYMSNAAGANFPEPQ
FT                   PAAGAAAGDAPAAAPAAPVAAAPAAAVAAAEPAPAAAPAPAAAAASDVGKNLYNTTCMA
FT                   CHASGVAGAPKFGDKAAWAPFIAKGMDDMVQKATQGVGAMPPKGGSTASDADFKAAIQY
FT                   MVDAAK"
FT   gene            complement(371462..372895)
FT                   /locus_tag="CtCNB1_0347"
FT   CDS_pept        complement(371462..372895)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0347"
FT                   /product="RND efflux system, outer membrane lipoprotein"
FT                   /note="COG1538, TolC, Outer membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31093"
FT                   /db_xref="GOA:D0IXJ8"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="InterPro:IPR010131"
FT                   /db_xref="UniProtKB/TrEMBL:D0IXJ8"
FT                   /protein_id="ACY31093.1"
FT                   /translation="MNKTLLPVALAGALLASGCSFIPTLERPAAPVAEHYSATDEQAGA
FT                   TAAADIPWQQFYTDPRLQQVIQLALENNRDLRVAVLNIEKAQAQYQIQRAGQFPEFGVA
FT                   GSASRQPSATTGRYANSYMVGLSMPSWEIDFWGRIGSLKQQALAQYLATEEGRKAAQIS
FT                   LIATVANTWLNLQADEELLAISRRTLGTREQSIKLTKLRLDSGVASELDYRQAQSLTES
FT                   ARATLAQQAGQRERDVNALTLLVGQTLPADLLTSMQGKQLRDLPALADVPSGLPSDLLL
FT                   RRPDIRQAEQSMIAANASIGAARALFFPNISLTASAGFASSDISDLLKSDSAAFTIAPS
FT                   LYLPIFNAGRNRANLQVAEASQKIAVAQYEGSIQSAFREVSDTLVNRQALKDQLDAQSR
FT                   QLEAEQVRYKLSDLRYTNGVASYLDLLDAQRSLFALEQSVVQVRLAQLQNQVNLYKVLG
FT                   GGWTQASASDNPAAATTAQ"
FT   gene            complement(372888..376067)
FT                   /locus_tag="CtCNB1_0348"
FT   CDS_pept        complement(372888..376067)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0348"
FT                   /product="hydrophobe/amphiphile efflux-2 transporter"
FT                   /note="COG0841, AcrB, Cation/multidrug efflux pump"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31094"
FT                   /db_xref="GOA:D0IXJ9"
FT                   /db_xref="InterPro:IPR000731"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR004764"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:D0IXJ9"
FT                   /protein_id="ACY31094.1"
FT                   /translation="MSKFFIHRPIFAWVIAIFVIIAGVISITKLPVAQFPSVAPPTINV
FT                   TATYPGATSQTMTDSVLQLIEREINGAQGLMYMEASAPAGGQGTLTVTFAPGTNPDLAQ
FT                   VDVQNRLSRVLPRLPQVVQALGVRVDKSMSNFLMILAFQAESGETSRDDIADYVNRNVV
FT                   PEIQRLDGVGKAQLFASGRAMRVWVDPAKLQGFGLSIASVNAAIAAQNQQISGGALGNL
FT                   PSTPGTTTTATIVVPGQLTTPEEFGEVVLRSNSDGSTVRLKDVARIELGIESYAFESRL
FT                   DGKPAVAMAVQLTSTANAMATAKLVKAKMAEMEPFLPAGVKWSSPYDTSKFVKISIEKV
FT                   VHTLLEAIVLVFIVMLIFLQNIRYTLIPTIVVPIALLGTFAVMLVAGLTINILAMFAMV
FT                   LVIGIVVDDAIVVVENVERIMAEEGLPPKEATIKAMGQIQGAVVGITVILVTVFLPLAM
FT                   FSGATGNIYRQFSLVMAISIFFSGFFALTLTPALCATMLKPIPKGHAHDKKTGLLGPFY
FT                   NWFNRKFDAGTKRYSSALSGVVKRSAQAFIVYLLVIAGVVFMFMRLPTAFLPTEDQGYV
FT                   ISLTQLPPGASLERTSKTVAELEKFVLSQPEVDHIVSILGFSFMGQGQNVGLAFTTLKD
FT                   WSERTAPGSDAKSFADRAKGAMSALRDGFIFTLVPPSISELGNSDGFTFRLQDRGSKGH
FT                   AALLAARNQLVAKANQSPVLAGVRFDGVDDAPQWQVDINRDAVYAQRVSMGDLATTLAT
FT                   ALGSSNSTDFPNNGFMQRVTIQADAARRMQPEDVMRLTVPNAQGQLVELSTMVSAKWIS
FT                   GPMQLTRYNGYPSMSITGQAKPGFTSGDAMKEMEKLAQELPDGFGYEWTGQSLDEKKAG
FT                   SSAMLLYAFSILAVFLCLAALYESWSIPLSVLLVVPLGVFGAVAGMLMRSMPNDIYFQV
FT                   ALITVIGLSAKNAILIVEFAKDLHAEGKSALEAALEAGHLRFRPILMTSLAFILGVVPL
FT                   YIASGASAASQKEIGTGVFWGMVIGTPISVFLVPVFFVAVFNLFGKKSKQDSNATPPAA
FT                   TSAAQGGSQHE"
FT   gene            complement(376080..377396)
FT                   /locus_tag="CtCNB1_0349"
FT   CDS_pept        complement(376080..377396)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0349"
FT                   /product="efflux transporter, RND family, MFP subunit"
FT                   /note="COG0845, AcrA, Membrane-fusion protein"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31095"
FT                   /db_xref="GOA:D0IXK0"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:D0IXK0"
FT                   /protein_id="ACY31095.1"
FT                   /translation="MHPMYEANQAPDNQSHSAASGTRSMVIGLSLAAALGLVACSDKNA
FT                   EAQKAQAAAQAQPPEVGVVTVSMQNVPLISDLPGRLEPSRIAQVRARAAGIVQKRLFQE
FT                   GSDVKAGQALFQIDNTPYKANLQSAQATLAQAEANLAQASATARRYKPLVEANAISKQE
FT                   YDTAIANEKAALAQVAAGKAAVTNANVNLGYASVTAPISGRIGRALVTEGALVGQGEAT
FT                   QLATIQQVNPLYVNLTQSSSDIMRMREALSSGKLAKVGDNAARVHVYLDDGKEYAHTGK
FT                   LLFTDLTVDPTTGQVSVRAELPNPDGLLLPGTYVRVHLEQAQVENAALIPQQAVTRNEK
FT                   GNFVMIVAEDGSVAPRPVQISQSSGNNWVVTSGLKAGEKVMVDGLIKVGMGAKKVKPVE
FT                   INNAAAGAPAQPSAAAPAAPAQEKAATPAEGAGEGQAAK"
FT   gene            377615..378235
FT                   /locus_tag="CtCNB1_0350"
FT   CDS_pept        377615..378235
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0350"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="COG1309, AcrR, Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31096"
FT                   /db_xref="GOA:D0IXK1"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR013572"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:D0IXK1"
FT                   /protein_id="ACY31096.1"
FT                   /translation="MARRTKAEADETRTKLLDAAEEVFFEKGVSRTSLGDIAQRAGATR
FT                   GAVYWHFKDKMDVFVSMLGRICLPFEEICDDRYGDLLPLERIRHSILCVFESLDEDERR
FT                   RKVFETALFKMEYVGELADVRLQHIESSGFAREKFAHDLAAAAQGQSVRLSVSPEEAAL
FT                   GLHSLFVGLIHGWVLTEGSFSLVKVGSMSVDVYLSGLGFQVNL"
FT   gene            378310..378385
FT                   /locus_tag="CtCNB1_R0002"
FT   tRNA            378310..378385
FT                   /locus_tag="CtCNB1_R0002"
FT                   /product="tRNA-Arg"
FT   gene            378466..378551
FT                   /locus_tag="CtCNB1_R0003"
FT   tRNA            378466..378551
FT                   /locus_tag="CtCNB1_R0003"
FT                   /product="tRNA-Tyr"
FT   gene            378610..378683
FT                   /locus_tag="CtCNB1_R0004"
FT   tRNA            378610..378683
FT                   /locus_tag="CtCNB1_R0004"
FT                   /product="tRNA-Gly"
FT   gene            378727..378801
FT                   /locus_tag="CtCNB1_R0005"
FT   tRNA            378727..378801
FT                   /locus_tag="CtCNB1_R0005"
FT                   /product="tRNA-Thr"
FT   gene            378877..380067
FT                   /locus_tag="CtCNB1_0351"
FT   CDS_pept        378877..380067
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0351"
FT                   /product="translation elongation factor Tu"
FT                   /note="COG0050, TufB, GTPases - translation elongation
FT                   factors"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31097"
FT                   /db_xref="GOA:D0IXK2"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004160"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004541"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR033720"
FT                   /db_xref="InterPro:IPR041709"
FT                   /db_xref="UniProtKB/TrEMBL:D0IXK2"
FT                   /protein_id="ACY31097.1"
FT                   /translation="MAKEKFERTKPHVNVGTIGHVDHGKTTLTAAIATVLSKHFGGEAK
FT                   DYSQIDNAPEEKARGITINTSHVEYETANRHYAHVDCPGHADYVKNMITGAAQMDGAIL
FT                   VCSAADGPMPQTREHILLSRQVGVPYIIVFLNKADMVDDEELLELVEMEVRELLSKYDF
FT                   PGDDTPIIRGSAKLALEGDQSDKGEPAILKLAEALDTYIPTPERAVDGAFVMPVEDVFS
FT                   ISGRGTVVTGRIERGIVKVGEEIEIVGIKDTVKTTVTGVEMFRKLLDQGQAGDNVGLLL
FT                   RGTKREDVERGQVLCKPGSIKPHTNFTAEVYVLSKDEGGRHTPFFNNYRPQFYFRTTDV
FT                   TGSIELPEGKEMVMPGDNVSITVKLISPIAMEEGLRFAIREGGRTVGAGVVATIIA"
FT   gene            380077..380152
FT                   /locus_tag="CtCNB1_R0006"
FT   tRNA            380077..380152
FT                   /locus_tag="CtCNB1_R0006"
FT                   /product="tRNA-Trp"
FT   gene            380240..380623
FT                   /locus_tag="CtCNB1_0352"
FT   CDS_pept        380240..380623
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0352"
FT                   /product="preprotein translocase, SecE subunit"
FT                   /note="COG0690, SecE, Preprotein translocase subunit SecE"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31098"
FT                   /db_xref="GOA:A0A454XPL2"
FT                   /db_xref="InterPro:IPR001901"
FT                   /db_xref="InterPro:IPR005807"
FT                   /db_xref="InterPro:IPR038379"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454XPL2"
FT                   /protein_id="ACY31098.1"
FT                   /translation="MATTQVETVSSAADKAKLAAVAALVVASIAGFYLLSKQGALVQWA
FT                   ALIVGLVLAAGVFLISEPGKRFIGFARDAWREVKKVVWPTRKETMQMTLYVFAFVVVMA
FT                   LFLWFTDKTLEWVLYDLILGWRK"
FT   gene            380623..381210
FT                   /locus_tag="CtCNB1_0353"
FT   CDS_pept        380623..381210
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0353"
FT                   /product="NusG antitermination factor"
FT                   /note="COG0250, NusG, Kantiterminator"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31099"
FT                   /db_xref="GOA:A0A454Y0W0"
FT                   /db_xref="InterPro:IPR001062"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR006645"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR015869"
FT                   /db_xref="InterPro:IPR036735"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454Y0W0"
FT                   /protein_id="ACY31099.1"
FT                   /translation="MADAVETDVNGGAAGPANPDLRWYIVHAYSGMEKAVERNIAERIA
FT                   RSDMQSKFGRILVPSEEVVEMRNGTRRTTERRLFPGYVFVEMVMDDDTWHLVKHTSKVT
FT                   GFVGGAKNRPAPISEEEVRKIVDQMQEGTEKPRHKVEFMVGEMVRVKEGPFADFNGSVE
FT                   EVNYEKNRLRVSVTIFGRATPVELEFSQVEKT"
FT   gene            381336..381767
FT                   /locus_tag="CtCNB1_0354"
FT   CDS_pept        381336..381767
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0354"
FT                   /product="ribosomal protein L11"
FT                   /note="COG0080, RplK, Ribosomal protein L11"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31100"
FT                   /db_xref="GOA:D0IXK5"
FT                   /db_xref="InterPro:IPR000911"
FT                   /db_xref="InterPro:IPR006519"
FT                   /db_xref="InterPro:IPR020783"
FT                   /db_xref="InterPro:IPR020784"
FT                   /db_xref="InterPro:IPR020785"
FT                   /db_xref="InterPro:IPR036769"
FT                   /db_xref="InterPro:IPR036796"
FT                   /db_xref="UniProtKB/TrEMBL:D0IXK5"
FT                   /protein_id="ACY31100.1"
FT                   /translation="MAKKIVGFIKLQVPAGKANPSPPIGPALGQRGLNIMEFCKAFNAQ
FT                   TQGVEPGLPLPVVITAFADKSFTFVIKTPPATVLIKKAVKLDKGSSNPLKNKVGKITRA
FT                   QLEEIAKTKLKDMNAADVDAAVRTLAGSARSMGVIVEGV"
FT   gene            381768..382463
FT                   /locus_tag="CtCNB1_0355"
FT   CDS_pept        381768..382463
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0355"
FT                   /product="ribosomal protein L1"
FT                   /note="COG0081, RplA, Ribosomal protein L1"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31101"
FT                   /db_xref="GOA:A0A454XVA8"
FT                   /db_xref="InterPro:IPR002143"
FT                   /db_xref="InterPro:IPR005878"
FT                   /db_xref="InterPro:IPR016095"
FT                   /db_xref="InterPro:IPR023673"
FT                   /db_xref="InterPro:IPR023674"
FT                   /db_xref="InterPro:IPR028364"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454XVA8"
FT                   /protein_id="ACY31101.1"
FT                   /translation="MAKLTKKQKALQGKVDSNKLYSFADAVALVKEAATAKFDESIDVA
FT                   VQLGVDAKKSDQVVRGAVVLPHGTGKTARVAVFAQGAKAEEAKAAGADVVGMDDLAAQV
FT                   KAGDMPFDVVIAAPDAMRVVGQLGQILGPRGLMPNPKVGTVTPDVATAVKNAKAGQVQF
FT                   RVDKAGIVHGTIGRRSFDADKLQGNLAALIDALNKAKPASSKGLYLRKVAVSSTMGVGV
FT                   RVDTQSISA"
FT   gene            382766..383215
FT                   /locus_tag="CtCNB1_0356"
FT   CDS_pept        382766..383215
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0356"
FT                   /product="ribosomal protein L10"
FT                   /note="COG0244, RplJ, Ribosomal protein L10"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31102"
FT                   /db_xref="GOA:D0IXK7"
FT                   /db_xref="InterPro:IPR001790"
FT                   /db_xref="InterPro:IPR022973"
FT                   /db_xref="UniProtKB/TrEMBL:D0IXK7"
FT                   /protein_id="ACY31102.1"
FT                   /translation="MIAEYRGITVADMTKLRADARSKGVSLSVLKNTLARRAVAGSAFD
FT                   VVADQMTGPLIYGFSEDAVAAAKVVADFAKTNDKLVIRGGAFGGKALDIDGVKQLANIP
FT                   SKEVLLAQLCGLLMSPISRTAVVLGALAAKKGEGSAEAATETAAA"
FT   gene            383252..383629
FT                   /locus_tag="CtCNB1_0357"
FT   CDS_pept        383252..383629
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0357"
FT                   /product="ribosomal protein L7/L12"
FT                   /note="COG0222, RplL, Ribosomal protein L7/L12"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31103"
FT                   /db_xref="GOA:A0A454Y1J5"
FT                   /db_xref="InterPro:IPR000206"
FT                   /db_xref="InterPro:IPR008932"
FT                   /db_xref="InterPro:IPR013823"
FT                   /db_xref="InterPro:IPR014719"
FT                   /db_xref="InterPro:IPR036235"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454Y1J5"
FT                   /protein_id="ACY31103.1"
FT                   /translation="MAFDKDAFLTALDSMTVLELNDLVKAIEEKFGVSAAAMAAPAAGG
FT                   AAGGAAAAEEKTEFNVVLTDAGANKVSVIKAVREITGLGLKEAKDLVDGAPKTVKEAAP
FT                   KADAEAAVKKLVEAGAKAELK"
FT   gene            383904..388016
FT                   /locus_tag="CtCNB1_0358"
FT   CDS_pept        383904..388016
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0358"
FT                   /product="DNA-directed RNA polymerase, beta subunit"
FT                   /note="COG0085, RpoB, DNA-directed RNA polymerase"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31104"
FT                   /db_xref="GOA:A0A454XJX6"
FT                   /db_xref="InterPro:IPR007120"
FT                   /db_xref="InterPro:IPR007121"
FT                   /db_xref="InterPro:IPR007641"
FT                   /db_xref="InterPro:IPR007642"
FT                   /db_xref="InterPro:IPR007644"
FT                   /db_xref="InterPro:IPR007645"
FT                   /db_xref="InterPro:IPR010243"
FT                   /db_xref="InterPro:IPR014724"
FT                   /db_xref="InterPro:IPR015712"
FT                   /db_xref="InterPro:IPR019462"
FT                   /db_xref="InterPro:IPR037033"
FT                   /db_xref="InterPro:IPR037034"
FT                   /db_xref="InterPro:IPR042107"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454XJX6"
FT                   /protein_id="ACY31104.1"
FT                   /translation="MAYSYTERKRIRKSFGSRDSVLEVPYLLQMQKDAYTAFLQADVAP
FT                   KKRTIDGLQAAFNSAFPIVSHNGFVEMKFVEYNLAKPAFDVRECQTRGLTFASAVRAKV
FT                   QLIIYDRESSTAQSKVVKEVKEQEVYMGEVPLMTDKGSFIINGTERVIVSQLHRSPGVF
FT                   FEHDKGKTHSSGKLLFSARIIPYRGSWLDFEFDPKDLLYFRVDRRRKMPVSILLKAIGM
FT                   TPETILATFFVNDNFRLMDSGAQMEFVADRLKGEVARFDITDKSGKVVVAKDKRITARH
FT                   TRELEQSGTKFVSVPEDFLLGRVLAKNIVDPDTGEIIAKANEELTEALLKKLRSAGVQD
FT                   VQCIYTNELDQGAYISQTLRTDETVDEFAARVAIYRMMRPGEPPTEDAVQALFQRLFYN
FT                   ADTYDLSRVGRMKFNAKIGREGATGPMVLSNEDILAVVKILVDLRNGRGEVDDIDHLGN
FT                   RRVRCVGELAENQYRTGLARIEKAVKERLGQAEQEPLMPHDLINSKPISAALKEFFGAS
FT                   QLSQFMDQTNPLAEITHKRRVSALGPGGLTRERAGFEVRDVHVTHYGRVCPIETPEGPN
FT                   IGLINSLALYARLNEYGFIETPYRRVVDGKVTMDIDYLSAIEEGKYVIAQANADLDAEG
FT                   NLVGELVSAREAGESTLVSAERVQYMDVSPAQIVSVAASLIPFLEHDDANRALMGANMS
FT                   RQAVPVLRPEKPMVGTGIERVAAVDSGTVVTAKRGGIVDYVDATRIVIRVNDDEAVAGE
FT                   VGVDIYNLIKYQRSNQNTNIHQRPIVSRGDKLAKGDVLADGASTDLGEIAIGQNMLIAF
FT                   MPWNGYNYEDSVMINERIVADDRYTSIHIEELVVMARDTKLGAEEITRDIPNLSEQQLN
FT                   RLDESGIIYVGAEVQPGDVLVGKVTPKGETTLTPEEKLLRAIFGEKASDVKDTSLRVDQ
FT                   GSQGTVIDVQVFTREGIQRDKRAQQIIDDELKRFRLDLNDQLRIVEADAFDRIEKLLTG
FT                   RVANGGPQKLSKGAKIDKAYLDGVEKFHWFDIRPAEDDVAAQLESIKNSIEQQRHTFDL
FT                   AFEEKRKKLTQGDELPAGVLKMVKVYLAVKRRLQPGDKMAGRHGNKGVVSKITPVEDMP
FT                   FLADGTTADIVLNPLGVPSRMNIGQVLEVHLGWAGKGLGQRIGDMLQKEARAAEVRAFL
FT                   EEIYNRSGRKEELSQLDDGEVMSMAKELTTGVPFATPVFDGASEAEIKDMLKLAYPDDI
FT                   AAAKGLTETRTQAYLYDGRTGERFERPTTVGYMHYLKLHHLVDDKMHARSTGPYSLVTQ
FT                   QPLGGKAQFGGQRFGEMEVWALEAYGAAYVLQEMLTVKSDDVVGRTKVYESIVKGEHSI
FT                   EAGMPESFNVLVKEIRSLGLDIELERS"
FT   gene            388138..392361
FT                   /locus_tag="CtCNB1_0359"
FT   CDS_pept        388138..392361
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0359"
FT                   /product="DNA-directed RNA polymerase, beta' subunit"
FT                   /note="COG0086, RpoC, DNA-directed RNA polymerase"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31105"
FT                   /db_xref="GOA:A0A454XNB3"
FT                   /db_xref="InterPro:IPR000722"
FT                   /db_xref="InterPro:IPR006592"
FT                   /db_xref="InterPro:IPR007066"
FT                   /db_xref="InterPro:IPR007080"
FT                   /db_xref="InterPro:IPR007081"
FT                   /db_xref="InterPro:IPR007083"
FT                   /db_xref="InterPro:IPR012754"
FT                   /db_xref="InterPro:IPR038120"
FT                   /db_xref="InterPro:IPR042102"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454XNB3"
FT                   /protein_id="ACY31105.1"
FT                   /translation="MKSLLDLFKQFTPDEHFDAIKIGLASPEKIRSWSFGEVKKPETIN
FT                   YRTFKPERDGLFCAKIFGPIKDYECLCGKYKRLKHRGVICEKCGVEVTQTKVRRERMGH
FT                   IDLAAPCAHIWFLKSLPSRLGLVLDMTLRDIERVLYFEAYVVTDPGMTPLKKFSIMTED
FT                   DYDAKQLEYGYDEFTAKMGAEGIKDLLEGIDIDVEIERLRNDLTGSEVKVKKNAKRLKL
FT                   LEAFKKSGIKPEWMVMEVLPVLPPDLRPLVPLDGGRFATSDLNDLYRRVINRNSRLRRL
FT                   LELKAPEIIARNEKRMLQEAVDSLLDNGRRGKAMTGANKRALKSLADMIKGKSGRFRQN
FT                   LLGKRVDYSGRSVITVGPYLKLHQCGLPKLMALELFKPFIFAQLEQRGIATTIKAAKKE
FT                   VEAGTPVVWDILEEVIKEHPIMLNRAPTLHRLGIQAFEPILIEGKALQLHPLVCAAFNA
FT                   DFDGDQMAVHVPLSVEAQMEARVLMLASNNVLFPASGEPSIVPSQDVVLGLYHATREKI
FT                   NGKGEGMVFADLMELQRALDAGETELHAKISVRLTEWNKNKETGEFEPVTSLVETTVGR
FT                   ALLSEILPKGLAFSNMNKALKKKEISKLINASFRKCGLKATVVFADKLLQNGFRLSTHA
FT                   GISISIDDMLVPPQKADILARAESEVKEIEQQYVSGLVTSGERYNKVVDIWGKAGDDVS
FT                   KVMMDQLKVQKTTDRHGNEVDQESFNAIYMMADSGARGSAAQIRQLAGMRGLMAKPDGS
FT                   IIETPITANFREGLNVLQYFISTHGARKGLADTALKTANSGYLTRRLVDVTQDLVVNEQ
FT                   DCGTSNGYLMRAIVEGGEVIESLRDRVLGRSTAEEVLHPETRAVLVPAGTLLNEDTIEE
FT                   LEAQGVDEIKVRTALTCETRFGLCATCYGRDLGRGGLINLGEAVGVIAAQSIGEPGTQL
FT                   TMRTFHIGGAASRAAIASSVEAKSNGVIGFNSTMRYVSNTKGELVVISRSGEIVISENG
FT                   RERERHKVPYGAVLTIKPDEAIKAGKILANWDPLTRPIITEYAGQVRFENVEEGLTVAK
FT                   QVDEVTGLSTLVVIDPKRRGSAKVVRPQVKLIDANNQEVKIPGTDHAVTIGFQVGALIQ
FT                   VRDGQDVGPGEVLARIPVEGQKTRDITGGLPRVAELFEARTPKDKGTLAEMTGTVSFGK
FT                   ETKGKIRLQITDLEGKVWEELVPKERNILVHEGQVVNKGESIVDGPADPQDILRLLGIE
FT                   ELSRYIVDEVQDVYRLQGVKINDKHIEVIVRQMLRRVIIENSGDTTYIQGEQVERSEVL
FT                   NTNEQMQKEGKLPATYSNVLLGITKASLSTDSFISAASFQETTRVLTEAAIMGKRDELR
FT                   GLKENVIVGRLIPAGTGLAYHQARKAKDEMDDAERRAIAEAEEAELAGVLADDVEAPAG
FT                   DASAD"
FT   gene            392569..393954
FT                   /locus_tag="CtCNB1_0360"
FT   CDS_pept        392569..393954
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0360"
FT                   /product="sun, tRNA and rRNA cytosine-C5-methylase"
FT                   /note="COG0144, Sun, tRNA and rRNA cytosine-C5-methylases"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31106"
FT                   /db_xref="GOA:D0IXL1"
FT                   /db_xref="InterPro:IPR001678"
FT                   /db_xref="InterPro:IPR004573"
FT                   /db_xref="InterPro:IPR006027"
FT                   /db_xref="InterPro:IPR018314"
FT                   /db_xref="InterPro:IPR023267"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR035926"
FT                   /db_xref="UniProtKB/TrEMBL:D0IXL1"
FT                   /protein_id="ACY31106.1"
FT                   /translation="MTSKPSQPKNAAAGAAVPNAPALWQQLDAVAKALHGILGGQSSKA
FT                   VLAQVPQRLRPGVQALLFQVLRNLGRAQALQKQLAPRPPAPKVSALLSTALALAWDETQ
FT                   APYPPFTLVNQAVEAAKNGAARAQSGFINACLRRFLRERDALVSATDNDPVAVWNHPAW
FT                   WIARLKKDHPQDWQTILAANNAQPPMTLRVNAQKSTPAQYQNALQAMNLKSTAVAECGL
FT                   QLEQAVPVQELPQFEEGWASVQDGAAQAAAPLLLAGLPEPQGRPLRVLDACAAPGGKTA
FT                   HLLERAAPGGIEVTALEIDPERARRIGETLSRLGLKAKVLVADASAPQAWFESQCGGQL
FT                   FDAILLDAPCTASGIVRRQPDVRWLRRESDVTQLADIQSRLLDTLWPLLQPGGRMVYCT
FT                   CSVFKAEGDAQMQAFLARNTTAASLPAPGHLIPGKAAKHDSVADNPLGDHDGFFYALLE
FT                   KLR"
FT   gene            394001..394567
FT                   /locus_tag="CtCNB1_0361"
FT   CDS_pept        394001..394567
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0361"
FT                   /product="putative proline rich signal peptide protein"
FT                   /note="COG1140, NarY, Nitrate reductase beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31107"
FT                   /db_xref="InterPro:IPR025500"
FT                   /db_xref="UniProtKB/TrEMBL:D0IXL2"
FT                   /protein_id="ACY31107.1"
FT                   /translation="MLALSLVFVLARADTVPPDISSMQVTRTDEGVFLSANLQFELPGQ
FT                   VEDALRQGIPMYFIAEAQVQRERWYWSDQQLGVATRYYRITHQPLTRRWRLHISNSAFT
FT                   GGSGTGLALGQSYEQLEDAIAAIQRIYRWKILDSGQLGSTSGVSVQLRFRVDLSSLPRP
FT                   LQIGALGRSGWNLQLSRTQTLEAAP"
FT   gene            394567..396888
FT                   /locus_tag="CtCNB1_0362"
FT   CDS_pept        394567..396888
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0362"
FT                   /product="multi-sensor signal transduction histidine
FT                   kinase"
FT                   /note="COG5000, NtrY, Signal transduction histidine kinase
FT                   involved in nitrogen fixation and metabolism regulation"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31108"
FT                   /db_xref="GOA:A0A454XW17"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR017232"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454XW17"
FT                   /protein_id="ACY31108.1"
FT                   /translation="MADIKLPDGEAGGSSAARWSRATRWAVGTGVALMVVVGVLLLFLL
FT                   TLATNNRLAYERNYNWLFAANVVVAGLLLLVLFWGGLRLALRLRRGRFGSKLLLKLAGI
FT                   FTLVGLLPGLLIYVVSYQFVSRSIESWFDVKVEGALSAGVSLASATLDTVANDMANNTR
FT                   TAGLQLSQTSDAGAALMLERIRDQIGASDVVLWNASGKAIASAGQSQFSLAPERPNTQL
FT                   LRSLREQGGQRAVASIEGLDDAGDVPADQAAANAKVRTLALVPSSAVNLLEEARYLQAT
FT                   IPLPQALVSNALAVQEANREYQERALARGGLQRMYIGTLTLALFLAVFGAVVLAVVLGN
FT                   QLAKPLLLLAQGMRDVARGDLRPKPALQSKDEIGGLTRSFAVMTQQLADARSDANRNLL
FT                   QLDAARSNLQTILDNLTSGVIVLDRSGRIVLSNPGATRILRAPMAVFQGKRLRDVSGLQ
FT                   DFARVVQEQFEIFLGDASAEQGRDRWQQVYELDAGNGNGDVVHNTTSLVMRGAELPDDQ
FT                   RLLVFDDISEIVSAQRAQAWGEVARRVAHEIKNPLTPIQLSAERLAMKLTDKLQPAEQA
FT                   LLAKSVKTIVDQVGAMKRLVDEFREYARLPAANLQALDLNALVAEVLQLYGEENAAVRV
FT                   EASLDEACPLIQGDSQQLRQVIHNLLQNAQDSTAQRAQETGQTPGSVTIETRWMDTAQR
FT                   VRLSISDSGTGFAPNILQRAFEPYVTTKSRGTGLGLAVVKKIADEHGARVDLGNREEDG
FT                   VVQGARVSLSFVPNDRAGAA"
FT   gene            396943..397593
FT                   /locus_tag="CtCNB1_0363"
FT   CDS_pept        396943..397593
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0363"
FT                   /product="response regulator receiver protein"
FT                   /note="COG2204, AtoC, Response regulator containing
FT                   CheY-like receiver"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31109"
FT                   /db_xref="GOA:D0IXL4"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:D0IXL4"
FT                   /protein_id="ACY31109.1"
FT                   /translation="MVDDELGIRDLLSEILNDEGHSVDVAENATQARVSRATHNYDLVL
FT                   LDIWMPDTDGVTLLKEWATAGQLTMPVIMMSGHATIETAVEATRIGALSFLEKPITMQK
FT                   LLKAVEQGLARSTASQGSETAAHASNGTAPSAVVSITAQAAEDNLPNSHQGFDLDRPLR
FT                   EARDGFEKAYFEFHLAREGGSMTRVAEKTGLERTHLYRKLRQLGVDLGRNRRG"
FT   gene            397679..397754
FT                   /locus_tag="CtCNB1_R0007"
FT   tRNA            397679..397754
FT                   /locus_tag="CtCNB1_R0007"
FT                   /product="tRNA-Phe"
FT   gene            397928..398003
FT                   /locus_tag="CtCNB1_R0008"
FT   tRNA            397928..398003
FT                   /locus_tag="CtCNB1_R0008"
FT                   /product="tRNA-Phe"
FT   gene            398244..401831
FT                   /locus_tag="CtCNB1_0364"
FT   CDS_pept        398244..401831
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0364"
FT                   /product="exodeoxyribonuclease V, gamma subunit"
FT                   /note="COG1330, RecC, Exonuclease V gamma subunit"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31110"
FT                   /db_xref="GOA:D0IXL5"
FT                   /db_xref="InterPro:IPR006697"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR013986"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041500"
FT                   /db_xref="UniProtKB/TrEMBL:D0IXL5"
FT                   /protein_id="ACY31110.1"
FT                   /translation="MTAEQQSRASQPAANWQPGLIAIHGNQTEALADTVLAWLAAHPLQ
FT                   ALEPEIVLVQSNGMAEWFKMRMAEQQGVCAAAQVELPARFVWRSYRQILGRHEVPRESP
FT                   LDKTPMIWRLMRLLPQCLGEPAFAPIANFLRPGEPQRLLQLAEKLADLFDQYQIYRADW
FT                   LAAWEKGEDVLRTAGRPDAPVPEGQLWQPQLWRKVLAELDEQERAATRPALLARILDAL
FT                   QSGQPPVTPLARRVVVFGMSQMPLSLMQFLSGIAQHSQVLIAVPNPCRFHWADAIDGRE
FT                   LLRQQRRRHADKGGKDLAQIPLAAMHAHAHPLLAAWGRQSRDYVRQLDAFDTTGDIAVQ
FT                   WGWPRVDVYDEADASELIDAPLLVQVQQRIRDLVPMSEHPAVEIAAADQSIVFHKAHGL
FT                   VRELEVLHDQLLQWLAEPAAAGRAVLAPREVVVMLPSIEEAAPAIRAVFGQYGRHDARH
FT                   IPFDIADVGARASSPLVTALQWLLKLPQQRCRLSELCDLLDVPAVAARVGLAADDLPQL
FT                   THWMAGAGIRWGLNHAQRAQLGLAACGDPNSAWFGLRRMLLGYASGPALEAAFDEAQVF
FT                   AGMEPYDEVGGLTAELAGSLASLLGRMLQWWQTAATAAAPEVWAQRFRSLMDDFFVAQG
FT                   DEDQALCAALDTALVGWQAACEQAGFEALIPLEVAQEAWLQALSEPALNQRFRAGGVTF
FT                   CTLMPMRAIPFEVVCLLGMNDGDYPRRATRVDFDLMALPGQQRPGDRARRDDDRQLMLD
FT                   ALLSARSKLYISWAGRHVRDNSEQPPSVLVSQLRDYLRQGWQGEDSAGLSASERGELLL
FT                   AQRTRQHPLQPFSRSYFEQASGLSTFAREWYGAHEERAAQVLPVVAAFEPDPEVPLTLA
FT                   RLTEFLRHPARSFLRNRLQVRFEQDEELLEDDELFSVDGLTAYGLIQQLQQGVRTQLAH
FT                   DAELDVGLQVQRQVQCLGRAGVLPLAGLGRREAEVLQAQATPSLLAWQQQMRLWPHAAP
FT                   RERLLLHSGAVTLDDWMDGLQEREEPSSDAGHSRCWFALEPRTLLNKKGELQAHKLLPI
FT                   YVRSLALSSTGSDTLMGVIARDTLVWVQPLEPEAATQRLQALMQLWLTGQNEPLPLPLK
FT                   AAIAAGRDELNAAAQAYEGGYMLGGECEDPSWARCYPDWEALTADLRFHVLAKQVYGPL
FT                   HDWLAAQVQTEDLPLMQCADQNEQPGEPA"
FT   gene            401828..405637
FT                   /locus_tag="CtCNB1_0365"
FT   CDS_pept        401828..405637
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0365"
FT                   /product="exodeoxyribonuclease V, beta subunit"
FT                   /note="COG1074, RecB, ATP-dependent exoDNAse (exonuclease
FT                   V) beta subunit (contains helicase and exonuclease
FT                   domains)"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31111"
FT                   /db_xref="GOA:D0IXL6"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR004586"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="InterPro:IPR038726"
FT                   /db_xref="UniProtKB/TrEMBL:D0IXL6"
FT                   /protein_id="ACY31111.1"
FT                   /translation="MSAPANPMKPGSQALQPLQFPLWGSRLIEASAGTGKTWTIAALYL
FT                   RLVLGHGAENGFARALMPPDILVMTFTRAATRELSDRIRARLIEAVQCFRGEAEPAAHD
FT                   SFLRDLRDAYAEGELRDTAAWRLDMAAQCMDDAAIHTIDAWCQRMLREHAFDSGNLFDE
FT                   TLEADESQRQTEAAQDYWRQQCYPLSGEVLEAALQVWPDVQALVKDMQSLLRENIAATA
FT                   GAGTLGECIAQTQAERAQQLRMLGDGWEQKAQQLEDWLDGQLATNKSAWNGLKLKPANY
FT                   KNWLKALREWAAAPHDGLAAAMKTGATRLVPAGLDEARKGDAPVELHPASAELEQLLQA
FT                   LAQMPSLHVALRLHAAVHVQQRLLWLKRQAGTFGFADMQQRLDAALAGDNGPALQAGIL
FT                   AQYPVALIDEFQDTSPLQYRLFDQIYRTADNSAGSALLLIGDPKQSIYGFRGGDIYSYL
FT                   QARQATEGRHYVLDTNFRSTEVLVDAVNQWFVQAEVREGEGAFMFRAGQSNPLPFESVK
FT                   ANGRKELLMQGSQRMAALTIAWDGSSDEPLSNDDIRRRGAEFCASQIVQWLMDGATGFA
FT                   EAGQPLQRLRPADIAVLVRTGKEAAAVRRALARRNVASVYLSDQDSVFASVEAQDLLLW
FT                   LRAVAAPLDGLAVRAGLATPMMGLSFDELAWLASDDEAFDARSELLKELHSLWLRLGVL
FT                   AMLRQTLYRFELPARWLKDMGGERRLTNYLHLAELLQGASAQLEGEQALIRWLATQIES
FT                   PGAAGDAQIVRLESDADLVKVVTVHKSKGLEYPLVCLPFGGSFRPVDGKAAYLSLPVQI
FT                   DGVPARELVLDYDDAQLAQADKERLREDLRLLYVALTRPRHALWMGLAPMKRGNSKNCV
FT                   NEQGAAGYLLAGDVSQAAASWRASIQALSERCMEIAVVDLPAELPVASRYVAAQALPAL
FT                   AAAPVYEAQFDRRWGIGSFSSLTRAMAAPSLPVLPVAAQSPAEDERALQAQEAGEAALD
FT                   LGVINDVMTALPNLTRFAAGARSDAAVWHRFMRGPVVGNFLHDQLEWLAAEDFALLPED
FT                   DPGNSEPLAARLLRRCERAGRKEQAADVLQWLRAVVHQPLAPLGVSLAQLGEGDALLPE
FT                   MEFWLPARRLSAPRIDALCRRHILAGQPRPVLPERELHGMLMGFADLVFHHGGRYWVLD
FT                   YKTNHLGQDGAAYAPQALEQAMLEHRYDVQAALYLLALHRLLQSRLGAAYDPREQLGGA
FT                   LYFFLRGLDGEAAGMHVLKPPLALLDGLEALLGDNEKELKEEQP"
FT   gene            405634..407724
FT                   /locus_tag="CtCNB1_0366"
FT   CDS_pept        405634..407724
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0366"
FT                   /product="exodeoxyribonuclease V, alpha subunit"
FT                   /note="COG0507, RecD, ATP-dependent exoDNAse (exonuclease
FT                   V)"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31112"
FT                   /db_xref="GOA:D0IXL7"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR006344"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027785"
FT                   /db_xref="InterPro:IPR041851"
FT                   /db_xref="UniProtKB/TrEMBL:D0IXL7"
FT                   /protein_id="ACY31112.1"
FT                   /translation="MKGRRKADLQTLDLFAAPADGDTIAPGTTDWLAALERLADAGLLR
FT                   RLDSALAAFVAAQDAEAGPALLVATAVLAQMEGRGHSCLPLKALAGDPNQILAWPKEAE
FT                   RLQQSLWEQLPGRLADWLQALRRSPVVRVVQPGAPAADRGQPLVLLDGAAPLLYLRRYW
FT                   DYERSVAAHIAQRTAADAVALDEPRVREWLGRLFSSSAAAANAVDWQKLACALALRGHM
FT                   SVITGGPGTGKTYTAARLLALLFATAPDAAQLRVALAAPTGKAAARLKQSIDSSLLELK
FT                   EAVGRELDLEALVKRMGAARTLHSLLRARPDTRRFAHHAGNPLDVDVLIVDEASMIHLE
FT                   MMAALLQALPPTARLILLGDKDQLASVEAGAVLGDLCRDAQRGNYAPDTAAYVERVTGQ
FT                   SLPAQYLAPARALPLAQHTVMLRESRRFGGPIGLLAQAVNAGDAPSAMALLRTQTQAGL
FT                   HAELWAREGGEVEAVVRSAVQGRGGMASYAAYAEVLAQHGQGKGCGFATEAEHRQWVRE
FT                   VLAAFDRYRLLCAVRDGSWGVAGLNRAVEQALQAMGAIRKEGEWYMGRPVMVTRNDAQL
FT                   GVFNGDIGMALPSFADPARLRVYFMQGELLHHVSTARLAHVETAFAMTVHKSQGSEFEH
FT                   TALVLAAQGGNVLSRELVYTGITRARKAFSLWTEVPGLLVSAMGSPTQRSSGLLGFMER
FT                   AQ"
FT   gene            complement(407943..408356)
FT                   /locus_tag="CtCNB1_0367"
FT   CDS_pept        complement(407943..408356)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0367"
FT                   /product="Glyoxalase/bleomycin resistance"
FT                   /note="COG3565, Predicted dioxygenase of extradiol
FT                   dioxygenasefamily"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31113"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:D0IXL8"
FT                   /protein_id="ACY31113.1"
FT                   /translation="MQSAFHLAYHVTDLDQARRFYGGVLGCREGRSTDTWVDFDFFGHQ
FT                   ISLHLGQPFAVSNTGKVGNHMVPMPHLGMILLKPDWLALAERLKAAGTTFILEPQVRFE
FT                   GEPGEQWTMFFTDPCGNPIEVKGFANWDAIYEH"
FT   gene            complement(408401..409060)
FT                   /locus_tag="CtCNB1_0368"
FT   CDS_pept        complement(408401..409060)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0368"
FT                   /product="Putative GSH-dependent dehydroascorbate
FT                   reductase"
FT                   /note="COG0625, Gst, Glutathione S-transferase"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31114"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="UniProtKB/TrEMBL:D0IXL9"
FT                   /protein_id="ACY31114.1"
FT                   /translation="MLTLCGFSASNYYNKVKLALMEKQIPFAEELAWLGSTNPEESPLG
FT                   KVPYLRTQHGAISESDAIIEYVETLSSKVPLLPADPFAAAKVRELCVYLNLHLELVARN
FT                   LYPQAFFGGKISDGTRDKTLEQLKKNIAAFAKLARFDTPFIAGDSFTLADCSAIVHLPL
FT                   VSSASKILGGSDLLAELPVRDYLARMSERPTVQKVNADRKRNTEELMARMQAKAAR"
FT   gene            409254..409577
FT                   /locus_tag="CtCNB1_0369"
FT   CDS_pept        409254..409577
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0369"
FT                   /product="hypothetical protein"
FT                   /note="COG3968, Uncharacterized protein related to
FT                   glutaminesynthetase"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31115"
FT                   /db_xref="UniProtKB/TrEMBL:D0IXM0"
FT                   /protein_id="ACY31115.1"
FT                   /translation="MLLVSMLTPWARATPPAGWEAVCTASGSTHWVPSPASDDAATPHG
FT                   LDCALCLPLLAPPPAQQPDPGSHRAVVDARPWADVAHRAFVSTLPPVRAPPFETLKNIA
FT                   EGA"
FT   gene            409717..410232
FT                   /locus_tag="CtCNB1_0370"
FT   CDS_pept        409717..410232
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0370"
FT                   /product="hypothetical protein"
FT                   /note="COG2847, Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31116"
FT                   /db_xref="InterPro:IPR007410"
FT                   /db_xref="InterPro:IPR036182"
FT                   /db_xref="UniProtKB/TrEMBL:D0IXM1"
FT                   /protein_id="ACY31116.1"
FT                   /translation="MNTRRFTVMALGSLVASLLVSGAAWAHADAAHVKVENAWARASVA
FT                   GQQASGAFMRLTAQEPLKLVGVETTAAAVAEVHEMKMEGDVMRMRAIEALDLPQGVAVD
FT                   LKPGGYHLMLQQLKAPLVKDSQVPVTLVFKDAKGAVSRLSLQLPVRVAAPAAAGAGHQH
FT                   MSHGAHQH"
FT   gene            410360..411247
FT                   /locus_tag="CtCNB1_0371"
FT   CDS_pept        410360..411247
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0371"
FT                   /product="conserved hypothetical protein"
FT                   /note="COG3064, TolA, Membrane protein involved in colicin
FT                   uptake"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31117"
FT                   /db_xref="UniProtKB/TrEMBL:D0IXM2"
FT                   /protein_id="ACY31117.1"
FT                   /translation="MSGDASAFGFGKFIPGFDFLQGLAQSAGAAANPMGRVPQWVAPTV
FT                   SVEEVDKRIAELKAVQFWLEQNSRALAATIQALEVQRMTLSTLKDMNVSMSELAKSFPF
FT                   PGAAPAEPAATGNVGWPMGSATAKAAVAEPLASPAPEPEAQAAAQEEQNHAKAQAEAPS
FT                   QAALNQAMQWWGALTQQFQQIAAKAMAEPVPPETLAAAQRATEMASGFAKSTMEKVMAQ
FT                   AGGFGAAAAAKTAATGAAKSAAAAEPRPARKAAAKTGQPKTAASKTAAAKKTAAKQPAA
FT                   KKTAAKTSATSRKP"
FT   gene            411320..412570
FT                   /locus_tag="CtCNB1_0372"
FT   CDS_pept        411320..412570
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0372"
FT                   /product="conserved hypothetical protein"
FT                   /note="COG4398, Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31118"
FT                   /db_xref="InterPro:IPR013702"
FT                   /db_xref="InterPro:IPR019494"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454XNQ2"
FT                   /protein_id="ACY31118.1"
FT                   /translation="MSLFPVAHASHEDWRAATEQVVLQLRGQLLRQSLQPHRLGLVYIA
FT                   QGLVPHAQPLLALLARELPQVTDWVGSSGHAVLAMEHEYSESSSLAVMLLDLPAAHYRV
FT                   YSGVAPLAQSGAEAGFEAHSALVHSSIDQPDLAELLLELSERISSGNLFGALSSEQGVQ
FT                   FACRAEDLPRLRAQASVGIFHAGFSGVAFDADVACISRLAQGCAPLGAGLEITEARGPV
FT                   VLELEGEPALPRLLQMLDVEASPSAGGGWQAALSQLRKTQAAIAPLGRGLERGALTDEA
FT                   QVLHIVGLDPVRQGVALSSPVEAEHTVIFCQRQSSAARHELMQMGAALKDALQPDFADA
FT                   GPETMAEAAQPQHIRGAIYVSSKGRGSELFGGADAELKLLRHALGPVPLIGLVAEAQLM
FT                   DAHVHQLAGVLTVFTGK"
FT   gene            complement(412812..413966)
FT                   /locus_tag="CtCNB1_0373"
FT   CDS_pept        complement(412812..413966)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0373"
FT                   /product="hypothetical conserved protein"
FT                   /note="COG4950, Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31119"
FT                   /db_xref="GOA:D0IXM4"
FT                   /db_xref="InterPro:IPR003779"
FT                   /db_xref="InterPro:IPR004675"
FT                   /db_xref="InterPro:IPR010195"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="UniProtKB/TrEMBL:D0IXM4"
FT                   /protein_id="ACY31119.1"
FT                   /translation="MTDTIDRLAGLEQGNPTFTTRHEREKVALATQACEDLLLGNQLDS
FT                   ALTQAERLVLAAEQARVSGVSTLEAEYRSRAEALGDAITPELRSILDQPGAQTDNARLD
FT                   AMLHFVRTLALNPAQSDQAALLAIPAAGLSLNDTVLLAQLIGFVAYQARLLAGVKAMGE
FT                   LGGATEMPAAQPVDAAPFVHPANLPPPGEPLRRNGFTSETLDWKAWLQVLDPATATPEQ
FT                   QQVLEVSHPKAKSMDFYLLLARQPQVLLERSQAFNAIMYAPGGLSRTEREVAATAVSRS
FT                   NGCVYCASVHAQRFEQLAKRNDVMAQLFDEPDTAGTNARERAIIQASLTLTRAPGSFGK
FT                   HNLQPLRDAGLSALEILDMLHSAALFGWANRLMLNLGVEIYATP"
FT   gene            complement(413982..415445)
FT                   /locus_tag="CtCNB1_0374"
FT   CDS_pept        complement(413982..415445)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0374"
FT                   /product="putative transmembrane oxidoreductase protein"
FT                   /note="COG2072, TrkA, Predicted flavoprotein involved in K+
FT                   transport"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31120"
FT                   /db_xref="GOA:D0IXM5"
FT                   /db_xref="InterPro:IPR025700"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D0IXM5"
FT                   /protein_id="ACY31120.1"
FT                   /translation="MSISPSTTAATSGLATLEERLRDDFVTLGWPAKAWIPPSTRKGLP
FT                   VHDVLVIGAGQAGLALSMALQQVGIKPVLLDRSAPDFEGPWATTARMETLRSPKELTGP
FT                   AMGVAALSFRAWFIAQFGLDAWTALDKIPRLQWMDYLRWYRRVTNADVRNGHEVIAVRP
FT                   QADDVVEVDVKANGVTATWQTRRLVLATGRDGLGGATVPAFMRGVDRKFWAHSSDAMDY
FT                   ATLAGKHVGVVGAGASAMDSAATALENGAASVDMLIRRQQLPQINKSKGSGVPGLTHGQ
FT                   YLLPDAWKWRIRHYINAQQVPPPHGSTLRVSRHDNAFFNLGCAVQSVEKAGNKLQVQTS
FT                   AGVFVLDFLIVSTGFAIDWSLRPEFADIAPHVKLWNSRFTPESGDEDAELSASPDLGPL
FT                   FEFQGELPGLDRIHCFCYPAALSHGTVSGDIPAISDGARKLAQGLASLFYLNDIEQHFD
FT                   KLKAYAEPELDGTEWTAADSAARIRQLQP"
FT   gene            complement(415658..416668)
FT                   /locus_tag="CtCNB1_0375"
FT   CDS_pept        complement(415658..416668)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0375"
FT                   /product="hypothetical conserved protein"
FT                   /note="COG3181, Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31121"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:D0IXM6"
FT                   /protein_id="ACY31121.1"
FT                   /translation="MRLLPRFISGLVATTAAVALLPLTSQAADSGAASYPHQPITMIMG
FT                   FNAGSGVDVIGRVAQEPLGKILGQPVIIDYKSGAAGNIGSEFVARAKPDGYTIYFGTAA
FT                   THGSNAALYKKLPFDVEADFVPVAPLVDVANVLTINPNVINVKNLKEFVDEVKAHPGKY
FT                   NYASTGNGAGTHMAFAEFNSRLGLDMVHVPYKGGPEAITSVLRGETCCIMNQVQTVLSH
FT                   YKAGKVRLLGVTTAKPVEAVKEVPTIAASGLPGTKGFNSSIWFGIFAPKGTDPVIVKKL
FT                   NLAVNDVLKQPEVRERFVSQGNTIREETPEQFKKTVHEDRIKWAKVVKDAKISID"
FT   gene            complement(416880..417284)
FT                   /locus_tag="CtCNB1_0376"
FT   CDS_pept        complement(416880..417284)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0376"
FT                   /product="putative signal peptide protein"
FT                   /note="COG4991, Uncharacterized protein with a bacterial
FT                   SH3domain homologue"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31122"
FT                   /db_xref="InterPro:IPR024447"
FT                   /db_xref="UniProtKB/TrEMBL:D0IXM7"
FT                   /protein_id="ACY31122.1"
FT                   /translation="MLTIRNTIHTVAAAGALALLGFAGSAQAQSAYWAGASQGAYVNVQ
FT                   FNAPPPVRYEAVPAPRRGYVWAPGYWEPRGHRHVWRAGHWVQNRPGYVYRQPVWVQHGN
FT                   RWDYRASRWDRDGDGVPNRHDRNPHNPYRR"
FT   gene            complement(417485..418216)
FT                   /locus_tag="CtCNB1_0377"
FT   CDS_pept        complement(417485..418216)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0377"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="COG3655, Predicted transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31123"
FT                   /db_xref="GOA:A0A454XKV1"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454XKV1"
FT                   /protein_id="ACY31123.1"
FT                   /translation="MSTTADLVTAIKKELKAAQMTYADLAQAIGMAESSVKRMLAKGDM
FT                   PLSRIDEICRALHLDFADLARNVADSRPLLQQITREQEIAVVADRKLLLTAICVLSQWT
FT                   LEQIVATYRISEPEGIGYLAQLDRIGIIELRPGNRYKLRLAKTFRWQTNGPVMDFFREN
FT                   AVLDYFGGTFAGEDETMLLVHGSIAPSLAPSFVERIQRIGQDFSQQHLQDQRLGPNKIE
FT                   GYTLVLGMRKWELPAFAALRR"
FT   gene            418327..419127
FT                   /locus_tag="CtCNB1_0378"
FT   CDS_pept        418327..419127
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0378"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31124"
FT                   /db_xref="GOA:D0IXM9"
FT                   /db_xref="UniProtKB/TrEMBL:D0IXM9"
FT                   /protein_id="ACY31124.1"
FT                   /translation="MQLRTSSITTVEMTNPETSGTLEQRFALFGCMALLFTLALLMPGM
FT                   AQPEHYHAFADRRGWLGVPHAADVLSNLGFVLAGLAGWVALARADYQKLNGTARALCAL
FT                   FFTGLLCSGAGSAYYHWAPQDSSLVWDRLGMSLAFAGLLGLAVQTRIDDISARITAGVL
FT                   LVAAPASVAVWAQTSNVLPWVLVQGGGMLTLLWLAFVAPRRHALPMELGWVLGLYLVAK
FT                   LLEFSDGDVFDVTAHSISGHSLKHWVAAAAAWPVLRALLQWRES"
FT   gene            419233..421185
FT                   /locus_tag="CtCNB1_0379"
FT   CDS_pept        419233..421185
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0379"
FT                   /product="phospholipid/glycerol acyltransferase"
FT                   /note="COG0204, PlsC, 1-acyl-sn-glycerol-3-phosphate
FT                   acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31125"
FT                   /db_xref="GOA:D0IXN0"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D0IXN0"
FT                   /protein_id="ACY31125.1"
FT                   /translation="MNSTPTVHTAAAAQQHAHPNQFALLGQRRFAPFFWTQFAGAGNDN
FT                   LFKFAFTVMVTYQLSVSWLPPSMAGLVIGALFTLPYLLFSATSGQLTDKWDKTRMFRLV
FT                   KNLEIAIMLIAAWGFVQANVPVLLLCVFLMGLHSTLFGPVKFAYLPQVLNDRELTGGNG
FT                   MVEMGTFVAILLGQVAGGLLIAVPEVGHMQVAMACVAVAVVGRICAQFIPHAPATDPGL
FT                   VINWNPFTETWRNLQLARQQPVVFRSLLGISWMWFFGAVFLSQFPSFAKEVLHGDEHVA
FT                   SLLLVIFSVGIGIGSLLCEVFSRRQVEIGLVPLGAIGMSVFAIDLFFATRALPPSELMG
FT                   VNAFFGEAKHWRVMLDLGLLALSAGIYSVPMYALIQMRSQPTHRARIIAANNILNALFM
FT                   IASAVLAGALLAAGCSIPQVFLITGIANAIVALYVFLLVPEYLLRFVAWVITHFVYRFK
FT                   VRGDEHIPRDGAAVLVCNHVSFVDAILLMAASPRPIHFVMDHRIFQTPVLGWLFKLAKA
FT                   IPIAPHKEDPATYEAAFARAAEVLREGDLLAIFPEGGITFNGELQPFKGGIMKILDHAR
FT                   DDGLQVPVIPMALTNLWGSYFSRIELRGGRNVAMVKPLRRGLFNRVGLEVGEPVAASSV
FT                   TPALLQQNVADLLRR"
FT   gene            complement(421196..421888)
FT                   /locus_tag="CtCNB1_0380"
FT   CDS_pept        complement(421196..421888)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0380"
FT                   /product="hypothetical protein"
FT                   /note="COG3720, HemS, Putative heme degradation protein"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31126"
FT                   /db_xref="InterPro:IPR021409"
FT                   /db_xref="UniProtKB/TrEMBL:D0IXN1"
FT                   /protein_id="ACY31126.1"
FT                   /translation="MSTLAVSALAQGSSIPAFSQMPPGPLGGPWHFATLPNKNPTAFNV
FT                   VDQDGGHVLRVSTQDAYGNMVHTLHLTASPDLQLQWRWRVDQLIDKADIKTRAGDDAAL
FT                   KLCISFDFDKSQLSFGERAKLRLGKISTGEDIPAETLCYVWDNKQPTGTVMHNAFTHRM
FT                   RYIVLQSGSTHKGQWVAEQRNLASDYLHAFGDESQAMPTIIGVTVSADSDNTHGEGLAY
FT                   MGDIRLLP"
FT   gene            complement(421876..422163)
FT                   /locus_tag="CtCNB1_0382"
FT   CDS_pept        complement(421876..422163)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0382"
FT                   /product="hypothetical protein"
FT                   /note="COG5338, Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31128"
FT                   /db_xref="UniProtKB/TrEMBL:D0IXN2"
FT                   /protein_id="ACY31128.1"
FT                   /translation="MHAATNESSMRPKLRPCVLSKSASGRSRSIEKRYFPPAASAQTSC
FT                   SLHILPHSRAHNFQKSSGNPCGFTLRPSPCTNLHAGKAGLQQRLPRPCPR"
FT   gene            422158..422664
FT                   /locus_tag="CtCNB1_0381"
FT   CDS_pept        422158..422664
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0381"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31127"
FT                   /db_xref="UniProtKB/TrEMBL:D0IXN3"
FT                   /protein_id="ACY31127.1"
FT                   /translation="MQIAAHFNNHREPFVINVLTFIRPLRNGLCALGAAFALLGGSAVH
FT                   AQSEASLVLSALPVASVVAAASGGASEEVVAIPLFLSAAGASVIVEAVESSATGVTYVL
FT                   KNVADGTSAVVKVSGQAAGALSVGVGTVVQTSATAAGVILSTAGKVLAFIPNEIGKALM
FT                   HNERL"
FT   gene            422686..423543
FT                   /locus_tag="CtCNB1_0383"
FT   CDS_pept        422686..423543
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0383"
FT                   /product="conserved hypothetical protein"
FT                   /note="COG4727, Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31129"
FT                   /db_xref="InterPro:IPR014547"
FT                   /db_xref="UniProtKB/TrEMBL:D0IXN4"
FT                   /protein_id="ACY31129.1"
FT                   /translation="MIKEATSVVQAMAPARRAGMPIHGPVALALGAALIAWAGSAEAGR
FT                   SCEDRPLTADVMAKGLNLAARTAKALDAEFQKNGTQVVLLARQGQDLSKYDLKYSHYGW
FT                   AYRTSAGPWRVAHKLNECGTASGHIYRQGLGEFFLDDMWRYEAAIQIPTPAVQQALLKF
FT                   LSAPTVLRLQNEPYSMVSYVWSSKYQQSNQWATETLAAAMEPAAIQNRAQAQAWLQSKG
FT                   YEPSALIIRAFSRLGGRMTAANIAFDDHPNEKRFASRIETVTVDSVTQWLQRTQLASAV
FT                   RIVQ"
FT   gene            423614..424714
FT                   /locus_tag="CtCNB1_0384"
FT   CDS_pept        423614..424714
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0384"
FT                   /product="serine endopeptidase"
FT                   /note="COG3206, GumC, Uncharacterized protein involved in
FT                   exopolysaccharide biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31130"
FT                   /db_xref="UniProtKB/TrEMBL:D0IXN5"
FT                   /protein_id="ACY31130.1"
FT                   /translation="MSKSLRLPEKWFRRGLWLVALVFAFFLIGLGGLVVGNLPQPDRSL
FT                   EIESFIPEADAQRVQAQIDQARKTAGVTQKALDRAQLKFDAERARYQSARDTFDNWVAT
FT                   RRATERPEQDAELVARSKALDALKQAEDMARQEREKEAQTHLEANQAVSNAEAEMSSLR
FT                   EQAYPQYEAAMRASELRVFLFRLAITLPLLGVAGWLFAKKRKSTWWPFVWGFIFFALFA
FT                   FFVELVPYLPDYGGYVRYIVGILVTVLLGRYAILALNRYLEKQKLQESLPEEQRREELS
FT                   YDVALERLSKNVCPGCERPVDLKNTEIDFCPHCGIGLFDHCGSCNTRKSAFSRFCHSCG
FT                   TAAGKMLPRPDAAVAAPPAFGSDEPG"
FT   gene            complement(424744..426165)
FT                   /locus_tag="CtCNB1_0385"
FT   CDS_pept        complement(424744..426165)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0385"
FT                   /product="diguanylate cyclase"
FT                   /note="COG2199, FOG: GGDEF domain"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31131"
FT                   /db_xref="GOA:D0IXN6"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:D0IXN6"
FT                   /protein_id="ACY31131.1"
FT                   /translation="MTEASAPKPTPLPQTAAPRTWAAALGLGGLVLLAALLGILGRPMG
FT                   FLSAIWPANALLLGLLLHRPDWLRPSSVLAVSAAYIAADLLTGSRLDVAILLSIANMAG
FT                   VGAAWALMHRQRHATLFMQRQSSALLLFVGSGLGALTAALLGAPVLSAVFGTPHWQAFS
FT                   MWLSSEWLNYMMFLPIVLAWPTRKQPVGHLGEPSPLRRILPLLSVIALEAISYWIKGPG
FT                   SLAFSLPALIWCALSYRIFSLTLITATLCLSSIIFISLGTLEFTPAHFLETLSFRMGLC
FT                   MLVLGPLAVAGSHMARNELMQKLSHAVNHDFLTDMLARGAFMKQGQRILERCRQDGQPF
FT                   AILMLDLDHFKQINDSFGHAGGDQLLRSFSQTLSQVLRAQDIVGRMGGEEFAVALPKVD
FT                   ASAAQEIAKRINRAIRELRVPMNDKTMSATVSIGLVHTTSLQAHQSLDMLLLQADQALY
FT                   EAKAAGRNRVSSQLC"
FT   gene            complement(426439..427611)
FT                   /locus_tag="CtCNB1_0386"
FT   CDS_pept        complement(426439..427611)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0386"
FT                   /product="queuine tRNA-ribosyltransferase"
FT                   /note="COG0343, Tgt, Queuine/archaeosine
FT                   tRNA-ribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31132"
FT                   /db_xref="GOA:D0IXN7"
FT                   /db_xref="InterPro:IPR002616"
FT                   /db_xref="InterPro:IPR004803"
FT                   /db_xref="InterPro:IPR036511"
FT                   /db_xref="UniProtKB/TrEMBL:D0IXN7"
FT                   /protein_id="ACY31132.1"
FT                   /translation="MLQFDLLKTDPTSHARRGTLTLNHGKVQTPIFMPVGTYGTVKGVM
FT                   PRSLEEMGAQIILGNTFHLWMRPGLDIMKSFGGLHDFEKWDKPILTDSGGFQVWSLGAM
FT                   RKITEEGVHFQSPVNGDKLFMSPEVSMQIQTILNSDIVMQLDECTPYETNGKKTTEAEA
FT                   RKSMEMSRRWAKRSKEEFQRLENPNALFGIVQGGMYTNLREESLQGLLEIDFPGYAVGG
FT                   VSVGEPKDEMLEIMAHTPHLLPANKPRYLMGVGTPEDLVQGVADGVDMFDCVMPTRNAR
FT                   NGTIFTRYGDLKIRNARHKVDHQPIDTTCTCHACAGKSGVSWDDGGREGFSRAYLHHLD
FT                   RCGEMLGPMLTTIHNLHYYLNLMQEIRNALDAGTFAEFRAQFKADRARGV"
FT   gene            427733..428206
FT                   /locus_tag="CtCNB1_0387"
FT   CDS_pept        427733..428206
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0387"
FT                   /product="UspA"
FT                   /note="COG0589, UspA, Universal stress protein UspA and
FT                   related nucleotide-binding proteins"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31133"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454Y627"
FT                   /protein_id="ACY31133.1"
FT                   /translation="MLKIMIAVDGSDVALEAVRHGIKLLQSGLDAHFVIAHVQKEATLL
FT                   ELATTDSDLIANASIEAGMDLVAPAQDLLKEAGASYEVEISLGEEANTLIDIAESNECD
FT                   QIIIGATGQSGLGSILIGSVSREVARHSRLPVTIVKMPEVAEADDNSAEDADS"
FT   gene            complement(428262..428693)
FT                   /locus_tag="CtCNB1_0388"
FT   CDS_pept        complement(428262..428693)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0388"
FT                   /product="conserved hypothetical protein"
FT                   /note="COG1537, PelA, Predicted RNA-binding proteins"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31134"
FT                   /db_xref="UniProtKB/TrEMBL:D0IXN9"
FT                   /protein_id="ACY31134.1"
FT                   /translation="MDLLHLRYRLKSGFYYLYDMRDAPNAITGERPYRLKTELVAIAFD
FT                   RITGRVHQHGHPTRIHSWAMGAQRRLRMAGDWEGANRLVVVSGPLPEEEINKCLSVQGY
FT                   CRWMLMRLASMPHGKFAAHRAGSRSSWQRRESGQQRRAA"
FT   gene            complement(428780..429304)
FT                   /locus_tag="CtCNB1_0389"
FT   CDS_pept        complement(428780..429304)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0389"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="COG1846, MarR, Transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31135"
FT                   /db_xref="GOA:D0IXP0"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR023187"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D0IXP0"
FT                   /protein_id="ACY31135.1"
FT                   /translation="MPTMAQHNPDFSIDMPEAPGREAGLSHSDHQAVRLWLRLLTCSTQ
FT                   IEQVIRSQLRTEFGTTLPRFDYLAQLSRFPKGLRMKTLSEYLMVTGGNVTGLTDQLVAE
FT                   GWVERVADEEDRRSMIVRLTRSGKKQFKAMAAAHELWLEQLLTPLGSKNASDLYEQLGK
FT                   LRQVLSSPESA"
FT   gene            429421..431733
FT                   /locus_tag="CtCNB1_0390"
FT   CDS_pept        429421..431733
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0390"
FT                   /product="NADH:flavin oxidoreductase/NADH oxidase"
FT                   /note="COG1902, NemA, NADH:flavin oxidoreductases"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31136"
FT                   /db_xref="GOA:D0IXP1"
FT                   /db_xref="InterPro:IPR001155"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D0IXP1"
FT                   /protein_id="ACY31136.1"
FT                   /translation="MKIVCIGGGPAGLYFALLMKQMSPAHEVTVVERNKPYDTFGWGVV
FT                   FSDATMDNMRDWDPVTAAQIEQAFNHWDDIELLFKGRKIRSGGHGFVGIGRKHLLNILQ
FT                   ARCEQLGVNLVFETDVQSDEDYPDADLVIACDGVNSRIRSKYADIFKPDIVTRPNRYIW
FT                   LGTNKVYEAFSFDFVRTPHGWFQAHIYKFDDKTSTFIVETTEECWKASGLDTADQEQSI
FT                   AFCEKLFADNLQGEKLMTNARHLRGSAWINFQRVVCDQWWLKNRKGSHVVLMGDAVHTA
FT                   HFAIGSGTKLAIEDAIELARQFKQRGDAAAHIPEVLAAYQEARRVETLRIQNAAWNAME
FT                   WFEVCGQRYCDQLEPEQFMYSMLTRSQRISHENLRLRDAQWLGGYEKWLAERSGVAVDA
FT                   KAPPPMFLPYTLRGITLKNRIVVSPMAQYSAVDGVPGEFHLVHLGARALGGAGLVFAEM
FT                   ACVSAEGRITPGCPGTYSAEQKQAWKRISDWIHTNTDAKFAMQIGHAGAKASTRLAWEG
FT                   TDLPLEQGNWPVMAASEQQYLQGVSQISRAMTRADMDEVLQQFVHAAQMAADIGVDWLE
FT                   LHCAHGYLLSGFISPLTNQRSDEYGGSLENRLRYPLEVFKAMRAVWPQDKPMSVRISAH
FT                   DWVPGGITPEDAVQIAKAFKAAGADLIDCSSGQVSKLEKPVFGRMYQTPFADRIRQEAG
FT                   IATMAVGAISEADHANSIIAAGRADLCAIARPHLANPAWTLTEAAKIGYTPIVWPKQYF
FT                   QGKRQMEALFEREKALK"
FT   gene            431880..432650
FT                   /locus_tag="CtCNB1_0391"
FT   CDS_pept        431880..432650
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0391"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="COG1028, FabG, Dehydrogenases with different
FT                   specificities (related to short-chain alcohol
FT                   dehydrogenases)"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31137"
FT                   /db_xref="GOA:D0IXP2"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D0IXP2"
FT                   /protein_id="ACY31137.1"
FT                   /translation="MTGDLNDQHALVTGAGQGIGEAIARQLLAQGARVTVLGRRAEPLQ
FT                   KLVEEHPAQCRMALADVADESQVKTAFEKAVAAQGAISILINNAGQAGSAPFMKMDAAH
FT                   WQQMLAVNLSGTMHCIQQVLPAMSASGWGRIVNVASTAGLVGYAYVAAYVAAKHGVVGL
FT                   TRALALEYAKTGITVNAVCPGYTETEIVKTSIDRVVAKTGRTPEQAMAEFVKSNPQGRL
FT                   VQPHEVADAVLWLCGRGASSITGQAIAVAGGEVM"
FT   gene            432672..433526
FT                   /locus_tag="CtCNB1_0392"
FT   CDS_pept        432672..433526
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0392"
FT                   /product="Enoyl-CoA hydratase/isomerase"
FT                   /note="COG1024, CaiD, Enoyl-CoA hydratase/carnithine
FT                   racemase"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31138"
FT                   /db_xref="GOA:D0IXP3"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:D0IXP3"
FT                   /protein_id="ACY31138.1"
FT                   /translation="MSEYAIDPALQAGNHKLLAGYKATHFQWQVTDGVATITLNRPERK
FT                   NPLTFDSYAELRDLFHQLKWAQDVKAVVLVGAGGNFCSGGDVHEIIGPLVALKAPELLM
FT                   FTRMTGELVKTMRACPQPIIAAIDGVCAGAGAIMAMASDMRLGTARSKTAFLFNRVGLA
FT                   GCDMGACAMLPRIIGQGRASELLYTGRSLGGEEGERWGFFNRLIEPESVLAEAQKLAAD
FT                   LAAGPSFANGITKTMLHQEWAMTIEQAIEAEAQAQALCMLTEDFSRAYHAFVAKQKPVF
FT                   QGN"
FT   gene            433528..434691
FT                   /locus_tag="CtCNB1_0393"
FT   CDS_pept        433528..434691
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0393"
FT                   /product="acyl-CoA dehydrogenase-like protein"
FT                   /note="COG1960, CaiA, Acyl-CoA dehydrogenases"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31139"
FT                   /db_xref="GOA:D0IXP4"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:D0IXP4"
FT                   /protein_id="ACY31139.1"
FT                   /translation="MADTSYLKWPFFEAHHARLAQSLDAWARQNIAHSHGPDVDAECRQ
FT                   LVKALGEAGWLRHAVAGTAYGGAGEHIDTRTICLIRETLARHSGLADFAFAMQGLGSGA
FT                   ISLAGSEEQKKRYLSLVARGDAISAFALSEPDAGSDVAAMACEARLEGDHYVINGEKTW
FT                   ISNGGIADFYVVFVRTGEAAGSRGLSALIVEAGTPGFEIAERINVIAPHPLARLKFSNC
FT                   RVPAAQLVGAAGEGFKVAMRTLDVFRTSVAAASLGFARRAMDEALQRATSRKMFGGVLA
FT                   DFQLTQAKLAQMATQIDSAALLTYRAAWLRDQGENVTREAAMAKMTATENAQQVIDAAV
FT                   QIWGGLGVVSEQPVERLYREIRALRIYEGATEVQQLIIGRDLIKSHS"
FT   gene            434745..436355
FT                   /locus_tag="CtCNB1_0394"
FT   CDS_pept        434745..436355
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0394"
FT                   /product="benzoate-CoA ligase"
FT                   /note="COG0365, Acs, Acyl-coenzyme A
FT                   synthetases/AMP-(fatty) acid ligases"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31140"
FT                   /db_xref="GOA:D0IXP5"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR011957"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:D0IXP5"
FT                   /protein_id="ACY31140.1"
FT                   /translation="MLYTAHIDTFAADNLPPPEQQPEFIFELPELRFPERLNCAVELLD
FT                   RHVSEGRGDRLCIQAEGLRWSYADLQLKANRIANVLTQELGLQPGNRVLLCAPNNPMMV
FT                   ACWFGVIKAGGIAVAAMPLLRAKELSTIIDIAQISHALCDAALRTEVQGAQEKTSTLKA
FT                   VRYFNSVEADALERLMERAGDDFQAVETAATDTCLLGFTSGTTGVPKATMHFHRDVMAV
FT                   CACWPVHTLRANADDVFIGSPPLAFTFGLGGQVLFPMSIGASMALLEKAGPVQLVDGIE
FT                   RFGASVVFTAPTSYRVMAQQGERIRRTRLRKCVSAGEALTASTRALWKEATGIEIIDGI
FT                   GSTEMLHIFISHREEEARPGATGKAVPGYRAKVVDDAGLEVPPGTVGRLAVQGPTGCRY
FT                   LNDSRQTKYVSRGWNLTGDAYLMDVDGYFVYQARTDDMIISAGYNIAAPEVEEALMQHR
FT                   SVAECAVIGVADSERGQIVKAFVVLRAGHVASDAMVMELQDFVKSQVAPYKYPRAVQFV
FT                   DQLPRTATGKLQRFRLHQT"
FT   gene            436433..436894
FT                   /locus_tag="CtCNB1_0395"
FT   CDS_pept        436433..436894
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0395"
FT                   /product="thioesterase superfamily"
FT                   /note="COG0824, FcbC, Predicted thioesterase"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31141"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:D0IXP6"
FT                   /protein_id="ACY31141.1"
FT                   /translation="MNEVAMASKRFVTQMPIRFAHCDPAGIIFFPQYLVLFNGLVEDWF
FT                   NQALGLSYADMLHKDKVGLPIVHLECDFRAITRMGETVSLGLSVAKLGNRSLTLDVDCT
FT                   GPEGQLRVTAQKVLVFTSLQTHQAITAPQHIRHAIERWQSSSNPTENRS"
FT   gene            436897..437289
FT                   /locus_tag="CtCNB1_0396"
FT   CDS_pept        436897..437289
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0396"
FT                   /product="Endoribonuclease L-PSP"
FT                   /note="COG0251, TdcF, Putative translation initiation
FT                   inhibitor"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31142"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454XPF7"
FT                   /protein_id="ACY31142.1"
FT                   /translation="MQVLLPPGWPRPKGYANGVAVSGRQIYVAGMIGWDAEGRFHTDDL
FT                   AAQARQALHNIVEVLQAGGARPEHIVRMTWYITDKKEYLAQQAEIGKAYRELIGSFSVA
FT                   MTAVQVAALIEDRAKVEIEVTAVVPD"
FT   gene            437459..438130
FT                   /locus_tag="CtCNB1_0397"
FT   CDS_pept        437459..438130
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0397"
FT                   /product="amino acid transport related protein"
FT                   /note="COG2755, TesA, Lysophospholipase L1 and related
FT                   esterases"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31143"
FT                   /db_xref="InterPro:IPR013830"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="UniProtKB/TrEMBL:D0IXP8"
FT                   /protein_id="ACY31143.1"
FT                   /translation="MKPIFDPYRRHVLQCMRAAALLTGGAMLLSACGKKTPKAAAVPAG
FT                   ATVLALGDSLTQGVGASADAGYPSLLAERTGWKVVNAGVSGETSKQIADRLPGLLDEHG
FT                   PSLAILCAGGNDWLQRRSEQVVQGEITRMLQLCKARATPVLLVAVPELSLSAALTGRMK
FT                   DHSIYQTLAKDNRVALLADAWSEVLGNSALRADQVHANAAGYARFTELLVAQARASGFL
FT                   A"
FT   gene            complement(438169..439383)
FT                   /locus_tag="CtCNB1_0398"
FT   CDS_pept        complement(438169..439383)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0398"
FT                   /product="phospholipase A1"
FT                   /note="COG2829, PldA, Outer membrane phospholipase A"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31144"
FT                   /db_xref="GOA:D0IXP9"
FT                   /db_xref="InterPro:IPR003187"
FT                   /db_xref="InterPro:IPR036541"
FT                   /db_xref="UniProtKB/TrEMBL:D0IXP9"
FT                   /protein_id="ACY31144.1"
FT                   /translation="MSIRFFTPPPLTLSIGLALVGGLNPTTASSAELPPPESWQQCAAT
FT                   TSNNDRLACFDAWAHKQGPAAAPPATGWSAPAASAQAAPALTAATASANDAAPASAAGA
FT                   TVSSADSGLGLSPNNGGCRDPRYTEVSRYFELEPGTDCGTFNFRGYRPMSVSVVVGDGV
FT                   NQQPYSPSRGLATEQPYQKHEMRLQLSARTKIASGLLTGPTSKGKDSLWFGYTQQSYWQ
FT                   LFNGDISRPFRTTDHEPEVFYVYPTDAQLPLGWRWRYSGIGIAHQSNGQSNPLSRSWNR
FT                   WYLMTGAELGNRWQLHLKAWQRMKESALEDDNPHIQDYIGRGEVKLGWNVNEQNYLGLT
FT                   ARGSLGQGKGSGRIEWLRTLGEGWNGGKSNLRLHVQLFSGYGDSLVDYNNKRTVLSVGL
FT                   SLLDF"
FT   gene            complement(439434..439862)
FT                   /locus_tag="CtCNB1_0399"
FT   CDS_pept        complement(439434..439862)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0399"
FT                   /product="conserved hypothetical protein"
FT                   /note="COG1274, PckA, Phosphoenolpyruvate carboxykinase
FT                   (GTP)"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31145"
FT                   /db_xref="UniProtKB/TrEMBL:D0IXQ0"
FT                   /protein_id="ACY31145.1"
FT                   /translation="MTLRSLIFIAASAFSITACAQFDSKPVSTCARDWQMSDKQLQGVW
FT                   MGSVAGSEETARMVLGPHPEWEGNVKGSVSRLGSSHPMVGDVNEGTVTLEESADGSRIT
FT                   GTWLGEVVEGSCGTEIHGSYQEGENVPPRAFIMRKAQP"
FT   gene            complement(439872..441944)
FT                   /locus_tag="CtCNB1_0400"
FT   CDS_pept        complement(439872..441944)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0400"
FT                   /product="UvrD/REP helicase"
FT                   /note="COG0210, UvrD, Superfamily I DNA and RNA helicases"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31146"
FT                   /db_xref="GOA:D0IXQ1"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR005752"
FT                   /db_xref="InterPro:IPR013986"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="UniProtKB/TrEMBL:D0IXQ1"
FT                   /protein_id="ACY31146.1"
FT                   /translation="MSAGLNLAQLQAVHYTEGPCLVLAGAGSGKTRVITHKIGRLIETG
FT                   LAPRRIAAITFTNKAAAEMRERAAGLIGRQAKEVLICTFHSLGVRMVREDGHILGLKPQ
FT                   FSILDTDDVTGILKDCAGGTTDVATARQWQWTISGWKNQGWDSRKALAMAQDDNERSTA
FT                   LIMQRYEERLTAYQSVDFDDLIGMPMRLLRGHPEVREKWQRLLGHVLVDEYQDTNATQY
FT                   ELLKFLVGERAHFTAVGDDDQSIYGWRGATLDNLRKLPVDFPQLKVIKLEQNYRSTSAI
FT                   LRAANNVIGPNPKLFPKTLFSELGEGEPVRIVDCDTEEHEAERAVARIQSLRANMNPQP
FT                   AWKDFAILYRANHQAKPFEKALRKANIPYKVSGGTSFFDRAEIKDLCAWFRLWINNDDD
FT                   PAFLRSIGTPKRGIGHTTLGKLGEFSAAHKLSMFGSLFNAMLEEALPRKAFESLLEFGR
FT                   YINDLEYRARHTLGFEASRSFLIDWLKEIGYEQYLYDSEDSESVAAARWSNVLEFCDWM
FT                   AQRAGGQIEDAAGAGTQTEVKSLLEVSQNIALLSTISEREKEQDMVVLSTLHASKGLEW
FT                   PHVMQVGVTEGMLPFKLDDDDGKQQQVSDETAARLQEERRLMYVGITRAQRTLAVSWTK
FT                   RRKKGREMVACQPSRFIKEMGLDAATAKEDPREKLRKLREEFAARKNQAAPGAAN"
FT   gene            442222..442962
FT                   /locus_tag="CtCNB1_0401"
FT   CDS_pept        442222..442962
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0401"
FT                   /product="hypothetical protein"
FT                   /note="COG1180, PflA, Pyruvate-formate lyase-activating
FT                   enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31147"
FT                   /db_xref="UniProtKB/TrEMBL:D0IXQ2"
FT                   /protein_id="ACY31147.1"
FT                   /translation="MARTIGEVSLAAELWTPAVQQRFEALFAVAARKSLSGWRQVPRHA
FT                   AEVLVIEGLESLLVRAEARAPCVVYLGGEPAMQPLGRSSQGWAVHLDVDFTLSDLIDML
FT                   DRAAVFLMDWRARHRAGEPLPLQRALQELQSQGVDCTHCFQIKSWVALPGSVNSAQNMR
FT                   ALALLARGPIDARSLAEHAGIEMSQLSTLLSLPQIQAVLRCSLRGSGEPSAAQKSIAQK
FT                   QPAASVTRQWLSKLTGWITRGGRT"
FT   gene            442959..443525
FT                   /locus_tag="CtCNB1_0402"
FT   CDS_pept        442959..443525
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0402"
FT                   /product="putative GTPase"
FT                   /note="COG2229, Predicted GTPase"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31148"
FT                   /db_xref="GOA:D0IXQ3"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D0IXQ3"
FT                   /protein_id="ACY31148.1"
FT                   /translation="MTSFMPMQPGQGLLRVSLLGPMGIGKTTALRSLCGEFMAGSDVRN
FT                   LDKVTHSKEFTTVGAEFGEIDLGSGERLQLVGSPGQDRFDFVRRWVLSASVGALLMVDV
FT                   NDAGAVDYACEMLTGIAELDQAPLMVILSCRPTSGARLEAFSSALVAKGHDLTPLVEAD
FT                   PRDRQQMLDALSVLASLLSLQSQTL"
FT   gene            443522..443923
FT                   /locus_tag="CtCNB1_0403"
FT   CDS_pept        443522..443923
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0403"
FT                   /product="hypothetical protein"
FT                   /note="COG2018, Uncharacterized distant relative of
FT                   homeoticprotein bithoraxoid"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31149"
FT                   /db_xref="InterPro:IPR004942"
FT                   /db_xref="UniProtKB/TrEMBL:D0IXQ4"
FT                   /protein_id="ACY31149.1"
FT                   /translation="MKTHTSLVIPPHAVEAGQEILARVVAPVAGVHIALLCTPDGFEIS
FT                   ALRIRSDLPTERLSAMAGSLMAMAKAVANEIGHKDCKRLTFETESGTVVFQAVNGSFPA
FT                   VLCLVVDQNALLGRALWAAGEVATGYLPS"
FT   gene            444009..444368
FT                   /locus_tag="CtCNB1_0404"
FT   CDS_pept        444009..444368
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0404"
FT                   /product="conserved hypothetical protein"
FT                   /note="COG0045, SucC, Succinyl-CoA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31150"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454XYT3"
FT                   /protein_id="ACY31150.1"
FT                   /translation="MASIQDSLNALMTADGAVCGALVDSASGMLMGSVGGGVDMELAAA
FT                   GNTEVVRAKIKTMRMLNLNDQIDDILITLGKQYHIIRPVAANDGVFFYLVLDKARANLA
FT                   LARRKTADVEKELKL"
FT   gene            444496..445446
FT                   /locus_tag="CtCNB1_0405"
FT   CDS_pept        444496..445446
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0405"
FT                   /product="auxin Efflux Carrier"
FT                   /note="COG0679, Predicted permeases"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31151"
FT                   /db_xref="GOA:D0IXQ6"
FT                   /db_xref="InterPro:IPR004776"
FT                   /db_xref="UniProtKB/TrEMBL:D0IXQ6"
FT                   /protein_id="ACY31151.1"
FT                   /translation="MLSVLLITFPFFALVACGFVATWRGILPQASIPGLNAFVLYFALP
FT                   CMLYRFGAQTPIHQLLDINVTLVYLLCAVLMVGATVLLTHARLGWNDAAFGALVAAFPN
FT                   TGFMGVPMLAALLGAQSAGPVIVTMAIDMVLTTSACIALSRLDLAGGQGIWLAVRNSLK
FT                   GMASNPMPWSILLGGLASAMGWVLPGPVDKTVSMLAAAASPVALFTIGAVLARSQMNSH
FT                   ERVAARDYVPIALAKLVVHPLLVWAVGLAAISMGLGLQHETLVVLVLLAALPSASNVSL
FT                   LTERYGAHSGRVARIILVSTSLAFLSFSAAVALMT"
FT   gene            complement(445624..446745)
FT                   /locus_tag="CtCNB1_0406"
FT   CDS_pept        complement(445624..446745)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0406"
FT                   /product="L-asparaginase, type II"
FT                   /note="COG0252, AnsB, L-asparaginase/archaeal Glu-tRNAGln
FT                   amidotransferasesubunit D"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31152"
FT                   /db_xref="GOA:D0IXQ7"
FT                   /db_xref="InterPro:IPR004550"
FT                   /db_xref="InterPro:IPR006034"
FT                   /db_xref="InterPro:IPR020827"
FT                   /db_xref="InterPro:IPR027473"
FT                   /db_xref="InterPro:IPR027474"
FT                   /db_xref="InterPro:IPR027475"
FT                   /db_xref="InterPro:IPR036152"
FT                   /db_xref="InterPro:IPR037152"
FT                   /db_xref="InterPro:IPR040919"
FT                   /db_xref="UniProtKB/TrEMBL:D0IXQ7"
FT                   /protein_id="ACY31152.1"
FT                   /translation="MQKQVFRQSLLAATIAVLGVLSAPGAALAQDASPAAAQAAKAQAA
FT                   KPNVVVLATGGTIAGAGASTVNSATYTAAKVPVDKLLAGLPELAQIANVRGEQVFQIAS
FT                   ESFTNDNLLTLAKRVSQLAKQSDVDGIVITHGTDTLAETAYFLSLTVHTDKPIAVVGSM
FT                   RPGTALSADGALNLVNAVSVAGSKDARGKGVFVTMNDEINTARDVNKDINIQTGAFKSQ
FT                   WGPLGMVVEGKNYWFRAPVKRHTMNSEFNIDNIDKLPQVDIVYAYGSVQPTAVNALVDA
FT                   GAKAIVHAGTGNGSVADRMVKPLQDARGKGVLIVRSARVPYGFVLRNAEQPDDKYDWVV
FT                   AHDMRPEKARLLTMLALTKGANTKELQRMFWEY"
FT   gene            complement(446941..449112)
FT                   /locus_tag="CtCNB1_0407"
FT   CDS_pept        complement(446941..449112)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0407"
FT                   /product="primosomal protein N'"
FT                   /note="COG1198, PriA, Primosomal protein N' (replication
FT                   factor Y) -superfamily II helicase"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31153"
FT                   /db_xref="GOA:D0IXQ8"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR005259"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040498"
FT                   /db_xref="InterPro:IPR041222"
FT                   /db_xref="InterPro:IPR041236"
FT                   /db_xref="InterPro:IPR042115"
FT                   /db_xref="UniProtKB/TrEMBL:D0IXQ8"
FT                   /protein_id="ACY31153.1"
FT                   /translation="MSHIVYVAVQTPAHSAVGDLLSYVSDAWLEPGSLARVPLGKRELL
FT                   GVVWDTPAAPEAIPDGVELRSIAGLLQGIEPLNQAWRRLVAFAAHYYQRSLGEIAVTAL
FT                   PPQLRDMSPEQLARRLTPPKTAKTPAGKRKKAQVAEAAQASTETMAHTQGASSATPLLA
FT                   LSAEQSVVFEQIEQNPGPFLLYGSTGSGKTEVYLRAVQAVLDANPEAQALVMVPEINLT
FT                   PQLEERFVARFVPQYGKDAVVSMHSGMTNPQRLKSWLAAHTGRARIVLGTRMAIFASVP
FT                   QLALIVVDEEHDASYKQQEGARYSARDLAIWRGRDTGAKVILGSATPSLESWHASEPDV
FT                   GRYLRLHMPSRIGAASLPRVRMVDMGQQPKRAVFSPPLIEAITERVKRGEQSLILLNRR
FT                   GFAPVLFCADCNWKSDCPHCSAHQVFHKGDRTLRCHHCGFTQRVPFACPNCGNPDILPL
FT                   GKGTEQLQEELERLLRNVQRPDGNPARVARIDADTTKAKGSLEQQLAQVHAGDVDVLVG
FT                   TQMVAKGHDFRRITLVAAVQPDSALYSSDYRAPERLFCLLMQAAGRAGRDAQYVQAQGS
FT                   HPEMWIQSHDPQNAVYTALRKHDYPAFARQQLKERLDAGMPPYAFQAIVRADARTQEAA
FT                   QAFLNAATQVAREAKLPYLDEVFIYPPIPMAVQRVANVERAQMLLEAGNRSALLRFLNA
FT                   WQQYLHWLRTLPEHRPLVRWLVDVDPLSI"
FT   gene            complement(449772..450974)
FT                   /locus_tag="CtCNB1_0408"
FT   CDS_pept        complement(449772..450974)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0408"
FT                   /product="uroporphyrinogen decarboxylase"
FT                   /note="COG0407, HemE, Uroporphyrinogen-III decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31154"
FT                   /db_xref="GOA:D0IXQ9"
FT                   /db_xref="InterPro:IPR000257"
FT                   /db_xref="InterPro:IPR006361"
FT                   /db_xref="InterPro:IPR038071"
FT                   /db_xref="UniProtKB/TrEMBL:D0IXQ9"
FT                   /protein_id="ACY31154.1"
FT                   /translation="MAAAIPAQRAELPLGIVVNGKAGVGDNRHMSFAPLTNDTFLRACR
FT                   RQATDYTPLWLMRQAGRYLPEYKATRAKAGSFMGLATNVDYATEVTLQPLDRFPLDAAI
FT                   LFSDILTVPDAMGLGLSFAEGEGPRFAKVVRDEAAVAELAVPDMDKLRYVFDAVTNIRK
FT                   VLNGRVPLIGFSGSPWTLACYMTEGKGSDDYRTVKSLMYSRPDLMHRILEVNADSVAAY
FT                   LNAQIDAGAQAVMIFDSWGGVLADGAFQEFSLAYTKRVLAQLKRTGVDGSDVPRIVFTK
FT                   GGGIWLPDMKDIDCEVLGLDWTANLGKARAIVGGEIGGPGKALQGNIDPNVLFAAPEQV
FT                   AAQARAVLDSFGKPHTDKSTTGPTHIFNLGHGISQFTPPEHVAALVEAVHSHSRLLRTK
FT                   G"
FT   gene            451104..451970
FT                   /locus_tag="CtCNB1_0409"
FT   CDS_pept        451104..451970
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0409"
FT                   /product="conserved hypothetical protein"
FT                   /note="COG3176, Putative hemolysin"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31155"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D0IXR0"
FT                   /protein_id="ACY31155.1"
FT                   /translation="MRHPEILDALNGQSIATTSSSAPSLSHRPASPVHPAAPALRLQVR
FT                   WARHLDEVRQAQRLRYQIFAEEMGAVLQTPVAGHDIDVFDDFCEHLMVCDEEQNKVIGT
FT                   YRLLTPAQAQRAGGLYSDQEFDLSPINAWRAQMVELGRSCVHAEHRQGGVILALWGALA
FT                   EFMQRNRLEAMVGCASIPMQYPGLAHGEGPARIWQQLRQSHLAEPELQVRPRVALPEEL
FT                   AHISNVSADALKVEPPALIQGYLRAGAKVLGAPAWDSDFNTADLPIMMRMQDLPSRYRR
FT                   LFGRMKA"
FT   gene            complement(452033..452503)
FT                   /locus_tag="CtCNB1_0410"
FT   CDS_pept        complement(452033..452503)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0410"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31156"
FT                   /db_xref="GOA:D0IXR1"
FT                   /db_xref="UniProtKB/TrEMBL:D0IXR1"
FT                   /protein_id="ACY31156.1"
FT                   /translation="MLRALALASLAIAGLALPFAWDVLASINSMPKMHWLQQALAQAPA
FT                   FSWLMMFVWGGAIPLVLLKNMDQTPSHKLRTTVVMLVLMWIAVTWYVHMPASNQCSALY
FT                   GSWDWACSVLQWGYSMSLVLSIAAYAFLMLGLMVTALGLFAEGLEDEPSHAA"
FT   gene            452869..453255
FT                   /locus_tag="CtCNB1_0411"
FT   CDS_pept        452869..453255
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0411"
FT                   /product="Glyoxalase/bleomycin resistance"
FT                   /note="COG3324, Predicted enzyme related to
FT                   lactoylglutathionelyase"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31157"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454Y1W8"
FT                   /protein_id="ACY31157.1"
FT                   /translation="MLSHSAVTTMLPVMDMARARAFYEESLGLQPGELRPDGKFVYLVG
FT                   GSALALFPKPGGTKAEHTAISFRVPDIAASIRELKSRGVVFEDYDFPDFKTVNHVCVLG
FT                   SEKAAWFKDTEGNYLCLHEEVAPA"
FT   gene            complement(453286..455559)
FT                   /locus_tag="CtCNB1_0412"
FT   CDS_pept        complement(453286..455559)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0412"
FT                   /product="cytochrome c biogenesis protein, transmembrane"
FT                   /note="COG4232, Thiol:disulfide interchange protein"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31158"
FT                   /db_xref="GOA:D0IXR3"
FT                   /db_xref="InterPro:IPR003834"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR028250"
FT                   /db_xref="InterPro:IPR035671"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:D0IXR3"
FT                   /protein_id="ACY31158.1"
FT                   /translation="MLFATSSRRPRPSLLALWLIALLLIAASALSTTATAGIQLRTSAS
FT                   NSTALVQTPRVRAELVAQAPEGIAAGQSFWLGLKLAHEPDWHTYWKNAGDSGLPTELQW
FT                   QLPSGLSTGSIDWPTPHALRVGPLVNYGYENTVLLPIPVKVANDFKAPASGMVEVHLSA
FT                   SWLICRVECIPESGEFTLQIPVVGSTAANSEDFLKARAQQPVALNGNGQASVQPATDAK
FT                   IADDRIHLRVAGLPAAIKGKTLELYPENAETFKHAAESGKDWQQRWDGDDWVAEGLPLS
FT                   DMRSDTPPQLAIVVALAGKDRAAALDNGQPIAWRSTLDVQGQWTPATLTSVSPALAAAL
FT                   EANKNATAPAQTSGSVSSTSLLAALLGGLIGGLILNLMPCVFPVLAIKVLGFAGHGENR
FT                   QAQKLGGLAYTAGVVLSFVALGALLLGLRAAGQQLGWGFQLQSPVVVSLLAALFTVLGL
FT                   NLAGLFEFGSLLPSRIASAQARNPVLDSFLSGVLAVAIASPCTAPFMGASLGFAIDMPA
FT                   AQALTVFAALGVGMALPYLLASFVPSVVGWLPRPGPWMQTFRHAMAFPMFATVVWLVWV
FT                   LGHQGGMDAAAALLALLLVLAALIWALGLRGKSRISLGALALLLAAGVTYYALPLIKAE
FT                   PAGQVQAQAGELWQPWSADKVQSAHASGQPVFVDFTAAWCVTCQVNKRTTLSNAEVLAA
FT                   FAQHQVQLLRADWTRQDPAITQALQSLGRSGVPVYVLYLPGKQPVVLSELLSKSEVLDA
FT                   LKQI"
FT   gene            complement(455660..457255)
FT                   /locus_tag="CtCNB1_0413"
FT   CDS_pept        complement(455660..457255)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0413"
FT                   /product="MATE efflux family protein"
FT                   /note="COG0534, NorM, Na+-driven multidrug efflux pump"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31159"
FT                   /db_xref="GOA:D0IXR4"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:D0IXR4"
FT                   /protein_id="ACY31159.1"
FT                   /translation="MPEASASAPRQSTRTANSKPQTRDLTQGPIASTLLVFALPILAGN
FT                   VLQSLNGSVNAIWVGGHLGEAALTATANANNVMFALIGAVFGISMATNILIAQSMGSKN
FT                   IAQAKRVLGTSATFFGVVSLLIAVLGWPLSRHLMQWMSTPEAALPLAEAYLKVIFLAIP
FT                   LLFMFSFVTAALRGAGDTRTPFWFLLVVVALDMALNPLLIFGWGPVPRMGIQGSAVATL
FT                   IANAVSFAALLGWLRLRRHPLWIGRRQLGLFKPDRTIVRTLVVKGLPMGVQIVMISLAM
FT                   IAMISMVNEHGVQTASAYSAALQLWTYVQMPAMAIGAACSSMAAQNVGAGLWRRVSATA
FT                   NAGMLGNLLMTGSLIVLIVLLDRHVLGWFLPGGSPSLEVARHLNHIAIGSFLFFGVTFV
FT                   LAGVVRSTGAVMAPVLILAIAMWGIRVPVARWLQPVMGVDAIWWSFPISSVCSMLMMLA
FT                   YYRWGNWRQAHMLPTRQAEPAITAPPQTSENTSVDADALLNNASNCERIVMPAEVGGQP
FT                   PSPVANQAQAVDKS"
FT   gene            457352..458227
FT                   /locus_tag="CtCNB1_0414"
FT   CDS_pept        457352..458227
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0414"
FT                   /product="Creatininase"
FT                   /note="COG1402, Uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31160"
FT                   /db_xref="InterPro:IPR003785"
FT                   /db_xref="InterPro:IPR024087"
FT                   /db_xref="UniProtKB/TrEMBL:D0IXR5"
FT                   /protein_id="ACY31160.1"
FT                   /translation="MMAMSNTPTTPASALPRWPSRFWAQASAHDFALAQSNGLAADTVA
FT                   VLPVAAVEQHGPHLPLSVDASLIEGVIDAALAQLPAELPVLFLPAQNIGFSVEHTHYAG
FT                   TLSLQPATLIALWTELGACVARAGIRKLLLLNGHGGQVSVMDIVARELRIKHGLLVYSA
FT                   SWFGLVDDAANQQFCAHEHRFGIHGGEVETSMMLHLAPETVHMERAQNFASSSELRAGK
FT                   YHFIGNGRSAKLGWAIEDYNPAGAVGNSAAATAERGAAMVHSSAEGLVRLLSEIHDLPL
FT                   STVGNQPQPL"
FT   gene            complement(458333..459319)
FT                   /locus_tag="CtCNB1_0415"
FT   CDS_pept        complement(458333..459319)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0415"
FT                   /product="TctC"
FT                   /note="COG3181, Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31161"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:D0IXR6"
FT                   /protein_id="ACY31161.1"
FT                   /translation="MKRRSFTQSLISAAAGAALLSGFAATAQAEGLSNRPIRIVVPFGA
FT                   GGVADVTARVVAQQLSTQLGQPVVIDNKPSAGGIVAADTVAKAAPDGHTLFLMSNGSAV
FT                   TVNLFNNLPFDMVKDLTPISTLGYFDIGVITDAKSPFKNLGELVSYAKANPGKLNLGSI
FT                   NVGSTQHLAAELFKTTAGIDAQIVPFNGTPAVVTALRGKQIDAAVEILTPIMGQINSKA
FT                   VNLLAVTGEKRSPLLPNVPTAQESGVKGFVASSWNALAAPSKTPAPVIARLNKEINAAV
FT                   NNPEVAKKLRELNVQAQASTPEQTAKLLQSEIKRWGDVIAQAKIPKQ"
FT   gene            complement(459421..459870)
FT                   /locus_tag="CtCNB1_0416"
FT   CDS_pept        complement(459421..459870)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0416"
FT                   /product="conserved hypothetical protein"
FT                   /note="COG4258, Predicted exporter"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31162"
FT                   /db_xref="UniProtKB/TrEMBL:D0IXR7"
FT                   /protein_id="ACY31162.1"
FT                   /translation="MDSIFLSLGDTALTLDIGAQQHRLPIGIATLVKAFAQRMPNALML
FT                   ENAIADVEDAVMPAGRWLPAGASLLQTTAPLLRQLIHSATADPQATQASREAIENLFEL
FT                   LARQAQQPGHADPQLPQTPEHAAALLIVREVMHHWGLDTLQASGN"
FT   gene            complement(459919..460578)
FT                   /locus_tag="CtCNB1_0417"
FT   CDS_pept        complement(459919..460578)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0417"
FT                   /product="Phosphoglycerate mutase"
FT                   /note="COG0406, GpmB, Fructose-2"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31163"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:D0IXR8"
FT                   /protein_id="ACY31163.1"
FT                   /translation="MRHGQASFGADDYDQLSPRGQEQAVRLGEYWRERGLKFDAVYAGT
FT                   LKRHQQTLAGIVQGLGSASSPEAQNRPGLNEYDSEALLRAIHPAPLPRPDTPELYRHHF
FT                   RLLCDALAQWMGGTISPVGMPDWNGFADGVHQVLEEIRHQHSGQNVLLVSSGGPISAAV
FT                   GQVLGTAPEVTIALNMRLRNIAVTEFSISPKRLMLQSFNTLNHLDGLEYRDWVTAA"
FT   gene            460881..461909
FT                   /locus_tag="CtCNB1_0418"
FT   CDS_pept        460881..461909
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0418"
FT                   /product="extracellular solute-binding protein, family 1"
FT                   /note="COG1840, AfuA, ABC-type Fe3+ transport system"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31164"
FT                   /db_xref="InterPro:IPR026045"
FT                   /db_xref="UniProtKB/TrEMBL:D0IXR9"
FT                   /protein_id="ACY31164.1"
FT                   /translation="MFRRPLFALAAVASLCAPALSAHAEDITLYTTREPALIQPLLAAF
FT                   TAQTKIGVKTVFVKDGLLERVKAEGQRSPADVLMTVDIGNLLDLVDGGVTQPVKSSILE
FT                   AAIPAQLRAADNQWFALSMRARVLYAEKDMKIGAFRYEDLAKPQFKGKVCSRAGQHPYN
FT                   TALIAAMIAHDGEAKTEQWLKGVKANLARKATGGDRDVARDILGGICDVGLANTYYVGH
FT                   MKAAKEGTDARKWGDAIKVVKPTFNDPKSGTHINISGASVAKHAPNRDQAVKLLEFLVS
FT                   EPAQNMYAQANYEHPVRKGVALDPVVAQSIGEIKIDPLPLTEIAKHRKAASVLVDKVGF
FT                   DK"
FT   gene            462095..463705
FT                   /locus_tag="CtCNB1_0419"
FT   CDS_pept        462095..463705
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0419"
FT                   /product="iron utilization protein"
FT                   /note="COG1178, ThiP, ABC-type Fe3+ transport system"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31165"
FT                   /db_xref="GOA:D0IXS0"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D0IXS0"
FT                   /protein_id="ACY31165.1"
FT                   /translation="MWQGASWLIALGVFAPIASLAWLALGADWAHWQDLLRYVLPDAAA
FT                   NTAWLLGGVGLVVLVVGTGCAWLVTACDFPGRRWLHWALLLPLAMPAYIVAFAYLDLLH
FT                   PIGPVQGALRWLLGYDSPRQWRLPDLRSMGGAIFVLGFTLYPYVYMTARSMFMTQPAHL
FT                   MEAARSLGETRWGAFWRVALPMARPALVVGLSLALLETLNDIGASEFLGVHTLTVSIYT
FT                   TWVTRSDLAGAAQIACSMLLAVVALVWLERQGRSRQRFGSAQRMRAIAPHRLPAGRAWL
FT                   ATLACSLPVLIGFAAPAAYLAWESGKRLVQGSGVSEGLVSSLLNTLGLALGVTVIAVAA
FT                   GLVVAWATRTGISTRAPSRWPAQLAALGYAVPGTVLAIGLLTPALAFDAGLAQLFGMNG
FT                   LPLMGQGIVLVAACVIRFLVMPVGGIEAGLARIPPTLEQASRLLGESRLGTLRRVHLPL
FT                   LRPAMATSAMLVFVDAMKELPATLLLRPADFDTLATWLYAEAARGTYEEGAIAALCIVV
FT                   AGLVPVMLLARTQLSGGQR"
FT   gene            463863..464522
FT                   /locus_tag="CtCNB1_0420"
FT   CDS_pept        463863..464522
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0420"
FT                   /product="ABC transporter"
FT                   /note="COG3842, PotA, ABC-type spermidine/putrescine
FT                   transport systems"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31166"
FT                   /db_xref="GOA:D0IXS1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030287"
FT                   /db_xref="UniProtKB/TrEMBL:D0IXS1"
FT                   /protein_id="ACY31166.1"
FT                   /translation="MTASLQIAQLQLGYDTPKGLHTVLQGFDLQVPAGHIASLLGPSGC
FT                   GKTSVLRAIAGFEPVRAGSIHLGEVLLSGPGTHLPPEQRHVGMMFQEYGLFPHLTAVQN
FT                   VGFGLRRMGKPERDKRVQELLAVVGLANSGSKFPHELSGGQQQRVALARALAPSPALLL
FT                   LDEPFSNLDAATRERLTLEVRDILRATGQTAILVTHNAQEAETMADQICRMTPAQL"
FT   gene            complement(464537..465463)
FT                   /locus_tag="CtCNB1_0421"
FT   CDS_pept        complement(464537..465463)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0421"
FT                   /product="phenazine biosynthesis protein PhzF family"
FT                   /note="COG0384, Predicted epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31167"
FT                   /db_xref="GOA:D0IXS2"
FT                   /db_xref="InterPro:IPR003719"
FT                   /db_xref="UniProtKB/TrEMBL:D0IXS2"
FT                   /protein_id="ACY31167.1"
FT                   /translation="MTVDVFTHTALLGNPVAVVLGADGLSDAQMQAFARWTNLSETTFV
FT                   LQPTPEGLAAGADYQLRIFTPAGELAFAGHPTLGSCHAWLAQGGQPRNPEQVLQECQKG
FT                   LVAIGCNAQGALFFEAPSLDSQEISEEELAPVLQALGLQREQLLMARSLYNGSPWLGML
FT                   LDHPDTVLSVEPDFGALKKLGAKAGLAAIYEVEEDAPLIGRSSREARAFAKQAEEAAQE
FT                   KVAPAQPRLEVRALIGETASEDPVTGSLNAALAQWLTDEGLLQTPYIAAQGVCVGRDGQ
FT                   VHVQTAANGKLWVGGHTVTVTSGRVLL"
FT   gene            complement(465678..466859)
FT                   /locus_tag="CtCNB1_0422"
FT   CDS_pept        complement(465678..466859)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0422"
FT                   /product="aminotransferase, class I and II"
FT                   /note="COG1167, ARO8, Transcriptional regulators containing
FT                   a DNA-bindingHTH domain and an aminotransferase domain
FT                   (MocR family)and their eukaryotic orthologs"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31168"
FT                   /db_xref="GOA:D0IXS3"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D0IXS3"
FT                   /protein_id="ACY31168.1"
FT                   /translation="MTTWTLAERAAKMNSSAIREILKLTDRPGIISMAGGLPSPKAFPL
FT                   DAFTEACQTVMQRDGAAALQYSTTEGFAPLRQAIADFLPWNVDPEQILITTGSQQALDL
FT                   IGKVFLDKGSRLLVEKPTYLGALQAFTPMEPVAVGVDSDDEGMLIDDFAKQIGSGADKA
FT                   RLAYVLPNFQNPTGRTMSDARRQALVDKARELDIPLIEDNPYGDLWYEQEPPLPLAARN
FT                   PEGVIYMGSFSKVLAPGLRIGFIVAPKSVYGKLTQAKQAADLHTPSFNQRVVAEVIKDG
FT                   FLDRHVPTIRAMYKTQRDVMLMALEREMAGLDVKWTRPVGGMFLWVRLPAGMDAQALLA
FT                   KAVERNMAFVPGAPFYAGDAQNNTLRLSYVTVSAEQINIGIAALADAIRSNTP"
FT   gene            467242..468714
FT                   /locus_tag="CtCNB1_0423"
FT   CDS_pept        467242..468714
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0423"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="COG1167, ARO8, Transcriptional regulators containing
FT                   a DNA-bindingHTH domain and an aminotransferase domain
FT                   (MocR family)and their eukaryotic orthologs"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31169"
FT                   /db_xref="GOA:D0IXS4"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D0IXS4"
FT                   /protein_id="ACY31169.1"
FT                   /translation="MSISLSRQAALTLTQQLAERLAERIRTRLLPAGARLPSVRECARQ
FT                   QGVSPYTVVAAYDLLQAQGLVEARPQRGFYVRDIVQNPLQMPEGKAQIAINAGAVNTPV
FT                   GIPPGTRINATMLIRGMFVESVAGKPQPGAGVLPAEWLDAGFLVAAMRKVTSGQALRES
FT                   LVRYGEPMGDSRLREALARRLQRIGIAVGTGQIITTLGATQALDIVSRALLQPGDPVMV
FT                   EEPGWAVEYARLAAMGMRVLPVPRGPEGPDMAVMQRYCETMAPKLYVSVSVLHNPTGYS
FT                   LSAASAHEVLQMAQRYGFYVVEDDSYCHIAADHAPRVSVLDRLQRSIYISGFAKVLVPN
FT                   WRLGYLAAPPDLVERLLDTKLLSTLSTPTPMEQALALCMEQGQLRRHAERLRQHLAQAR
FT                   TRSVALAQAAGCRFVAEPAGMFGWVDTGVDTEVLTQLLLDQGYMIAPGAMFHASRGSST
FT                   CMRINFATTQDAAFWRVFERVVAQMRAQAQKL"
FT   gene            complement(469009..469836)
FT                   /locus_tag="CtCNB1_0424"
FT   CDS_pept        complement(469009..469836)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0424"
FT                   /product="conserved hypothetical protein"
FT                   /note="COG3394, Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31170"
FT                   /db_xref="GOA:D0IXS5"
FT                   /db_xref="InterPro:IPR006879"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:D0IXS5"
FT                   /protein_id="ACY31170.1"
FT                   /translation="MNHMNTSRAILLCADDYALHPLVDDAVQQLTAAGRLSATSCMTTS
FT                   PLWPQAAPALRDLRPRLSVGLHFNLTEDHGGQHDAQALGTVLRQAYARQMPQGLMRQAW
FT                   REQLDAFEQVMGTAPDFIDGHQHVHQLPGLRAAMQQELQSRYAAHEMPWVRSTAPASGL
FT                   WRSPKAAIIALLGGWTTTRQLRHADIPMNHGFGGVYGFDAPDTASYGRQMAGWLPHMAA
FT                   GGLLMCHPASGVVEGDAIGRQRPVEFEYLMSDAFGELLQRTGCHIHQGPVQLG"
FT   gene            complement(469833..470249)
FT                   /locus_tag="CtCNB1_0425"
FT   CDS_pept        complement(469833..470249)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0425"
FT                   /product="GtrA-like protein"
FT                   /note="COG2246, Predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31171"
FT                   /db_xref="GOA:D0IXS6"
FT                   /db_xref="InterPro:IPR007267"
FT                   /db_xref="UniProtKB/TrEMBL:D0IXS6"
FT                   /protein_id="ACY31171.1"
FT                   /translation="MIADALQRLRRLPQLLQFVLVGGSAAATHLAVVGLLVSFSGMPPL
FT                   WANVLAFLVAFVVSYNGHALLTFSAAQARGWPVVAKFFAVACLSFVANEALYYIALNWL
FT                   HWHYFWSLAAVLVLVAIGTFVMSKFWAFKARSAA"
FT   gene            complement(470246..471250)
FT                   /locus_tag="CtCNB1_0426"
FT   CDS_pept        complement(470246..471250)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0426"
FT                   /product="glycosyl transferase, family 2"
FT                   /note="COG0463, WcaA, Glycosyltransferases involved in cell
FT                   wallbiogenesis"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31172"
FT                   /db_xref="GOA:D0IXS7"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D0IXS7"
FT                   /protein_id="ACY31172.1"
FT                   /translation="MTDLHAEYAPAAPPAQLPRQPLRLSCVVPAYNEQANIEGFLRALA
FT                   QTVRALTPDFEIVVVNDGSRDGTHELSLRLAQELPLRYLALSRNFGKEAALSAGIDHAR
FT                   GNAVLLIDADFQHPLEMLAEMHGLWQSGYEMIYGVIADRGAESGAKRVGTDLFYRVMNS
FT                   GSAVKMPPNAGDFRWMDRKVVDALKALPENNRFMKGLYAWVGFKAAALPFVPKDRVAGS
FT                   SSFNLRRLGSLALLGLTSFTTLPLRVWSMVGAGISLLALAYGLWIAAEALFFGNPLRGW
FT                   PTLAASIMLFSGVQLLSIGILGEYIGRIYEEVKRRPIYLVAHDEDRSPLREPS"
FT   gene            471385..472866
FT                   /locus_tag="CtCNB1_0427"
FT   CDS_pept        471385..472866
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0427"
FT                   /product="4-amino-4-deoxy-L-arabinose transferase and"
FT                   /note="COG1807, ArnT, 4-amino-4-deoxy-L-arabinose
FT                   transferase and related glycosyltransferases of PMT family"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31173"
FT                   /db_xref="GOA:D0IXS8"
FT                   /db_xref="InterPro:IPR038731"
FT                   /db_xref="UniProtKB/TrEMBL:D0IXS8"
FT                   /protein_id="ACY31173.1"
FT                   /translation="MTAVPRESLVLGGRAVAALLAVYGVIWLAIHWVTALAAPGDNVEQ
FT                   LIWIHSLELGYFKHPPMPTWIMAASAAVFGPSIGLTYVLGGVLTLGSLAIFWKLLCDMR
FT                   GRAYATVGLLAALSITFYCGRLYYYNHNVVMMLWISLAVALSWHVTQKPSLAGWALLGL
FT                   VSGLGMLSKYQYVLALGVIGLWWLRIGAWKNPVHVKGAALATVIGLLVLSPHLYWLSTH
FT                   DWMPMHYAERTSLGLHLDTAARINMSWKFAVDWIFNRCMPAWIVLGVALWWGRRRAGKT
FT                   GEQTAPTKVAPVAADRMLREFWLLWGLVPLLAMLALCLFTGSYLHLQWGTAFMFLCVPA
FT                   VMEWSRSPRSWGAAGELRAAWLTFGVLQALLLLQFWLASPMGLSGYKSTHQNHIPVDRI
FT                   VEGLAPAAHQALGGPVDIIIGPQALAGRIAMELPERPRVYVERNLQYSPWIREDELPNA
FT                   RIIEVMVAPDPLPPGLMRAYGVWAWRPVKIAKGEH"
FT   gene            complement(472940..473302)
FT                   /locus_tag="CtCNB1_0428"
FT   CDS_pept        complement(472940..473302)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0428"
FT                   /product="hypothetical protein"
FT                   /note="COG0480, FusA, Translation elongation factors
FT                   (GTPases)"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31174"
FT                   /db_xref="UniProtKB/TrEMBL:D0IXS9"
FT                   /protein_id="ACY31174.1"
FT                   /translation="MTLQEMLDSLDAVIQTVSASLQSPDASALEQSSTRLRDAMVAFSQ
FT                   LVKRFSADDWTPALRERAQSLDREISLVRDQLARLSVLNQRRTKALVPAAEDSTYESSL
FT                   RGASQTGRARIYHAAS"
FT   gene            complement(473341..473655)
FT                   /locus_tag="CtCNB1_0429"
FT   CDS_pept        complement(473341..473655)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0429"
FT                   /product="putative anti-sigma-28 factor, FlgM"
FT                   /note="COG2747, FlgM, Negative regulator of flagellin
FT                   synthesis (anti-sigma28 factor)"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31175"
FT                   /db_xref="GOA:D0IXT0"
FT                   /db_xref="InterPro:IPR007412"
FT                   /db_xref="InterPro:IPR031316"
FT                   /db_xref="InterPro:IPR035890"
FT                   /db_xref="UniProtKB/TrEMBL:D0IXT0"
FT                   /protein_id="ACY31175.1"
FT                   /translation="MKIGNKPDLQQTAAAAKQAPKSATTVATEESTKGLSERAAGVPVS
FT                   FSSSARALDSQSRTNTDFDADRVKAMREAIANGSFRVNAEAVADKLLANTEEFLVHARG
FT                   "
FT   gene            complement(473773..474531)
FT                   /locus_tag="CtCNB1_0430"
FT   CDS_pept        complement(473773..474531)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0430"
FT                   /product="flagellar protein FlgA"
FT                   /note="COG1261, FlgA, Flagellar basal body P-ring
FT                   biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31176"
FT                   /db_xref="GOA:D0IXT1"
FT                   /db_xref="InterPro:IPR013974"
FT                   /db_xref="InterPro:IPR017585"
FT                   /db_xref="InterPro:IPR039246"
FT                   /db_xref="InterPro:IPR041231"
FT                   /db_xref="UniProtKB/TrEMBL:D0IXT1"
FT                   /protein_id="ACY31176.1"
FT                   /translation="MSGRFSLFLCLRPSRGLAAAWGLAALLLTAGAQAQDGAAQLSQIG
FT                   QRFVDAALHQPSAETVQAGNGMALRMEVQMGQLDSRLRLAACAKVEPYLPAGSRLWGRT
FT                   RLGLRCVQGSVPWNVFLPITVRAYGPAWVAQGNIPAGKTLSAEDAAPAEVDWAEDSAPV
FT                   FANAQDFIGMVAARPLTSGQALRQNMVRPPALFTAGSPVQVMVNGGGFSVAGSGKAMTA
FT                   AGEGQQVRVRMDNGRLVTGTVNASGVVLVQ"
FT   gene            474735..475148
FT                   /locus_tag="CtCNB1_0431"
FT   CDS_pept        474735..475148
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0431"
FT                   /product="flagellar basal-body rod protein FlgB"
FT                   /note="COG1815, FlgB, Flagellar basal body protein"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31177"
FT                   /db_xref="GOA:A0A454XL68"
FT                   /db_xref="InterPro:IPR001444"
FT                   /db_xref="InterPro:IPR006300"
FT                   /db_xref="InterPro:IPR019776"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454XL68"
FT                   /protein_id="ACY31177.1"
FT                   /translation="MLNKMTERLDFQSEALLLRAERQRAIASNIANADTPGYVARDFNF
FT                   REALMAATSGPKPLTQASVTTAGHIPLQAQMSDEALKAKLGYSVNSQPSLDNNTVDLDR
FT                   ERANFVDNSVRYEATLRFINGQAKTMLSAIQGQ"
FT   gene            475165..475569
FT                   /locus_tag="CtCNB1_0432"
FT   CDS_pept        475165..475569
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0432"
FT                   /product="flagellar basal-body rod protein FlgC"
FT                   /note="COG1558, FlgC, Flagellar basal body rod protein"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31178"
FT                   /db_xref="GOA:A0A454XQJ1"
FT                   /db_xref="InterPro:IPR001444"
FT                   /db_xref="InterPro:IPR006299"
FT                   /db_xref="InterPro:IPR010930"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454XQJ1"
FT                   /protein_id="ACY31178.1"
FT                   /translation="MSMFSIFNISGSAVSAQSQRLNVVASNLANVDAVAGPDGSVYKAR
FT                   QVVFQTVPMGNDGSAGVKVNAISEDNTPGRRIHDPSNPLADGEGYVTHSNVSAVDEMVN
FT                   MISASRSYQNNVEVMNTAKTLLLKTLQMGQ"
FT   gene            475586..476248
FT                   /locus_tag="CtCNB1_0433"
FT   CDS_pept        475586..476248
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0433"
FT                   /product="flagellar hook capping protein"
FT                   /note="COG1843, FlgD, Flagellar hook capping protein"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31179"
FT                   /db_xref="GOA:A0A454XPP9"
FT                   /db_xref="InterPro:IPR005648"
FT                   /db_xref="InterPro:IPR025963"
FT                   /db_xref="InterPro:IPR025965"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454XPP9"
FT                   /protein_id="ACY31179.1"
FT                   /translation="MIYGASSVDGTTTNTTSNTKNAVTNPNEAQDRFLKLLVAQLNNQD
FT                   PMNPMDNAEMTSQMAQINTVTGIQQLNQTMASMSSQFTAMQVLQGTSMIGRTVLTEGNT
FT                   LGVAADGTHTAAFDLENQAASVKIQITTASGELVDTIDLGAGAAGRNYFTWDGKDKYSG
FT                   DASQLRYSVVATNGTTAVASTPLAPHAVIATSSANGSLSLELDNGDSVAYSGVKAVY"
FT   gene            476263..477531
FT                   /locus_tag="CtCNB1_0434"
FT   CDS_pept        476263..477531
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0434"
FT                   /product="FlgE"
FT                   /note="COG1749, FlgE, Flagellar hook protein FlgE"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31180"
FT                   /db_xref="GOA:D0IXT5"
FT                   /db_xref="InterPro:IPR001444"
FT                   /db_xref="InterPro:IPR010930"
FT                   /db_xref="InterPro:IPR011491"
FT                   /db_xref="InterPro:IPR020013"
FT                   /db_xref="InterPro:IPR037058"
FT                   /db_xref="InterPro:IPR037925"
FT                   /db_xref="UniProtKB/TrEMBL:D0IXT5"
FT                   /protein_id="ACY31180.1"
FT                   /translation="MGFQQGLSGLNAASKNLDVIGHNIANSNTTGFKASRADFAEMVAS
FT                   AIGSASGQSSGIGVNVASVSQQFRQGSITSTGNNLDIAINGNGFFVVKQSDGSIAYTRA
FT                   GNFGLDKEGNLKTVDNDNVMGYVVDPSTGKIQSGATPVPMSFPTGQPIPAKQTSKVNVE
FT                   LNLDARATAAAGDATATPPVAATPRATYGTSLNVYDTQGTAIPVNLYFEKDATGNTWNV
FT                   FNSLDATATPIGKAVFDASGKLTSVTPNAPTTGSGTTLNLSVSGGTANPNGLQPFNVAF
FT                   DFGGLTQFGTKFAVSSLKQDGYTSGALTGINVGRDGSIVASYSNGVTRTEGQIALAAFT
FT                   NTQGLGSIGNNKWVATSDSGPALNGSAQTGTFGSLQSGALEESNVDLTAELVNMMTAQR
FT                   SYQANAQTIKTQDQVFSTLVNLR"
FT   gene            477600..478340
FT                   /locus_tag="CtCNB1_0435"
FT   CDS_pept        477600..478340
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0435"
FT                   /product="flagellar basal-body rod protein FlgF"
FT                   /note="COG4787, FlgF, Flagellar basal body rod protein"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31181"
FT                   /db_xref="GOA:A0A454Y1I5"
FT                   /db_xref="InterPro:IPR001444"
FT                   /db_xref="InterPro:IPR010930"
FT                   /db_xref="InterPro:IPR020013"
FT                   /db_xref="InterPro:IPR037925"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454Y1I5"
FT                   /protein_id="ACY31181.1"
FT                   /translation="MDKIIYTSMTGANAAAQRQAVLAHNLANAGTNGFRAEMSTFRSVP
FT                   LQGSGAGTRVFALEATSGYQDTPGPAQRTGRALDAMAMGRAWFAVQGLDGQEAYTRNGV
FT                   FEISPEGQLVNSNGQAVLSDGGAPIDIPPESTISLGSDGTLTAKMGNQLPVAVGRVKLV
FT                   TPPVDEPLVRGDDGFFRAAQGDALPNDETARLLSGSIEGSNVNSVETMVGMIAASRQFE
FT                   QQMKLLQTAETNDKSASQLLSLNG"
FT   gene            478359..479141
FT                   /locus_tag="CtCNB1_0436"
FT   CDS_pept        478359..479141
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0436"
FT                   /product="flagellar basal-body rod protein FlgG"
FT                   /note="COG4786, FlgG, Flagellar basal body rod protein"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31182"
FT                   /db_xref="GOA:A0A454Y1J8"
FT                   /db_xref="InterPro:IPR001444"
FT                   /db_xref="InterPro:IPR010930"
FT                   /db_xref="InterPro:IPR012834"
FT                   /db_xref="InterPro:IPR020013"
FT                   /db_xref="InterPro:IPR037925"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454Y1J8"
FT                   /protein_id="ACY31182.1"
FT                   /translation="MINSLFIAKTGMEAQQTQLDVISHNLANVSTTGYKRANAVFEDLI
FT                   YQNLRQSGSQTTEQNQLPTGLHLGLGVRTVATSRNFLQGSLQQSSNALDVAINGNGFFE
FT                   VNMPDGTIAYTRDGSFEVDAQGQLVTSSGLPVANGITIPQGATKVSISHDGVVSVTMPG
FT                   QAAPQQVGNIAMSQFINAAGLEPRGQNLYVETASSGQPQQGTPGTNGLGTIQQGYLEAS
FT                   NVNVVQELVTMIQTQRAYEMNSKAIQTSDQMLAKLAQL"
FT   gene            479312..480019
FT                   /locus_tag="CtCNB1_0437"
FT   CDS_pept        479312..480019
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0437"
FT                   /product="flagellar L-ring protein"
FT                   /note="COG2063, FlgH, Flagellar basal body L-ring protein"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31183"
FT                   /db_xref="GOA:A0A454Y468"
FT                   /db_xref="InterPro:IPR000527"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454Y468"
FT                   /protein_id="ACY31183.1"
FT                   /translation="MFKAIVSHCPPLCALAGALLVSGCVTLNPPPPVDMPSTAPPVLQP
FT                   REQTAQAPTGSLFNASRYRPMFEDQRARMVGDSVTVQIVERVSASQSTDSKVGRANELS
FT                   TGITSLPLLRGGAEKTVADALTLGAESKNDFKGSGATSSNNTFTGSIATTVVDVLPNGH
FT                   LVIAGEKQIGVNHNVDVLRFTGTVDPRSLRPGSTVASTQVANLRVESRSRGQAGEAQSI
FT                   GWLSRFFLNVMPF"
FT   gene            480031..481188
FT                   /locus_tag="CtCNB1_0438"
FT   CDS_pept        480031..481188
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0438"
FT                   /product="flagellar P-ring protein"
FT                   /note="COG1706, FlgI, Flagellar basal-body P-ring protein"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31184"
FT                   /db_xref="GOA:A0A454XVW5"
FT                   /db_xref="InterPro:IPR001782"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454XVW5"
FT                   /protein_id="ACY31184.1"
FT                   /translation="MGSMKVLSTLLSLRPAHTALLVVAALGASGLTLPAHATRIKEVAA
FT                   IQGVRSNQLTGYGLVVGLDGTGDQTTQMPYTKQALANYLEQMGIALPATGNAAQLQLKN
FT                   VAAVIITAELPAFAQPGQAIDINVSSMGNAKSLKGGTLVATPLRGADGEIYALAQGNVV
FT                   VGGAGAAAGGSKVQVNHLNAGRVPQGAQVERAVPTPVNQGNTITLGLNQTDFQTADKMV
FT                   RAINQRMGAGTAMALDGRTVQVNAPIDPGSRVRMIAEIQEMPIETSKPAAKVVINARTG
FT                   SIVLNQAVTLGPCAIAHGNLSITISTTPVISQPAPFSQGQTVVAQKSDIQVKQEPGKVI
FT                   NMPNSPQLTDVVRALNSLGATPQDLLAILQAIKAAGAMDAELEVI"
FT   gene            481185..482213
FT                   /locus_tag="CtCNB1_0439"
FT   CDS_pept        481185..482213
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0439"
FT                   /product="flagellar rod assembly protein/muramidase FlgJ"
FT                   /note="COG1705, FlgJ, Muramidase (flagellum-specific)"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31185"
FT                   /db_xref="GOA:A0A454Y3M7"
FT                   /db_xref="InterPro:IPR002901"
FT                   /db_xref="InterPro:IPR013377"
FT                   /db_xref="InterPro:IPR019301"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454Y3M7"
FT                   /protein_id="ACY31185.1"
FT                   /translation="MSTSLPHSSSLAASNALAVDARSLNALKTAAGENSPQAARETAKQ
FT                   LESLFMREMIKSMREATMKSGLLDSAQGNLSTDLLDQQLSVAMAGQPGGLTDAISKQLA
FT                   RSMGVDAAEDAEIAVPSTLSLSRNAWRNVGSNGAWSGSRSQAAQSINAYAPAPKGRDNF
FT                   VTAHTGAAQRVASESGIPAHYMIGQAGHETGWGRSEIRNKDGSNSFNLFGIKAGGSWTG
FT                   KVAEVTTTEYINGAPKKVTAKFRAYDSYEESFRDYARLIGSNPRYEKAMAQTGSAQAYA
FT                   SELQKAGYATDPAYAQKLSRAIQSVAQVSVANAGNNSANVASRLGVSARAAQINKITEN
FT                   QS"
FT   gene            482225..484156
FT                   /locus_tag="CtCNB1_0440"
FT   CDS_pept        482225..484156
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0440"
FT                   /product="flagellar hook-associated protein FlgK"
FT                   /note="COG1256, FlgK, Flagellar hook-associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31186"
FT                   /db_xref="GOA:D0IXU1"
FT                   /db_xref="InterPro:IPR001444"
FT                   /db_xref="InterPro:IPR002371"
FT                   /db_xref="InterPro:IPR010930"
FT                   /db_xref="UniProtKB/TrEMBL:D0IXU1"
FT                   /protein_id="ACY31186.1"
FT                   /translation="MGARALMANQIALQTTGHNIANVNTAGYSRQSVAFQTSAGQNIGN
FT                   GYIGNGADVATILRNFSELLNRQATAATAASAADSARSNSLNQLQEVFSGGTNGLGAAI
FT                   NDMMNAFADVSSAPTDSSARQVVLTRMSELAARFRSASAQLDEMDYSTRQQMSNDVNVV
FT                   NSLSQQVAALNGQISSAIATGHTPNDLLDQRDQLVRDINKYVQTSQVDAGDGSISLFVG
FT                   GSQPLVLGQSAAKLSLQESTQYPGSGKMSLYFQQQGGQPVELTPAMAGGGEIAGLLQFQ
FT                   NNDLSEGRNLLGRMVISIGDTLNAQNQLGLTLSGQKGGALFNIPMTTTGSTTGAQWVQP
FT                   DTPTVTVKDSSALKASDYKIVFGNDAPKGKVVRLSDGQTTAFNDLTDLRGMTIDGLQFD
FT                   LKNDGQAGQSVLFSPVASAAHDIQTMVHSGNDLAVANPVSAKINSLGDAAVRMSSLKVE
FT                   KGFDASVFPAGTTLSFAPDGAGGMTYTITPAPSGVAATGAYISGQAIELAPGLKVTLTG
FT                   TPAVDGATSDTVSFGPNSFYSSDTGNASSFLSLRDAVIFDGATTLSDGFSTAMAQIGTR
FT                   TQSAAYAAKLSDSIAKNLEGDRTAVSGVNLDEEAAKLLQYQQSYQASAKMLQVAQGIFD
FT                   SVIQAVGR"
FT   gene            484180..485394
FT                   /locus_tag="CtCNB1_0441"
FT   CDS_pept        484180..485394
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0441"
FT                   /product="flagellar hook-associated protein 3"
FT                   /note="COG1344, FlgL, Flagellin and related hook-associated
FT                   proteins"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31187"
FT                   /db_xref="GOA:D0IXU2"
FT                   /db_xref="InterPro:IPR001029"
FT                   /db_xref="InterPro:IPR013384"
FT                   /db_xref="UniProtKB/TrEMBL:D0IXU2"
FT                   /protein_id="ACY31187.1"
FT                   /translation="MSINRIGTANMYDSTINNLGSRQSSLVDLMEKTTAGKRVLRASDD
FT                   PVAAAQAERARTRITRSENDQRVLGAQRDVIAQGESELGKAHGALQDFRDLVVQAGNGS
FT                   YDQVARDALVQQMQSLRDQILGYANAKDSNGLPIFRGLGSPDTPLQSTPPGSSSQLNPG
FT                   QSTGSDNGLPISLDGHAAWLNVPTGNGVFVVNGAASNSGKAWADVGSVTDPSKVTGDSY
FT                   TLVFTKDPTTGEVSYEINSSSATATNPVVPTTPYKEGQAITVGGQQISIKGTPADGDSF
FT                   TMSPSTRTDIFSVLDQAIATVKGGTGGSTALQQGLGRALSELDSGMNRVQAMRSYAGDQ
FT                   LKRADGLESDMKDQALTQEGARSRAEDIDMITALSQVDTQKVGLQAALQSYAQMQKLSL
FT                   FNYIG"
FT   gene            485567..486718
FT                   /locus_tag="CtCNB1_0442"
FT   CDS_pept        485567..486718
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0442"
FT                   /product="putative signal transduction protein"
FT                   /note="COG3434, Predicted signal transduction protein
FT                   containingEAL and modified HD-GYP domains"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31188"
FT                   /db_xref="InterPro:IPR013976"
FT                   /db_xref="UniProtKB/TrEMBL:D0IXU3"
FT                   /protein_id="ACY31188.1"
FT                   /translation="MAHFLRTVDEIWSRQAPPLLISPQSRQVLCNLLEHAPQSSPWIEV
FT                   RGDWLQQDEGIYELVQKAKARGLMLVWGGSLADVPDADAARCFASSLLSLPPEGAAGLP
FT                   NAVRSSQPAKDADKETASGFFANPPLNLLDGQMYQSLQSLELARSCLDEHEAAAVAGWP
FT                   VADTMQAFRLQQPQPSRDALFRLMKAIDKEQSLDVMEEILGSDPVLAYRFLLYTNSAAL
FT                   GLRRGVDSLRRGLVMLGLGTLERWLADQLPHACTEQDLVPLRTQVVLRARLAEQLIEAG
FT                   VSLDLQREMYLCSLFSQLDLLLHEPVATILRRTPLNERIFDAIVTRSGPYAAVLQMSQA
FT                   LESRDPAPIRQLREQEEWEAEDLNRMLLRMLSELKLGMPQAQA"
FT   gene            486903..488084
FT                   /locus_tag="CtCNB1_0443"
FT   CDS_pept        486903..488084
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0443"
FT                   /product="type III secretion exporter"
FT                   /note="COG1377, FlhB, Flagellar biosynthesis pathway"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31189"
FT                   /db_xref="GOA:D0IYF3"
FT                   /db_xref="InterPro:IPR006135"
FT                   /db_xref="InterPro:IPR006136"
FT                   /db_xref="InterPro:IPR029025"
FT                   /db_xref="UniProtKB/TrEMBL:D0IYF3"
FT                   /protein_id="ACY31189.1"
FT                   /translation="MSESQDKNLPATERKLQKTREDGQGARSRDLSHLAILGTGALLML
FT                   MGTQPMINHLREAMARQLVFNAAAAKTPALMLERFQSMLVLGLGIAVIFALVTTTASVL
FT                   SGVAAGGWIFSFKPIQPRFGKLNPLSGLKNLFSKQQLTTVVKMVFMTIVLGFVAWKYMS
FT                   ANIAEIASVSAQPSPMALTMVGSWLTTGITLLLIVVLLVALIDVPLQDFLFKSRLKMSH
FT                   EEVKQEHKESEGNPQLKGKIRQKQREIADRASVSAVPKADFVVTNPTHYAVALRYDDAS
FT                   MAAPQVIAKGTDLVALKIREIAGAHQIPVLESPMLARALYAHADLDQAIPAALYTAVAQ
FT                   VLAYVYRLKAALSGQGPMPDALGEPPVPVELDPHRGRTQPAAVDAAAQQEGNL"
FT   gene            488081..490186
FT                   /locus_tag="CtCNB1_0444"
FT   CDS_pept        488081..490186
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0444"
FT                   /product="flagellar biosynthesis protein FlhA"
FT                   /note="COG1298, FlhA, Flagellar biosynthesis pathway"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31190"
FT                   /db_xref="GOA:D0IYF4"
FT                   /db_xref="InterPro:IPR001712"
FT                   /db_xref="InterPro:IPR006301"
FT                   /db_xref="InterPro:IPR042193"
FT                   /db_xref="InterPro:IPR042194"
FT                   /db_xref="InterPro:IPR042196"
FT                   /db_xref="UniProtKB/TrEMBL:D0IYF4"
FT                   /protein_id="ACY31190.1"
FT                   /translation="MMSSNPLQLFQKWSGSNAGALQGITAPILVVAILGLMVLPVPPWL
FT                   LDTFFTLNIAVALMVMMVAAYMIKPLDFAAFPSVLLLTTLMRLSLNVASTRVVLMEGHT
FT                   GPGAAGAVIEAFGHFLIGGNFAVGLIVFSILVVINFVVITKGAERIAEVSARFTLDAMP
FT                   GKQMAVDADLNAGLIDEKEAKRRRAEVGEEANFFGSMDGASKFVRGDAIAGILILVINV
FT                   IGGLIIGMAQHGLSAGQAADSYILLAVGDALVAQIPGLLISVASAMVISRVGKESDMGR
FT                   QIVQQLFMSPKVLGITAGVMILLGLIPGMPHLVFISMGALLGWGAWVLDKREKARLAAQ
FT                   SSAPAPQQQAAQNDGEATWDDLQPVDLLGLELGYRLIALVDKSRQGDLLTRIKGVRRKF
FT                   AQEVGFLPPAVHVRDNLELKPSAYRMTLRGVMVGEGEAFPGMFLAINPGGITTPLIGTA
FT                   TTDPAFGLPAHWIDERQKEAAQMAGFTVVDSETVMATHLSHLMQVHAAKLLSRTETQQL
FT                   VDHVAKLAPKLIEEVIPKMVPITTFQKVLQLLLEDSVHIRDIRTIIETLAENATQTTDP
FT                   VELARRVRIALSPAIVQQIYGPTRELNVIAIEPGLERLLVQALSNPNAPSLDPGVAEIL
FT                   TQKAVDVANQQEELGLPACLLVPDAIRNSLAKLLRRVAPRLQVLAHSEIPETHTIRIGP
FT                   ILKGATA"
FT   gene            490183..491799
FT                   /locus_tag="CtCNB1_0445"
FT   CDS_pept        490183..491799
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0445"
FT                   /product="GTP-binding signal recognition particle SRP54"
FT                   /note="COG1419, FlhF, Flagellar GTP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31191"
FT                   /db_xref="GOA:D0IYF5"
FT                   /db_xref="InterPro:IPR000897"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR020006"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D0IYF5"
FT                   /protein_id="ACY31191.1"
FT                   /translation="MNIKRFYAPTAREALAKARMVFGDGTLILSNRQTPDGVEVMATAE
FT                   ETLQDMDAGMQTGSPLQKALERRASDEGMSSLRKEHSPLAPAAARRSQGGEAMSTLEHV
FT                   QARQTAKEEQAREMQVQAKPVKAINELARHSVQDDVEQLSMSTLTFQDYVRERMLRRRH
FT                   ESTLDSSEALPTFAQRVQERNNERPAMAAKSQSASAAVVRHNPLRPEKIQLKESARPAS
FT                   VAAPQNFMQEMQSMKDLIEERFNTLTWLGQTRQNPIQSSLMHKLIRAGYSPALARALIE
FT                   KLPETLSAGDAVRWLMQVLERNLRTDAAQPAIYEQGGVFALVGATGVGKTTTTAKLAAL
FT                   CAAKHGPASVGLITLDTYRIGGHDQLRTYARMLGMVAHQAHDKAALQDLLGLLQSKKMV
FT                   LIDTTGVAPRDPRKDEIMDVLAIEGVQQLLAVNAAAQGDAQDDVMQAFKARGSQHAILT
FT                   KVDEAVKVGPSVDTLIRHQIQLRGVTNGQRVPEDFERANAQLLVSASMRSAAKSAFDPQ
FT                   SLDLDFFFTPSSASGAEAAHA"
FT   gene            491792..492649
FT                   /locus_tag="CtCNB1_0446"
FT   CDS_pept        491792..492649
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0446"
FT                   /product="conserved hypothetical protein"
FT                   /note="COG2902, NAD-specific glutamate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31192"
FT                   /db_xref="UniProtKB/TrEMBL:D0IYF6"
FT                   /protein_id="ACY31192.1"
FT                   /translation="MLERRSPLHQGMALHMSDASTAGLRVLAVLHSASGAAAEQAVLWP
FT                   LCAQLQRLGQKVLVLDGSQAESFHTPGLAQLLAQHAWQAQAGLRASVGDAQSVASLPAR
FT                   QGLKQLKASADEMGLDMLTALQAYVRGYTTVIIYASSETLTPMLQGQGLQPLLVVPPDS
FT                   EHLIESYRQLKHLAVFAGVECTIAALEAPLTADGPQKYDWSRKQSSSQTAKQNAQTRLQ
FT                   RLNALLQCSQRHLGDAPVLMRLRWRQASDLHQLTLHMLKTACILPMHAQPTAAAAPESL
FT                   VWSH"
FT   gene            492655..493374
FT                   /locus_tag="CtCNB1_0447"
FT   CDS_pept        492655..493374
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0447"
FT                   /product="RNA polymerase, sigma 28 subunit"
FT                   /note="COG1191, FliA, DNA-directed RNA polymerase
FT                   specialized sigmasubunit"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31193"
FT                   /db_xref="GOA:D0IYF7"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007624"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR012845"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR028617"
FT                   /db_xref="UniProtKB/TrEMBL:D0IYF7"
FT                   /protein_id="ACY31193.1"
FT                   /translation="MYTAKGQLDRDALIRQHVPLVRRIALHMIAKLPPNVELDDLIQVG
FT                   MIGLAEALSRFESEQGVQFDTFASQRIRGAMLDELREGDWMSRSSRKSQKEIEQALNRL
FT                   EQRLGRPPLESEIAAELGMALDDYQSLLGKVRGTQLVYLEDIGGGDGDDGDDYLERHVA
FT                   DSGADPFALLRDQRMRSALVEAIKTLPEREQYVMGMYYEHDMNLKEIAAVLGVTESRVC
FT                   QLHSQAIARLRTKMRSH"
FT   gene            complement(493623..493910)
FT                   /locus_tag="CtCNB1_0448"
FT   CDS_pept        complement(493623..493910)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0448"
FT                   /product="flagellar protein FliT"
FT                   /note="COG4389, Site-specific recombinase"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31194"
FT                   /db_xref="InterPro:IPR008622"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454Y5Z5"
FT                   /protein_id="ACY31194.1"
FT                   /translation="MIDFYRAIEESSAKMLQAAQAKDWDGVARYEGTCAVLIEQLRFRS
FT                   RDEKLAPELRKEKARIMQRILRNDAQIRVLAEPWLASFEHMFDGQPHVMH"
FT   gene            complement(493926..494339)
FT                   /locus_tag="CtCNB1_0449"
FT   CDS_pept        complement(493926..494339)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0449"
FT                   /product="flagellar protein FliS"
FT                   /note="COG1516, FliS, Flagellin-specific chaperone FliS"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31195"
FT                   /db_xref="GOA:A0A454XUX3"
FT                   /db_xref="InterPro:IPR003713"
FT                   /db_xref="InterPro:IPR036584"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454XUX3"
FT                   /protein_id="ACY31195.1"
FT                   /translation="MFSPANARAMSAYRQVGVQSMVDSASPQQLIKMLFDGLLASINAA
FT                   RGAIERGDINEKVRHIGKAVRILQEGLLGALDREKGGELAGNLASLYEYCTTRLTLANA
FT                   RNDASMVDEVAGLVSTVAQGWNEITNAPAPAAA"
FT   gene            complement(494433..495875)
FT                   /locus_tag="CtCNB1_0450"
FT   CDS_pept        complement(494433..495875)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0450"
FT                   /product="flagellar hook-associated 2-like protein"
FT                   /note="COG1345, FliD, Flagellar capping protein"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31196"
FT                   /db_xref="GOA:D0IYG0"
FT                   /db_xref="InterPro:IPR003481"
FT                   /db_xref="InterPro:IPR010809"
FT                   /db_xref="InterPro:IPR010810"
FT                   /db_xref="InterPro:IPR040026"
FT                   /db_xref="UniProtKB/TrEMBL:D0IYG0"
FT                   /protein_id="ACY31196.1"
FT                   /translation="MGISSVGIGSGLEVETIVKQLVALESKPIAALQTKATGINTQISA
FT                   FSQLKSQISNLQDQLDKLAKPATWLGNTLTSSNSAQVAGTATSNAVQATYDVKVSQMAS
FT                   GQTIGSSLVTSNTTLGAGTLTISMGQWDSKAIGGFKANTNKDGSDVKFTVTITDTDNSL
FT                   AKIAAKINAEKGDVSATVLTDHTGERLVLQSKTTGTNSAFKVEATGAGLQQFAYNGTDA
FT                   AANETGMKRSAIAQDTLATINGIEMASHTNVFEEVAAGVTLTVSQKMAAADAPVRITIA
FT                   NDTATAKTALKNLVESYNALSNALKTMTAYDKDSKTAGTLQGDSTAVNLQSAMRRLLSG
FT                   PGGEGGAFTSLSQMGIAFQTDGTLKIDDTKLDKALKDPESMSKFFTADVADANQDGLAV
FT                   RMKDFTSGLLATGGTFSTKDETLKNALKRNTADQERQTARVTAYEARVRAQYSRLDTQM
FT                   ASLKSLDTYVSQQVAAWNKSSN"
FT   gene            complement(496032..497261)
FT                   /locus_tag="CtCNB1_0451"
FT   CDS_pept        complement(496032..497261)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0451"
FT                   /product="flagellin-like protein"
FT                   /note="COG1344, FlgL, Flagellin and related hook-associated
FT                   proteins"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31197"
FT                   /db_xref="GOA:D0IYG1"
FT                   /db_xref="InterPro:IPR001029"
FT                   /db_xref="InterPro:IPR001492"
FT                   /db_xref="InterPro:IPR042187"
FT                   /db_xref="UniProtKB/TrEMBL:D0IYG1"
FT                   /protein_id="ACY31197.1"
FT                   /translation="MAAIINTNIQSLNAQRSLSSSQSQLATSMQRLSSGLRINSAKDDA
FT                   AGLAIAERMTTQVRGLTVAMRNANDGISLAQTAEGALSSVGSNLQRIRELAVQSRNATN
FT                   SDEDRAALDAEVQQLKAEISRIARDTSFNGTKLLDGSFTNMAFQVGANQGQTIDVNSIA
FT                   DSRIDKLGTWNSVPTPSKSVAVGTIAGGAATGDTGDYTYELTVDSVAFFSKTVLDTKTA
FT                   DPLVTGQELDAQWAAFAATSAGQGYKLSGTFSAGTAVISKLDGTDLKIEVKETGATTAK
FT                   TAPTYGSAGFVGTFSNGKVTQSKTGFEDLSVKDTQNSDNAIVAMDAALRAINGARADLG
FT                   AIQSRFETTVENLSVNTENLSASRSRIMDADFAAETANLSRTQILQQAGTAMVAQANQL
FT                   PQQVLKLLQG"
FT   gene            complement(497551..498729)
FT                   /locus_tag="CtCNB1_0452"
FT   CDS_pept        complement(497551..498729)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0452"
FT                   /product="flagellin-like protein"
FT                   /note="COG1344, FlgL, Flagellin and related hook-associated
FT                   proteins"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31198"
FT                   /db_xref="GOA:D0IYG2"
FT                   /db_xref="InterPro:IPR001029"
FT                   /db_xref="InterPro:IPR001492"
FT                   /db_xref="InterPro:IPR042187"
FT                   /db_xref="UniProtKB/TrEMBL:D0IYG2"
FT                   /protein_id="ACY31198.1"
FT                   /translation="MAMTINTNIQSLNAQRNLGTSQSSLSTSMQRLSSGLRINSAKDDA
FT                   AGLAIAERMSAQVRGLNQAQRNANDGVSLAQTAEGALSTIGGNLQRIRELAVQSRNATN
FT                   STEDRAALQKEVDQLKEEIDRVATTTSFNGTKLLNGSFTDQEFQVGANQGQVIKVGDFV
FT                   NAQIDKLGTWSAAADVKTYSNAAGTGPTIADDKLALSFDINGVTIGVAADTSRTTGQGV
FT                   TALKAAFDTAVAANPEKLKGMSMDAAGKITVANADQSASISNLVGMTALALGTETVTTV
FT                   VAKGASQTGFDKLDVSTIAGSDNAIVAMDAALKDVNSARADLGAIQNRFESVVSNLSVN
FT                   SENLSASKSRIMDADFASETANLSRSQILQQAGTAMVAQANQLPQGVLSLLR"
FT   gene            499112..499972
FT                   /locus_tag="CtCNB1_0453"
FT   CDS_pept        499112..499972
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0453"
FT                   /product="MotA/TolQ/ExbB proton channel"
FT                   /note="COG1291, MotA, Flagellar motor component"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31199"
FT                   /db_xref="GOA:A0A454XKJ4"
FT                   /db_xref="InterPro:IPR000540"
FT                   /db_xref="InterPro:IPR002898"
FT                   /db_xref="InterPro:IPR022522"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454XKJ4"
FT                   /protein_id="ACY31199.1"
FT                   /translation="MLVLIGYIVAFGCIFGMYVLHGGSVGVLVKALPFEMVTIGGGALG
FT                   AFIVSNQPKVLKATAKAIPSALKPSRYNKARYMEVMALLYELLQKARKEGLMSIESDVE
FT                   DPQSSTVFQNYPQLMADHHVVEFLTDYLRMMVSGNLNSHEIEALMDSEIEAHHAEAHAP
FT                   VMALNRLAGALPAFGIIAAVLGVVNTMAFVGQPPAVLGGMIASALVGTFLGILLAYALV
FT                   EPMAALLEQRAQDAAKEFECIKATLLASMQGYNPGTAIEFGRKVLFSTERPGFLELESH
FT                   VKGKK"
FT   gene            500015..501082
FT                   /locus_tag="CtCNB1_0454"
FT   CDS_pept        500015..501082
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0454"
FT                   /product="OmpA/MotB"
FT                   /note="COG1360, MotB, Flagellar motor protein"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31200"
FT                   /db_xref="GOA:D0IYG4"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR025713"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="UniProtKB/TrEMBL:D0IYG4"
FT                   /protein_id="ACY31200.1"
FT                   /translation="MADKKLQPIIIKRVKKTAHAHHGGAWKIAYADFVTAMMAFFLLMW
FT                   LLGSTAQGELQGIAAYFNSPLKVAMSGGSGAGNSSSIVPGGGNDLSKVHGQVRRSESED
FT                   NANRRSSQAMGRADESARDAQRLHALKAKVDSMIANNARLNEFRSQIRTEITHDGLMIQ
FT                   IVDDQNRPMFDSGSAVVKPYMRDILREIGAAMGNAENRISLSGHTDAAPYGNADRGYSN
FT                   WELSADRANASRRELVAAGMPLDKLARVVGMASSDLLLPEEPRAAQNRRITITVLTKEA
FT                   ERRVLGNDKERSTEQVTSAEEAASTINQPKARRAVPSAVDRQSLDAKEEFVVTNPEVAT
FT                   ETVEKPDNARPMPGG"
FT   gene            501169..501534
FT                   /locus_tag="CtCNB1_0455"
FT   CDS_pept        501169..501534
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0455"
FT                   /product="response regulator receiver protein"
FT                   /note="COG2204, AtoC, Response regulator containing
FT                   CheY-like receiver"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31201"
FT                   /db_xref="GOA:D0IYG5"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:D0IYG5"
FT                   /protein_id="ACY31201.1"
FT                   /translation="MIVDDFSTMRRIVRNLLKESGFADADEAEDGVVAITKLRASKFDF
FT                   VVTDINMPNMNGFQLLTEIKQDEKLKHLPVLMVTAEARKEDIVAAAQGGAAGYIVKPFT
FT                   KATLEEKVNLIIKKLDL"
FT   gene            501538..502155
FT                   /locus_tag="CtCNB1_0456"
FT   CDS_pept        501538..502155
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0456"
FT                   /product="chemotaxis phosphatase, CheZ"
FT                   /note="COG3143, CheZ, Chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31202"
FT                   /db_xref="GOA:A0A454XJN7"
FT                   /db_xref="InterPro:IPR007439"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454XJN7"
FT                   /protein_id="ACY31202.1"
FT                   /translation="MSSDQASANVHYKIGVLTRQLHNSLNELGYADRLRGSAGELPDAQ
FT                   SRLSYIARLTGEAANKVLGQVEVTQNRQDALAERTRAMRAELIKDPVAAVAKGRVMNYL
FT                   QEVEEGTEQTNSHLTEIMMAQDFHDLTGQVIARVVALAADLESQLLELLIQTSPDAAQA
FT                   PALAPVEAAQPKLAGPVVDPENTADVVTSQSQVDDLLASLGF"
FT   gene            complement(502352..502660)
FT                   /locus_tag="CtCNB1_0457"
FT   CDS_pept        complement(502352..502660)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0457"
FT                   /product="flagellar hook-basal body complex subunit FliE"
FT                   /note="COG1677, FliE, Flagellar hook-basal body protein"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31203"
FT                   /db_xref="GOA:A0A454Y4Q4"
FT                   /db_xref="InterPro:IPR001624"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454Y4Q4"
FT                   /protein_id="ACY31203.1"
FT                   /translation="MDLKIPAINPAQLGNQLTKVGSAGTAPVAGGFGQALQNALQSVSA
FT                   AQNHSGQLQREVQLENPAVSLEQTMVAMQKSQIGFQATLHVRNRLVQAYSDVMNMQV"
FT   gene            502834..504540
FT                   /locus_tag="CtCNB1_0458"
FT   CDS_pept        502834..504540
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0458"
FT                   /product="flagellar M-ring protein FliF"
FT                   /note="COG1766, FliF, Flagellar biosynthesis/type III
FT                   secretory pathwaylipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31204"
FT                   /db_xref="GOA:D0IYG8"
FT                   /db_xref="InterPro:IPR000067"
FT                   /db_xref="InterPro:IPR006182"
FT                   /db_xref="InterPro:IPR013556"
FT                   /db_xref="UniProtKB/TrEMBL:D0IYG8"
FT                   /protein_id="ACY31204.1"
FT                   /translation="MSAVAEVPVPNAVPGATYAPRPALAQRWNALDRGQRLRWGALAAL
FT                   VAVGLVAAAVFYRQPDYKLLFSNVSDKDGGAIVAQLTQMNVPYKYSEGGGAILIPADRV
FT                   HDVRLKLATQGLPKGSVTGFELMENSKFGITQFQERLNFQRGLEGELTRSILALNAVQS
FT                   ARVHLALPNQNGFFREQQKPSASVLLSLHPGRMLDRAQIAGIVHLVASSVPEMEPAAVS
FT                   VVDDTGKLLSQSPDGNAGGVDMQQFLYTQQVEQQYVRRILDILEPVVGKNNVKAQVSAE
FT                   LDFSQTESTSEQHRPNQSADGGAVRSQQVMETNGEKTATPPTGVPGATSNQPPQNSTAP
FT                   INGANPAPQAAGAGQGNGQGNKRESITNYEVDKTVRVTRGSTGTVKRLTAAVVVNAPLA
FT                   AAAGTDAATAATAAAVSSGLRPLTAQQQEQLLTLVRETVGYSADRGDSVNLVSAPFMDS
FT                   GAAPAELPMWKDPEIQAMAKSLGVPIALALFGALVLLGLVRPLLKGRNTGPGGQLNAIE
FT                   AEALDRPALPAPAKELSPTKEQERLDQARHLAKQNPIAVANIVKTWINGEG"
FT   gene            504686..505687
FT                   /locus_tag="CtCNB1_0459"
FT   CDS_pept        504686..505687
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0459"
FT                   /product="flagellar motor switch protein FliG"
FT                   /note="COG1536, FliG, Flagellar motor switch protein"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31205"
FT                   /db_xref="GOA:D0IYG9"
FT                   /db_xref="InterPro:IPR000090"
FT                   /db_xref="InterPro:IPR011002"
FT                   /db_xref="InterPro:IPR023087"
FT                   /db_xref="InterPro:IPR028263"
FT                   /db_xref="InterPro:IPR032779"
FT                   /db_xref="UniProtKB/TrEMBL:D0IYG9"
FT                   /protein_id="ACY31205.1"
FT                   /translation="MNMDDRGLNDAAILLVSLGEEEAAEVFKHLTPKEVQKLGETIARM
FT                   RGVTREKVDFVIDRFTSDAASQSLLVDDASDYVRSVLKRALGDDKAALLIDRIMQGGDI
FT                   SGIESLKWMDPLSVAELLRGEHPQIVAAILVHLEYEQAAAVLMQFPDRARSEVMLRVAT
FT                   LEGIQPTALKDLNEVLFKVLAGGDKVRKTSLGGVKTAAEMLNQMGGNADVAVLDTIRNY
FT                   DPELAQKIMDKMFVFDDLVKLDDRSVQLVLREVVSETLIVALKGGSMEVRDKILANMSM
FT                   RAAESLREDLEGRGPMRLSEVEAQQKEILKVVRRLVEEGQVTIGSGPEDSYV"
FT   gene            505680..506507
FT                   /locus_tag="CtCNB1_0460"
FT   CDS_pept        505680..506507
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0460"
FT                   /product="flagellar assembly protein FliH"
FT                   /note="COG1317, FliH, Flagellar biosynthesis/type III
FT                   secretory pathwayprotein"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31206"
FT                   /db_xref="InterPro:IPR018035"
FT                   /db_xref="UniProtKB/TrEMBL:D0IYH0"
FT                   /protein_id="ACY31206.1"
FT                   /translation="MSKGQPPRSHSRFIPQEEIDDSTVVQWRFGAVDAQDRGVFAPAQQ
FT                   AAFIPAGVEHFNGFSPSIAHQPQAQPEVQVVEPVEPAAPAFDEEQLQQMLEQARAEGHA
FT                   QGLAEGRTQTQQQWQQHLDDHINGAGRESAQRVDGVLQGLEDNFKQLQSGMAQELLNLA
FT                   CDIARQVVRQELRSQPQALLPVIREALDMLVDESRPVTVRLNPADFELLDEALRAEHGA
FT                   HSRIQWLGDASIAPGDVKVESGGAEIDGGLDKRWRRAVAALGLVSTWYDGDKA"
FT   gene            506504..507892
FT                   /locus_tag="CtCNB1_0461"
FT   CDS_pept        506504..507892
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0461"
FT                   /product="flagellar protein export ATPase FliI"
FT                   /note="COG1157, FliI, Flagellar biosynthesis/type III
FT                   secretory pathwayATPase"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31207"
FT                   /db_xref="GOA:D0IYH1"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005714"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR020005"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032463"
FT                   /db_xref="InterPro:IPR040627"
FT                   /db_xref="UniProtKB/TrEMBL:D0IYH1"
FT                   /protein_id="ACY31207.1"
FT                   /translation="MNPWQQFMSQARARYAEPVPLECQGRLTRLTGMVLEASGLRVPVG
FT                   AQCHIHQHGQEPVLAEVVGFAGERAFLMPAGDIQGLSSGAMVTPAAPFVPVPQLGVVET
FT                   EKVSQTVGVLRLPMGDGLLGRVVDSQGTPLDHAGELGSVVPEVLDRNPINAMDRDPVRE
FT                   SLDTGVKALNALLTVGRGQRLGLFAGSGVGKSVLLGMMARYTQADVIVVGLIGERGREV
FT                   KEFVEDILGAQDRSRAVVVAAPADAPPLLRMQGASYATAIAEHFRDKGKHVLLLMDSLT
FT                   RYAMAQREIALAIGEPPATKGYPPSCFAKLPALVERSGNGLHGVGSITAFYTVLSEGDD
FT                   QQDPIADAARAILDGHVVLSRALAETGHYPAIDIEQSASRVMHNVVSREHFELARRFRA
FT                   VYSRYQKGRDLVQVGAYVPGSDPQLDEAIALQPAMTGFLQQSMFESSSMEQSLAGMAQA
FT                   MQRG"
FT   gene            507926..508390
FT                   /locus_tag="CtCNB1_0462"
FT   CDS_pept        507926..508390
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0462"
FT                   /product="flagellar export protein FliJ"
FT                   /note="COG2882, FliJ, Flagellar biosynthesis chaperone"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31208"
FT                   /db_xref="GOA:D0IYH2"
FT                   /db_xref="InterPro:IPR012823"
FT                   /db_xref="UniProtKB/TrEMBL:D0IYH2"
FT                   /protein_id="ACY31208.1"
FT                   /translation="MSSLNALNVAIEAAERKRDAARTTMQERQRAQQAAQAQMDQLQGY
FT                   VLEMQARWGPQEGLAVQPEVMHHQYQFMERLQHAIGLQTRVVADQDIRLETARQALLAA
FT                   ELRVTSLQKVVQARRRDVALAQMRREQKDTDERATMAFFRRSFGLQLQEA"
FT   gene            508393..509700
FT                   /locus_tag="CtCNB1_0463"
FT   CDS_pept        508393..509700
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0463"
FT                   /product="hypothetical protein"
FT                   /note="COG3144, FliK, Flagellar hook-length control
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31209"
FT                   /db_xref="InterPro:IPR021136"
FT                   /db_xref="InterPro:IPR038610"
FT                   /db_xref="UniProtKB/TrEMBL:D0IYH3"
FT                   /protein_id="ACY31209.1"
FT                   /translation="MAETRIDGPRGGESRTGKAMAQSMSSAKSAAAAAGEPGQGFSSLL
FT                   ASLDGFVTAGLPQAAQQPAETSDAKLAPGEQDALLIAQGHAPWMSLVGQTAQLDGQGDA
FT                   DLRQGVATDFLSGRGHAAQLAHRQALQLGSGEAHAAFMGKDFQSNQAQTYTTQPQAAIN
FT                   SDAAVLQPQQDAAAQGQDSGHSALASAVEEVPAARLEPAVHKAQALPQQGISLQGMTAV
FT                   QPQALEGLKDLLRAARSPQQEPQGKMAAVQGGADLQAVAAAVGAAMGAASAGMQGGGQN
FT                   GSDFGQSLAGQDAAPTEREQEVSEQVAFWVHQKTQNAALSIQHEGKAIQVQVQLNGQEA
FT                   HVRFAAGDEQARQLLADGQAQLRELLQAQGLNLSGVSVDAGGADARSGGDSQGDDVQRG
FT                   QPRVARVSVNAAELPMSAASARNGARPVQSGVDLFV"
FT   gene            509890..510444
FT                   /locus_tag="CtCNB1_0464"
FT   CDS_pept        509890..510444
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0464"
FT                   /product="flagellar basal body-associated protein FliL"
FT                   /note="COG1580, FliL, Flagellar basal body-associated
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31210"
FT                   /db_xref="GOA:A0A454Y2W9"
FT                   /db_xref="InterPro:IPR005503"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454Y2W9"
FT                   /protein_id="ACY31210.1"
FT                   /translation="MSANPNAAPVAPAPAKSKKLIVIVAIVAVLAIVAAAAYVLMMQRQ
FT                   HSSADGEEEVSAKATVPTFLPLDNMVANLADPGGDRFVQLGITLELADEKTASTVKQYL
FT                   PSIRNGILMLVSQRTADELLAREGKEKLAADILTEVSAPLGFGPSAKKRSRDDEDADED
FT                   SPRANRKGPVRRVLFSSFIIQ"
FT   gene            510460..511464
FT                   /locus_tag="CtCNB1_0465"
FT   CDS_pept        510460..511464
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0465"
FT                   /product="flagellar motor switch protein FliM"
FT                   /note="COG1868, FliM, Flagellar motor switch protein"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31211"
FT                   /db_xref="GOA:A0A454XXJ8"
FT                   /db_xref="InterPro:IPR001543"
FT                   /db_xref="InterPro:IPR001689"
FT                   /db_xref="InterPro:IPR028976"
FT                   /db_xref="InterPro:IPR036429"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454XXJ8"
FT                   /protein_id="ACY31211.1"
FT                   /translation="MSDSFLSQEEVDALLEGVTGESQRSEVVEVDLGQVRSYDISSQER
FT                   IVRGRMPTMEIVNERFARNFRIGLFNFIRRSPEVSVGTVTVQRYSAFLRELAVPTNFNI
FT                   MAIRPLRGNGLIVCDPSLVFGVIDTLYGGTGRLQTRIEGRDFSTTEQRVINRMVNVICE
FT                   EYKKAWHGIYPLELAYQRSEMQPQFANIATPSEIVVSTAFQLEIGDISGSIHICMPYAT
FT                   LEPIRDVLYSSTQGDAIEVDRRWVKVLTREIQAAEVTLVAELARADATVEQLLAMRPGD
FT                   FIELDREPLIRASIGGVPVFECQYGTHNDKYAIRVERSLRGGETSWMGEKHGN"
FT   gene            511454..511888
FT                   /locus_tag="CtCNB1_0466"
FT   CDS_pept        511454..511888
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0466"
FT                   /product="flagellar motor switch protein FliN"
FT                   /note="COG1886, FliN, Flagellar motor switch/type III
FT                   secretory pathwayprotein"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31212"
FT                   /db_xref="GOA:A0A454Y2Y1"
FT                   /db_xref="InterPro:IPR001172"
FT                   /db_xref="InterPro:IPR001543"
FT                   /db_xref="InterPro:IPR012826"
FT                   /db_xref="InterPro:IPR036429"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454Y2Y1"
FT                   /protein_id="ACY31212.1"
FT                   /translation="MAIDDNNKPAGDDPFSGWAEALEEQRQHDQAVEGPDLSDQGGPLA
FT                   GDAARSYGDVPVHDINMVLDIPVQLSVELGRTKVPIKYILQLAQGSVVELDALAGEPMD
FT                   VLVNGYLIAQGEVVVVNDKFGIRLTDVVTPSERLRRVSRG"
FT   gene            511923..512312
FT                   /locus_tag="CtCNB1_0467"
FT   CDS_pept        511923..512312
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0467"
FT                   /product="hypothetical protein"
FT                   /note="COG3190, FliO, Flagellar biogenesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31213"
FT                   /db_xref="GOA:A0A454Y2B4"
FT                   /db_xref="InterPro:IPR022781"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454Y2B4"
FT                   /protein_id="ACY31213.1"
FT                   /translation="MWPTLLLVVLFVAVMAALPWLVRRLQQKNLLPRGMGMARGVASVP
FT                   AQVLGTLAIGPQQRVVTVQLGEGEQAVRLVLGVTAQQIQCLHVLQDPSASLQSARAAHS
FT                   PAVSSFTDSLMRAQADEAARNSGNV"
FT   gene            512305..513054
FT                   /locus_tag="CtCNB1_0468"
FT   CDS_pept        512305..513054
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0468"
FT                   /product="flagellar biosynthetic protein FliP"
FT                   /note="COG1338, FliP, Flagellar biosynthesis pathway"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31214"
FT                   /db_xref="GOA:D0IYH8"
FT                   /db_xref="InterPro:IPR005837"
FT                   /db_xref="InterPro:IPR005838"
FT                   /db_xref="UniProtKB/TrEMBL:D0IYH8"
FT                   /protein_id="ACY31214.1"
FT                   /translation="MSKFVSRAAAAVLLAMPLMAAAQSAPASLPLLVGQGAGGTSYSVP
FT                   IQTLLFFTALSFLPAILLLMTGFTRIVIVLSLLRQALGTQSAPPNQVVIGLSLFLTMFV
FT                   MGPTLDKVYQDAYLPYTQNSISFEQAMEKAEAPMRGFMLKQTRQSDFALFKRLAKLDAN
FT                   VTAETAPLRVLVPAFVTSELKTAFQIGFMIFIPFLVIDMVVSSILMSLGMMMLSPVLVA
FT                   LPFKLMLFVLADGWNLIIGSLAASFAT"
FT   gene            513206..513475
FT                   /locus_tag="CtCNB1_0469"
FT   CDS_pept        513206..513475
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0469"
FT                   /product="flagellar biosynthetic protein FliQ"
FT                   /note="COG1987, FliQ, Flagellar biosynthesis pathway"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31215"
FT                   /db_xref="GOA:A0A454XJQ4"
FT                   /db_xref="InterPro:IPR002191"
FT                   /db_xref="InterPro:IPR006305"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454XJQ4"
FT                   /protein_id="ACY31215.1"
FT                   /translation="MTSQFVLTFGREALTLLLMISMPVLGVVMGVGLLVSVFQAVTQVH
FT                   EATLAFVPKLIAAVLVFAVAGPWMLSTLVDFIRRTIESIPGSVG"
FT   gene            513472..514236
FT                   /locus_tag="CtCNB1_0470"
FT   CDS_pept        513472..514236
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0470"
FT                   /product="flagellar biosynthetic protein FliR"
FT                   /note="COG1684, FliR, Flagellar biosynthesis pathway"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31216"
FT                   /db_xref="GOA:D0IYI0"
FT                   /db_xref="InterPro:IPR002010"
FT                   /db_xref="InterPro:IPR006303"
FT                   /db_xref="UniProtKB/TrEMBL:D0IYI0"
FT                   /protein_id="ACY31216.1"
FT                   /translation="MISFSEAQIAAWLSPLIWPFVRVLALFTTAPVFSQKAIPMRLKVG
FT                   LAFLVALCAQPVLGEQTVVSIASAQALGTLVQQVVIGLSVGFAVRLVMAAIEVAGEVVG
FT                   LQMGLNFASFFDPTSNAQLSAVARFMVQIATLLFIVINGHLLVLMAVLKSFEAFPVDGN
FT                   FLQAISQMRIHEMGSAVFASAFWIALPMIAMLLFVNLVLGIISRVAPQMNIYAVGFPVT
FT                   LTVGLLGLTATLPLLEQPLVALLQKGMAVFGV"
FT   gene            complement(514361..514999)
FT                   /locus_tag="CtCNB1_0471"
FT   CDS_pept        complement(514361..514999)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0471"
FT                   /product="two component transcriptional regulator, LuxR"
FT                   /note="COG2197, CitB, Response regulator containing a
FT                   CheY-like receiverdomain and an HTH DNA-binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31217"
FT                   /db_xref="GOA:D0IYI1"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:D0IYI1"
FT                   /protein_id="ACY31217.1"
FT                   /translation="MIHVVLCDDHAILRRGIRDTLAEATDISVTAEAGSYAELREQLRE
FT                   AACDVLLLDINMPGRSGLEVLASVRETHPQIRVIMVSMYPEDQYALRSIKAGAAGYANK
FT                   AGDPVLLIDAVRTVHSGLKYLTAEVAQMLADSLAQPAAPVPHETLSEREMQTLLKIASG
FT                   QRQTDIAQELMLSPKTVSVYRARVLEKLGMGSNAELTAYAIKNGLIDTP"
FT   gene            complement(515055..516137)
FT                   /locus_tag="CtCNB1_0472"
FT   CDS_pept        complement(515055..516137)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0472"
FT                   /product="response regulator"
FT                   /note="COG4585, Signal transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31218"
FT                   /db_xref="GOA:D0IYI2"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D0IYI2"
FT                   /protein_id="ACY31218.1"
FT                   /translation="MQFRNQTLKILHIEDSVADQALARLSLKRGQLPCTLTTVDSLQEV
FT                   QGALEAQDFDLILADYHLPGFTALDVWDLVRTRADAPPFVLLSGAIGESAAVDIMRLGI
FT                   SDYLLKDQINGLPHVIKRAMEVHEARRARRRAALQLAESEKRLAELTEHLHTSIEQERA
FT                   NISREIHDDIGGSLTAVKFDLAWLIRNSPEGKQREHARSALEMLEHALGASQRIMQNLR
FT                   PPVLDQGLVAAVQWLAQDFERRTGIPARLHTSREHMEIAPEQQVVVYRTAQESLTNISK
FT                   YAQASQVTLDLSDHEGFLTLEVTDNGVGLSQDDRKKPQSFGLRGLSERARTIQGWLDVS
FT                   SHPGRGTSIILTIPLAEIQA"
FT   gene            516290..516739
FT                   /locus_tag="CtCNB1_0473"
FT   CDS_pept        516290..516739
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0473"
FT                   /product="conserved hypothetical protein"
FT                   /note="COG3437, Response regulator containing a
FT                   CheY-likereceiver domain and an HD-GYP domain"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31219"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454Y544"
FT                   /protein_id="ACY31219.1"
FT                   /translation="MQTMQNPSGVPAVAVPVMVAAELQDALLVTLRDLQRLEGLLDHAT
FT                   HNLLERFEQVNGQLSQPALPDSAALATARESLRLAVTELQFHDMSSQLIAHMAHTLQAC
FT                   AFRLGAAAMGRDEDEAESAISLPNLPEKPNPVTQSEMDAGSVELF"
FT   gene            516827..517144
FT                   /locus_tag="CtCNB1_0474"
FT   CDS_pept        516827..517144
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0474"
FT                   /product="response regulator receiver protein"
FT                   /note="COG0745, OmpR, Response regulators consisting of a
FT                   CheY-likereceiver domain and a winged-helix DNA-binding
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31220"
FT                   /db_xref="GOA:D0IYI4"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:D0IYI4"
FT                   /protein_id="ACY31220.1"
FT                   /translation="MVSFTLSSAGFKVVEAVDGVDALEKAQAQNIDLVLADQNMPRLDG
FT                   IGLTRKLRENPKFKGTPILILTTESSDLMKQAGRAAGATGWLVKPFDPNRLIEVIQKVL
FT                   R"
FT   gene            517177..519381
FT                   /locus_tag="CtCNB1_0475"
FT   CDS_pept        517177..519381
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0475"
FT                   /product="CheA signal transduction histidine kinase"
FT                   /note="COG0643, CheA, Chemotaxis protein histidine kinase
FT                   and related kinases"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31221"
FT                   /db_xref="GOA:D0IYI5"
FT                   /db_xref="InterPro:IPR002545"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004105"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR008207"
FT                   /db_xref="InterPro:IPR036061"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036641"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR037006"
FT                   /db_xref="UniProtKB/TrEMBL:D0IYI5"
FT                   /protein_id="ACY31221.1"
FT                   /translation="MADTHQDGAGSGADFDLSQFYQIFFEEASENLDQMEQMLLSLDLS
FT                   AANDEELNGIFRCAHSIKGGAATFGFSDVTELTHRMESLLDRLRRHEITPIPEMVDVLL
FT                   ESADASRSLLARHQSGDEGEPVSTAELVVRIEALAQGLTEIPQVNRSAAAAEPVQPVAV
FT                   VAAVVADTPAQAPAPAAAQVAEPGPVIGTAPPEGARELTIEIGPLSRLELGDAIKELFR
FT                   DIPGLGTIQDQVGTKADHRLFKVRTVSTDDELRDLFVFHVSKEQVQISDAAQPQNATEP
FT                   VVEPLEVVVDEEAAMPPHNLPAEEAYGFFAGAPGSPEAQQNQEHAVIGGAGSTVQKAAP
FT                   KAAAAHMESTSIRVDVKKVDQLINLVGELVITQAMLAQNSQGLDPTTYQQLLAGLADLD
FT                   RNTRDLQESVMSIRMIPMSTVFSRFPRMLRDLAGKLGKKIDLVTLGEATELDKGLVEKI
FT                   TDPLTHLVRNSVDHGIEMPEDRIAAGKSEHGTLTLAASHQGGSIVIEVRDDGKGMNRER
FT                   ILNKARERGMDVSDSMPDSDVWQLIFAPGFSTADVVTDVSGRGVGMDVVKRNITSLGGT
FT                   VEIESVAGVGMKVAVRLPLTLAIMDGMSVGVGEEVYILPLSSVVESFQVKADDVNTVAN
FT                   GTQLVKVRDEYMPVIALERTFQVPRADESQTSNIMVVVEAEGSRVALLVDELLGQHQVV
FT                   VKNLESNYRKVPNVSGATILGDGSVALILDTGALVRRTRH"
FT   gene            519432..519920
FT                   /locus_tag="CtCNB1_0476"
FT   CDS_pept        519432..519920
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0476"
FT                   /product="CheW protein"
FT                   /note="COG0835, CheW, Chemotaxis signal transduction
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31222"
FT                   /db_xref="GOA:A0A454XZN7"
FT                   /db_xref="InterPro:IPR002545"
FT                   /db_xref="InterPro:IPR036061"
FT                   /db_xref="InterPro:IPR039315"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454XZN7"
FT                   /protein_id="ACY31222.1"
FT                   /translation="MNIINKTAEGVATGAREYLTFRLGEEEYGIDILKVQEIRGYEQPT
FT                   RIANAPEFIKGVVNLRGTIVPIVDMRLRFNCSEVEYNAFTVVIILNLRNRVVGIVVDSV
FT                   SDVMELPADAVRPAPDIESAIDSGCILGLGSVGERMLILLDIEKLMGNVDMGLVASEA"
FT   gene            519938..520852
FT                   /locus_tag="CtCNB1_0477"
FT   CDS_pept        519938..520852
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0477"
FT                   /product="MCP methyltransferase, CheR-type"
FT                   /note="COG1352, CheR, Methylase of chemotaxis
FT                   methyl-accepting proteins"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31223"
FT                   /db_xref="GOA:D0IYI7"
FT                   /db_xref="InterPro:IPR000780"
FT                   /db_xref="InterPro:IPR022641"
FT                   /db_xref="InterPro:IPR022642"
FT                   /db_xref="InterPro:IPR026024"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR036804"
FT                   /db_xref="UniProtKB/TrEMBL:D0IYI7"
FT                   /protein_id="ACY31223.1"
FT                   /translation="MLNLGRSASFAASPARLEQDDEALPGAMSGPLAQGREFVWSNRDF
FT                   ARVQALIYKRAGISLHDGKHAMVYSRLSRRLRETGYESFVSYLDWLESINDGPEWQEFV
FT                   NALTTNLTSFFREQHHFDILAQHLRSHKPGGNGWKVWCSAASTGEEPYSILMTAVESLG
FT                   SSASFQLMASDIDSRVLDTASRGIYRAENLKGVSTERLHRFFLRGRSANSGMVRVKPEL
FT                   RRMVDFLNVNLIAGDWPFRESFDIVFCRNVMIYFDAPTQRRVLERIHQVMRPGGLLFVG
FT                   HAENFSDSRDLFALKGKTVYERQ"
FT   gene            520877..521608
FT                   /locus_tag="CtCNB1_0478"
FT   CDS_pept        520877..521608
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0478"
FT                   /product="CheD"
FT                   /note="stimulates methylation of MCP proteins; COG1871,
FT                   CheD, Chemotaxis protein; stimulates methylation of
FT                   MCPproteins"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31224"
FT                   /db_xref="GOA:D0IYI8"
FT                   /db_xref="InterPro:IPR005659"
FT                   /db_xref="InterPro:IPR011324"
FT                   /db_xref="InterPro:IPR038592"
FT                   /db_xref="UniProtKB/TrEMBL:D0IYI8"
FT                   /protein_id="ACY31224.1"
FT                   /translation="MRNLSSPLDLPGAGAARPLRGNSFVPQGYPDPAMPAPVSSLEQLK
FT                   RQPRQPGEASFFYYDPHFQLNSAKVLPGEYFVSRDEMAIVTVLGSCIAACLWDRFMRIG
FT                   GMNHFMLPDGDSSDVSGRYGSYAMELLINEMLKLGARRESMQAKIFGGAQVMANFTTMN
FT                   VGERNTSFVTEYLQTERIPIVSEDVLDIYPRKVVFFPSTGKAMVKRLAHAHPEALVQQE
FT                   ITRGNAAAVARNTAGGSVDLF"
FT   gene            521643..522737
FT                   /locus_tag="CtCNB1_0479"
FT   CDS_pept        521643..522737
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0479"
FT                   /product="response regulator receiver modulated CheB"
FT                   /note="COG2201, CheB, Chemotaxis response regulator
FT                   containing a CheY-likereceiver domain and a methylesterase
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31225"
FT                   /db_xref="GOA:D0IYI9"
FT                   /db_xref="InterPro:IPR000673"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR008248"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR035909"
FT                   /db_xref="UniProtKB/TrEMBL:D0IYI9"
FT                   /protein_id="ACY31225.1"
FT                   /translation="MIVVDDSALVRSLLAEIINRQHDMECIGSANDPLIAREMIRDLNP
FT                   DVITLDVEMPRMDGIDFLGRLMRLRPMPVVMISTLTERGAEVTMRALELGAIDFVAKPR
FT                   VGVANGLQELASQIVDKIRVAAVAQVHRLPVVPHGVAAAASAGAKPAAPRAPAAPSLLG
FT                   RISTEKIIAIGASTGGTEAIREVLTHLPADCPAIVITQHMPPGFTTSFAARLNSLCQMT
FT                   VKEATHGERLLPGHAYIAPGGKHFSITRSGANYVAVVDDAPPVNRHKPSVEVLFKSVAA
FT                   SAGRNAYGIMLTGMGADGATAMREMRDAGSYNLVQDESTCIVFGMPREAIVHGAADEVL
FT                   PLPQIAHALLSKLRGGSDQVHHRI"
FT   gene            complement(522849..524690)
FT                   /locus_tag="CtCNB1_0480"
FT   CDS_pept        complement(522849..524690)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0480"
FT                   /product="ABC transporter"
FT                   /note="COG0488, Uup, ATPase components of ABC transporters
FT                   with duplicatedATPase domains"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31226"
FT                   /db_xref="GOA:D0IYJ0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032524"
FT                   /db_xref="InterPro:IPR032781"
FT                   /db_xref="InterPro:IPR037118"
FT                   /db_xref="UniProtKB/TrEMBL:D0IYJ0"
FT                   /protein_id="ACY31226.1"
FT                   /translation="MALLDHANFSLETGERVGLIGRNGAGKSSLLKILGGLAKADDGQL
FT                   QVQNGVRITYVAQEPDLNPAHTIFESASDGIAAVIAIRERYLAGGEGEDLDELQTQIEA
FT                   YDAWNWEQRVEETLQRLHLDPNAVVGSLSGGTRKRVALAQALVARPDVLLLDEPTNHLD
FT                   LDSIEWLEELLIAFKGSVITITHDRSFLDRIATRIVELDRGVLRTYPGNFSQYVLQKEE
FT                   QLNQEAVINAKADKLLAQEEVWIRKGVEARRTRSQSRISRLQELRASRAQRRDVLGSVN
FT                   MDIASGKGDGYQGKIVAELTDVSKSFGEKKIVEKFSGTILRGDKVGLLGPNGAGKTTLL
FT                   KMILGELAPDSGQVRLGGNLQVAYFDQMRHQVNLDATLEDFISPGSEWIEIGSQKKHVK
FT                   SYLADFLFSPARAHSPVRSLSGGERNRLLLARLFARPANVLVLDEPTNDLDIETLDMLE
FT                   DLLQSYDGTVFLVSHDRTFLDNVVTSTIAWEGPGHWREYEGGVTDWMEQSRRSKAMAEA
FT                   AQAKSAPKEEPKPVASRTDAAASPKKKLSYKDQRELEALPATIAALETEQKQIQQALAD
FT                   GSLFASDNAKAVAMHQRDAEIDEALMEALERWTLLSE"
FT   gene            525211..526736
FT                   /locus_tag="CtCNB1_R0009"
FT   rRNA            525211..526736
FT                   /locus_tag="CtCNB1_R0009"
FT                   /product="16S ribosomal RNA"
FT   gene            526830..526906
FT                   /locus_tag="CtCNB1_R0010"
FT   tRNA            526830..526906
FT                   /locus_tag="CtCNB1_R0010"
FT                   /product="tRNA-Ile"
FT   gene            526935..527010
FT                   /locus_tag="CtCNB1_R0011"
FT   tRNA            526935..527010
FT                   /locus_tag="CtCNB1_R0011"
FT                   /product="tRNA-Ala"
FT   gene            527425..530305
FT                   /locus_tag="CtCNB1_R0012"
FT   rRNA            527425..530305
FT                   /locus_tag="CtCNB1_R0012"
FT                   /product="23S ribosomal RNA"
FT   gene            530469..530581
FT                   /locus_tag="CtCNB1_R0013"
FT   rRNA            530469..530581
FT                   /locus_tag="CtCNB1_R0013"
FT                   /product="5S ribosomal RNA"
FT   gene            complement(530729..531814)
FT                   /locus_tag="CtCNB1_0481"
FT   CDS_pept        complement(530729..531814)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0481"
FT                   /product="beta-lactamase-like protein"
FT                   /note="COG0491, GloB, Zn-dependent hydrolases"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31227"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:D0IYJ1"
FT                   /protein_id="ACY31227.1"
FT                   /translation="MTSSQESALHYPLGDTLPGPAQTLEVAPGVKWIRMTLPFALDHIN
FT                   LWLLRDRQTDLHGQVREGWTVIDCCVNRTEAREQWEQIFASALEDLPILRVIVTHMHPD
FT                   HIGLAGWLCHQWNAPLWISATDYNVARVAMKDRDGFGGESGADFYSLHGQRDEEFLLHV
FT                   RGRGSYYSSLVAPIPDIYHRIMDGDEIDINGRTWQCIAGYGHAPEHMALYCAELETLIS
FT                   GDMVLPRISANVSVHSSEPEANPLQLFLTSLKRYFALPQNTYVLPSHGKPFTGLHVRVQ
FT                   QLLDHHQERLNDIMQASQLQGLSAADILPILFKRQLDTHQMTFAMGEALAHLHYLWFSR
FT                   QLTRRLDENDILRFYASNMQK"
FT   gene            531936..532337
FT                   /locus_tag="CtCNB1_0482"
FT   CDS_pept        531936..532337
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0482"
FT                   /product="transcriptional regulator, MerR family"
FT                   /note="COG0789, SoxR, Predicted transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31228"
FT                   /db_xref="GOA:A0A454XXH3"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454XXH3"
FT                   /protein_id="ACY31228.1"
FT                   /translation="MSTIYTISDLAKEFDLTTRAIRFYEDMGLLQPERSGAGGRNRVYS
FT                   SRDRARLRLTLRAKRLGLSLSEAKEIIDMYDSPRDTGVQLRKFLDVLAIHRKQLEAQMA
FT                   DLQVTLDEVREQEKEARTLLKRSESKNGA"
FT   gene            532386..532844
FT                   /locus_tag="CtCNB1_0483"
FT   CDS_pept        532386..532844
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0483"
FT                   /product="hypothetical conserved protein"
FT                   /note="COG2050, PaaI, Uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31229"
FT                   /db_xref="InterPro:IPR003736"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:D0IYJ3"
FT                   /protein_id="ACY31229.1"
FT                   /translation="MSVAGVTESLDFVHRVKQSFAKQGAMATIGAELSLVEPGVVDICL
FT                   DWAPGLTQQHGFLHAGMVSTALDSACGYAGLTLMPADAAVLTIEFKINLLAPAKGQRFR
FT                   MEGRVIKPGRTITVSEGKAFAIDQGKEKLIATMGCTLMCVQNREGIQH"
FT   gene            532884..534071
FT                   /locus_tag="CtCNB1_0484"
FT   CDS_pept        532884..534071
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0484"
FT                   /product="acyl-CoA dehydrogenase-like protein"
FT                   /note="COG1960, CaiA, Acyl-CoA dehydrogenases"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31230"
FT                   /db_xref="GOA:D0IYJ4"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR034183"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:D0IYJ4"
FT                   /protein_id="ACY31230.1"
FT                   /translation="MSLANLPGLNFQLGEDIDALRDAVREFAQSEIAPRAAEIDRSDQF
FT                   PMDVWRKFGELGVLGITVPEQYGGADMGYLAHMVAMEEISRASASVGLSYGAHSNLCVN
FT                   QINRNGSEAQKAKYLPKLITGEHVGALAMSEPGAGSDVISMKLKAEDKGGYYLLNGNKM
FT                   WITNGPDADTLVVYAKTEPEMGARGVTAFLIEKGMKGFSIAQKLDKLGMRGSHTGELVF
FT                   QDVEVPAENILGGLNMGAKVLMSGLDYERAVLTGGPLGIMQSVMDNVVPYIHDRKQFGQ
FT                   SIGEFQLIQGKVADMYTVLQAGRSFAYTVAKNLDLLGTDHVRQIRKDCASVILWCAEKA
FT                   TWMAGEGVQIYGGNGYINEYPLGRLWRDAKLYEIGAGTSEIRRMLIGRELFAETC"
FT   gene            534122..534784
FT                   /locus_tag="CtCNB1_0485"
FT   CDS_pept        534122..534784
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0485"
FT                   /product="carbonic anhydrase"
FT                   /note="COG0288, CynT, Carbonic anhydrase"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31231"
FT                   /db_xref="GOA:A0A454XS01"
FT                   /db_xref="InterPro:IPR001765"
FT                   /db_xref="InterPro:IPR015892"
FT                   /db_xref="InterPro:IPR036874"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454XS01"
FT                   /protein_id="ACY31231.1"
FT                   /translation="MTTTSIEELFVHNRQWADQMERDRPGFFTGLMAQQKPKYMWIGCS
FT                   DSRVPANQITGLEPGEVFVHRNVANVVVPSDLNCLSTIQYSVDHLKIEHLMVVGHYGCG
FT                   GVYAALNNLRLGLVDNWTRHVRDVRDKHIKLLEGISTQFRHDVLCELNAIEQVVNVAQS
FT                   TVMQDAWARGQKVTLHGWCYSLNNGHITNLEMTVPGVGGLEDVYNKAVEKVAARKRD"
FT   gene            534888..536735
FT                   /locus_tag="CtCNB1_0486"
FT   CDS_pept        534888..536735
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0486"
FT                   /product="multidrug resistance protein mdtA"
FT                   /note="COG4579, Isocitrate dehydrogenase
FT                   kinase/phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31232"
FT                   /db_xref="GOA:D0IYJ6"
FT                   /db_xref="InterPro:IPR010452"
FT                   /db_xref="UniProtKB/TrEMBL:D0IYJ6"
FT                   /protein_id="ACY31232.1"
FT                   /translation="MFPQRLDAPEAYAIAQALMHGYNQHYRMFSAEAARAKQRFETMDW
FT                   PGQQQAQRERIEFYDRQVRACIQRLEEEFAASLQSMAVWQQVKLHYIGLMVDHLQPELA
FT                   ETFFNSVTTKILHRTHFQNDFIFVRAAVSTEYLENTAPGAVPIYRAYYPGNLAQLEGTL
FT                   QTLFEQLQLQCRFEDLQRDVHLLAERIRERLAGLTLRANFQLQVLSSLFYRNKGAYLVG
FT                   KIITGYTELPLAIPILHGEKEQLIVHAALFGEDDLHALFSFARAYFMVDMEVPSAYVSF
FT                   LRSLMPRKPKAEIYNALGLAKQGKTLFYRDFLHHLRHSSDQLRIAPGIKGLVMLVFDLP
FT                   SFPYVFKLIKDRIASSKDVSRPQVKAKYQLVKKHDRGGRMADTMEYSLVAFPKERFSDE
FT                   LLAELHAQAPEQIEISDRDGDGQMEVIISHLYIERRLVPLNLFLMECLAEADTKPERRV
FT                   AMERAILEYGNAIKDLVATNIFPGDMLWKNFGVTRGGKVVFYDYDEIEYLTDCNFREVP
FT                   QPRTEEEEMSGDIWYSVGPRDVFPETFGPFLLGHPAVRDIFMRHHADLLEAEFWRGHQS
FT                   RIRDGHFLDVFPYERSRFLHAGDAGLDTQRFEIPANSLA"
FT   gene            536777..537961
FT                   /locus_tag="CtCNB1_0487"
FT   CDS_pept        536777..537961
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0487"
FT                   /product="acetyl-CoA acetyltransferase"
FT                   /note="COG0183, PaaJ, Acetyl-CoA acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31233"
FT                   /db_xref="GOA:D0IYJ7"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020610"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:D0IYJ7"
FT                   /protein_id="ACY31233.1"
FT                   /translation="MHQDPVVIVSAARTPMGAFQGDFSDLAAHDLGGAAIKAAVERAGI
FT                   RPELVEEVLFGNCLMAGQGQAPARQAGFKGGLPQSTGAVTLSKMCGAGMEATILAHDQL
FT                   IAGSREVMIAGGMESMTNAPYLLKKGRGGYRMGHDKIFDHMMLDGLEDAYEAGRSMGTF
FT                   GEDCAAKYQFTREAQDAFAIASVQRAQAAAQSGAFDAEITPVTVKTRKGDVTVSLDEGP
FT                   AKAKLDKISSLKPAFKKDGTITAASSSSINDGAAAMVLMRESTAKQLGCKPLARIVSHA
FT                   TFAQAPEWFTTAPVGATEKALKKAGWAVEDVDLWEINEAFAVVPMALMADLKVSHDKVN
FT                   VNGGACALGHPIGASGARILVTLLHALKTRGKKKGLATLCIGGGEATAMAIELI"
FT   gene            538069..539181
FT                   /locus_tag="CtCNB1_0488"
FT   CDS_pept        538069..539181
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0488"
FT                   /product="hypothetical protein"
FT                   /note="COG0465, HflB, ATP-dependent Zn proteases"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31234"
FT                   /db_xref="UniProtKB/TrEMBL:D0IYJ8"
FT                   /protein_id="ACY31234.1"
FT                   /translation="MSADIHHDESETIKPLEPQQIDAFWGDFSNQLSQLEELDRHEFVE
FT                   SSNELLHQYAPGLSLELEGKLGEAGSRLVISAHGNTAQFENAQALVRQAPRFEHYSVQA
FT                   FRSRALGSNFGMRMDGFELACSDIRVGYYDAGGIIGLKLSFEKPIARDMAEHAQHMAFI
FT                   MLDHVLGEWDFSVRVGPVEFASEAATDVYGSALLSEFPPLFDGFIRQQLGRSYEFPKED
FT                   SDRWLSLEVRAQDADEDAPPDILTFHDGANAVATRADLSHFMEWRFSFSSQQELDGVRD
FT                   AQDALDEQLSREQRGILAFSRVENMSARVATYYVEDPAHAVQLAAQLGRQHVPGLEGEL
FT                   SVSFDPSWNEFLSLYAAIHRNDRPEEVLAS"
FT   gene            539178..539807
FT                   /locus_tag="CtCNB1_0489"
FT   CDS_pept        539178..539807
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0489"
FT                   /product="pyridoxamine 5'-phosphate oxidase-related
FT                   protein"
FT                   /note="COG3576, Predicted flavin-nucleotide-binding
FT                   proteinstructurally related to pyridoxine 5'-phosphate
FT                   oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31235"
FT                   /db_xref="GOA:D0IYJ9"
FT                   /db_xref="InterPro:IPR011576"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="InterPro:IPR024029"
FT                   /db_xref="UniProtKB/TrEMBL:D0IYJ9"
FT                   /protein_id="ACY31235.1"
FT                   /translation="MITSREQLLQLYEPPAERALLKQQWELDRHCLRFIALSPFLVMAT
FT                   GGAGGTLLDASPRGGKPGFVKAPDANTLLIPDAGGNNRLDSLSNLLDDPRLGLLFFVPG
FT                   FDETLRVNGTAQLRDEAHYTALFASDHFRPKLVIEVHVQEAYLHCAKALMRSRLWSEEA
FT                   RVARNVMPTLNQIIHAQMGLTAQPESQESMVARYGAMIAAEQIKKN"
FT   gene            539885..540556
FT                   /locus_tag="CtCNB1_0490"
FT   CDS_pept        539885..540556
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0490"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="COG0300, DltE, Short-chain dehydrogenases of various
FT                   substratespecificities"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31236"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D0IYK0"
FT                   /protein_id="ACY31236.1"
FT                   /translation="MALILILGASRGLGRALAEAYLAQGHQVIATVRKAEDMVYLQARG
FT                   ARVLQVDLADPASVSGLAWQLDGASIDVALYVAGVWDGHDAGVPPTQQQFDLVMHSNVL
FT                   GFMQALPQIAPMVQDAGGVIGAFSSGMSLLADADESAWLYRVSKAALNMAVVSACRQWP
FT                   GLTLLALDPGWVQTEMGGAAAPLSVAQSVQGLMQALAQVKPEDRGQLLRHDGRYIQLLD
FT                   A"
FT   gene            540602..541732
FT                   /locus_tag="CtCNB1_0491"
FT   CDS_pept        540602..541732
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0491"
FT                   /product="acyl-CoA dehydrogenase-like protein"
FT                   /note="COG1960, CaiA, Acyl-CoA dehydrogenases"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31237"
FT                   /db_xref="GOA:D0IYK1"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:D0IYK1"
FT                   /protein_id="ACY31237.1"
FT                   /translation="MLLNQDQEMIRDALRDFVREQITPHAARWDKEHEFPKDVHQGLAA
FT                   LGAYGICVPEELGGAGLDYVSLALVLEEIAAGDGGTSTVISVTNCPVNAILMKYGNASQ
FT                   QEQWLRPLAQGQMLGAFCLTEPHVGSDASALRTTAVRDGGDYVINGVKQFITSGKNGDV
FT                   AIVIAVTDKTAGKKGMSAFIVPTGNPGYQVARLEDKLGQHSSDTAQINFENCRIPAANL
FT                   IGAEGEGYRIALSALEGGRIGIAAQSVGMARAAFECALQYSKERESFGQPIFNHQAVGF
FT                   RLAECATQIEAARQLIWHAASLRDAGLPCLKEAAMAKLFASEMAERVCSAAIQTLGGYG
FT                   VVSDFPVERIYRDVRVCQIYEGTSDVQKILIQRALA"
FT   gene            541894..542685
FT                   /locus_tag="CtCNB1_0492"
FT   CDS_pept        541894..542685
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0492"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /note="COG0596, MhpC, Predicted hydrolases or
FT                   acyltransferases (alpha/betahydrolase superfamily)"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31238"
FT                   /db_xref="GOA:A0A454XN85"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR013595"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454XN85"
FT                   /protein_id="ACY31238.1"
FT                   /translation="MPFAQVNGQNIYYEDTGGRGPAIVFSHGLLMDHTMFEPQIQALQG
FT                   QYRCISWDERGHGQTADPEHCEAFSYYDSADDLAALLKYLGVEKAVLVGMSQGGYLSLR
FT                   CALIHPDVVGALVLIDTQAMLEDPEQMPHHEALLKAWMEHGLSDDMATIVEHTILGQGW
FT                   PGAAQWRAKWKQASPINLGQSFATLALRDDISPRLAEIKVPALVIHGDKDAAIGVERAR
FT                   AMFKGLPQAQWVDVAGAGHAANLTHPEPVNAAIRQFLDGLH"
FT   gene            complement(542710..543318)
FT                   /locus_tag="CtCNB1_0493"
FT   CDS_pept        complement(542710..543318)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0493"
FT                   /product="conserved hypothetical protein"
FT                   /note="COG2323, Predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31239"
FT                   /db_xref="GOA:D0IYK3"
FT                   /db_xref="InterPro:IPR007353"
FT                   /db_xref="InterPro:IPR023090"
FT                   /db_xref="UniProtKB/TrEMBL:D0IYK3"
FT                   /protein_id="ACY31239.1"
FT                   /translation="MIGNAALSAKSNNEQAGLRSRLPQSTVAAVQSSLFKGLPMFSMAA
FT                   PWWEFVIRGVSVYLFLLVFLRLTGRRQTGQYAPFDLVLLLILSNAVQNSMNAGDNSLIG
FT                   GLISAGTLLACHALLSRLSYRFARLRRLVNGKPKVLIHQGIVQPSLMTQEQITAEDLAA
FT                   ALRSNGCLNAHEVERATIETNGQITVVLRKRSMAELGEA"
FT   gene            543332..543745
FT                   /locus_tag="CtCNB1_0494"
FT   CDS_pept        543332..543745
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0494"
FT                   /product="conserved hypothetical protein"
FT                   /note="COG3012, Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31240"
FT                   /db_xref="InterPro:IPR023006"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:D0IYK4"
FT                   /protein_id="ACY31240.1"
FT                   /translation="MKEAENKRDCPCGRKNAKGRLLAYADCCGRYIDHWDARPAPDAEA
FT                   LMRSRYTAFVSENQEYLQATWHTSQRPSQLDFDAATKWLGLDVKQFQLTGDASAEVEFV
FT                   ARYRLAGRAVRLHERSRFVLEGGRWFYVDGDQF"
FT   gene            543729..545558
FT                   /locus_tag="CtCNB1_0495"
FT   CDS_pept        543729..545558
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0495"
FT                   /product="periplasmic sensor hybrid histidine kinase"
FT                   /note="COG0642, BaeS, Signal transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31241"
FT                   /db_xref="GOA:D0IYK5"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D0IYK5"
FT                   /protein_id="ACY31241.1"
FT                   /translation="MATNSEVDSAQLTRLQAWLRLLQSLASRGSSEIAALLIPALLLWV
FT                   STRNSPAVSAGLAWWWGLMIVMALGFLLFRRSLHRQWRSARDWEPSRLQEALTTWQRQL
FT                   ALAALINGLLWVSVLAFTWGESHSELRLLIYLVLLGVMASAATFLAPVLQVFAAFMAGI
FT                   YLPMLLCTLHYFPKKGPYLLPLLLLYGAILARHAWGARRFVQQQMAHELERQALAERYR
FT                   EAKEQAENALAEKNWFISAASHDLRQPLHAMGLMLQAAHQRNQDDELAQLLQEMQACTR
FT                   DLGSMFNDLMDLSRLEGDSFAPQWQAVSMSAVLDEARRLFAREAAQRGLRLRVRQPAHM
FT                   PALCTDAVLLRQMVFNLLQNALRYTDQGGVLLALRHRQGRWLLQVWDSGCGMSEQECAQ
FT                   VFMRHYRSPARQQRDAMDGVPAPLRGRGLGLSVVALAAQRLGVECGVQSLPGKGSCFWL
FT                   RWPQDAEQWQTSSVLPAPPISTGPQWFAPLQGHCLVVENDAQLAPVLVQILQSWGVQVQ
FT                   RARSLLEAQQLLADGLRPDFVLCDQRLKDGASGLECLMQLLEEHPQASGALMSGDEEML
FT                   EQVQDQGYLALATPLQPDQLHAVLARCMTIRQP"
FT   gene            complement(545555..546250)
FT                   /locus_tag="CtCNB1_0496"
FT   CDS_pept        complement(545555..546250)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0496"
FT                   /product="two component transcriptional regulator, LuxR"
FT                   /note="COG2197, CitB, Response regulator containing a
FT                   CheY-like receiverdomain and an HTH DNA-binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31242"
FT                   /db_xref="GOA:D0IYK6"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:D0IYK6"
FT                   /protein_id="ACY31242.1"
FT                   /translation="MPDLLQILSTTQLSAQPYALVVDDHPLVAEGAAHVLMTSAGVQRV
FT                   RCAVHGNEALAMIAALGEPVITVMDFWLEDGASLEFVHSILALAPGTRILVTSGDKHPA
FT                   IASKAAAAGVHGFVHKSSPSHEFQAAVQALLAGRTWFEALPPIPTAPPAPTAGSILHMS
FT                   ARELGITARQAQVLSLLLQGKPNRAIAQALNLSEYTVKEHVTALLQRLGASNRVALITR
FT                   MRGIEVDLD"
FT   gene            546406..547464
FT                   /locus_tag="CtCNB1_0497"
FT   CDS_pept        546406..547464
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0497"
FT                   /product="conserved hypothetical protein"
FT                   /note="COG1512, Beta-propeller domains of methanol
FT                   dehydrogenasetype"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31243"
FT                   /db_xref="UniProtKB/TrEMBL:D0IYK7"
FT                   /protein_id="ACY31243.1"
FT                   /translation="MPSLMQITRRTAALLLISTLAACGGGGDGGSSESGGGGGGSEGGG
FT                   GNTGGGNGGGTGNQAVTGTYKMGGQTATSHAQMLEAANSMGADGYALFSSLAGSVGPTG
FT                   AEIGDFYLTDTAHAGRKFSYVNPAAQPSRTAFLAQLNQQGSSGYMYKSDAVFSDVSDIR
FT                   SVYVKDNSRSDQFSYRTVTPVATTAEAFATELNGQGAEGYRYLGPQIVNNELFSLYAKR
FT                   NDSVTYTYQVDKLGSASSAADAAEMRTRLAQKGADGWFIRGTQGLGSDPMNMNYVDVFE
FT                   KSSAQNGAIEYLVEASASSDSLTTQLSNMNANAANGFFYFSGIMTADNKTSTIYAKNSA
FT                   WMINPLAGVTFP"
FT   gene            547566..548291
FT                   /locus_tag="CtCNB1_0498"
FT   CDS_pept        547566..548291
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0498"
FT                   /product="HAD-superfamily hydrolase, subfamily IA"
FT                   /note="COG0637, Predicted phosphatase/phosphohexomutase"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31244"
FT                   /db_xref="GOA:D0IYK8"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:D0IYK8"
FT                   /protein_id="ACY31244.1"
FT                   /translation="MTAFDAVLFDCDGVLVDSESITNRVLCTMLNESGWAISQEQCTRD
FT                   FIGKTVRSQAAVIEAHTGKPLTDAWMAEFYERRNAALRAELVAIDGALEAVRRIHALCN
FT                   GRIACASGADRAKVEMQLAKVGMAPYFEGHVYSGHEMPRSKPFPDVYLAAAEALKADHA
FT                   KCLVIEDTMTGVQAGVAAGATVWGYFPADQGHASAEQLLEAGAACVFGDMGDLPAMFEA
FT                   VRRSAASASAGEDDEHDLR"
FT   gene            complement(548299..548994)
FT                   /locus_tag="CtCNB1_0499"
FT   CDS_pept        complement(548299..548994)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0499"
FT                   /product="conserved hypothetical protein"
FT                   /note="COG3164, Predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31245"
FT                   /db_xref="InterPro:IPR025638"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:D0IYK9"
FT                   /protein_id="ACY31245.1"
FT                   /translation="MQESSENWQAIADGVWALSYHFSNAGLKVSTRMTVIRLADGSLFS
FT                   HSAVPLTGGQKAALDALGPLQHIVAPSAMHHLFVGKLARLYPQARIYGTQGVLSKRPDL
FT                   PLLEPLPPDSEAPWAGELQCLRLDGLPMLDETLWFHPASGSLIATDVLQCWQGPLSLPV
FT                   RMYLGLTGGHERLTVPRTVRLLVRDRAAVRNWVKRVESWPVRRVILLHNSVIDDQPVKR
FT                   LREALSIWD"
FT   gene            complement(549010..550086)
FT                   /locus_tag="CtCNB1_0500"
FT   CDS_pept        complement(549010..550086)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0500"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="COG2207, AraC, AraC-type DNA-binding
FT                   domain-containing proteins"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31246"
FT                   /db_xref="GOA:D0IYL0"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR032687"
FT                   /db_xref="UniProtKB/TrEMBL:D0IYL0"
FT                   /protein_id="ACY31246.1"
FT                   /translation="MLTPSLVKTPLPHHASSVLKSHPAITPMAFVKAIVSAYEARQMSA
FT                   LGALEKAQIPPDLINDANERITALQMEALSDAAMRELDDEALGWFERRLPWGSYGMLAR
FT                   ASISAPQLGLALARWCRHHGLIAQDIQLQLSEQAGIATLTLHESRPLESMREFCMVSVL
FT                   RNIHGFASWLINEPISLLHASFPFSEPAHADVYKVLFAPGSIVFDAPVASLQFEARWLQ
FT                   APLARDEAALNRMLQRALPIQVRPYQREKTLVQRVRHLLAASGEEQQTAETLSRQLHLS
FT                   QRSLHRQLKEEGISLQALKDDIRRERAIALLLRTSRPIKRVAQACGFLNDKSFIRAFRL
FT                   WTGLSPSEFRKTAGQRAA"
FT   gene            550222..551985
FT                   /locus_tag="CtCNB1_0501"
FT   CDS_pept        550222..551985
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0501"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="COG0318, CaiC, Acyl-CoA synthetases
FT                   (AMP-forming)/AMP-acid ligasesII"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31247"
FT                   /db_xref="GOA:D0IYL1"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:D0IYL1"
FT                   /protein_id="ACY31247.1"
FT                   /translation="MPSQVNALTTSYAKGGTDVPLIEQTIGDFFAAMAQRQGSRDALVS
FT                   RHQGLRYSYAQLHMAARQLASALLSQGLVKGDRVGIWSHNNAEWVLMQLATAQVGLVLV
FT                   NINPAYRTSEVEYALNKVGCKALVSMPRFKTSDYLGMLRELAPELASCAPGQLQSKRLP
FT                   ALRTVVWIDAAGSGAAGSGATGPGAADLDAEQPGMLRFSQLMAQGTSADERIDAIAATL
FT                   SNRDPINIQFTSGTTGFPKGATLTHRNILNNGFFIGECMRLTPEDRLCIPVPLYHCFGM
FT                   VLGNLACFTHGSTIVYPNDGFDPITVLEAVQAEKCTGLHGVPTMFIAELDHPRFAEFDL
FT                   STLRTGIMAGSPCPIEVMKRVVRDMHLSEITIAYGMTETSPVSCQSDADTPLEKRVATV
FT                   GKVQPHLEVKIVDPSTGEIMPPGQSGELCTRGYSVMHGYWEDEARTREAIDAEQWMHTG
FT                   DLATMDGEGYVNIVGRIKDMVIRGGENIYPREIEEFLYRHPKVQDVQVVGVPDVRYGEE
FT                   LCAWIIVKPGQELGEEEVRDFCKGQIAHYKVPRYIRFVQAFPMTVTGKIQKFRIRDEMI
FT                   ELLDLRVIKTA"
FT   gene            complement(552057..553790)
FT                   /locus_tag="CtCNB1_0502"
FT   CDS_pept        complement(552057..553790)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0502"
FT                   /product="Na+/H+ antiporter"
FT                   /note="COG0025, NhaP, NhaP-type Na+/H+ and K+/H+
FT                   antiporters"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31248"
FT                   /db_xref="GOA:D0IYL2"
FT                   /db_xref="InterPro:IPR004705"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR018422"
FT                   /db_xref="UniProtKB/TrEMBL:D0IYL2"
FT                   /protein_id="ACY31248.1"
FT                   /translation="MHAVETVLLVLLLGALTGIVARYIRAIPLPLIQIALGALIAWPQA
FT                   GLHIAFDPELFLLLFIPPLLFADGWRIPKREFFALAKPILLLALGLVLFTVLGLGYLIH
FT                   WMIPEIPLTVAFALAAVISPTDAVAVSAITRNLGMPEKTMHVLEGESLLNDASGLVALK
FT                   FAIAATLTGMFSWGEVAKEFTWMAVGGLGVGALIGWGFSHARGTITRRLGDVAATQMVL
FT                   LLVLLPFAAYIVGEKIGVSGILAAVAAGIATNFADLERSSYISERLQTEGTWSMVEAAF
FT                   NGAIFLLLGLQLPSIIGVPLHQAGHDWWILVGYVAAISFALLLMRWIWLVLGVHGSLLR
FT                   AHRQGKMSERPSPLLNLATTLAGIRGAVTLAGALSVPMLLNNGQPFPGRDMLVFLATGT
FT                   ILFTLVIGAVGLPIVLRHLPPHEESPTVREERLAREQACMAAMAKLTLSEEEVLRRDPE
FT                   WVAMRQEVNGHLTQEYRNRIQLLDDGSGAAQSIELLREAPEVVRQRKLRYVMEIETRIE
FT                   CIHAERDFYYAERQAHRINDESLRSLVSELDMQEIAMRKRLAVARRAAGLPKSETSAHQ
FT                   H"
FT   gene            553888..555495
FT                   /locus_tag="CtCNB1_0503"
FT   CDS_pept        553888..555495
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0503"
FT                   /product="carboxyl transferase"
FT                   /note="COG4799, Acetyl-CoA carboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31249"
FT                   /db_xref="GOA:D0IYL3"
FT                   /db_xref="InterPro:IPR011762"
FT                   /db_xref="InterPro:IPR011763"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR034733"
FT                   /db_xref="UniProtKB/TrEMBL:D0IYL3"
FT                   /protein_id="ACY31249.1"
FT                   /translation="MSILGTQLNPRSADFLANAAAMQALVNELHARCDQNALGGNEAAR
FT                   AKHVARGKLLPRERVQRLLDPGTPFLELSPLAALNMYNNDAPGAGVIVGVGRVSGVDCM
FT                   IVCNDATVKGGTYYPMTVKKHLRAQEVAAQNRLPCIYLVDSGGANLPNQDEVFPDREHF
FT                   GRIFYNQANMSAQGIAQIAVVMGSCTAGGAYVPAMSDESIIVKNQGTIFLGGPPLVKAA
FT                   TGEVVSAEDLGGGDVHTRLSGVADHLAENDLHALALARQAVANLNKDKPPSQTDHAPAA
FT                   PLFESEELYGVIPVDTRKPFDVREIIARIVDGSQFDEFKARFGNTLVCGFARIEGMQVG
FT                   IIANNGILFSESAVKGAHFIELCCQRKVPLVFLQNITGFMVGRKYENEGIARHGAKLVT
FT                   AVATAAVPKFTIIIGGSFGAGNYGMCGRAYSPRFLWMWPNARISVMGGEQAASVLATVK
FT                   RDGIEAKGGSWSAEEEERFKAPIRQQYEDQGHPYYATARLWDDGVIDPADTRRVLALGL
FT                   AAARNAPIEDTRFGVFRM"
FT   gene            555516..556454
FT                   /locus_tag="CtCNB1_0504"
FT   CDS_pept        555516..556454
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0504"
FT                   /product="dipeptidyl"
FT                   /note="COG1506, DAP2, Dipeptidyl
FT                   aminopeptidases/acylaminoacyl-peptidases"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31250"
FT                   /db_xref="GOA:D0IYL4"
FT                   /db_xref="InterPro:IPR000383"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D0IYL4"
FT                   /protein_id="ACY31250.1"
FT                   /translation="MSRRHFLTCLPPVLLSAALAMPMVGAAEPAVQRMDARIPVWVPAS
FT                   GDSPAHSAELAGHVYRPHGQGPWGLIVLNHGTPSGKEARETMRDRYGPQARALAELGYV
FT                   VVTGLRRGYGASDGPLADRYGSCDDPDYAHAAQEAARDVAAIMTYGQKLPYVDGSHVLL
FT                   LGKSAGGFASLALAAQQPVGLRGVVNFAGGRGSQPQMREKAAVCGEAQLLKTVAGFAAT
FT                   SRVPQLWIYAENDSYFRPPLVRKMAESYLAAGQNLKLVFAPSSGAEGHQFFDRAANIGQ
FT                   WLPQVREFLMQQLPGTAAAQLQRPNSLGDKP"
FT   gene            556451..557233
FT                   /locus_tag="CtCNB1_0505"
FT   CDS_pept        556451..557233
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0505"
FT                   /product="Enoyl-CoA hydratase/isomerase"
FT                   /note="COG1024, CaiD, Enoyl-CoA hydratase/carnithine
FT                   racemase"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31251"
FT                   /db_xref="GOA:D0IYL5"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:D0IYL5"
FT                   /protein_id="ACY31251.1"
FT                   /translation="MTALTLTVDGGIARVTLAQPAIRNAFSDAAIAEITAAFLQVGERA
FT                   DVRAVVLAAEGPAFCAGADLNWMRRMADYSRDENRVDAGLLAEMLRVIYECPKPTIARV
FT                   QGDVYAGGMGLVACCDMAVAADTAGFCLSEVKIGLIPATISPYVIRAMGARAAHRYFLT
FT                   GERFSAQEAHRIGYVHEVVDADGLDAVVDGWLKHLLSAGPAAVRACKRLVLDMAEREIS
FT                   EQLIAATVESIATIRASSEGKEGVQAFLNKRKPNWLPG"
FT   gene            557295..558047
FT                   /locus_tag="CtCNB1_0506"
FT   CDS_pept        557295..558047
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0506"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31252"
FT                   /db_xref="InterPro:IPR025196"
FT                   /db_xref="UniProtKB/TrEMBL:D0IYL6"
FT                   /protein_id="ACY31252.1"
FT                   /translation="MDIWQTIIDWLHRIGLHIDPETARAVGDAAGQVGDVAARAGQAVG
FT                   QMDMASMLALAAALGWASGFRLYAVVFVVGLLGASGLMPLPGGLHVLQHPMVLVISGGL
FT                   LFVEFFADKIPVVDSVWDLFQSVLRIPAGAALAASVFAADSTTMAMAAALMGGTLAATS
FT                   QAAKTTTRALINTSPEPFSNLGASLAEDTVSLGAIWLALTNPLVFAAVLLVVVIAMWLV
FT                   IWALWRFLKAIFRRLRGTGDAQEPLQKT"
FT   gene            558106..560142
FT                   /locus_tag="CtCNB1_0507"
FT   CDS_pept        558106..560142
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0507"
FT                   /product="Carbamoyl-phosphate synthase L chain"
FT                   /note="COG4770, Acetyl/propionyl-CoA carboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31253"
FT                   /db_xref="GOA:D0IYL7"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001882"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005481"
FT                   /db_xref="InterPro:IPR005482"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR011764"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:D0IYL7"
FT                   /protein_id="ACY31253.1"
FT                   /translation="MFKKILIANRGEIACRVAATARRMGVKTVAVYSDADARAKHVAAC
FT                   DEAVHIGGSAPKDSYLRWERILEAAQATGAEAIHPGYGFLSENEDFANACAAAGLVFIG
FT                   PPASAIRAMGLKAESKQLMEKAGVPLVPGYHGHDQNPELLQREADRIGYPVLIKASAGG
FT                   GGKGMRLVEKSEDFAASLESCKREAINSFGNDAVLIEKYVLRPRHIEIQVFGDTQGNCV
FT                   YLFERDCSVQRRHQKVLEEAPAPGMTAALRQKMGEAAVAAAKAVNYVGAGTVEFIVEQP
FT                   GGYDQPEAMKFYFMEMNTRLQVEHPVTEAITGEDLVRWQLLVASGQPLPKAQSELRIQG
FT                   HAIEARICAENPENNFLPATGHLAVYRKPVCSSFEISDVRVDDGVREGDAISPFYDSMI
FT                   AKLIVHGEDRAQALARLDAALAQTHIVGLTTNVQFLRQVVKSQAFSNALLDTALIERER
FT                   EALFGKDFVGRDLAVAAAMAWQLQGEQAGQGVDPFSRRDGWRMSGRYVRSFGFAYRGED
FT                   FTAGLAYGRDTQAAQTYQLGIGEGESRSDAALQWRALADGRLELGLDGKRTVVVVHAQG
FT                   DQLSIFTEAGSTQITVVDQLAHAGDTGHEGGRLTAPMPGKVVSFTVKAGDKVSKGQPLA
FT                   VMEAMKMEHTIAAPGDGVVLELLYVPGDQVSEGAELLRIEVAA"
FT   gene            560270..561244
FT                   /locus_tag="CtCNB1_0508"
FT   CDS_pept        560270..561244
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0508"
FT                   /product="D-isomer specific 2-hydroxyacid dehydrogenase"
FT                   /note="COG0111, SerA, Phosphoglycerate dehydrogenase and
FT                   related dehydrogenases"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31254"
FT                   /db_xref="GOA:D0IYL8"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR029753"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D0IYL8"
FT                   /protein_id="ACY31254.1"
FT                   /translation="MAICVCSGHGKALGLASMKVLFCCDDTRPEPWLKGLHEALPGAEI
FT                   AIWEPGAPQADYALVWAPPQQFLDEQAAGLKAMFNIGAGVDALLPLRIPAALPVYRLED
FT                   AGMAVQMAEYVAQAVIRFFRGLDQYEADMAQGLWQHQRNPRRVDYPVGVMGLGKMGERV
FT                   ARALTVFDFKVNGWSRSPRELQGIECFSGMDSLDRFLSETRILVNLLPLHDETRDIINA
FT                   RTLALLQPGAYVINVGRGGHVVDADLIAQIESGHVSGAMLDVFREEPLPENHPFWKQSR
FT                   IILTPHTSARTLAADSIAQIVGKVAAMSRGEPVTGRVDLSKGY"
FT   gene            561261..562169
FT                   /locus_tag="CtCNB1_0509"
FT   CDS_pept        561261..562169
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0509"
FT                   /product="pyruvate carboxyltransferase"
FT                   /note="COG0119, LeuA,
FT                   Isopropylmalate/homocitrate/citramalate synthases"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31255"
FT                   /db_xref="GOA:D0IYL9"
FT                   /db_xref="InterPro:IPR000138"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D0IYL9"
FT                   /protein_id="ACY31255.1"
FT                   /translation="MKYPARVKIIDVGPRDGLQNEKQPVPAGVKIELVQRLQDAGLKEI
FT                   EVTSYVSPKWVPQMADNAEVMAGIARRGGVRYSVLTPNLKGFEAALAGKPDEIVVFGAA
FT                   SEAFSQRNINCSIAESIERFAPVVQAALEAGIAVRGAMSCTVGCPYEGEIAPEKVGYLA
FT                   GLMKSIGVQRVDVADTIGVGTPVKVQKALEATLAHFDIDQVSGHFHDTYGQALSNTLAA
FT                   LDLGVWNFQSSVAGLGGCPYAKGATGNVATEDVVYLLQGMGIETGIDLDKLIDAGQFIS
FT                   EHLGRPTQSRVAKALLTKRAG"
FT   gene            562193..562759
FT                   /locus_tag="CtCNB1_0510"
FT   CDS_pept        562193..562759
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0510"
FT                   /product="hypothetical protein"
FT                   /note="COG4191, Signal transduction histidine kinase
FT                   regulatingC4-dicarboxylate transport system"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31256"
FT                   /db_xref="InterPro:IPR021242"
FT                   /db_xref="UniProtKB/TrEMBL:D0IYM0"
FT                   /protein_id="ACY31256.1"
FT                   /translation="MGVVTIAAMQARSRFSLALCLAAAALLGGCAGMDAQECRDTDWAY
FT                   LGQLDAMDGRLDLSTRARRHFKACKDQGVQMDARAYQQGWLRGLQDFCTPESGKAYAEA
FT                   GRKFQPGYCPAPLEAAFLQGYAPARDRYQDRQSVLELERRIEAKKKELREARDAKNSAG
FT                   HIAYVQKDLRDLQLELVQLRLKLAQ"
FT   gene            562806..563303
FT                   /locus_tag="CtCNB1_0511"
FT   CDS_pept        562806..563303
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0511"
FT                   /product="YbaK/prolyl-tRNA synthetase associated region"
FT                   /note="COG2606, EbsC, Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31257"
FT                   /db_xref="GOA:A0A454Y6V3"
FT                   /db_xref="InterPro:IPR007214"
FT                   /db_xref="InterPro:IPR036754"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454Y6V3"
FT                   /protein_id="ACY31257.1"
FT                   /translation="MCGSELHALPEGVQRVSRFLQDAGHPHAPQMLDGAARTAQEAADQ
FT                   LSILVGQVAKSIIFKRRSDGAAVLVVASGDRRVDEKKVTQLVGKVGRADADFVKSSTGF
FT                   SIGGVSPVAHATKVVTLMDAELQRFETVWAAAGHPHGVFPASPAQLQALTAAPWSDVVE
FT                   QA"
FT   gene            563300..563590
FT                   /locus_tag="CtCNB1_0512"
FT   CDS_pept        563300..563590
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0512"
FT                   /product="Fe-S protein"
FT                   /note="COG3313, Predicted Fe-S protein"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31258"
FT                   /db_xref="InterPro:IPR010710"
FT                   /db_xref="UniProtKB/TrEMBL:D0IYM2"
FT                   /protein_id="ACY31258.1"
FT                   /translation="MSTELLQEQQAQQAQQLAQLAAKAEVALVWAEADQPVASPCINVC
FT                   RMTADRSHCQGCFRTIDEIRAWSKGDAELRLEIWGRLLQRAGLEDPRSAQA"
FT   gene            563606..564247
FT                   /locus_tag="CtCNB1_0513"
FT   CDS_pept        563606..564247
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0513"
FT                   /product="DSBA oxidoreductase"
FT                   /note="COG3917, NahD, 2-hydroxychromene-2-carboxylate
FT                   isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31259"
FT                   /db_xref="GOA:D0IYM3"
FT                   /db_xref="InterPro:IPR001853"
FT                   /db_xref="InterPro:IPR014440"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:D0IYM3"
FT                   /protein_id="ACY31259.1"
FT                   /translation="MKHITFYLDFVSPYAWLALEQMPKVLQGISHHIEYRPVLLGALLQ
FT                   SDANPGPAGIPAKRLWTYRQVTWLGQSLGIPLQMPAQHPFKPLPLLRLALAHGQAGSIN
FT                   RFVAQSVMQHVWDGGHEANAPQRLIDLRNLLQNQKRCEESSDEVKQWLRANTDRARQAG
FT                   VFGVPAWEVDGHVFWGLDALPMLRSYLKGDAWFESQWDAAAQVENGLNPV"
FT   gene            complement(564326..565816)
FT                   /locus_tag="CtCNB1_0514"
FT   CDS_pept        complement(564326..565816)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0514"
FT                   /product="secreted acid phosphatase"
FT                   /note="COG1169, MenF, Isochorismate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31260"
FT                   /db_xref="GOA:D0IYM4"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR007312"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:D0IYM4"
FT                   /protein_id="ACY31260.1"
FT                   /translation="MSDNNTQISPDNIHTGTELSRRSILRSAVAAGLAGGLGASLLSAC
FT                   GGGDSNESGIKTRWTPKKTVIVILENKSFSQLINNAEMPYLNQLAAAGALLTASYAAPT
FT                   PYGRIPQGGAIRASDPSNLASSSWTMGSQFVHELPARGSQTNYFYQFAGHNQGFLPDWF
FT                   ESPGSGRTTSPAAAAAYSDQYGNTMVDASGKPAPSFTTEVGLSNELVTSYPNVSLPFTT
FT                   PNLGAAIVGQGLTFATFSSSLPYPSYNEKAFNPTGVPDGYARRHNPAINWINFPVYGKT
FT                   VASNKLRFTLPVSANLAMVNTVDPDGTKYPGFAVDKDGKAASFTELPTVSLVVPNNMEN
FT                   IHTGTFKAADDWLQTHIKPYADWAKANDALLIITTDEDGVTDSSNGVANVSMDTYFGGK
FT                   TSYMYGHDPITTLFFGPSNRIKTGKFSTRVDHLNVLATVLDMYGALDQFKADFKTAWSA
FT                   ETHPINAKWAGGKDKVRQEELAAQLLSLGQPITEVFAA"
FT   gene            566010..567353
FT                   /locus_tag="CtCNB1_0515"
FT   CDS_pept        566010..567353
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0515"
FT                   /product="Di-heme cytochrome c peroxidase"
FT                   /note="COG1858, MauG, Cytochrome c peroxidase"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31261"
FT                   /db_xref="GOA:D0IYM5"
FT                   /db_xref="InterPro:IPR004852"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:D0IYM5"
FT                   /protein_id="ACY31261.1"
FT                   /translation="MRNFRFPTRITLSLVALGCGLLLGACSEGNETPASKEVGKVDKTT
FT                   AAPALSAVAQVGKKLFFDKALSASGAMSCASCHDPAHAYGPPNALAVQLGGAHLDKPGL
FT                   RAVPSLRYKLVTPAYSNELFDPDGTEPPGPGGGFSWDGRANTLAEQAAQPLLSDFEMGN
FT                   ISREAVVEKVRAASYAPLFLEVFGSRAFEDGVKAFAGITQALEAFQKEDPDFRPYSSKF
FT                   DAYVMRGKGTLTVPEQRGKAVFYDPRRGNCASCHIPDLNQFTDQMYAAIGVPRNPAILA
FT                   NAADKFYDLGLCGPLREDMKPERSLCGMFKTPTLRNVATRSVFFHNGVMTSLEQVIRFY
FT                   NTRDTNPEIWYPTKGGKPQTKPSSDFPTYGLITTQYAGGRVQKFNDLPTAYLENIDPQM
FT                   PLDGRAAASKPPMSEQDIADLICFLKTLTDGFDEAADKKQPASGACVN"
FT   gene            complement(567435..569168)
FT                   /locus_tag="CtCNB1_0516"
FT   CDS_pept        complement(567435..569168)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0516"
FT                   /product="SSS sodium solute transporter superfamily"
FT                   /note="COG4147, DhlC, Predicted symporter"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31262"
FT                   /db_xref="GOA:D0IYM6"
FT                   /db_xref="InterPro:IPR001734"
FT                   /db_xref="InterPro:IPR018212"
FT                   /db_xref="InterPro:IPR038377"
FT                   /db_xref="UniProtKB/TrEMBL:D0IYM6"
FT                   /protein_id="ACY31262.1"
FT                   /translation="MKQRISSQWLAGAAALVATAPVLAAGGDVGNAAKQATNWTAIIMF
FT                   TAFVVATLWITKWAAGRTKSASDFYTAGGGITGFQNGLAIAGDYMSAASFLGISASVMA
FT                   SGYDGLIYSIGFLVGWPILTFLLAERLRNLGRFTFADVAGYRFEQKPFRIFASCGTLVV
FT                   VAFYLIAQMVGAGQLIKLLFGLDYWIAVVLVGGLMMIYVLFGGMTATTWVQIIKACLLL
FT                   AGVTFMGFMVLAKYGFSPEALFAEGVKVRTQIAANGGAEPSVAEKLGLAIMGPGGFIKD
FT                   PISAISFGMALMFGTLGLPHILMRFFTVPDAKEARKSVFWATTWIGYFYVLIFIIGFGA
FT                   ITLVLTNPEMADTAKGVIHGGAGTANMAAVLVAKTVGGDVFYGFISAVAFATILAVVAG
FT                   LTLSGASAVSHDLYATVIKKGKADSASELKVSRITTLCLGFVAVLLGIVFEKQNIAFMV
FT                   SLAFAVAASANFPPLLLSVLWKDCTTKGAVIGGFMGLVSSVGLTIVSPSVWEGTLGNPA
FT                   GSAWFPYASPALFSMAIGFFGVWLFSVLDKSAQAAKERAVFPAQQVRSETGLGAAGASG
FT                   H"
FT   gene            complement(569165..569473)
FT                   /locus_tag="CtCNB1_0517"
FT   CDS_pept        complement(569165..569473)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0517"
FT                   /product="hypothetical conserved protein"
FT                   /note="COG3162, Predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31263"
FT                   /db_xref="GOA:A0A454Y147"
FT                   /db_xref="InterPro:IPR007436"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454Y147"
FT                   /protein_id="ACY31263.1"
FT                   /translation="MRDPVIETIQSNPAYQQLRRKRNRLGLALTVLMLIVYYGYVALIA
FT                   FDKEFLARPIGAGVTTLGIPIGMGVIIFSVIITGLYVRRANNEFDQLTRDILKGIKQ"
FT   gene            569766..571448
FT                   /locus_tag="CtCNB1_0518"
FT   CDS_pept        569766..571448
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0518"
FT                   /product="proline/betaine transporter"
FT                   /note="COG2814, AraJ, Arabinose efflux permease"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31264"
FT                   /db_xref="GOA:D0IYM8"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D0IYM8"
FT                   /protein_id="ACY31264.1"
FT                   /translation="MAINATAHMGGKSAPRPMSPEERKVIFASSLGTVFEWYDFYLYGS
FT                   LAAIIAKQFFSGLDAGSAFIFALLAFAAGFIVRPFGALVFGRLGDMIGRKYTFLVTILI
FT                   MGLSTFIVGILPNYASIGVAAPVILIALRMLQGLALGGEYGGAATYVAEHAPHGKRGAY
FT                   TSWIQTTATLGLFLSLLVILGVRTSMGEEKFADWGWRIPFLVSILLLAISVWIRMTLSE
FT                   SPAFQKMKAEGKVSKAPLTESFGQWKNLKIVILALVGLTAGQAVVWYTGQFYALFFLTQ
FT                   QLKVDAVTANLMIAAALLIGTPFFVIFGTLSDKIGRKPIIMLGCILAVLTYFPVFKALT
FT                   EAANPDLAAAQAKNKVVIVADPAECSFQFNPTGTTKFTSSCDVAKQVLAAGSVSYETEE
FT                   AAAGTQAMIRIGATEIPSFSLKGLSPEDAKAKDGAFKKTVAAELAKDGYPTKADPAKMN
FT                   KVMMVVILTYLVLLVTMVYGPIAAMLVELFPTRIRYTSMSLPYHIGNGWFGGLLPTMSF
FT                   AIVAQTGNMYNGLWYPIIIAGVTAVIGTLFVPETKDRDIYAED"
FT   gene            571708..572700
FT                   /locus_tag="CtCNB1_0519"
FT   CDS_pept        571708..572700
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0519"
FT                   /product="gram-negative type outer membrane porin protein"
FT                   /note="COG3203, OmpC, Outer membrane protein (porin)"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31265"
FT                   /db_xref="GOA:D0IYM9"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="InterPro:IPR033900"
FT                   /db_xref="UniProtKB/TrEMBL:D0IYM9"
FT                   /protein_id="ACY31265.1"
FT                   /translation="MTKMTRIALAALAVMGATTAMAQSSVTLYGRINTTVERQKVGDES
FT                   VSGLYNNASRWGIRGTEDLGGGLKAGFTLESGFNSDTGTGSAWTHPTSGMSFARQSEVN
FT                   LSGGFGMIRLGNFVPESYYATADYISMHNHDTGSSSDALYYDPVWFGGLSTKNKIGYRT
FT                   PNMGGLTVDASVSMHEKDPTVGPRKNGYDLAANYATGPLHLGAGFSKVGDNWQAALRGL
FT                   YTFGQFTVGAYYQRNDQDLIGTRNNFRLSGMYTMGASEFHVNVGHANKWSKVADSAATQ
FT                   WTLGYNYNLSKRSKVYGYYTRVNNDSGAAYNAPAGKDFSSIAVGIRHNF"
FT   gene            572921..573058
FT                   /locus_tag="CtCNB1_0520"
FT   CDS_pept        572921..573058
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0520"
FT                   /product="hypothetical protein"
FT                   /note="COG1681, FlaB, Archaeal flagellins"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31266"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454Y733"
FT                   /protein_id="ACY31266.1"
FT                   /translation="MWKLAIGFVVFAAVALFVIMKAGDKVDMSGEKHGADAIHAPAESK
FT                   "
FT   gene            573207..579143
FT                   /locus_tag="CtCNB1_0521"
FT   CDS_pept        573207..579143
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0521"
FT                   /product="excinuclease ABC, A subunit"
FT                   /note="COG0178, UvrA, Excinuclease ATPase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31267"
FT                   /db_xref="GOA:D0IYN1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR004602"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041102"
FT                   /db_xref="InterPro:IPR041552"
FT                   /db_xref="UniProtKB/TrEMBL:D0IYN1"
FT                   /protein_id="ACY31267.1"
FT                   /translation="MTQGLIRIRGARQHNLRNLDIDIRTGELTVVTGPSGSGKSSLVFD
FT                   TLYAEGQRRYVETFSAYARQFLDRMDKPAVDKVEGVPPAIAIDQTNPVRNSRSTVGTMT
FT                   EINDHLKLLFARAAQLFDSRTALPVRHDTADSIYAELAQRCEAAGDPRIAITFPVELPA
FT                   NTSAEEVEQWLSASGFTKVQAEREVERAHPAADEVAKGKKKAKPAPEKIKVLDVIADRF
FT                   RLGKAERSRAMEAIEVGLKRGSGRLTVYVLPESGVEAAEPELWKFSLGLHCPESNLTYQ
FT                   EPIPSLFSFNSAVGACDACRGFGRVIGVDWGLVIPNEKLTLRTGVIKPIQTPAWKEIQD
FT                   DLMRHSEAEGIPRDTAWSKLTREQKDWVIEGSPNWNGKWSQTWYGIRRFFEYLESKAYK
FT                   MHIRVLLSKYRSYTECPTCGGARLKTESLLWRIGGKQAADAVLPPGDDSGRYQRFMPQA
FT                   VGWSREQLDSLPGLCLHDLMRLPITRLRDFFAQLAPDSDAVKNDGEAQALKMLHAEVMT
FT                   RLQYLCDVGIGYLTLDRQSRTLSGGEVQRINLTTALGTSLVNTLFVLDEPSIGLHPRDM
FT                   ERITEAMQRLRDAGNTLVVVEHDPAVMFAADRMIDMGPGPGARGGQIVFDGTPEDLRKA
FT                   DTLTGAYLGGRKQVGFGLKRMVTESTPRLILEGAREHNLRDISVDFPLQRLVTITGVSG
FT                   SGKSTLIQDVLVPALMRHFGKPTDAAGAFERLLGADHLADVMFVDQSPIGKTARSNPVS
FT                   YVGAWDAIRELFAVAPLSRQRGYTAAKFSFNSGDGRCPTCGGSGFEHVEMQFLSDVYLR
FT                   CPDCNGTRYRPEILEVKIERNGQPLNVADVLELTVAEAALLFAQDRDVIRALQPIVDVG
FT                   LEYVKLGQPVPTLSGGEAQRLKLAGFLAEAARAQSKSKQSLAKKGTLFLFDEPTTGLHF
FT                   EDIAKLMRALRKLLEAGHSLIVIEHNLDVIRASDWLIDLGPEGGDGGGLIVAQGTPEDV
FT                   RHVQESHTAQALREYDLAMGVGGEAVREVAPMLYKPERKAKAAQALQAKNAIEIVNAKE
FT                   HNLKSLTVDVPRGKFNVVTGVSGSGKSTLAFDILFNEGQRRYLESLNAYARSIVQPAGR
FT                   PEVDAVYGIPPTVAIEQRLSRGGRKSTVGTTTEVWHFLRLLYVKLGVQHCIHDDAIVQP
FT                   QTEESIAAQLMTNFRGQTIGLLSPLVVNRKGVYTELADWARPKGYTHLRVDGEFLPTTG
FT                   FPRIDRFKEHTIELPVASVTVTAANEKELRGHLRQALEIGKGVLHVLSGIENLADAMQG
FT                   GRSTAGIGALQVFSTQRACPVCATSYAELDPRLFSYNSKHGWCPDCVGTGVKLTKDQRK
FT                   VYDDTLLADDNRGREVKFEGQEVEDLAEVVCPKCHGTRLNPVARAVKFHDEAITDIAQL
FT                   SVSDVRHWIQSLELTGREADIARDLIPEIQSRLEFLEEVGLNYLTLDRGAPTLSGGEAQ
FT                   RIRLAAQLGSNLQGVCYVLDEPTIGLHARDNQILLNALHKLGDKGNTLVVVEHDEDTIR
FT                   RADHVIDIGPSAGIRGGRLVAEGTVDDIMAAKDSVTGRYLLHAMRHPFKPRLWVGEGEP
FT                   PEQPAAINAEAADAGDMAALDKKPSKAKKKKAVAATENVVQQESDALHWLTVLGANLHN
FT                   LQSVDARVPLKRLVAVTGVSGSGKSTLARDVLLSNVAAWVQQRSTKAGRDAMDAGKSPA
FT                   LVGCKGLKGFETIDRVLEVDQTPIGKTPRSCPATYIGFWDTIRKLFAETLEAKARGYAA
FT                   GRFSFNTGEGRCPACEGQGVRTIEMSFLPDVKVPCEVCHGARFNPETLAVSWRGKSIGD
FT                   VLQMEVDEAVEFFASMPSIAHPLQLLKDVGLGYLTLGQPSPTLSGGEAQRIKLVTELTK
FT                   VRDDIGRRGQKAPHTLYVLDEPTVGLHMADVDKLIHVLHRLVDGGHSVVVIEHDLDVIA
FT                   EADWIIDLGPEGGKEGGRIVATGTPEELVKIGTHTGKALAPVLAR"
FT   gene            579159..579920
FT                   /locus_tag="CtCNB1_0522"
FT   CDS_pept        579159..579920
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0522"
FT                   /product="hypothetical protein"
FT                   /note="COG5426, Uncharacterized membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31268"
FT                   /db_xref="UniProtKB/TrEMBL:D0IYN2"
FT                   /protein_id="ACY31268.1"
FT                   /translation="MSFSSGNFPAPAELAASRVAWMAQIARPSLPPAVQAWMTWARGWK
FT                   DALPWLQLPAWREGAGNWLAMQRTTDAAGLWSQTGEYRFGLDLKASTPGDLRWIDGAVA
FT                   DGWSPHWLVLSHGLDGDPLIGDMSRPEVPVLWKWHDEPHRAARPLFASLEELMAHVQPK
FT                   AAKAPLVPRETRSSTIFYTVRLLELGNDPARVMLALRKIFTTLSAQELLKLKTRLPLTL
FT                   LDDSVSALQKDRLVQHFGGLGARVEVSERRL"
FT   gene            complement(580112..581398)
FT                   /locus_tag="CtCNB1_0523"
FT   CDS_pept        complement(580112..581398)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0523"
FT                   /product="TRAP dicarboxylate transporter, DctM subunit"
FT                   /note="COG1593, DctQ, TRAP-type C4-dicarboxylate transport
FT                   system"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31269"
FT                   /db_xref="GOA:D0IYN3"
FT                   /db_xref="InterPro:IPR004681"
FT                   /db_xref="InterPro:IPR010656"
FT                   /db_xref="UniProtKB/TrEMBL:D0IYN3"
FT                   /protein_id="ACY31269.1"
FT                   /translation="MGITLFVAIIVLLTLGFPVAFALAISAALAVFVGGRYPQLIVFKE
FT                   MFTGIDSFPLMAVPFFILAAELMSGGALTAVLLRFAAQFVGHLRGGLGYANVLSLTMFS
FT                   GISGSALADAAGPGSMMVKMMDKAGYSRPYAAALTASTAIVGPIIPPSVSMIIYALQDE
FT                   NVSVGGLFMAGFIPGILIALAMAAVNWWVCKKRDYRSTEPRPSAREMWSTSFKAIPALM
FT                   LIVLIVVGIRFGIFTPTEASVVAVFYALVCGKWVYRTLRWSALPGILARSAMLTASVLL
FT                   VMATSAAFAWVLTVEGIPQYLSELIVSWELSPVMFLIAVNILLLVFGIFMEPLPGVMIL
FT                   VPILAPIAFSLGIDPTHFAMVVIVNLTLGMITPPVGGLLFVTAVATRVSITELTREMPL
FT                   FLLAHFVVLCLLTFIPALSTWLPHTLGFQ"
FT   gene            complement(581670..582185)
FT                   /locus_tag="CtCNB1_0524"
FT   CDS_pept        complement(581670..582185)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0524"
FT                   /product="Tripartite ATP-independent periplasmic"
FT                   /note="COG3090, DctM, TRAP-type C4-dicarboxylate transport
FT                   system"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31270"
FT                   /db_xref="GOA:D0IYN4"
FT                   /db_xref="InterPro:IPR007387"
FT                   /db_xref="UniProtKB/TrEMBL:D0IYN4"
FT                   /protein_id="ACY31270.1"
FT                   /translation="MLDRIERILVAGNRWLLILLLLAMACIVFANVVLRYTTGDSIVWA
FT                   EEVARHMMIWVTFLGAGLVLRFGGHVAIDNLHRSVSARKAQAMRGFVVVVLAVFFAVMT
FT                   VTSSQYVYATRFQTTAATDIPISYIYGAMPVGFVLMLIHLLFIARGYITAGSFAESDEM
FT                   DADAAASI"
FT   gene            complement(582388..583374)
FT                   /locus_tag="CtCNB1_0525"
FT   CDS_pept        complement(582388..583374)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0525"
FT                   /product="TRAP dicarboxylate transporter, DctP subunit"
FT                   /note="COG1638, DctP, TRAP-type C4-dicarboxylate transport
FT                   system"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31271"
FT                   /db_xref="GOA:D0IYN5"
FT                   /db_xref="InterPro:IPR004682"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR018389"
FT                   /db_xref="InterPro:IPR038404"
FT                   /db_xref="UniProtKB/TrEMBL:D0IYN5"
FT                   /protein_id="ACY31271.1"
FT                   /translation="MRMIRRTFVATAVAATAALTAGTAFAQGKEVKIGYALAVNSHYGA
FT                   AANAWAEGVEKGTNGAYKFKQFPASALGGERELIEGLQLGTVEAAIVSTGALSNFVPDV
FT                   GVVDIPFLFRDTQHARAVMDGAFGQELLAKFQKRGLIALAWGEQGFRHLSNNKHAVNGV
FT                   ADLKGLKIRVTENPVHITAFRTLGASPTPMSWPEVIGALQQGTIDGQENPISVLVSAKL
FT                   WQVQKHLTLSSHVYAPMALIVSPSFWGSLNAAQKTAFTEAAKKGALASRAFVDNVEKKG
FT                   VEEAKANGMKVVEKVDQNAFRTALEPAYKEYAKKFGQKTLDSITAVK"
FT   gene            complement(583626..584426)
FT                   /locus_tag="CtCNB1_0526"
FT   CDS_pept        complement(583626..584426)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0526"
FT                   /product="HAD-superfamily hydrolase, subfamily IIB"
FT                   /note="COG0561, Cof, Predicted hydrolases of the HAD
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31272"
FT                   /db_xref="GOA:D0IYN6"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:D0IYN6"
FT                   /protein_id="ACY31272.1"
FT                   /translation="MSQEFLRPLSELQTPAKLLGVLTDIDDTLTTDGVVPEHVVAAIAR
FT                   LKDAGLKVVPITGRPVGWSVPFASAWPVDAIVAENGAVALRRNAQGGLDKLYQQSADER
FT                   ARNFARMQQVLEQIEATVPGARRATDSAGRECDIAVDHSEFTNMPQAQIDECVAIMKAA
FT                   GMNATVSSIHINGWFGEHNKLEGARWITRELFDIDLDATLARWVYIGDSTNDQQMFEHM
FT                   PHSVGVANIARFVPQLRHLPRHVTSAERGDGFVQLADQLLTQQK"
FT   gene            complement(584578..586206)
FT                   /locus_tag="CtCNB1_0527"
FT   CDS_pept        complement(584578..586206)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0527"
FT                   /product="peptide chain release factor 3"
FT                   /note="COG4108, PrfC, Peptide chain release factor RF-3"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31273"
FT                   /db_xref="GOA:D0IYN7"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004548"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR032090"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR038467"
FT                   /db_xref="InterPro:IPR041732"
FT                   /db_xref="UniProtKB/TrEMBL:D0IYN7"
FT                   /protein_id="ACY31273.1"
FT                   /translation="MSYAPETRRRRTFAIISHPDAGKTTLTEKLLLFSGAIQIAGAVKG
FT                   RKASRHATSDWMEIEKQRGISVASSVMQMSYRDHVINLLDTPGHKDFSEDTYRVLTAVD
FT                   SALMVIDAANGVESQTRRLIEVCRQRDTPIISFINKFDREVRDPLDIMDEVERELGMPC
FT                   CPITWPVGQGKSFGGIINLRTQSMTVFTPGSDRGPKDFEVIPLSEGDKLRARFGKAFDD
FT                   ALESMELAVGASAEWNHEAFLAGKLTPVFFGSGVNNFGVMEVLDAVVDMSPPPGPRVAF
FT                   TEVNRVREEKIIRPEDKGFSGVVFKVQANMDSNHRDRIAFVRVASGKYTPGMKMKVQRT
FT                   GKELRPTSVVTFMSQRREAVDEAYAGDIIGFTIHGGVQLGDSITDGPSLQFTGLPFFAP
FT                   EMFMTVVLKNPLRTKQLQQGLMQLGEEGAIQVFKPDVGGNMLLGAVGQLQFEVVQHRLK
FT                   TEYDCDVRLEGCQYTGARWITADSPAELREFENAYPMRLAHDAADTLAYLCTSPYDVRL
FT                   AQERFPKIHFHPLREHAGLALGSAN"
FT   gene            586473..587747
FT                   /locus_tag="CtCNB1_0528"
FT   CDS_pept        586473..587747
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0528"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="COG2814, AraJ, Arabinose efflux permease"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31274"
FT                   /db_xref="GOA:D0IYN8"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D0IYN8"
FT                   /protein_id="ACY31274.1"
FT                   /translation="MNSAPQDVNTSWPIQSPASAAPVWIKRGTPEYRRVSVALFLAGFA
FT                   TFSLLYCVQPLLPELVHSFAVSPAQSALALSVSTACLAGSIVLAGALSEGLGRRKLMFI
FT                   SMALAALCNLLASFMPQWHALLAARALEGLLLGGVPAVAMAYLSEEIDPPGLGFAMGLY
FT                   VGGTALGGMLGRVGMSAMTEFWGWRHAMAALSVLDLLAALGFVWLLPNSRNFVKKTGLG
FT                   ARYHLQAWGRHLRHPGLPLLFLIAFGLMGVFVSIYNYAGFLLSASPYQLSQLQISHIFY
FT                   AYLLGTAASPIAGGLADRLGRGPVLVAGTLLMAAGVVLTLLQPLAVIVLGIVLLTAGFF
FT                   IAHSVASGWVGRLATQSKGHASSLYLWGYYMGSSVLGAGAGWFWSRWGWTGVGSVALVV
FT                   LALVIVLALRVQWLAGVAAANRAAS"
FT   gene            588067..589773
FT                   /locus_tag="CtCNB1_0529"
FT   CDS_pept        588067..589773
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0529"
FT                   /product="potassium-transporting ATPase, A subunit"
FT                   /note="COG2060, KdpA, K+-transporting ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31275"
FT                   /db_xref="GOA:D0IYN9"
FT                   /db_xref="InterPro:IPR004623"
FT                   /db_xref="UniProtKB/TrEMBL:D0IYN9"
FT                   /protein_id="ACY31275.1"
FT                   /translation="MWLPWMEFAAVLTAATLLTIPMGQWLARCFTSERHGWLERLSYRV
FT                   MGVNPQERMGWQRYGTALVLSNALMMLLGYLLLRLQGALPLNPLEIAAQAPDLAFNTAA
FT                   SFITNTNWQAYSGENSLSNATQMVVITFLMFAGATTGVAAGAGFVRGLARSSSKDVGNF
FT                   WVDFVRVFWRVLLPLSFIMALVYVWQGIPQTLHTDAVATTLEGGRQQLLMGPVASLESI
FT                   KHLGTNGGGFFGMNAAHPFENPTPLTNLLHILSMLLIPAGMTYAFGSMLLRRKQGWVLF
FT                   AACMVMFVGFLSLVFVAEQNGSQLLARAGADQQYSLIQSGGNMEGKELRFGIADTALFV
FT                   ATTTAATTGSVNAMHDSLTPLGSITPLAQMMLNCVFGGDGVGLINLIQYAILTVFLAGM
FT                   MIGRTPEFLGKKIEVREIKLVMLAVLVPPACVLGFTALAVLWPDAAASLNNRGPHGFSE
FT                   ILYAYASATANNGSAFAGLNANTPFFNTTTGLAMLAGRFLTLVPMLAVAGSLAAKATVP
FT                   PGPGTFPTATPLFMGLLVFVVLVVGGLTFLPALALGPVIEHLQMLVAQLYA"
FT   gene            589838..590551
FT                   /locus_tag="CtCNB1_0530"
FT   CDS_pept        589838..590551
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0530"
FT                   /product="potassium-transporting ATPase, C subunit"
FT                   /note="COG2156, KdpC, K+-transporting ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31276"
FT                   /db_xref="GOA:D0IYP0"
FT                   /db_xref="InterPro:IPR000864"
FT                   /db_xref="InterPro:IPR003820"
FT                   /db_xref="UniProtKB/TrEMBL:D0IYP0"
FT                   /protein_id="ACY31276.1"
FT                   /translation="MKTSTQTLCASVLPSHAQAQPEAQSASWPHLLGSSVRAALLVMAI
FT                   SGIAYPLLTTGVAQALFPHAANGSLIERQGRIVGSALIGQQFTGPQYFHGRPSATVAPD
FT                   PSQEGANIAAPYNAGLSGASNQGATHKDLSEAVAQRVAQYRADNGLAAGLAVPVDAVTA
FT                   SASGLDPHISMANALLQLPRVAKARGLSPNQVQPLLAQKTEQRTLGLLGEPRVNVLQLN
FT                   LALDALQPVTSAVKE"
FT   gene            590555..592645
FT                   /locus_tag="CtCNB1_0531"
FT   CDS_pept        590555..592645
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0531"
FT                   /product="K+-transporting ATPase, B subunit"
FT                   /note="COG2216, KdpB, High-affinity K+ transport system"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31277"
FT                   /db_xref="GOA:D0IYP1"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006391"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:D0IYP1"
FT                   /protein_id="ACY31277.1"
FT                   /translation="MSTKKMTAGRSLLDAKLAKSALWDALRKLSPRTQWANPVMFVVYL
FT                   GAILSSLLWWQSLMEPGSENSGFVLAIALWLWFTVLFANFAEALAEGRSRAQAASLRGM
FT                   KRDTVAKLLQQPHFGSSWIPMRASELRKGVVIFVEAGDTIALDGTVIEGVASVDESAIT
FT                   GESAPVIREAGGDFSSVTGGTRVLSDWLVVEVTVNPGESFLDRMISMVESAKRQKTPNE
FT                   MALTILLVGLTLVFLLVIVTLWPFSAFAVSQAGTGSVVGVAVLIALLVCLIPTTIGGLL
FT                   SAIGVAGMSRMMQANVIATSGRAVEAAGDVDVLLLDKTGTITLGNRQASDFLPAPGTSA
FT                   AQLAEAAQLSSLADETPEGRSVVALARERHGLPDRSSEDFPGEFVPFTAQTRMSGVDLQ
FT                   SPQGLRSLRKGAADAVRRHVEALGGSFPAQVQLSVDNVSRKGSTPLVVADGAKVLGVIE
FT                   LKDIVKPGMRERFAELRRMGIKTVMVTGDNPLTAAAIAAEAGVDDYLAEARPEDKLQLI
FT                   RSHQAAGRLVAMTGDGTNDAPALAQADVAVAMNSGTQAAKEAGNMVDLDSNPTKLIEVV
FT                   ETGKQMLMTRGALTTFSIANDVAKYFAIIPAAFVGTYPQLASLNVMQLHSADSAILSAV
FT                   IFNALIIIALVPLALRGVQYRAVGAAILLRRNLLIYGLGGLIVPFVGIKLIDMLLAVLG
FT                   LV"
FT   gene            592732..593619
FT                   /locus_tag="CtCNB1_0532"
FT   CDS_pept        592732..593619
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0532"
FT                   /product="conserved hypothetical protein"
FT                   /note="COG4773, FhuE, Outer membrane receptor for ferric
FT                   coprogen andferric-rhodotorulic acid"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31278"
FT                   /db_xref="InterPro:IPR010239"
FT                   /db_xref="UniProtKB/TrEMBL:D0IYP2"
FT                   /protein_id="ACY31278.1"
FT                   /translation="MRLSHPQKPFHASRSWVIGSALLMLALSCAKPSAAEETKAQSASE
FT                   SSAPAQADNRSSLAGSLGLISDYRFRGISQTWQGAAVQGAVELALPKGFYLGTSLSNVS
FT                   TNSYGQGQGLEHDIYGGWRGELVPDWLLDAGLLQYRYPGARLGASDGSSKRFDTTELYL
FT                   GATHGGLSIKWSVALTPYFGLGESTAGSAFATALQPAGSSRGSQYLDLNYQHPLGDLAT
FT                   LGLHGGYTWVRNYSDVSYADWRISLSRAWGPWTASLAYAGTSADARYYSAVNSRGQWRD
FT                   LARSGWLLGLSAGF"
FT   gene            593649..596342
FT                   /locus_tag="CtCNB1_0533"
FT   CDS_pept        593649..596342
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0533"
FT                   /product="osmosensitive K+ channel signal transduction"
FT                   /note="COG2205, KdpD, Osmosensitive K+ channel histidine
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31279"
FT                   /db_xref="GOA:D0IYP3"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR003852"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR025201"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR038318"
FT                   /db_xref="UniProtKB/TrEMBL:D0IYP3"
FT                   /protein_id="ACY31279.1"
FT                   /translation="MPSSTPSSAAQRPDPDALVAQLQADRQRAHLGKLRIYFGSNAGVG
FT                   KTYSMLAAAQRERQAGRKVLVGLVETHGRAETEQQLHDLELLPRRTLVYQGRQLDEFDL
FT                   DAALARRPEVLLLDELAHSNVSGSRHPKRWQDVQELLEAGIEVWTTLNVQHLESLNDVV
FT                   GGIVGIQVHETVPDHIFDDADEVIVVDIPPEELLKRLKSGKVYPLEQAERASRNFFRQG
FT                   NLLALRELALRRTADRVDEDMRDYRRERSIGDVWPTRERLLVGVGGRAGDDALVRQVAR
FT                   LARRLEADWVVVYVDAPERQHRPRAAQEAVLKTLALAARLGAETATIPGAHVAQALVDF
FT                   ARERNASHLVLARVHEPLSRWLRWRASSLSEQIAALDPGLDVLLLSVKQSKNESTLRLP
FT                   AAREKTIPWKGYAGVTLACLAATAVAELLLRVFDPANVVMLFLLVVVLSAVRWGRGPGA
FT                   WAALLSVLLFDFYFVPPRNSFSVNDTQYLFTFSLMLGVALVCGQLTARLRHEARVAAER
FT                   ERRAGALARLARDLSGALTQEQVTQIALTTISGVFDAQTGLLVPDADERLQLAPGSEAQ
FT                   IDTSVGRWSMEHGQMAGHGTDTLAAAPALYVPLMAPVRSRGVLVLQLRAPQRLRVPEER
FT                   RLLEACASQIALALERVHFVEVAQQTQIAMEGERMRNTLLSAVSHDLRTPLTGILGAAQ
FT                   AALPHAPQGPAHHMLVQIRNQAQALQQLVDNLLAMARLQQGGVQLKREWLPVDELVGSA
FT                   LAQMRERLAAHALQTSLPADLPLLQLDAVLMERVLVNLLDNAIKYTPEGTTITVAASVA
FT                   DGDCVLSVQDAGPGLPVHLSAEQLFEPFTRGQAESAVFGMGLGLALAQRIVQAHGGRLR
FT                   VAQADPGPGTIFSVHLPVPEQPAMDE"
FT   gene            596378..597085
FT                   /locus_tag="CtCNB1_0534"
FT   CDS_pept        596378..597085
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0534"
FT                   /product="two component transcriptional regulator, winged"
FT                   /note="COG0745, OmpR, Response regulators consisting of a
FT                   CheY-likereceiver domain and a winged-helix DNA-binding
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31280"
FT                   /db_xref="GOA:D0IYP4"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:D0IYP4"
FT                   /protein_id="ACY31280.1"
FT                   /translation="MTSAAPRILLIEDDASIRRFVRLALEDEGWQVFESETARRGLIEA
FT                   ASRQPDAVVLDLGLPDADGKTVIAELRAWSQLPILILSAREREEDKVAALDAGADDYLT
FT                   KPFGVPELLARLRVMLRRRQQASAADKPGSCARFGAVVVDLAAHDVRRDGVAVHLTPIE
FT                   FRLLAALIAGHGKVLTHRQLLLQVWGAEYLDRPHYLRVHMANLRQKIELDPAQPRHLVT
FT                   ELQVGYRLVGLEG"
FT   gene            597277..598707
FT                   /locus_tag="CtCNB1_0535"
FT   CDS_pept        597277..598707
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0535"
FT                   /product="adenosylhomocysteinase"
FT                   /note="COG0499, SAM1, S-adenosylhomocysteine hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31281"
FT                   /db_xref="GOA:D0IYP5"
FT                   /db_xref="InterPro:IPR000043"
FT                   /db_xref="InterPro:IPR015878"
FT                   /db_xref="InterPro:IPR020082"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR042172"
FT                   /db_xref="UniProtKB/TrEMBL:D0IYP5"
FT                   /protein_id="ACY31281.1"
FT                   /translation="MNAAVRFNPADSAITDISLAAWGRKEIRIAETEMPGLMAVREEFA
FT                   AAQPLKGARITGSLHMTIQTAVLIETLTALGAQVRWASCNIFSTQDHAAAAIAETGVPV
FT                   YAIKGESLEDYWNYTHSIFEFGAAGTEGEGPNMILDDGGDATMLMHLGKRAEKDLSVLA
FT                   NPGSEEERIVFAAIKAKLAVDPTWYSRKSAQIMGVTEETTTGVHRLNEMSAKGTLLFRA
FT                   INVNDSVTKSKFDNLYGCRESLVDGIKRATDVMIAGKVACVAGYGDVGKGSAQALRALS
FT                   AQVWVTEIDPINALQAAMEGYRVVTMEYAADKADIFVTTTGNKDIIRHEHMVAMKDQAI
FT                   VCNIGHFDNEIDVASIEKYKWEEVKPQVDQIEFPDGKKITLLAKGRLVNLGCATGHPSF
FT                   VMSNSFANQTLAQIELFTRPDAYEVGKVYVLPKILDEKVARLHLKKVGAMLTELSDEQA
FT                   AYIGVSKQGPYKPETYRY"
FT   gene            599065..600261
FT                   /locus_tag="CtCNB1_0536"
FT   CDS_pept        599065..600261
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0536"
FT                   /product="ribosomal RNA methyltransferase RrmJ/FtsJ"
FT                   /note="COG1189, Predicted rRNA methylase"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31282"
FT                   /db_xref="GOA:D0IYP6"
FT                   /db_xref="InterPro:IPR002877"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR004538"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:D0IYP6"
FT                   /protein_id="ACY31282.1"
FT                   /translation="MRADVFLVEAGHAATRSQAQRLIASGVEWRLTPLAPWKKVAKNGD
FT                   EIPAGAELQLLDAAEAKYISRGGLKLEGALAATGLSVKGLRCLDVGQSTGGFTDCLLQA
FT                   GATQVIGIDVGHGQLHERLKNDERVVCVEGFNARALTPELLEKACDEALCEVIEEEEDN
FT                   DTQPVAPYAWMRNGGQVDEDYDDSDDAKEQDVESFKAERAAKAKARAEGLAPVELRRKP
FT                   GTENIDISPAFDFVTGDLSFISLTLVLPAVVQLLKPHGQLLMLVKPQFELQPGQIGKGG
FT                   IVRDTALYAEVEKRIRDCLGDLGLSVKQWLDSPIEGGDGNHEFFVWAQQGAEVKAPAPV
FT                   VADEAAAARPAVKAAAKRPSRADIKAQRAKQELYEDPEVASFGQPGPARSKQKKRNER"
FT   gene            600339..601166
FT                   /locus_tag="CtCNB1_0537"
FT   CDS_pept        600339..601166
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0537"
FT                   /product="5,10-methylenetetrahydrofolate reductase"
FT                   /note="COG0685, MetF, 5"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31283"
FT                   /db_xref="GOA:A0A454XU51"
FT                   /db_xref="InterPro:IPR003171"
FT                   /db_xref="InterPro:IPR004620"
FT                   /db_xref="InterPro:IPR029041"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454XU51"
FT                   /protein_id="ACY31283.1"
FT                   /translation="MSFPVSFEFFPTKTPEGAAKHVGVRQALYARKPEFCSVTYGAGGS
FT                   TQAGTFTMVRDIQNEGVGAASHFSCIGATHEKVRAELNELKAMGVKRIVALRGDLPSGY
FT                   GLGGEFQYASDLVAFVRQEFGDWFHIEVAAYPETHPQAKSPRSDLDAFVAKVRAGADSA
FT                   ITQYFYNADAYMRFVDEVRALGLDVPVVPGIMPITSSTQLMRFSDACGAEIPRWIRLRL
FT                   QAFGDDTASIRAFGLDVVTHLCEQLRSQGAPGLHFYTMNQSVATLEICDRLGL"
FT   gene            601240..601983
FT                   /locus_tag="CtCNB1_0538"
FT   CDS_pept        601240..601983
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0538"
FT                   /product="rare lipoprotein A"
FT                   /note="COG0797, RlpA, Lipoproteins"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31284"
FT                   /db_xref="GOA:D0IYP8"
FT                   /db_xref="InterPro:IPR009009"
FT                   /db_xref="InterPro:IPR012997"
FT                   /db_xref="InterPro:IPR034718"
FT                   /db_xref="InterPro:IPR036908"
FT                   /db_xref="UniProtKB/TrEMBL:D0IYP8"
FT                   /protein_id="ACY31284.1"
FT                   /translation="MQPKFWRLRCCQWIGLAVVTATMAGCAPLQEKPEEQPPVAQSQPR
FT                   KKGAQPTVSAPLLPDAYARSNYRDKGLGVKANKPADADKADLPEDSNKYELSPPRESDQ
FT                   AGLASWYGEQFHGRKTASGERFDSMDMTAAHKTLPFGTRVCVRSSVTGKSVVVRINDRG
FT                   PFAPGRVIDLSKAAAQELGMLGLGIKPVELWQLDADEDECPATLNASGKKRHPSVAQGV
FT                   SVSKTRAASANQPARKVSQTAKRKR"
FT   gene            complement(602072..602938)
FT                   /locus_tag="CtCNB1_0539"
FT   CDS_pept        complement(602072..602938)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0539"
FT                   /product="ComJ"
FT                   /note="COG2961, ComJ, Protein involved in catabolism of
FT                   external DNA"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31285"
FT                   /db_xref="GOA:A0A454XPH2"
FT                   /db_xref="InterPro:IPR007473"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454XPH2"
FT                   /protein_id="ACY31285.1"
FT                   /translation="MFSYRHAFHAGNHADVLKHTVLIATVQYLTQKEAALTVLDTHGGA
FT                   GLYRLDGDYASKSGEAEEGVLRLAAAKEAELAPVLQDYLQMVRRFNQGNAIRNYPGSPF
FT                   ITQALLRGHDRLKAFELHPTDMRSLTGNMAQLEVRRQVAILHEDGFEGVKKFLPPPSRR
FT                   ALLLCDPSYELKTDYGRVLDMAADGLKRFPTGTYAVWYPIIPRPEAHDLPKRLKTMATK
FT                   AGKSWLHATLTVKSNKTSERGGLPASGMFLINPPFNLKDQLKPAMPQLVKLLGQDSNAG
FT                   FTLESGG"
FT   gene            603271..603699
FT                   /locus_tag="CtCNB1_0540"
FT   CDS_pept        603271..603699
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0540"
FT                   /product="ribosomal protein L13"
FT                   /note="COG0102, RplM, Ribosomal protein L13"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31286"
FT                   /db_xref="GOA:A0A454XVM0"
FT                   /db_xref="InterPro:IPR005822"
FT                   /db_xref="InterPro:IPR005823"
FT                   /db_xref="InterPro:IPR036899"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454XVM0"
FT                   /protein_id="ACY31286.1"
FT                   /translation="MSTFSAKPAEVQHEWFVIDATDKVLGRVASEVALRLRGKHKAIYT
FT                   PHVDTGDYIVIINASKLKVTGTKNLDKVYYRHSGFPGGITATNFRDLQAKFPGRALEKA
FT                   VKGMLPKGPLGYAMIKKLKVYGGAEHPHTAQQPKALEI"
FT   gene            603710..604102
FT                   /locus_tag="CtCNB1_0541"
FT   CDS_pept        603710..604102
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0541"
FT                   /product="ribosomal protein S9"
FT                   /note="COG0103, RpsI, Ribosomal protein S9"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31287"
FT                   /db_xref="GOA:A0A454XME2"
FT                   /db_xref="InterPro:IPR000754"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020574"
FT                   /db_xref="InterPro:IPR023035"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454XME2"
FT                   /protein_id="ACY31287.1"
FT                   /translation="MIGDWNNGTGRRKSSVARVFLKKGSGKITVNGKDIQQYFGRETSI
FT                   MIAKQPLVLTENLETFDIQVNVHGGGESGQAGATRHGITRALIDYDAALKPALSQAGFV
FT                   TRDAREVERKKVGLHSARRAKQFSKR"
FT   gene            604314..604679
FT                   /locus_tag="CtCNB1_0542"
FT   CDS_pept        604314..604679
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0542"
FT                   /product="iron-sulfur cluster assembly accessory protein"
FT                   /note="COG0316, IscA, Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31288"
FT                   /db_xref="GOA:A0A454Y5S6"
FT                   /db_xref="InterPro:IPR000361"
FT                   /db_xref="InterPro:IPR016092"
FT                   /db_xref="InterPro:IPR017870"
FT                   /db_xref="InterPro:IPR023063"
FT                   /db_xref="InterPro:IPR035903"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454Y5S6"
FT                   /protein_id="ACY31288.1"
FT                   /translation="MSAVAETTTTEMPSPIVFTDSAAAKVADLIAEEGNPDLKLRVFVQ
FT                   GGGCSGFQYGFTFDEITNDDDTTMTKNGVSLLIDSMSYQYLVGAEIDYKEDLQGAQFVI
FT                   KNPNASTTCGCGSSFSV"
FT   gene            604798..606222
FT                   /locus_tag="CtCNB1_0543"
FT   CDS_pept        604798..606222
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0543"
FT                   /product="drug resistance transporter, EmrB/QacA"
FT                   /note="COG2814, AraJ, Arabinose efflux permease"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31289"
FT                   /db_xref="GOA:D0IYQ3"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR004638"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D0IYQ3"
FT                   /protein_id="ACY31289.1"
FT                   /translation="MGEMPAAHHSAPHKERLLWLVAIGFFMQSLDATILNTALPAMATE
FT                   LGESPMKMQSVIVAYALTTAMLIPATGWVADRFGTRRVYGWAIGLFVLGSVLCALSPSL
FT                   PFLIAARVVQGVGGAMMLPVGRLAVLRTYPRGEFIRAMSFIAIPGQVGPLLGPTLGGWM
FT                   VEYASWHWIFWINVPVGLIGLWATWRWFPRSAPVPVHRFDGKGYAMLAFGMVAISIALD
FT                   GLSGMGLGMALVVVLMVFGLASLASYWMHALRVDEPLFAPGLFKVRSLRVGLLGNLFTR
FT                   FGSGAAPFLIPLMLQVGLKMSPMNAGLMMLATVTGSMLVKRIAVRTVQRFGYKRVLQVN
FT                   SVMLAVMLASFGLVVPGTPVWLLLVQLFIFGGFNSMQFSAMNSVTLKDMEGESASSGNS
FT                   LLSMVQMLAMSMGVALAGALLTGFSDMWPAHSDERMQAIRATFVTVALMTLAATLVFSQ
FT                   LDADEPVRPAPDGGDA"
FT   gene            606541..608145
FT                   /locus_tag="CtCNB1_0544"
FT   CDS_pept        606541..608145
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0544"
FT                   /product="molybdopterin dehydrogenase, FAD-binding protein"
FT                   /note="COG4630, XdhA, Xanthine dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31290"
FT                   /db_xref="GOA:D0IYQ4"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR002346"
FT                   /db_xref="InterPro:IPR002888"
FT                   /db_xref="InterPro:IPR005107"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR012175"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR014307"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="InterPro:IPR036683"
FT                   /db_xref="InterPro:IPR036884"
FT                   /db_xref="UniProtKB/TrEMBL:D0IYQ4"
FT                   /protein_id="ACY31290.1"
FT                   /translation="MSTSQNSQPIRFFHRGEVVEVQGPHPTRSVLQWLREDAHCTGTKE
FT                   GCNEGDCGACTVVIGELAEAGDTEAVNGLRLQTVNACIQFLPSLHGKALFTVEDLKSQC
FT                   AGKSACAGKPAGPQSLHPVQQAMVECHGSQCGFCTPGIVMTLWSAYEHHQQQGSEPTRQ
FT                   QLADELSGNLCRCTGYRPILDAGQRMFDLPAVRLDTAPVVAALQGLQAGNAGLNYAAPQ
FT                   GLRTDFFHAPRTLADLAGLCEAKPKARIVAGSTDVGLWVNKQFRDLGDMIYVGDVAEMK
FT                   RIEVRPDAEGGELYIGAGASLESAWSALVQRWPSLTDVWLRFASTPIRHAGTMGGNVAN
FT                   GSPIGDSPPVLMALDAQIELRKGERVRRMPLTDFYLDYMKNQLEPGEFVQALAVPLAAM
FT                   QRQVRGYKISKRFDCDISALCAGFAIELDGEIVQSIRLAFGGMAATVKRAAAAEAALLG
FT                   KPWSLENVKAAQAALAQDFKPMSDMRASADYRLKVAQNLIQRLWLETRADQPQGTDATS
FT                   VWSVMPHVVPAAVEQGV"
FT   gene            608147..610573
FT                   /locus_tag="CtCNB1_0545"
FT   CDS_pept        608147..610573
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0545"
FT                   /product="aldehyde oxidase and xanthine dehydrogenase"
FT                   /note="COG4631, XdhB, Xanthine dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31291"
FT                   /db_xref="GOA:D0IYQ5"
FT                   /db_xref="InterPro:IPR000674"
FT                   /db_xref="InterPro:IPR008274"
FT                   /db_xref="InterPro:IPR014309"
FT                   /db_xref="InterPro:IPR036856"
FT                   /db_xref="InterPro:IPR037165"
FT                   /db_xref="UniProtKB/TrEMBL:D0IYQ5"
FT                   /protein_id="ACY31291.1"
FT                   /translation="MNNPLELTNELVAEAFADYRKNQAYRIDEVTEAKAHDQGARVGVS
FT                   RKHESAHLHVAGEAAYIDDLPELEGTLHCALGLSPVAHGRLTALALEAVRAMPEVVEVI
FT                   TAADIPGVNDCGSIIHDDPILCDGEIRYVGQPLFAVIARSRDAARRAAALAKAAATISE
FT                   LPPVLTPRKAHELGQYVMPPMHLERSTHEGGARAAMDAAPHRLKGSFDVGGQEQFYLEG
FT                   QISYATPKEDGAVHIHCSTQHPSEMQHLVAHALGVASHSVHVECRRMGGGFGGKESQSA
FT                   LFACVAAVAAIRLQKPVKLRLDRDDDFMITGRRHCFWYEYEVGYDDEGRVLGAEISMVS
FT                   RAGHSADLSAPVMTRALCHFDNTYWLPDVLMHGYMGKTNTQSNTAFRGFGGPQGAIAIE
FT                   NILDTVARSLGRDPLDVRRVNFYGKGERNITPYEQVVTDNVIHELVAELEESSDYRARR
FT                   AAVNAFNAGSAVLKRGLALTPLKFGISFNVAHFNQAGALVHIYTDGSILVNHGGTEMGQ
FT                   GLNTKVAQVVAHELGVAFENVRVTATDTSKVANTSATAASTGADLNGKAAQDAARQLRE
FT                   RLAECAARLHGGDAHDVRFANNAVQVNGQNVPFAELVRAAYLQRVQLWSDGFYATPGLH
FT                   WDGKRMKGHPFFYFAYGAAVSEVVIDTLTGEWKLLRADVLHDVGRSLNPAVDVGQVEGA
FT                   FIQGMGWLTTEELVWHPQTGKLTTHAPSTYKIPTANDCPPVFNVRLFEGDNYEDSIHRS
FT                   KAVGEPPLLLPFSVFFAIRDAVSAAGEHRMNPPLQAPATSEAILRAVEAVQGHTG"
FT   gene            610737..612038
FT                   /locus_tag="CtCNB1_0546"
FT   CDS_pept        610737..612038
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0546"
FT                   /product="Xanthine/uracil/vitamin C permease"
FT                   /note="COG2252, Permeases"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31292"
FT                   /db_xref="GOA:A0A454XS87"
FT                   /db_xref="InterPro:IPR006043"
FT                   /db_xref="InterPro:IPR026033"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454XS87"
FT                   /protein_id="ACY31292.1"
FT                   /translation="MNWTERIFKLREHNTNVRTELVAGLTTFLSMAYIMFVNPSILGDA
FT                   GMPKGSVFVATCLIAALGSTIMALYANYPIALAPGMGLNAYFAYVVVLKMGYTWEAALG
FT                   AVFVSGCLFLICTMLGLRELIIKGIPQSIRVSITVGLGLFLALIALKTAGVVAADQNTY
FT                   VTLGDLHKPEVIMALLGFLLIVVLDRLKVPGALLIGILAVTVASFFFGGNTFHGIFSAP
FT                   PSIEPTFMKLDIKTALTTGFLNVVLVFFLVELFDATGTLMGVARRAGLLVPERMGRFNR
FT                   SLLADSGAIFVGSILGTSSTTAYVESAAGVQAGGRTGLTALTVAMLFLACLFIAPLAGV
FT                   VPGYATAPALLFVACLMLRDLTEVQWDETTEAIPAVVTALMMPFTYSIANGLAFGFITY
FT                   AVLKLCTGKVKEVHWIMWVIAALFLFKFIYVGGH"
FT   gene            612438..613442
FT                   /locus_tag="CtCNB1_0547"
FT   CDS_pept        612438..613442
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0547"
FT                   /product="putative sulfonate/nitrate transport system"
FT                   /note="COG0715, TauA, ABC-type
FT                   nitrate/sulfonate/bicarbonate transportsystems"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31293"
FT                   /db_xref="InterPro:IPR015168"
FT                   /db_xref="UniProtKB/TrEMBL:D0IYQ7"
FT                   /protein_id="ACY31293.1"
FT                   /translation="MHTWEKKVDKRRFLLAGPSWLAMAAAGITGAAHAAVDAKTRLVVA
FT                   DQSELIRHLLDASGERKKTGFQLELPNFAGGPAIFEAIRAGALDMAYVGDTPPIQARAA
FT                   GVNLPIIATFTRARAEYRLLQHAGAGVERLSDLRGKRVSYVEGSGRQVFLIEALNRAGL
FT                   TLKDVTLVHLRVAELNDALRARAVDVATIAEPHVTRLSRQIGARVVPDPLERQLLPSTS
FT                   YIYARPEVLADPQKAEAIREFLASFVRAGRWSNTHRKEWEQHYLRNFQRLDAESAAAIQ
FT                   AAQAPLEFQTAAQAVPHHQKLIDILHSAGSLPRRLDARDSFVASYDGVIVANR"
FT   gene            613455..614312
FT                   /locus_tag="CtCNB1_0548"
FT   CDS_pept        613455..614312
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0548"
FT                   /product="ABC transporter membrane subunit"
FT                   /note="COG0600, TauC, ABC-type
FT                   nitrate/sulfonate/bicarbonate transportsystem"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0548"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31294"
FT                   /db_xref="GOA:D0IYQ8"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D0IYQ8"
FT                   /protein_id="ACY31294.1"
FT                   /translation="MTPIPLEARVAGWQSQTGAPLAVPDRKAPALVPARLSPGMLLAGP
FT                   ALLLLVWEAASRLGYLSSETLTAPSQALRTGYEMALDGSLLPHLLASAGRAYTGLFLGI
FT                   VVGVLLALVAGLSRSGEALIDGLVQIKRAVPTLALIPLAIIWLGIGEAMKVFLIFTAVL
FT                   IPIYINTHAALRSIDIGHVELAQTLGLSRAEFIRKVALPGALPGFFVGLRMAVSLCWTA
FT                   LVVLELINTQTGIGYLMNRARDWGQTDVIVVGILIYALLGLLSDAAVRRLEAHVLSYRR
FT                   SLGS"
FT   gene            614324..615034
FT                   /locus_tag="CtCNB1_0549"
FT   CDS_pept        614324..615034
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0549"
FT                   /product="ABC transporter"
FT                   /note="COG1116, TauB, ABC-type
FT                   nitrate/sulfonate/bicarbonate transportsystem"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31295"
FT                   /db_xref="GOA:D0IYQ9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017875"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D0IYQ9"
FT                   /protein_id="ACY31295.1"
FT                   /translation="MTGTVQLHGFSRSFHGKQVLDDLHLDIASGQFVALLGESGSGKTT
FT                   LLRALAGLDAEARSSGAALAHGNVSVLFQDSRLLPWLTVLDNLTLGLDAQAARPAAVQL
FT                   LREVGLEDKAGAWPATLSGGQKQRAALARSLLREPHVLLADEPFGALDALTRMRMQGLL
FT                   RRMVERIRPTVILVTHDVDESLLLADRILVLRDGKIAEDHALDLAHPRRPDHPAFMQLR
FT                   TTLLRSLGVEAEFS"
FT   gene            615048..616400
FT                   /locus_tag="CtCNB1_0550"
FT   CDS_pept        615048..616400
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0550"
FT                   /product="putative monooxygenase"
FT                   /note="COG2141, Coenzyme F420-dependent N5"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31296"
FT                   /db_xref="GOA:D0IYR0"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR016215"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:D0IYR0"
FT                   /protein_id="ACY31296.1"
FT                   /translation="MTRQLHLNLFLMTRGHHEGAWRHPGANRKALTDLELYVDAARIAE
FT                   AAKFDAVFLADGLVGPDNGQMASSGQLEPLLLLAALAQHTERIGLIGTASTTYSLPYTL
FT                   ARQFATLDHLSKGRAGWNIVTSWLPRAGENYGLQQNVEHAERYRIAEEFVAAVDALWRS
FT                   FPGGAVVDDAESGQFLDIGQVRPVNYAGTHIRTRGPLNVPGSPQGRPMLVQAGQSETGR
FT                   AFAAQWAEAIFTAHGSKESAQGFYADIKGQAKALGRRAEDIVILPGISAAIGSTEYEAR
FT                   QVWEELDSLTSIDVGLGRLSARFGGHDFSSLPLDRRLTRDDFPDPALVEASRSRAMGYV
FT                   ETTLRDGLTLRQLLKRLAGARGHLAIAGTPEQVADTIEDWFRTGAADGFNVMPPVITQQ
FT                   LELFASEVVPILRKRGLFRSDYQSSTLRGHFGLPDLPVVQHKAQADAAVAA"
FT   gene            complement(616429..617568)
FT                   /locus_tag="CtCNB1_0551"
FT   CDS_pept        complement(616429..617568)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0551"
FT                   /product="metalloprotease"
FT                   /note="COG2377, Predicted molecular chaperone distantly
FT                   related to HSP70-fold metal loproteases"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31297"
FT                   /db_xref="GOA:D0IYR1"
FT                   /db_xref="InterPro:IPR005338"
FT                   /db_xref="UniProtKB/TrEMBL:D0IYR1"
FT                   /protein_id="ACY31297.1"
FT                   /translation="MPNAIEQAAQSNLYIGLMSGTSLDGVDGVLVDFSQGTRVLQHASC
FT                   GFDAALRAELLALNTAGGQDELHRAALAANALVRHYAQVVQQLLTAAGVRAGQIAAIGA
FT                   HGQTVRHRPQMFDGTGYTLQLNNPALLAELTGISVVADLRSRDVAAGGQGAPLVPAFHQ
FT                   SVFGRPAETALVLNIGGIANLSVLGADGSVLGFDTGTGNALMDGWCLRHTGRSYDESGR
FT                   WAASGKVLPELLAAMLGDPYLAQQPPKSTGRDLFHAEWLERHLQQHAAQAAAVDVQATL
FT                   AEFTAASCAHAVQRFGRGGTELLVCGGGALNTYLMQRLAALLPGVKVASTAECGLPPLE
FT                   VEAAAFAWLARQCLLGLPGNLASVTGASGPRILGAIHPA"
FT   gene            complement(617710..619068)
FT                   /locus_tag="CtCNB1_0552"
FT   CDS_pept        complement(617710..619068)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0552"
FT                   /product="peptidase M23B"
FT                   /note="COG0739, NlpD, Membrane proteins related to
FT                   metalloendopeptidases"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31298"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="UniProtKB/TrEMBL:D0IYR2"
FT                   /protein_id="ACY31298.1"
FT                   /translation="MTGLKNAGGALLARLTSALQKHPKRATAALATVLLTGGSGAFAVA
FT                   SLGPDPADLPVRTLTEPVTSLAAGQDLADLTDLQSFSLYRSEYTRSNDTTESLLQRLGI
FT                   ADPQAAAFMRSNEAVRQNVLGRAGRLVSAETTPDQQLSQLTVRWAPSEDGSFQRLTVER
FT                   VDGKLQSKIETGKLTASPRLAGGVIRSSFFAATDASDIPDSVSMQMADIFQGELDFRRG
FT                   LRKGDRFAVVYESLEADGEPLRAGRVLSTEFYNNGKSHQAMWFQEAGKKGAYYTLDGKS
FT                   LRQAYLNYPVEFSRISSGFSMRVHPIQKTWRAHLGTDFAAPTGTKVRTVGDGVVSFAGV
FT                   QNGYGNVIFVDHANQHTTVYAHLSRIDVKRGQRVDQGDIIGAVGSTGWATGPHLHFEFR
FT                   DKGEQRDPLTIAQITDAAQPISKAARPAFEQQAAQMRIELNAGTQSFALASTR"
FT   gene            619260..620492
FT                   /locus_tag="CtCNB1_0553"
FT   CDS_pept        619260..620492
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0553"
FT                   /product="tyrosyl-tRNA synthetase"
FT                   /note="COG0162, TyrS, Tyrosyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31299"
FT                   /db_xref="GOA:D0IYR3"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002305"
FT                   /db_xref="InterPro:IPR002307"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR024088"
FT                   /db_xref="InterPro:IPR024108"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:D0IYR3"
FT                   /protein_id="ACY31299.1"
FT                   /translation="MNQSAVTSFPVTDRVNQALEVTLRGVDELLPKDEWVQKLARSEAT
FT                   GVPLRIKLGLDPTAPDIHLGHTVVLNKMRQLQDLGHQVIFLIGDFTTLIGDPSGRNSTR
FT                   PPLTAEQIKVNAETYYTQAAKVLDPARTEVRYNSEWCDQLGARGMIQLSAKYTVARMME
FT                   RNDFHTRFTDGSSISLHEFLYPLLQGYDSVALKSDLELGGTDQKFNLMMGRHLQAEYGQ
FT                   DQQCVLTMPLLVGLDGVHKMSKSKNNYIGITEDANTMFAKVLSISDELMWDWYTLLSFK
FT                   SLAEIAALKAEIEAGGNPKHAKVALAKEITARFHSAEAADAAEQDFINRSKGGIPDDIP
FT                   EISLSGAPLGIGALVKQANLAASTGEANRLIDGGGVRVDGNVISDRALKLDAGTFVLQV
FT                   GKRKFARVTLS"
FT   gene            complement(620681..621661)
FT                   /locus_tag="CtCNB1_0554"
FT   CDS_pept        complement(620681..621661)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0554"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="COG0583, LysR, Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31300"
FT                   /db_xref="GOA:D0IYR4"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D0IYR4"
FT                   /protein_id="ACY31300.1"
FT                   /translation="MPHATTSPTPLLRTRAIGAGHLRAFLAVARHLNFRAAADELALTQ
FT                   SAVSRQIQSLEDEVGIPLFLRHSRAVELTGAGAQLLHAVQPALESIDATVRQIRQTVGR
FT                   KSVAITTWASFAAMWLIPRLEAFQRAYPDIDIRIDTGDAVVDLETTDVDLAIRYSAGVS
FT                   DASAKALFGEELVLVASPALLRSGPAVHSPADAARYTLIETGDVHRMPQLEWLSWQRWF
FT                   AANGCDQLQPPRWLYFNYAHQIVQAALAGQGLAIARLPLVADALAAGTLIEVLPEHRLA
FT                   SPLSYWLLQGPRSSERPEVQAFCQWLMEQARQTRDAMQGASEPTQ"
FT   gene            621766..623214
FT                   /locus_tag="CtCNB1_0555"
FT   CDS_pept        621766..623214
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0555"
FT                   /product="UDP-N-acetylglucosamine pyrophosphorylase"
FT                   /note="COG1207, GlmU, N-acetylglucosamine-1-phosphate
FT                   uridyltransferase(contains nucleotidyltransferase and
FT                   I-patchacetyltransferase domains)"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31301"
FT                   /db_xref="GOA:D0IYR5"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005882"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR038009"
FT                   /db_xref="UniProtKB/TrEMBL:D0IYR5"
FT                   /protein_id="ACY31301.1"
FT                   /translation="MTAPLDIVVMAAGKGTRMKSRHPKVLQKLAGRALLQHVLDTAAQL
FT                   KARSAVVVTGHGAAEVEAAIAAANGADGADGTHGAMDLKFVRQEPQLGTGHAVQQAVPA
FT                   LKDDGLVVVLSGDVPLTRADTLQGLLDAAGSDKMALLTVTMPDPTGYGRIVRNDAGTVQ
FT                   RIVEQKDASEAERAITEIYSGIMAVPARHLTAWLAKLDNNNAQGEYYLTDIVAMAVADG
FT                   VPVVGHRIADALQVAGVNSPLQLAELERAHQLRQARELMEQGVRMADPARFDLRDDARG
FT                   AKASLSCGQDVEIDVNCIFAGKVTIGAGARIGANCHLSNVSIADDAVIHPFTHIDGEKA
FT                   GVEVGQGALVGPFARLRPGAKLGREVHIGNFVEVKNSVLADGAKANHLAYLGDATVGER
FT                   VNYGAGSITANYDGVNKHRTVIEADVHIGSNCVLVAPVTIAAGGTVGGGSTVTKNTEAG
FT                   ALTVGRGRQVSISNWKRPEKLPKA"
FT   gene            623214..624011
FT                   /locus_tag="CtCNB1_0556"
FT   CDS_pept        623214..624011
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0556"
FT                   /product="Proline sensor PrlS"
FT                   /note="COG2205, KdpD, Osmosensitive K+ channel histidine
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31302"
FT                   /db_xref="GOA:D0IYR6"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D0IYR6"
FT                   /protein_id="ACY31302.1"
FT                   /translation="MEQAQQALESMAPQSLGEALALLARREAELSALRTAQQEWMHAVS
FT                   HDLRAPLRHLLAFNPLVAELLQSASPGAEDLEEARSFLQTMDQSAQRMAAMFDGLLQLN
FT                   RAQSHVLQPQPVDLLALLGSLRQRLQAGAQGRRIEWCLPAVAPMLQADPRLLEQALDAA
FT                   LANAVKFTRAVPLARIQVDVQRDGQGGCFITVADNGAGFEQARSGKLFGVFQRMHREAE
FT                   FEGLGIGLALVRDICRRHGGEAEIQAQLNAGCQLQMHWPTCLP"
FT   gene            complement(624016..625095)
FT                   /locus_tag="CtCNB1_0557"
FT   CDS_pept        complement(624016..625095)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0557"
FT                   /product="diguanylate cyclase"
FT                   /note="COG2199, FOG: GGDEF domain"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0557"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31303"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR007894"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:D0IYR7"
FT                   /protein_id="ACY31303.1"
FT                   /translation="MALGGAVVAASLSYLPTNLAWWAFTTVSALVWPHIAFLHSSRQQD
FT                   QFHAEYFNSLIDALIVGCWISLMHWSLLPSICILAIGVADRFYTGLKRRWLPSLIALLC
FT                   GMLFMSIAIRPTPQWAAPLAVQLSLLPLIILHSAYASWSNSRMLKTLARQNLQLKLLGR
FT                   IDPLTTVYSRDYWWKKARAALHQHRTAKEQTCLLVIDIDRFKSVNDLYGHIVGDDVLKM
FT                   IGLAIRNSLRSNDIAGRYGGDEFTVLCKHTTAKEAYSVAMRICEKIAQIRIREYPQLHI
FT                   SASIGVAAADEGFGSVTEWIKAADSALYSAKSGGRDQVMDATQQPERQHSPSTMPMRPE
FT                   STRISPASAEQESLDRDVV"
FT   gene            complement(625277..625777)
FT                   /locus_tag="CtCNB1_0558"
FT   CDS_pept        complement(625277..625777)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0558"
FT                   /product="transcriptional regulator, AsnC family"
FT                   /note="COG1522, Lrp, Transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31304"
FT                   /db_xref="GOA:D0IYR8"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D0IYR8"
FT                   /protein_id="ACY31304.1"
FT                   /translation="MNENSINLDDTDLQLLQQLQLDSSLSNQALARHLELSAPTCLRRV
FT                   KRLQELGLIEKQVAILSSEHIARLTGHGLQAIVEVSLDRQDSSSLLQFEHKAVAEPGVQ
FT                   QCWRVSPGPDFILVIATIDMPAYLALSQKLFTQDANVRNVKAFFSIKRAKFSTELPLPV
FT                   SNH"
FT   gene            625914..627830
FT                   /locus_tag="CtCNB1_0559"
FT   CDS_pept        625914..627830
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0559"
FT                   /product="glucosamine--fructose-6-phosphate"
FT                   /note="COG0449, GlmS, Glucosamine 6-phosphate synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31305"
FT                   /db_xref="GOA:D0IYR9"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR005855"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR035466"
FT                   /db_xref="InterPro:IPR035490"
FT                   /db_xref="UniProtKB/TrEMBL:D0IYR9"
FT                   /protein_id="ACY31305.1"
FT                   /translation="MCGIVAAVSHRNIVPVLVQGLQRLEYRGYDSCGVAVQAADASGLS
FT                   LGLQRARSTARVAELMEQVKTEHVEGFTGIAHTRWATHGEPAVRNAHPHFSHGPGISPV
FT                   ADADAPARVALVHNGIIENYEALRTELQAKGYVFASQTDTEVIAHLVDSLYNGDLFEAV
FT                   QAATARLHGAYAIGVMHRDEPRRVVGARAGSPLILGVGKDGAEHFLASDAMALAGVTDQ
FT                   IVYLEEGDLIDLQPGRYWVISKSGERLTEQQRPVRTVMAHSGAAELGPYRHYMQKEIFE
FT                   QPRALGDTLEGLKNIAPELFDGVTSEGKTGAAAWRVFKEIDRVLILACGTSYYSGCTAK
FT                   YWIEAIAGIPCNVEVASEYRYRTSVPDPKTLIVTISQSGETADTLAALRHAQSLGMKHS
FT                   LTICNVATSAMVRECELAYITRAGVEIGVASTKAFTTQLAGLFLLTLALAQSKGRLTEE
FT                   KEQQYLTAMRHLPVALQSVLALEPQIISWAEDFAKKENALFLGRGIHYPIALEGALKLK
FT                   EISYIHAEAYPAGELKHGPLALVDSQMPVVTVAPNDELLEKLKSNMQEVRARGGVLYVL
FT                   ADAKTNIESSEGMHVIRMPENYGALSPILHVVPLQLLAYHTAVARGTDVDKPRNLAKSV
FT                   TVE"
FT   gene            complement(628230..629525)
FT                   /locus_tag="CtCNB1_0560"
FT   CDS_pept        complement(628230..629525)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0560"
FT                   /product="TRAP dicarboxylate transporter, DctM subunit"
FT                   /note="COG1593, DctQ, TRAP-type C4-dicarboxylate transport
FT                   system"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31306"
FT                   /db_xref="GOA:D0IYS0"
FT                   /db_xref="InterPro:IPR004681"
FT                   /db_xref="InterPro:IPR010656"
FT                   /db_xref="UniProtKB/TrEMBL:D0IYS0"
FT                   /protein_id="ACY31306.1"
FT                   /translation="MNEITASIALIVVLLALLGGGVWVGLTLAGVAWFGMEFFTARAAG
FT                   DAMAMTIWGSASSWTLTALPLFVWMGEILYRTNLSESMFRGLAPWVNALPGRLLHTNVI
FT                   GCTIFAAVSGSSAATCATVGKMNVPELRKRGYPENMVIGSLGGPATLGLLIPPSIILIV
FT                   YGVSAELSISKLFMAGVLPGIMLALMFSGWIVVWALMNPDKVPKADSTMSFKQKVYESR
FT                   HLIPVVLLISGVIASIYSGIATATEAAGIGVMGALILSALQGALSWKNFKESLFGATRL
FT                   YCMIALILAGAAFMTLSMGYIGLPRQLAEYVGSLNLSPAMLIAVLGLFYILIGCFLDGI
FT                   STIVLTSGVVLPIIQAAGIDPLWFGIFLVITVETAQITPPVGFNLFVLQGMTGKQITYL
FT                   ARVCAPYFLLMVLALVILWFFPQIVTVLPNNM"
FT   gene            complement(629518..630024)
FT                   /locus_tag="CtCNB1_0561"
FT   CDS_pept        complement(629518..630024)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0561"
FT                   /product="transmembrane protein"
FT                   /note="COG3090, DctM, TRAP-type C4-dicarboxylate transport
FT                   system"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31307"
FT                   /db_xref="GOA:A0A454Y0B6"
FT                   /db_xref="InterPro:IPR007387"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454Y0B6"
FT                   /protein_id="ACY31307.1"
FT                   /translation="MRKLLNGLYDGSAWLAGIAMIGVLAMVLLTITSRLFGFSAPGTDA
FT                   YAGYAMAGAGFMALASTLKKGEHIRVTLLLGALKGRAYKALELTALGIATILSAFLAFY
FT                   STRLVWQSWEIEDISVGIDATPLWIPQIFMALGTIVFFIAFCDELVLELLGKRKAVEKE
FT                   GTPHE"
FT   gene            complement(630104..631087)
FT                   /locus_tag="CtCNB1_0562"
FT   CDS_pept        complement(630104..631087)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0562"
FT                   /product="TRAP dicarboxylate transporter-DctP subunit"
FT                   /note="COG1638, DctP, TRAP-type C4-dicarboxylate transport
FT                   system"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31308"
FT                   /db_xref="GOA:D0IYS2"
FT                   /db_xref="InterPro:IPR018389"
FT                   /db_xref="InterPro:IPR038404"
FT                   /db_xref="UniProtKB/TrEMBL:D0IYS2"
FT                   /protein_id="ACY31308.1"
FT                   /translation="MKRRIFCATATLLAGIGIAGHAMAQTKWDFATAYGPGNFHSKNNE
FT                   LFVKDVDAATGGKLKITPHFGASLFKMPEIKRAVQTGNAQMGEFFLVSFQNESQIFGAD
FT                   GLPFLVSNYDEAYKLYQAQKPALQKLLDKQGQVLLYSVAWPPQGIYTKKPVNSAADLKG
FT                   MKWRVYSPTTARIGELIGAQPVTVQEAELSQALATGVVDGLITSSATGADNKLFESLKY
FT                   YYNVQAWIPKNAVTVSKKAFGALDKSTQEAVLKAAAAAEQRGWKESREVDARSIAALKQ
FT                   GGMQVEQPSAQLKADLGKIGATVIKEWTDKAGADGQAILDGYKAGK"
FT   gene            complement(631259..631936)
FT                   /locus_tag="CtCNB1_0563"
FT   CDS_pept        complement(631259..631936)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0563"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="COG1802, GntR, Transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0563"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31309"
FT                   /db_xref="GOA:D0IYS3"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D0IYS3"
FT                   /protein_id="ACY31309.1"
FT                   /translation="MKVAAEVQNLTERIAEEIRSQLVKGVLSPGQRLSEAALSEALDIS
FT                   RNTLREVFRMLTKEGLLVHEPNKGVSVAVPSMASIIDIYRVRRMIECQALAQAYPMHPA
FT                   LTRMREAVESGQRHSEAEDWSEVGTANMAFHKAIVALADSERLNEMFSHLLAELRLAFG
FT                   LLRDPHFLHAPYVSMNLKILQIFEAGRPAEAAQELSAYLVHSERIILAAYARRLAEAGI
FT                   KAP"
FT   gene            632230..632949
FT                   /locus_tag="CtCNB1_0564"
FT   CDS_pept        632230..632949
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0564"
FT                   /product="gluconate permease"
FT                   /note="COG3819, Predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31310"
FT                   /db_xref="GOA:D0IYS4"
FT                   /db_xref="InterPro:IPR010374"
FT                   /db_xref="UniProtKB/TrEMBL:D0IYS4"
FT                   /protein_id="ACY31310.1"
FT                   /translation="MPVDVNLWPLIGVLIIIAGFALRFNPMLVVIVTAIGTAFAAGFPL
FT                   DKVLAAIGTGFIKTRNLPLIILLPLAVIGLLERHGLRQHAQNWISSIKSATAGRLLIVY
FT                   LAARQLTAAIGLTSLGGHPQMVRPLLAPMAEGATENRYGKLSGKVREKLRAMSAATDNV
FT                   GLFFGEDIFVAFGAIVLMTTFLKEAGIEVEPIHVALWGIPTAISAFAIHAFRLHRLDKQ
FT                   LAREITAEKKSAQGEQA"
FT   gene            632946..633899
FT                   /locus_tag="CtCNB1_0565"
FT   CDS_pept        632946..633899
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0565"
FT                   /product="hypothetical membrane protein"
FT                   /note="COG3817, Predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0565"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31311"
FT                   /db_xref="GOA:D0IYS5"
FT                   /db_xref="InterPro:IPR009323"
FT                   /db_xref="UniProtKB/TrEMBL:D0IYS5"
FT                   /protein_id="ACY31311.1"
FT                   /translation="MTITIQYLYYLVGLVLAVTAVMTLRDGSNPRRFSAGLFWALYALV
FT                   FLVGDLLPPVWVGAVAVVMALIAGFGGVMGGKHQPRTDAQYLESAKRLGNKLFVPALAI
FT                   PLITMVGTLSAKHLVFGGTPLIDPKNSTLVSLGIGCVIALVLACKMTRETPVQGLRESH
FT                   RLIDALGWALVLPQMLGMLGLVFSDAGVGKAVAYVTTTYINMDVRFVAVAVYVIGMALF
FT                   TVIMGNGFAAFPVMTGGVGVPVLVGVYHGDPAVMAAVGMLSGYCGTLLTPMAANFNLVP
FT                   AALLEIDKNAVIRAQVPTAITLLIVNVFLLNFLMFR"
FT   gene            633912..634574
FT                   /locus_tag="CtCNB1_0566"
FT   CDS_pept        633912..634574
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0566"
FT                   /product="pyrrolidone-carboxylate peptidase"
FT                   /note="COG2039, Pcp, Pyrrolidone-carboxylate peptidase
FT                   (N-terminalpyroglutamyl peptidase)"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0566"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31312"
FT                   /db_xref="GOA:D0IYS6"
FT                   /db_xref="InterPro:IPR000816"
FT                   /db_xref="InterPro:IPR016125"
FT                   /db_xref="InterPro:IPR029762"
FT                   /db_xref="InterPro:IPR033693"
FT                   /db_xref="InterPro:IPR033694"
FT                   /db_xref="InterPro:IPR036440"
FT                   /db_xref="UniProtKB/TrEMBL:D0IYS6"
FT                   /protein_id="ACY31312.1"
FT                   /translation="MTEAAHRILLTGFEPFDKDSVNPSWEVARALDGELIADGVVHAVQ
FT                   LPCVFGAAMVALDEALARLQPTLIISLGLAGGRSEITPERVAINIDDARIPDNAGHQPV
FT                   DQSVVRDAPAAYFSTLPIKAMVRHLRDAGIPASVSNTAGTFVCNHVFYALMHRLSRRAG
FT                   PGVRGGFIHIPALPQQAARQPGMASMALNTQIQGIRTAIHTAMTVQQDLLEHAGQLH"
FT   gene            634592..635362
FT                   /locus_tag="CtCNB1_0567"
FT   CDS_pept        634592..635362
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0567"
FT                   /product="LamB/YcsF"
FT                   /note="COG1540, Uncharacterized proteins"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0567"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31313"
FT                   /db_xref="GOA:D0IYS7"
FT                   /db_xref="InterPro:IPR005501"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:D0IYS7"
FT                   /protein_id="ACY31313.1"
FT                   /translation="MMKMDLNSDLGESFGAWRMGDDAAMLDIVSSANVACGFHAGDPAG
FT                   MLTTLRAAKARGVVVGAHVAYRDLSGFGRRNMDVASGDLVADVIYQIGALQGLAQAAGT
FT                   SVQYVKPHGALYNTIAQDKRQAMDVINAIKAINPKLVLMALAGAPLIAWARDAGLCVVA
FT                   EAFADRGYTPDGALVSRREPGAVLHDENLIAQRMLTLVREGVIEAVDGSLVRVEADSIC
FT                   VHGDSPGAVAIARNIRQRFEQEGVQITSFVETAP"
FT   gene            635359..636987
FT                   /locus_tag="CtCNB1_0568"
FT   CDS_pept        635359..636987
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0568"
FT                   /product="urea amidolyase related protein"
FT                   /note="COG1984, DUR1, Allophanate hydrolase subunit 2"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0568"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31314"
FT                   /db_xref="GOA:D0IYS8"
FT                   /db_xref="InterPro:IPR003778"
FT                   /db_xref="InterPro:IPR003833"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:D0IYS8"
FT                   /protein_id="ACY31314.1"
FT                   /translation="MSSMRFLPVNRQAILVELADLQQTLVLLGALQAQPIEGVQELVPA
FT                   ARTILVQFAPHIIGAAQLVRRIADCDLSGSVQRSDVLVQIPVRYDGEDLAEVAQILGIT
FT                   AEEVVSRHTGSEWSVAFTGFAPGFAYLSGGDPIFNVPRRATPRTKVPAGAVALAGSFSA
FT                   VYPQASPGGWQIIGVTDAAMWDLARDLPALLQPGYRVQFVDAATQKVAAGDFSDSISDG
FT                   KVSETKSEQAQAATSFNGCALRVRATGLLTMFQDMGRHGQAGQGVSASGAMDQAAFKTA
FT                   NRLVGNASQLPVLETVGGGLSLQSVGENVVAVTGADAPISITTADGRRWSAPRHAAIAL
FT                   ADGDTLSLAQPVAGARCYVAVRGGYEVAPVLGSASTDTLAHVGPPALHSGQLLAVLPAA
FT                   HAVVAELALPAQDLPAPDGEVVLDVELGPRTDWFTPEAVALLAAQRWQVTPQSNRVGLR
FT                   LAGEQALTRAVTSELPSEGTPLGAIQVPASGQPVLFLADHPLTGGYPVIGCVAPHHLDL
FT                   AGQIPVGAWIRFNPVRSFEELTPTL"
FT   gene            637025..638857
FT                   /locus_tag="CtCNB1_0569"
FT   CDS_pept        637025..638857
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0569"
FT                   /product="carbamoyl-phosphate synthase L chain"
FT                   /note="COG4770, Acetyl/propionyl-CoA carboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0569"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31315"
FT                   /db_xref="GOA:D0IYS9"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001882"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005481"
FT                   /db_xref="InterPro:IPR005482"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR011764"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:D0IYS9"
FT                   /protein_id="ACY31315.1"
FT                   /translation="MAKTAAQQLFHQIAGPAQQAAAVSHPCLTLPEVATMITKVLIANR
FT                   GEIAVRIARACADYGVKSVAVYADADIDALHVRRADEAYGLDGDKPADTYLNIAKLIAI
FT                   ARRSGADAVHPGYGFLSESEAFAQAVLDAGLIWIGPRPDTIAKLGDKVEARKIALQVGA
FT                   PLVAGTPDPVKDADEVLAFAQQHGLPIIIKAAFGGGGRGMKIAWRMDEVAELYASAVRE
FT                   AVTAFGRGECFVEQFLDKPRHIEAQVIADTHGNVVVLGTRDCSLQRRNQKLVEEAPAPF
FT                   ITEAQRERIHSAAKAICAQAGYVSAGTVEFLLSGNGAISFLEVNTRLQVEHTVTEETTG
FT                   IDLVQEQLRVADGLPLSFTQTPAPRAHSIEFRINAEDVGRGFLPTPGLITRFAPPSGPG
FT                   VRLDSGVETGSVIPGTFDSMMAKLIVTGATREQALARARRALAEFRIEGVASVLPFHKA
FT                   VLNQADFVGTAGFNVHTRWIETEFAEPLAAAARAEPVADTSLLRTAIEIDGRRVQLGLP
FT                   AMLLQGLSAPTTGVSQTAAQQSVDPEAVISPIAGNLHAWKVADGDEVKEGDVIAVMEAM
FT                   KMEMQVSAHKSGRVTLAAQAGSAQTLGAVIAHIR"
FT   gene            639034..641517
FT                   /locus_tag="CtCNB1_0570"
FT   CDS_pept        639034..641517
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0570"
FT                   /product="heavy metal translocating P-type ATPase"
FT                   /note="COG2217, ZntA, Cation transport ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0570"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31316"
FT                   /db_xref="GOA:D0IYT0"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR006122"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR017969"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:D0IYT0"
FT                   /protein_id="ACY31316.1"
FT                   /translation="MNALTKSGAFELSVEGMTCASCVGRVERALKKVPGVQEAVVNLAT
FT                   EKASLTVADPAQAAAILPQAVAAIEKAGYAVPAQSVDLQVGGMTCASCVGRVERALKKV
FT                   PGVQNAVVNLATERASVQLQGSVDVSSLIAAIEKAGYEAQPVLHNVAATGEDAAAQRQA
FT                   QERESLKRSLIFATVFALPVFLLEMGGHMVPAFHHWIAGSIGTQNSWYIQFALTAVVLF
FT                   GPGRRFFEKGVPALLRAAPDMNSLVAVGTSAAFAYSVVATFVPQWLPAGTVNVYFEAAA
FT                   VIVALILLGRFLEARAKGNTSEAIRRLVQLQAKTARVRRDGQVLEIDIAQVRAGDVIEV
FT                   RPGERIPVDGEVIEGRSFVDESMISGEPVPVEKVEGAEVVGGTVNQNGALAFRATKVGA
FT                   DTLLAQIIRMVEQAQGSKLPIQALVDKITMWFVPAVMAAALLTFVIWLVWGPDPALSFA
FT                   LVNAVAVLIIACPCAMGLATPTSIMVGTGRAAQMGVLLRKGEALQQLKDARVVAVDKTG
FT                   TLTRGRPELTDLVLADGFERAAVLARVAAVEDRSEHPIARAIVDAAKAEGLEVPAISDF
FT                   ASVTGFGVRAVVLGDQVEIGADRFMRELGLSVDGFAAEAQRLGSEGKTPLYAAIGGKVA
FT                   AMIAVADPIKPSTKPAIDALHALGLKVAMITGDNRHTAEAIARQLGIDEVVAEVLPGGK
FT                   VESVKRLKAEHGTLAYVGDGINDAPALAEADVGIAIGTGTDIAIEAADVVLMSGDLSGV
FT                   PNAIALSKATMKNIGENLFWAFAYNVALIPVAAGLLYPFNGMLLSPVFAAGAMALSSVF
FT                   VLSNALRLKRFKPAL"
FT   gene            complement(641575..642282)
FT                   /locus_tag="CtCNB1_0571"
FT   CDS_pept        complement(641575..642282)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0571"
FT                   /product="riboflavin synthase, alpha subunit"
FT                   /note="COG0307, RibC, Riboflavin synthase alpha chain"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0571"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31317"
FT                   /db_xref="InterPro:IPR001783"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR023366"
FT                   /db_xref="InterPro:IPR026017"
FT                   /db_xref="UniProtKB/TrEMBL:D0IYT1"
FT                   /protein_id="ACY31317.1"
FT                   /translation="MFTGIIQAVAKIAALRDQDGLRTFIMEFPEGFCQDLAIGASVSHD
FT                   GVCLTVTENLSPTSASFDVMLQSLNITTLGSYKAGDTLNVERAARDGAEIGGHPLSGHV
FT                   DFTAPLLEVMQTETNHKIRFGIPEAFRPYVFAKGYIAVNGASLTVAEVNRKEGWFEVWL
FT                   IPETLRMTVFGDKKVGDLVNIEIERSTQVVVDTVRETVEASLGRLKPVLEALLQEKGLS
FT                   LDDFVDVPQLPKQ"
FT   gene            complement(642376..643251)
FT                   /locus_tag="CtCNB1_0572"
FT   CDS_pept        complement(642376..643251)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0572"
FT                   /product="conserved hypothetical protein"
FT                   /note="COG4801, Predicted acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0572"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31318"
FT                   /db_xref="UniProtKB/TrEMBL:D0IYT2"
FT                   /protein_id="ACY31318.1"
FT                   /translation="MDMELTQNFLRGKNPCAMGYRWFVRNNLAGGDYQAAMDTQVAAGR
FT                   VEDARWLLENFGSTNSVLELEHLEADHFVYAGTLIVHGDVRVTGQLLVGRSLQAGGGIR
FT                   AGKLEAGEEIQCGGAIFAAKLLQAGGSIKAAWSVEVEGELRAEDLRCGWELRGGGHVKL
FT                   KGNAHIGQEVQVQGDMHCGKGLKAGGAIEVQGLLDVGHGIAGNDGILCGNHIQAGWGIK
FT                   AQGDIRAACSIRSGETLQADGEIAAGPGYGVFAGMNVQMQAWPDCAWVRALKKPEALIS
FT                   GFWEGRPAFA"
FT   gene            complement(643389..643568)
FT                   /locus_tag="CtCNB1_0573"
FT   CDS_pept        complement(643389..643568)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0573"
FT                   /product="hypothetical protein"
FT                   /note="COG1363, FrvX, Cellulase M and related proteins"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0573"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31319"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454XUA7"
FT                   /protein_id="ACY31319.1"
FT                   /translation="MACLHLSTAARLRRSALAAELPARACVLRALHTRRHGIPTAFVSL
FT                   SGVTAMLSAAVRMA"
FT   gene            complement(643763..645001)
FT                   /locus_tag="CtCNB1_0574"
FT   CDS_pept        complement(643763..645001)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0574"
FT                   /product="aminotransferase, class I and II"
FT                   /note="COG1167, ARO8, Transcriptional regulators containing
FT                   a DNA-bindingHTH domain and an aminotransferase domain
FT                   (MocR family)and their eukaryotic orthologs"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0574"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31320"
FT                   /db_xref="GOA:D0IYT4"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D0IYT4"
FT                   /protein_id="ACY31320.1"
FT                   /translation="MSRDSALAPFAAVFAEPAGSPIRELFPYLSRPGMISLAGGYPSPS
FT                   LFDAEGLAQAAAQAMTQGPGALQYGATEGLSELREALAQQARERGMHATAADILVTTGS
FT                   QQAFDLLVRVLVEPGDTVLVEVPAYPATLQALRLAQARILPVPMDEQGLQTEALADLLG
FT                   TLPAGQRPKLLYTVPNFSNPRGTLLAQERREALVQLARQHGFWVIEDDPYGELRFDEPG
FT                   DVPQAMPGTVRAAGERLAEPGSNPVIYLSSLSKTVAPALRVGWMLADAPLMRRCTVAKQ
FT                   TADLCTSPLTQSVAACYLASGRYPATVQRARQEYQRRMQALVQGLNAAPDSGIRCSRPA
FT                   GGMFVWAELDRRIDPQKLFDAAVALGVIYVPGKAFYPAAPDLHTLRMSFAAPEVPQIAQ
FT                   AVERLCQAAAQSR"
FT   gene            complement(644998..646500)
FT                   /locus_tag="CtCNB1_0575"
FT   CDS_pept        complement(644998..646500)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0575"
FT                   /product="hypothetical conserved protein"
FT                   /note="COG5383, Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0575"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31321"
FT                   /db_xref="InterPro:IPR009770"
FT                   /db_xref="UniProtKB/TrEMBL:D0IZ71"
FT                   /protein_id="ACY31321.1"
FT                   /translation="MTAQNMLHIPAAPPAARPFHEPLPFCFVMSATPHASSTAARFVSV
FT                   DEIRTRFSRAMSEMYRKEVPQYGTLIDLVADVNAVALQADPELRQRMNSSGELERLDVE
FT                   RHGAIRVGTAEELATLRRLFAVMGMEPVGYYDLSVAGVPVHSTAFRPVHDEALLANPFR
FT                   VFTSLLRLELIADEALRAQAAEILERRRIFTPRALELIAQAERDGGLDSSDADAFVQQA
FT                   LETFRWHSDATVDAATYKALQKAHRLVADVVCFKGPHINHLTPRTLDIDMAQADMPARG
FT                   MDAKDVVEGPPQRACPILLRQTSFKALKEAVRFTDADANADSSGAHTARFGEIEQRGVA
FT                   LTRKGRALYDELLGLVRGIDSAGSAAPDYAHRLQQVFTQFPDTHEQLRRQGLAFYRYRL
FT                   TEQAQASLAQSPAGADLEALIDRGLVQAEPITYEDFLPVSAAGIFQSNLGGEEQKQYQA
FT                   HAAQQVFESALGARVHDEIALYEASEQQSRAQVLAMLSGAAA"
FT   gene            646617..647504
FT                   /locus_tag="CtCNB1_0576"
FT   CDS_pept        646617..647504
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0576"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="COG0583, LysR, Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0576"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31322"
FT                   /db_xref="GOA:D0IZ72"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D0IZ72"
FT                   /protein_id="ACY31322.1"
FT                   /translation="MSLLCAFEASARHQSFTAAAAELHLTQSAVSRQIRALEERLGTEL
FT                   FVRERQTVRLSAAGQAYAQEIRAALARISNATLGFRTNPQGGSLNLAILPTFGTRWLAP
FT                   RLPQFFSAHPGITINLTTRLSQFDFQLEAVDAAIHFGLPNWPGAELEFLMSETVVPACS
FT                   PDVAARHGFARPQDLLRAPLLHLASRPDAWQRWFGSQGCQGGDMQGMLFDQFATAAQAA
FT                   IAGVGVALLPKFLILRELQAGDLVQALPQLPEVQSAERYYLAWPTSRSTYPPLQAFQGW
FT                   LKQVAQEFASSAPL"
FT   gene            complement(647631..648542)
FT                   /locus_tag="CtCNB1_0577"
FT   CDS_pept        complement(647631..648542)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0577"
FT                   /product="amino-acid ABC transporter binding protein ybeJ
FT                   precursor"
FT                   /note="COG0834, HisJ, ABC-type amino acid transport/signal
FT                   transductionsystems"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0577"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31323"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454XMV8"
FT                   /protein_id="ACY31323.1"
FT                   /translation="MRLMTANITLACTALVAAMAASGVQAQTASGSTLEKLQKTGKVVI
FT                   GVRESSAPMAYAIGANHRFTGYHVELCEKVLAQIAPSAKIEYMAITAQNTMPLVQNGTV
FT                   DLGCGPTTNNLSRQKQVSFAVTTYVSQVRMAVRADSPVTSFKQLDGKTVAASAGTTAVQ
FT                   LLRKYSHDNNVKLPTQLGKDHFESFLMLESGRADAFVLDDNLLAGVIANSKDPRGYKIV
FT                   GEALGSEPIALLMRKDDPGFKKAVDDALVRMMKSGEVAKIYDKWFMQPIPPKEMPLNLP
FT                   MSETLKQLLQAPNDKPLEAYNS"
FT   gene            complement(648687..648980)
FT                   /locus_tag="CtCNB1_0578"
FT   CDS_pept        complement(648687..648980)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0578"
FT                   /product="hypothetical protein"
FT                   /note="COG2211, MelB, Na+/melibiose symporter and related
FT                   transporters"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0578"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31324"
FT                   /db_xref="UniProtKB/TrEMBL:D0IZ74"
FT                   /protein_id="ACY31324.1"
FT                   /translation="MQSHSVAPLRAALREPKTEPDQAAATRPALAAQGWTRRKRCARAC
FT                   ATGADITQKARSAVPLWLCRVGCRTWIRAAGSYAASMTFFRFIVMKPLPFAG"
FT   gene            649008..649685
FT                   /locus_tag="CtCNB1_0579"
FT   CDS_pept        649008..649685
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0579"
FT                   /product="conserved hypothetical protein"
FT                   /note="COG0544, Tig, FKBP-type peptidyl-prolyl cis-trans
FT                   isomerase(trigger factor)"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0579"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31325"
FT                   /db_xref="InterPro:IPR021212"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454XKP4"
FT                   /protein_id="ACY31325.1"
FT                   /translation="MTANTPPSFLSRIAIAIGSFFAILGNGRLAADVSRVRAGEAFAAD
FT                   VAPREVRVEVPVEKIVEVRVEVPVEKIVEKTVEKRVEVPVEKLIEKTVEVEKLVATDSA
FT                   ALQLLGLMQREARFVDFIQEDVAPYTDAEIGAAARVVHEGCRKVLREHFTLSPVCSEAE
FT                   GSRITLQAGFDAAAVRLTGNVVGQPPFTGTLSHRGWLVTQVKLPQLTDIQAAKVIAQAE
FT                   VEL"
FT   gene            649689..651665
FT                   /locus_tag="CtCNB1_0580"
FT   CDS_pept        649689..651665
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0580"
FT                   /product="putative molecular chaperone protein HspA/DnaK"
FT                   /note="COG0443, DnaK, Molecular chaperone"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0580"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31326"
FT                   /db_xref="GOA:D0IZ76"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="UniProtKB/TrEMBL:D0IZ76"
FT                   /protein_id="ACY31326.1"
FT                   /translation="MNMFASIAASGAASQAASTPDSVAAAAQPQGPAGQADALSAGASY
FT                   SIGIDLGTTHCALSYVNKTVSDGEKVVQGVLDIPQLTAPGSVEARPLLPSFLYLPHESE
FT                   LTEAERSLPGAPGDFITGEFARSRGAATPIRLVSSAKSWLCHPGVDRRAGILPADAPEE
FT                   VSRISPLTASTRYLEHLRRAWEQAHPEAPFAQQDITVTIPASFDPAARELTAEACKAAG
FT                   FARLTLLEEPQAALYSWIQASGGQWRKQVKHGDIILVVDVGGGTTDLSLIAVLERDGNL
FT                   ELQRIAVGEHILLGGDNMDLALAYGVARKLAAEGKQLDAWQTRALAHGCRAAKEQLLAD
FT                   ASLQAVPVVVPSRGSKLIGGSIRTEVTRDEVLAMLVEGFFPKVAVSDKPKTRARGALTQ
FT                   LGLPYAQDAAVTRHLAAFLSRQVHALAEIEGLDGDQIDGSTFLHPTAILFNGGVLKAPQ
FT                   IEQRILEVINGWLDDEACEPARLLDGANLDLAVARGAAYYGHIATSGRGVRIRGGTAQS
FT                   YYVGVESNMPAIPGMEPPLSALCLAPFGMEEGTEVALPDEEFGLVVGEPVRLRFFGSSV
FT                   RRTDQVGTMLDFWSPEELVELQEIELNLPAAGRAAGEVVPVTLAARVTDIGTLELNAVP
FT                   VGGSERWKVEFDVRAETSAEAAE"
FT   gene            complement(651915..652859)
FT                   /locus_tag="CtCNB1_0581"
FT   CDS_pept        complement(651915..652859)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0581"
FT                   /product="gram-negative type outer membrane porin protein"
FT                   /note="COG3203, OmpC, Outer membrane protein (porin)"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0581"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31327"
FT                   /db_xref="GOA:D0IZ77"
FT                   /db_xref="InterPro:IPR002299"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="InterPro:IPR033900"
FT                   /db_xref="UniProtKB/TrEMBL:D0IZ77"
FT                   /protein_id="ACY31327.1"
FT                   /translation="MQIYGRLNTSVEHQKVGNSSLTGLFNNNSRFGFVGSEDLGGGLKA
FT                   GFQLESGFESDTGAGTGSTGALAFQRQSEVNLSGSLGKLRLGRFGAATYFGIADYGALD
FT                   EPNHDTGSIADALYDYVMRNTNKIAYRSPVMAGLTLEAQASLHEKTTGAVQKNGYDLYA
FT                   NWERGPLALGAGFTQLGDDRQFALRGHYIWNALQIGAYYQRSDNGSGSLCSNGGTGCGT
FT                   RDAARVTAAYRVGASELALGYGWASRWSHVPGSSARQWILGYNHHLSKRTKLYAAYTRI
FT                   DNGAGVAYGYNFKGGVGYGQDASSLSIGLRHAF"
FT   gene            653017..656016
FT                   /locus_tag="CtCNB1_0582"
FT   CDS_pept        653017..656016
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0582"
FT                   /product="DnaK-related protein"
FT                   /note="COG0443, DnaK, Molecular chaperone"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0582"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31328"
FT                   /db_xref="GOA:D0IZ78"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="InterPro:IPR021030"
FT                   /db_xref="UniProtKB/TrEMBL:D0IZ78"
FT                   /protein_id="ACY31328.1"
FT                   /translation="MPATVHCFGQLSSQQQLIPAGGSGIRLLLRSATEFYVSPPQPMHS
FT                   SRPTYAVGIDLGTSHTVVASVALDAATSDIALLDIPQRSTAGEVVAQPLLPSVRYQAAQ
FT                   GELGEAWRQPWPPQGADEAAPAVIGCWARDLGAAVPGRLVASAKSWLSHTGVDRTAAIL
FT                   PWGAGEDVAKVSPLAASSSYLAHVKAAWDQARPEAPLHQQSVVLTVPASFDEGARALTL
FT                   EAAQMAGLPRVQLLEEPKAAFHDWLVLQGDELAAQLADSRLVLVVDVGGGTTDLTLIRV
FT                   DASADGSLPTLTRTAVGEHLMLGGDNMDLALAHQLEPAFAHKAPDQGQRLSAQRFAQLV
FT                   QRCRMAKEQLLAQNAPEQIGITLLGGGSKLLAATQSVTLTREQVRQSVVEGFLPVAQIS
FT                   DMPARRQGALRGFGLPYPADAAISRHLAHFLAQHASEGLPDTVLLNGGVFHAHAMVQRL
FT                   TQLLGRWRGSPVRVLHNPHPDWAVARGAAAYGLARHQAELSVAQIAMPNPPEARAGQAS
FT                   AAIKTMVPRIGGGSARSYWLLLPGKRGEAPQGLCLLPRGTEEGVRMVLSGRRFALKLGQ
FT                   AVRFNVLANSLSHVPAQAGQIAALIGEGWVELPPLATVLPAPEGRAAAQVEVQLQACMS
FT                   EVGTLEVRCVAVQDAGQSWLLPFAVRAASASEPIADSAGEQGAEGPKQSDSLAARLPEA
FT                   VALVERIFGTQAQEVTTREVRQLRQSLERVLGPREGWELGLLRALFDVLLARSRRRRRT
FT                   ADHERVWLNLAGWCLRPGVGAQLDGWRIDQVWALYGQGLGHAKEGANWTEWWVFWRRVA
FT                   AGLNEARQMELLEDVAGHMQKAVQQNTRGKSSHGSYDDMLRLFAAMEAVPWQYRQEMGQ
FT                   WMLQRLRREDETVQTWWAIGRLAARQSLAANAHLVMPPDAALEFLNATLAQDWRKNETA
FT                   MFAAVQMARMTGDRARDLPDAVRAQVLEKMRSSGAPERWMAMVEQVVQMEAEDHRRSLG
FT                   DSLPPGLVLL"
FT   gene            656212..657240
FT                   /locus_tag="CtCNB1_0583"
FT   CDS_pept        656212..657240
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0583"
FT                   /product="TctC"
FT                   /note="COG3181, Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0583"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31329"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:D0IZ79"
FT                   /protein_id="ACY31329.1"
FT                   /translation="MKFEEAARTEMARNAVFISANQRRSLLLAAAAAVMVAPLTQALAQ
FT                   GGNWPAKPITFVVPQAPGGANDVIARAVAQGLENSLGQPVIVENRAGANGNLGTGQVAR
FT                   SAADGYTFLVTAQSAYTINPALYSRVPFDPIKDFTPVMQLAVAPYLLVVNPSFPARNLD
FT                   ELVAYAKAHPGKVEYASAGNGTLNHLLGEMLKKQKNVSLLHVPYKGASAAATDVVAGQL
FT                   PVTFGSFPGVMPFVSSGKLRVLGVASDRPTSLAPEIPVLGKGLAVTSWYGLFAPAGTPQ
FT                   PVVDKLHQAVKTVLARPEMAERLKTLGAERVESTPQSFKAMLPAELAYWKQVVKDSGAH
FT                   ID"
FT   gene            657305..657679
FT                   /locus_tag="CtCNB1_0584"
FT   CDS_pept        657305..657679
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0584"
FT                   /product="cyclolysin secretion ATP-bindingprotein cyaB"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0584"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31330"
FT                   /db_xref="GOA:D0IZ80"
FT                   /db_xref="InterPro:IPR021257"
FT                   /db_xref="UniProtKB/TrEMBL:D0IZ80"
FT                   /protein_id="ACY31330.1"
FT                   /translation="MTLLIAAVIAIGLASRRGYMPFPAWLGNYPGDALWAWVVLLCVAW
FT                   LRPAITRGKLMGCSLAIAFAIEFLQLYQAPWMQALRANKLAYLVLGNGFDPLDLLAYVV
FT                   GIGVGAMVDRLWERRQRRLA"
FT   gene            657717..659012
FT                   /locus_tag="CtCNB1_0585"
FT   CDS_pept        657717..659012
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0585"
FT                   /product="response regulator receiver and ANTAR domain
FT                   protein"
FT                   /note="COG3707, AmiR, Response regulator with putative
FT                   antiterminatoroutput domain"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0585"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31331"
FT                   /db_xref="GOA:D0IZ81"
FT                   /db_xref="InterPro:IPR005561"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013587"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:D0IZ81"
FT                   /protein_id="ACY31331.1"
FT                   /translation="MTTSTTPMKTPLHYLVAARQSEIAELEQISRASSLVASMSELVHA
FT                   LQKERGLSNIFLVSGGAQAQQSLLDHGRHVDRVMERVCLALEELGARAPGAHGARLFNA
FT                   IANALQGFEALPLLRRRRDALQLSAEDCTQALIRMIAACLTVVFEAADSACDPDIAKLL
FT                   VALFHFMQGKELAGQERATGVAAFTVGVGKSERQRHWLHLIESQERCFQVFADFASPSG
FT                   MERWQQQCGACPDMTVIERLRRMGCTAGDGVLLDRSLSSPWFEACSSRLDAMHQIEAFL
FT                   AEELQAQCLCKLEQARTALCQQKALLEMQPQPGTRAEAAAAFLGATQPAASLPAEGAYG
FT                   LQLEKSIVLLVQEQSMRLQDMQTEIDKARATLKERKTIERAKGVLMNYRQLGEGDAYKL
FT                   IRQTAMNQNRRMLDVAEAILATVDLLPGSTNS"
FT   gene            659272..660546
FT                   /locus_tag="CtCNB1_0586"
FT   CDS_pept        659272..660546
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0586"
FT                   /product="Twin-arginine translocation pathway signal"
FT                   /note="COG0715, TauA, ABC-type
FT                   nitrate/sulfonate/bicarbonate transportsystems"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0586"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31332"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="UniProtKB/TrEMBL:D0IZ82"
FT                   /protein_id="ACY31332.1"
FT                   /translation="MSQRLPSSTVPAPEPVSAGGRREFLRVAGAAALYGTLGHHGAWAA
FT                   GSDAPEKKEVRIGFIPLTDCASVVMASVLGFDQKYGVKIVPSKEASWAGVRDKLVNGEL
FT                   DFAHVLYGLVYGLHLGVGGPKKDMAVLMGLNNNGQAITLSKALADKGAVDGASLAKVMA
FT                   REKREYTFAGTFPTGTHAMWMHYWLAAAGINPLSEAKLITVPPPQMVANMRVGNMDGFC
FT                   VGEPWNHRAIMDGIGITANTTQDIWKDHPEKVLGTTGEFAQKNPNTCRAVMMAILEASR
FT                   WIDASLQNKTKMAETVAQKSYINTSVDAINQRILGRYQNGLGKTWDDPNHMKFFNDGAV
FT                   NFPYLSDGMWFLTQHKRWGLLKAHPDYLAVARQINRIDLYQQAASQLKVSVPKDVLRTS
FT                   KLIDGVVWDGKNPAQYADSFKIKAA"
FT   gene            660573..661565
FT                   /locus_tag="CtCNB1_0587"
FT   CDS_pept        660573..661565
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0587"
FT                   /product="nitrate ABC transporter, inner membrane subunit"
FT                   /note="COG0600, TauC, ABC-type
FT                   nitrate/sulfonate/bicarbonate transportsystem"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0587"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31333"
FT                   /db_xref="GOA:D0IZ83"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR005889"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D0IZ83"
FT                   /protein_id="ACY31333.1"
FT                   /translation="MVSAVLHSPLELDPPHDPQLAAQVANDALLETSKEIAAGTELVKA
FT                   EVEKDIKPKAIVTAPVAVAPSRLRQWAEQLFAQVLPPLLGLALLVGLWSLVSSSTGKSI
FT                   PTPAETWEQALQVFSDPFYRNGPNDQGVGWNVLSSLQRVALGFGLAALVGIPLGFVIGR
FT                   FGFLSRMFNPLISLLRPVSPLAWLPIGLLVFKGANPAAIWTIFICSIWPMVINTAVGVQ
FT                   RVPQDYMNVARVLNLSEWKIATTILFPAVLPYMLTGVRLAVGTAWLVIVAAEMLTGGVG
FT                   IGFWVWDEWNNLNVKNIIIAIFVIGIVGLVLEWALVKLASAFTFEEVKT"
FT   gene            661674..662486
FT                   /locus_tag="CtCNB1_0588"
FT   CDS_pept        661674..662486
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0588"
FT                   /product="nitrate ABC transporter, ATPase subunits C"
FT                   /note="COG1116, TauB, ABC-type
FT                   nitrate/sulfonate/bicarbonate transportsystem"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0588"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31334"
FT                   /db_xref="GOA:A0A454XRL7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005890"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454XRL7"
FT                   /protein_id="ACY31334.1"
FT                   /translation="MHTSLSTKYIEIHGVEQTFKTAKGLFPALRDINLNIAKGEFVSLI
FT                   GHSGCGKSTLLNLIAGLTIPTGGALLCANKEIKGPGPERAVVFQNHSLLPWLSCWGNVH
FT                   LAVERVFGKRESKAQLAQRTDAALAMVGLSHAAQKRPGEISGGMKQRVGIARALSMEPQ
FT                   VLLMDEPFGALDALTRAKLQDELLEIVARTQSTVVMVTHDVDEAVLLSDKIVMMTNGPA
FT                   ATIGEVLHVALPRPRSRVELAEDAQYQSYRKAVIDFLYTRQGHVEKAA"
FT   gene            662724..665240
FT                   /locus_tag="CtCNB1_0589"
FT   CDS_pept        662724..665240
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0589"
FT                   /product="nitrite reductase (NAD(P)H), large subunit"
FT                   /note="COG1251, NirB, NAD(P)H-nitrite reductase"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0589"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31335"
FT                   /db_xref="GOA:D0IZ85"
FT                   /db_xref="InterPro:IPR005117"
FT                   /db_xref="InterPro:IPR006066"
FT                   /db_xref="InterPro:IPR006067"
FT                   /db_xref="InterPro:IPR007419"
FT                   /db_xref="InterPro:IPR012744"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR017121"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036136"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR041575"
FT                   /db_xref="InterPro:IPR041854"
FT                   /db_xref="UniProtKB/TrEMBL:D0IZ85"
FT                   /protein_id="ACY31335.1"
FT                   /translation="MKRADVFFLALQMPTGTQMKKSKLVMIGNGMAGVRALEELLAIAP
FT                   DLYDITVFGAEPHPNYNRILLSPVLAGEQTLGDIVLNDWSWYQDHHILLHAGYTVTAVD
FT                   RARRTVHAVNAQGETASAEYDRLIMATGSKPFILPISGKDLEGVLAYRDIADTEAMIEA
FT                   AKTLKHAVVIGGGLLGLEAANGLMKRGMQVTVVHVGDWLMERQLDDQAGRMLQKSLAER
FT                   GMRFCMQAQTQELLGDAGGRVRAVRFKDGSEIPAELVVMAVGIRPSTELAESMHLHVNR
FT                   GIVVSDTLQTVTDPRIYAVGECAAHRGIAYGLVAPLFEQGKVLANHLAEFGIGRYLGSL
FT                   TSTKLKVTGIDLFSAGDFQGGGDTEEILMSDPYAGVYKKLVIKDDKLVGACLYGDTVDG
FT                   SWYFKLLREGRSVADIRDKLMFGESNLGDTGHQGQSKAAAMADGDEVCGCNGVTKGAIC
FT                   KAIKDKGLFTLDDVRKHTKASASCGSCTGLVEQIIMFTAGGDYSAAPKTKAMCGCTDHG
FT                   HQAVRDAIAEHKLLSTDAVFRFMEWRTPNGCASCRPAVNYYLVSTWPKEARDDPQSRFI
FT                   NERSHANIQKDGTYSVIPRMWGGETTASELRRIADVVDKYQIPTVKVTGGQRIDLLGVK
FT                   KEDLQAVWNDIGMPCGHAYAKALRTVKTCVGSEWCRMGTQDSTQMGKDLERAMWRMYAP
FT                   HKVKFAVSGCPRNCAESGIKDVGIIGVDSGWEMYVGGNGGIKTEVAHFFTKLKTAEEVM
FT                   EYTGAFMQLYRLEGWYLERTVHYINRVGLDYVKRRILDDAEGRRALWEQLQFALDGEPD
FT                   PWFETDKASVDTRQFQALPADVSVVA"
FT   gene            665418..665816
FT                   /locus_tag="CtCNB1_0590"
FT   CDS_pept        665418..665816
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0590"
FT                   /product="nitrite reductase (NAD(P)H), small subunit"
FT                   /note="COG2146"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0590"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31336"
FT                   /db_xref="GOA:D0IZ86"
FT                   /db_xref="InterPro:IPR012748"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:D0IZ86"
FT                   /protein_id="ACY31336.1"
FT                   /translation="MSEWISICTMDDIPVLGARRVARAKGLDVAVFRNADDEVFALLDR
FT                   CPHKGGPLSQGIVFGRSVACPLHNWTIALSSGEAAAPDEGCTPYFSVRVENGEVQLRAD
FT                   ELASRALEQTRPHAGPAHCAARSGCAAA"
FT   gene            666021..668882
FT                   /locus_tag="CtCNB1_0591"
FT   CDS_pept        666021..668882
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0591"
FT                   /product="molybdopterin oxidoreductase"
FT                   /note="COG0243, BisC, Anaerobic dehydrogenases"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0591"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31337"
FT                   /db_xref="GOA:D0IZ87"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR041854"
FT                   /db_xref="InterPro:IPR041957"
FT                   /db_xref="UniProtKB/TrEMBL:D0IZ87"
FT                   /protein_id="ACY31337.1"
FT                   /translation="MKETKSTCPYCGVGCGVVIESDGLQITGVRGDPEHPANFGRLCTK
FT                   GSTLHLTAAPAYAQQGRLLQPMRRLERTSAPQAASWDQALDELAARIAGIRAEHGPDAL
FT                   GFYLSGQLLTEDYYVFNKLVKGLLGTNNLDTNSRLCMSSAVAGYKATLGADAPPACYED
FT                   IDLAGCLFITGSNMAWAHPILFRRVEEARARNPQLRIIVADPRRTETAELADLYLPLQP
FT                   GSDVMLFHGLLHIMLWEGWTDSAFIAQHTSGFAQLKELVREASPEKVAAICGLPVADLY
FT                   RAARWMALGGAEEPTDARRPTLSLYCQGLNQSRSGTANNAALINLHLATGQIGRPGAGP
FT                   LSLTGQPNAMGGREVGGLSNLLSAHRDLSNAAHRAEVARLWGVESIPKQPGKSALEMFE
FT                   AAADGQIKALWIACTNPAQSMPEQAMVRRALERAELVVVQEAFAATETTAYADWLLPAS
FT                   TWGEKLGTVTNSERRISRVRAAVVAPGAARHDWQIGVQLARRLEQHLRPSLPSLFPYDT
FT                   ANADAGAEAIWNEHRESTRGRDLDITGLSWAVLEVKGPQQWPMPQGASQGRQRLYGDAV
FT                   FATDDGRARFDAQPWQAPAVPRDARHPFSLNTGRLRDQWHGMTRTGQLGRLFAHVSEPQ
FT                   LQVGPQDMQRLQLQDGDLVHVSNRYGAIVLPVQADPGLQPAQLYLPMHWGSMYLSGMGS
FT                   KGQRLAGVNALTTPERCPRSKQPELKHVAVKLLKAELPWTCLGMAWLDERQVQSVRQAL
FT                   TELMAEFDFASCVLFGRAVPLEKADQGRTGVQFRAAAYAQPGAEVLARLHGLLQLDGPQ
FT                   AMRYVDVRRQCSRAMAIGRQTEEPRLDAFLLCGDASAGQWLGPVLRDEQSVQTYGRLLL
FT                   SSGRKPPAAMPARSPQICACMNVDEASIGSALTTCEGSADERLAQLKTSLGCGTRCGSC
FT                   IPRIKQLVHATPAPQSAALPVAA"
FT   gene            668919..669743
FT                   /locus_tag="CtCNB1_0592"
FT   CDS_pept        668919..669743
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0592"
FT                   /product="uroporphyrin-III C-methyltransferase"
FT                   /note="COG0007, CysG, Uroporphyrinogen-III methylase"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0592"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31338"
FT                   /db_xref="GOA:D0IZ88"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR003043"
FT                   /db_xref="InterPro:IPR006366"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:D0IZ88"
FT                   /protein_id="ACY31338.1"
FT                   /translation="MTNSHATSLPPVGRCYLVGAGPGDPELLTLKALRLIQSATLLLAD
FT                   DLVSADIVKLASASARIVHVGKRGGRESTSQEFIEKLMIMAVRQGELVVRLKGGDPFIF
FT                   GRGGEEIEHLRRAGIAVEVVNGITAGLAAATSLGVPLTHRDHAHGVVFITGHAKPGSAG
FT                   HDWQLLAGTARMLGLTLVIYMGVATAGIIQQQLLAGGLPASTPVALVQSASLPAQQQIL
FT                   TELGQMTQALACSGLGSPCVFVVGEVVRLASSSAEGLGGLLEQAQLRRAVGA"
FT   gene            669889..671331
FT                   /locus_tag="CtCNB1_0593"
FT   CDS_pept        669889..671331
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0593"
FT                   /product="aldehyde dehydrogenase"
FT                   /note="COG1012, PutA, NAD-dependent aldehyde
FT                   dehydrogenases"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0593"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31339"
FT                   /db_xref="GOA:D0IZ89"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniProtKB/TrEMBL:D0IZ89"
FT                   /protein_id="ACY31339.1"
FT                   /translation="MSTAYPDTQLLIDGQWQDAASGKKIDVRNPASGEVIGRVAHADIA
FT                   DLDRALAAADKGFQVWRKVSAHERGAIMRRAAALLKERADEIAALLTQEQGKPLAEAKV
FT                   EIIAGAGIIEWFADEALRVYGRIVPSRRPEQQQLVIKDPVGPVAAFTPWNFPVNQIVRK
FT                   IGAALASGCSFLVKAPEETPASPAALLKCFVDAGIPAGVVGLVYGNPAQISEYLIAHPV
FT                   IRKVTFTGSTAVGKQLAALAGQHMKRSTMELGGHAPVIVAEDADVQLAVKAAGAAKFRN
FT                   AGQVCISPTRFLVHNSVREEFTRAMVAHAEALKVGNGLEQGTQMGPLANPRRVTALTQL
FT                   IQNAEQSGAKLMTGGASFGSAGNFFAPTVLADVPLTADIFNQEPFGPVAAIRGFDKIED
FT                   AIQEANRLSYGLAAYAFTRSLKTTHQLSQDVEAGMLWINQPALPSAELPFGGIKDSGYG
FT                   SEGGPEALEAYLVAKAVAISCV"
FT   gene            671498..673552
FT                   /locus_tag="CtCNB1_0594"
FT   CDS_pept        671498..673552
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0594"
FT                   /product="TonB-dependent receptor"
FT                   /note="COG4206, BtuB, Outer membrane cobalamin receptor
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0594"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31340"
FT                   /db_xref="GOA:D0IZ90"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039426"
FT                   /db_xref="UniProtKB/TrEMBL:D0IZ90"
FT                   /protein_id="ACY31340.1"
FT                   /translation="MPLHSTVSQIHPPSFVLRRSWLWGALAIVPMGTAWAQVAAAGAAE
FT                   AASQTFTLGTVEVSARREAEELGAGDMQRVGSAEMERSNASTVADAVRNLPGVSLSRNN
FT                   RNEEMISLRGFDSRQVPIFVDGVPLYVPYDGYVDLGRFTTFDLAEINVAKAGASLLYGP
FT                   NTLGGAVNLVTRKPVKPFEGDMRLGVGSGGERRASFNLGGNQGSWYYQLGASYLDADSF
FT                   PLPRGFRDYKKQPTDTGSKRENADRTDKRLSFKLGLTPNATDEYAIGYVRQEGEKGNPV
FT                   YTGQSTQKNAVRYWRWPYWDKDSLYFLSTTRLNGSNVLKTRLYHDTYKNGLDMYKDASY
FT                   TAHDPTSSYKDVSKGASVEWVNYAFSGHELHAAFHYKQDEHTDAASGKDPQKHYRDVTT
FT                   SLVLEDHIALAERWRLTLGLSHDQRDAKQVYQWPTGSTSATNGLARLSYALTAQGDEVY
FT                   LIASHKTRFATIKDRYSARMGTALANPDLKPEVANHLELGLSGKPWQGGKGQAALFYSR
FT                   VRDQIQTMVVDSTACGGKTCNQAQNVGRTRNAGFEVSLAQQLSAQWALHAGYTYLSRTN
FT                   LSDRSITLTDTPRQRLTAALQWNPQAQWQLRAELEAEQGRKVPLSASGQAQVYQMAGYG
FT                   VANLRARYLPRPDTTLDFGVANLGDKWYQLADGLPMPGRSWYVNLGYRF"
FT   gene            673552..674454
FT                   /locus_tag="CtCNB1_0595"
FT   CDS_pept        673552..674454
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0595"
FT                   /product="ABC-type tungstate transport system, permease
FT                   component"
FT                   /note="COG2998, TupB, ABC-type tungstate transport system"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0595"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31341"
FT                   /db_xref="UniProtKB/TrEMBL:D0IZ91"
FT                   /protein_id="ACY31341.1"
FT                   /translation="MVMQNLLRTSLARRDWLRSLAALGMAGGPALAMGAQPASGTGVQV
FT                   AAVGGLVLCGVWSHVAEQASQTLAMPVTTVAAAPKEGVVPAFARGEAQMLLIHASDEAM
FT                   ALEASGMASAARVWGWNQHVIAGPAHDPAGVRSVADGTQALRRIAETGSPFIALRDPGS
FT                   YTVVQRLWRRGGIRPDARWLRADTGPRPQAVLELAAREQAYAVVGHIPLAFGKMGAPGI
FT                   ELLLHGDPLMRRPYVLLTPGPRHPATAQQRQVAGLLAEYLLSAAGQQVLEAASGAGGPW
FT                   VFGRDSVPAGMSAGADGQT"
FT   gene            674480..675016
FT                   /locus_tag="CtCNB1_0596"
FT   CDS_pept        674480..675016
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0596"
FT                   /product="molybdenum ABC transporter ATP-binding protein"
FT                   /note="COG0413, PanB, Ketopantoate
FT                   hydroxymethyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0596"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31342"
FT                   /db_xref="GOA:D0IZ92"
FT                   /db_xref="InterPro:IPR018912"
FT                   /db_xref="UniProtKB/TrEMBL:D0IZ92"
FT                   /protein_id="ACY31342.1"
FT                   /translation="MTPPLAALIYPDERHDIEDLLEGVARRLQQSGRQVGGLVHRQSRY
FT                   ANGNKCMRLVDLRSGQQFEMTEDLGAASQACSLNPQALARASVVLRQALADGVELAVVN
FT                   CFGQLEAAGGGFVQEIAAFVEAGIPVVTAVAARHEAGWQSFTGGAFVRLPVEEQALLHW
FT                   CRQQLQREDQGDRSC"
FT   gene            675010..676047
FT                   /locus_tag="CtCNB1_0597"
FT   CDS_pept        675010..676047
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0597"
FT                   /product="periplasmic binding protein"
FT                   /note="COG0614, FepB, ABC-type Fe3+-hydroxamate transport
FT                   system"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0597"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31343"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:D0IZ93"
FT                   /protein_id="ACY31343.1"
FT                   /translation="MLTRRQWLQAGAATLAPGAWAQDGGSVIAARFGSLPARPGRVFAS
FT                   GPPAGVLLAALAPQQLLGWPMELGDAARAHLGSPLQALPYLGRLSGRGSTLPLEKLLAL
FT                   QPDLVLDSGTSDATHVSATERLARQTGLACVLVQGSLSDHARQLREVGSLLGASERGET
FT                   LARHADEVARLVRAVTAGLGEQARPRVYLGRGANGLETGLAGSINVEVIEYAGGRNVAA
FT                   QAGRGGLTRVSMEQILAWDPEVILTQEAGFAERVRQDPLWRGISAVRSGRVHCAPVLPF
FT                   GWLDGPPSVNRLIGVRWLFEKLHPGRPARHGATPLEQAVREFYALFYGIQLSPAQLQAL
FT                   LRAAR"
FT   gene            676063..677184
FT                   /locus_tag="CtCNB1_0598"
FT   CDS_pept        676063..677184
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0598"
FT                   /product="putative ABC-transporter permease protein"
FT                   /note="COG0609, FepD, ABC-type Fe3+-siderophore transport
FT                   system"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0598"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31344"
FT                   /db_xref="GOA:D0IZ94"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:D0IZ94"
FT                   /protein_id="ACY31344.1"
FT                   /translation="MKSFDISEGAQSPKEAGSPESAASSNASGHSRQRSHLRVGMGWWL
FT                   ALVLLALVLLWALGSGQFALAPAQLAEALWARATGAASPLPPAAETVLWNIRLPRIAAG
FT                   VAVGAMLAAAGAAYQGMFRNPLVSPDILGVSAGAGLGAVIAIYLGLSMFAVQWLAFGGG
FT                   LIAVAVVVAISACVRRHDPVLVLVLAGIALGALLGAGIALIKTLADPNTQLPSITFWLM
FT                   GGLSAVTLQEVAATAPVMLAALLPLLLLRWRINLLALPDEEARALGVPVGRLRLVLVVC
FT                   ATLGTAAAVSLAGIIGWVGLVVPHVARLLVGPDFVRLLPASALLGAGFVVAADTLARSM
FT                   ARIELPLGILTALVGAPFFLYLLARTGRREGDT"
FT   gene            677184..677939
FT                   /locus_tag="CtCNB1_0599"
FT   CDS_pept        677184..677939
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0599"
FT                   /product="hypothetical ABC transporterATP-binding protein"
FT                   /note="COG1120, FepC, ABC-type cobalamin/Fe3+-siderophores
FT                   transportsystems"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0599"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31345"
FT                   /db_xref="GOA:D0IZ95"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D0IZ95"
FT                   /protein_id="ACY31345.1"
FT                   /translation="MTVLDLQGLSTGHGRSVVSESVDLSIATGEVLCLLGPNGCGKTTL
FT                   FRTVLGLLPPLAGRVLVEGQPVQHWPRAEFARRVGYVPQAQAGVFAFEALDMVLMGRAA
FT                   RLPLLARPSGADRAMALACMERLQISHLAARRYTELSGGERQLVLIARALAQEPALLVM
FT                   DEPTASLDFGNQIRVLEQVEALSAQGMAMLLSTHQPEHGLRVASRIALLGHGRLLGVGE
FT                   PRAVATPAALAELYGVSKAAIAAHLSGSR"
FT   gene            complement(677945..679939)
FT                   /locus_tag="CtCNB1_0600"
FT   CDS_pept        complement(677945..679939)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0600"
FT                   /product="conserved hypothetical protein"
FT                   /note="COG1289, Predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0600"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31346"
FT                   /db_xref="GOA:D0IZ96"
FT                   /db_xref="InterPro:IPR006726"
FT                   /db_xref="UniProtKB/TrEMBL:D0IZ96"
FT                   /protein_id="ACY31346.1"
FT                   /translation="MSVAAYDRLLESATRWGFDSARLRQHLRTAFAACIAVFAAWALGL
FT                   EHPQWAGMTVWAASQPLRGQLLEKSFFRTTGTLVGTAAGVVLVLVANGDLLWLVTGLAV
FT                   WIGICAGLGNLQRSFASYGTMLAGYSASMVALLDNGNPAHVYALGWDRLFTALTGVAAA
FT                   LVVGWLFTPVGAEIPGDGRVRRLCARLLRDIADAAQATASGHSALSPRDLAERLAVMAA
FT                   IEEGLDPHAAGSQRSRRAVRALRRLINTQISALLWLRDSTGKTITPEFSPDHAQAMTAA
FT                   LEQAAMLLETQPAPLAAIDAIATARSAAAGWGHAEEILGNIGLALQAHFVAASDLNLPA
FT                   HHRARQLPVVLHSDWVGARRAMLRAFSSIFLVGLIWVVTGWHGGAYMLLGLSVMITVFS
FT                   SFENPAFTMRFVILGQAMGAGVALACQWFAWPFANSQLQMVLMMLPFIFLGALLLSHRR
FT                   TTLYGFDCNMVILLALSPHFPYQLDVGHSLSMAFAIVTGPLAGWAAYRFILPVTAQGRL
FT                   NGLRAMMVHELQDMACAPVHARDVRVWRARLYHRLLRLVRASEKVSAPAVQDAADCGLA
FT                   ALRVGKAVLILHQLQADVLLSESSLRGVRSALQRLQQLPSAPARAVPLLQGLARRIQQR
FT                   QPEQALQLRLAAQDIREHPAFFASSAALR"
FT   gene            complement(679936..680451)
FT                   /locus_tag="CtCNB1_0601"
FT   CDS_pept        complement(679936..680451)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0601"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="COG1846, MarR, Transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0601"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31347"
FT                   /db_xref="GOA:D0IZ97"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR023187"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D0IZ97"
FT                   /protein_id="ACY31347.1"
FT                   /translation="MSLHQNSAMSFADAPSRDRLGFLMVTLTRQWRRFVEEQLAASGLT
FT                   DATWTPLLHLRAWGDGVTQKELAERVGLDGSSLVRLLDILEGKGWVERRADAADRRSKR
FT                   IFLTAEGHGAVDHVRATMLEAELSLLQDLEDSEVEAMLDGVNKIRARIEQMHEQRSAQA
FT                   QPDTEERA"
FT   gene            complement(680607..681695)
FT                   /locus_tag="CtCNB1_0602"
FT   CDS_pept        complement(680607..681695)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0602"
FT                   /product="conserved hypothetical protein"
FT                   /note="COG2855, Predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0602"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31348"
FT                   /db_xref="GOA:D0IZ98"
FT                   /db_xref="InterPro:IPR004630"
FT                   /db_xref="InterPro:IPR018383"
FT                   /db_xref="UniProtKB/TrEMBL:D0IZ98"
FT                   /protein_id="ACY31348.1"
FT                   /translation="MNTTTLKNSAPSQGWMHKTGGMIPGLLLAGAIAAVATWAAQFPAI
FT                   RNNGLSALTLAIIIGLLIGNTVYPAIASQCASGIAFTKARLLRTGIVLYGLRLTFQDIG
FT                   QVGMAGVVIDALVLSSTFLLAQWIGQKLLGMDKRTTMLVGAGASICGAAAVLATEPVVK
FT                   GRAEDVAVAVATVVVFGTIGTFLYPALFHWNAEYGWIDTSMQQYGVFVGSTVHEVAQVV
FT                   AAGEAIGSQAADTAVIAKMVRVMMLAPFLLVLSMWLTRSERALGVNDGQPGNRITIPWF
FT                   AVGFVAMAGVNSLGVLPKEAVSVGIQLDNALLALAMAALGLTTHIRAVRAAGTRPLILA
FT                   LALFAWLLIAGLALNLWIPTLF"
FT   gene            681876..682889
FT                   /locus_tag="CtCNB1_0603"
FT   CDS_pept        681876..682889
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0603"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="COG0583, LysR, Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0603"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31349"
FT                   /db_xref="GOA:D0IZ99"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D0IZ99"
FT                   /protein_id="ACY31349.1"
FT                   /translation="MVGLPVFCWQAGAAGEPAVIDTNIRIIVMLHLTLRQFEIFCAVAQ
FT                   SGTTVAAAEAVALSQSATSAALQQLEQGLGVQLFERVGKRLVLNDAGRALLPQALSVLE
FT                   QARGIEQTFSARAANMPVRLRVAASTTIGTYALPEVLARLARSHPLVRVDLQIANTQEV
FT                   GEAVLAMEVDMGLIEGSSHWQGLEVEPWLRDELVIVASPQDPLAEQARSKPLGVAALRK
FT                   AAWLLREAGSGTREMVEHALLPHLHQLPAAATLGSSEAIARCVEQGLGISCLSRVLVQS
FT                   QLQARALEILPTTLPRMWRNFSLVQRAGKRRSPALQAFVDACKAGEPSAAQAPNTL"
FT   gene            683029..683250
FT                   /locus_tag="CtCNB1_0604"
FT   CDS_pept        683029..683250
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0604"
FT                   /product="hypothetical protein"
FT                   /note="COG2987, HutU, Urocanate hydratase"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0604"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31350"
FT                   /db_xref="UniProtKB/TrEMBL:D0IZA0"
FT                   /protein_id="ACY31350.1"
FT                   /translation="MKTIDEMLHLDLLTHEQHLQISHWIDDAQSPEAILQMPAGLWQAV
FT                   ERASQAMGVNEDLLRPPALDAGGLTFSQ"
FT   gene            complement(683320..683820)
FT                   /locus_tag="CtCNB1_0605"
FT   CDS_pept        complement(683320..683820)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0605"
FT                   /product="CreA"
FT                   /note="COG3045, CreA, Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0605"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31351"
FT                   /db_xref="InterPro:IPR010292"
FT                   /db_xref="UniProtKB/TrEMBL:D0IZA1"
FT                   /protein_id="ACY31351.1"
FT                   /translation="MRTTMKLLSAALAVATAAVGTMAFVGMSHAEQIGAVDTVFKWIGP
FT                   DHKIVVDAYDDPKVPGVTCYVSRAKTGGIKGGLGLAEDRSEASISCQATGNIQFPAPLR
FT                   QQEEVFTERTSLLFKRLRVVRMVDAKRNALIYMTYSDRVIEGSPQNSVTAVAVPQGTAI
FT                   PLK"
FT   gene            684095..685288
FT                   /locus_tag="CtCNB1_0606"
FT   CDS_pept        684095..685288
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0606"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="COG2814, AraJ, Arabinose efflux permease"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0606"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31352"
FT                   /db_xref="GOA:D0IZA2"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D0IZA2"
FT                   /protein_id="ACY31352.1"
FT                   /translation="MSVNVSAPGLSASSLLLMALACGLCAGGNYFNQPLLHSIAGHFSV
FT                   SESAAATSVTLAQVAYAAGLLLLAPLGDKLQRRGLAVSLMLLAALGQALCGLADQFDLF
FT                   LLGTLMAGLFSVAAQVLVPMAAALAQPGQSGRAVGWVMSGLLLGILLARSVAGMVSEAW
FT                   GWQAVYQGAALVMAVVALWLWKALPASRNPSPVSYPQVLRSMWHLLRSQPGLRQRTLVS
FT                   ALAFASVSVLFSTMALQLSSGPLGLDDGQIGLIGLAGAAGALVATQAGRLVDKGLGRVS
FT                   CAIGALALLLSWPLLWVGGAHLGWFVLGMVVIDLGLQCLNITNQATVAQLLPAARGRMN
FT                   AVYMTGYFTGAAAGSALGTLAWRINGWQGACALGLALALLACLGTFRMRKTHGLVAA"
FT   gene            complement(685285..687600)
FT                   /locus_tag="CtCNB1_0607"
FT   CDS_pept        complement(685285..687600)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0607"
FT                   /product="TonB-dependent receptor"
FT                   /note="COG1629, CirA, Outer membrane receptor proteins"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0607"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31353"
FT                   /db_xref="GOA:D0IZA3"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039426"
FT                   /db_xref="UniProtKB/TrEMBL:D0IZA3"
FT                   /protein_id="ACY31353.1"
FT                   /translation="MKQIFLPLVVSGIAWPCLAQTSTDSADLPERSKTLGVVTVNGGQP
FT                   SSLPTQIPTTIEGITREEIETRINATDSEDALKYLPSLLVRKRYIGDYNHAILSTRASG
FT                   TGNSARSAVYADGILLSNYLGNGIANGSNYAPRWGLVTPEEIERVDVMYGPFSAAYPGN
FT                   SAGAVVDYVTRMPDKLEAHVAAGYAHQSADVLGSSGHYRSWNTSASIGSRSGDWSYWIN
FT                   LSRSDSQGQPMTFPTVLQSAGVAGGAGTPVTGAIAGLNTTNQPWYILGAGTQYRTRQDH
FT                   AKIKLAYDITPTLRASYTLGWWQNSARGSSETYLRGPDGQPVYSGNINIDGKTYKLADT
FT                   AFGLSQDQQTHTMHGVSLKSHTQGEFDWELSASLYDYGKDQQRVPTVAQPAANLGGKGT
FT                   LQDQDGTGWNTLAAKGTWRQNDILGLQGTHIVDFGLGRDAYKLNIGKYNVVGDWQSGPA
FT                   NEQSIVSQVGGRAETRYAWAQDSWQLARDWKAVLGLRWEDWTASQGRTATTSSQLNYAQ
FT                   RSESHFSPKAALAYQLARNTTLKASLGRAVRFPTVGELYGATSGGALSFINDPNLKPEK
FT                   SWTGELTAEQDLGNGLLRATWFHERTRDALYSQLIPGTTISAVQNVDQVRTSGLELAYS
FT                   AQSVWIRGLDLGGSLTWSNSRITANAANPASVGKWQPRVPRWRATAWATYKPDERWAFT
FT                   VAVRYSGRQYSNLDNSDVHADTYMGASQYFSVDLRARYQIDRQLSAAFGIDNANNARYW
FT                   NFHPYPQRSFSASLRWDL"
FT   gene            complement(687685..688059)
FT                   /locus_tag="CtCNB1_0608"
FT   CDS_pept        complement(687685..688059)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0608"
FT                   /product="conserved hypothetical protein"
FT                   /note="COG3416, Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0608"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31354"
FT                   /db_xref="UniProtKB/TrEMBL:D0IZA4"
FT                   /protein_id="ACY31354.1"
FT                   /translation="MTLQQLRRIATCLLGRCVLAWMALSMGVATAAPLIQSQGFELICT
FT                   STGAVKLIVKGEDGGSALGAGHLDCPMCLPHAAPPPPALQLPPPTESPLWHALQPVQRA
FT                   RIAAITAAPLPARGPPPAYL"
FT   gene            complement(688301..690871)
FT                   /locus_tag="CtCNB1_0609"
FT   CDS_pept        complement(688301..690871)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0609"
FT                   /product="cyanophycin synthetase"
FT                   /note="COG0769, MurE, UDP-N-acetylmuramyl tripeptide
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0609"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31355"
FT                   /db_xref="GOA:D0IZA5"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR011810"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR020561"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:D0IZA5"
FT                   /protein_id="ACY31355.1"
FT                   /translation="MQITRNRALRGPNLWTRSTAIEAIVHCEDSELLYTAMPGFEEKLR
FT                   ARFPTIGTLQPHGADQRLSLAHVLEVAALSLQAQAGCPVTFSRTHETVEQGTFQVVVEY
FT                   TEESVGKLAMERAEALIQATLNDTPFDADATIAELRELDEDDRIGPSTGAIVDAAVARG
FT                   IPFRRLTTGSLVQLGWGSRARRFQAAEIDSTSAVAESIAQDKDLTKRLLHAAGVPVPMG
FT                   RPVTDVEDAWAVAQEVGLPVVVKPQDGNQGKGVVVNITTREGLEAAYKTASEFGDEILV
FT                   ERFLPGHDFRMLVVGGQLVAAARREPPQVLGDGQHTIRELVNIVNQDPRRGSGHGTALT
FT                   KVRLDDIAIARIASEGLTPDSVPAQGQRVVLRNNANLSTGGSATDVTDDVHPEIAARAI
FT                   EAAQTIGLHICGVDVVCETMLKPLEEQSGGIVEVNAAPGLRMHLAPSFGRPRNVGVPMV
FT                   DELFAPGDDGRIPLVAVTGTNGKTTTTRVIAHLFTSHGWRTAMTNTDGVYVNGRQIDSG
FT                   DCSGPKSARNALAHPETDAAVLECARGGILREGLGFDRCQVAVVTNVGEGDHLGLNFIT
FT                   TKEDVSVLKRVIVQNVASTGYAVLNAADPLVAAMAHVCPGKVIFFAADRHHPVMATHRA
FT                   QGSRVVYVDGDAIVAAEGSWRESIALRDIPLTRNGTITFQVENVMASIGAAWAAGLPWQ
FT                   TIRRGLAGFLNDSDNAPARFNVMDYKGATIIADYGHNPDAIRALSQAVEAMPAKRRSVV
FT                   ISGAGDRRDQDITEQTQILGKVFDDVVLYQDACQRGRVDGEVLALLKKGLEGAPRTSYS
FT                   TEIHGEFLAIDHALARLQPGDLCLVLVDQVEEALEHLRKHVNGQ"
FT   gene            complement(690968..693214)
FT                   /locus_tag="CtCNB1_0610"
FT   CDS_pept        complement(690968..693214)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0610"
FT                   /product="cyanophycin synthetase"
FT                   /note="COG1181, DdlA, D-alanine-D-alanine ligase and
FT                   related ATP-graspenzymes"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0610"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31356"
FT                   /db_xref="GOA:D0IZA6"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR011810"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="UniProtKB/TrEMBL:D0IZA6"
FT                   /protein_id="ACY31356.1"
FT                   /translation="MPTYQGQEFKKTCSPHSYPLINMAKFNDIQLLRTTFLRGPSVWTY
FT                   RPVLEVWLDLGELEDYPSNKIPGLNERLTSWLPDLIEHTCGVGERGGFIQRLEGGTWMG
FT                   HVMEHVIIELLNLAGMPAEFGQTREISRRGVYRMVFRCPEEAVARVALEYGHKLLMAAI
FT                   NDEPFDLKPAVHAIKTAINDRYLGPSTGCIVDAASERRIPHIRLNDGNLVQLGYGAAQR
FT                   RIWTAESDQTSAIAEGIAQDKDFTKRLLAACGVPVPEGQIVASPEEAWEVAQDIGFPVT
FT                   VKPSDGNHARGVTLELSKEADIKAAFALAQPEGSDVIVEKFIDGVEHRLLVVGGKVVAA
FT                   TKGETVSVYGNGNATLRELVAVLNQDPRRGPEQEYPLDWINLEAGAVKLELNRQHVTPD
FT                   SVIPQGQGVLLQRNGNMAIDCLDDVHPDVAYYAVLAAKIVGLDIAGMDMILKDVSKPMQ
FT                   GQGAILEVNAGPGLLMHLKPTSGAPRPVGMAIADHLFPREDGAGAGRIPVVGIVGTRNN
FT                   AFISRLVGWLLQLSGKLTGVASSEGMFLANRHTQKTNTANWAGAHRLLTNRLAEAAVIQ
FT                   TTARSILEEGLAYDRCLVGVVTDMDGYEQLADHDVLEPGQMRRVMRTQIDVVLDEGAGV
FT                   LNADLPEVADLAELCDGEVILYATGADNEFVAAHRANTEARHEGGRAVFLKGNNVVLAT
FT                   GTQERVLGTLEALSLAGGKRPDTSALLAAIASAWALDITPELIGAGIKTFEYQA"
FT   gene            693500..695671
FT                   /locus_tag="CtCNB1_0611"
FT   CDS_pept        693500..695671
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0611"
FT                   /product="putative multidrug exportATP-binding/permease
FT                   protein"
FT                   /note="COG1132, MdlB, ABC-type multidrug transport system"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0611"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31357"
FT                   /db_xref="GOA:D0IZA7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:D0IZA7"
FT                   /protein_id="ACY31357.1"
FT                   /translation="MQFGSGLLALTQERLLACDPKTQQWREWALAVDQSLRLQDHGGVG
FT                   NLELHDRSARLAQWLITLKHQSSMLQLMQQFDRQRERIARQEAYSAVSDEDVPHCPVCH
FT                   SVLPPDTEECPACARQQAPQTSTWVLLRLWRFAKPYQGQLLLGFLLTLATTAAQLVAPY
FT                   LTIPLMDKILIPFQNGEKIDRDLVFFYLGMLLLSALLAWALGWARTFVLAKVSERIGSN
FT                   LRTTTYNHLLNLSVDYYGSKRTGDLMARIGAETDRINLFLSLNALDFATDVLMIVMTSA
FT                   ILFSINPWLALVTLVPLPFIAWMIHTVRDRLRTGFEKIDRVWSEVTNVLADTIPGIRVV
FT                   KAFAQEKREADRFADANLINLQANDKVNKTWSLFTPTVTLLTEVGILVVWGFGIYLVAG
FT                   GSITVGVLTAFIAYIGRFYTRLDSMSRIVSVTQKAAAGAKRIFDILDHVSNVPEPSNPV
FT                   KLPGKAKGAITMEDVGFRYGSRAVIKHLNLEIKPGEMIGLVGHSGSGKSTLVNLICRFY
FT                   DVSEGSIQLDGVDVRRMSVSDYRSNIGLVLQEPFLFFGTIAENIAYGKPDATREEIVAA
FT                   ARAAHAHEFILRLPHGYDSLVGERGQGLSGGERQRISIARALLIDPRILILDEATSAVD
FT                   TETEKEIQKALDNLVQGRTTIAIAHRLSTLRKADRLVVMDRGEIVEVGPHDELMDLKGH
FT                   YFRLYDAQARRAEEDAQAAGLKLQTKETQ"
FT   gene            695668..696159
FT                   /locus_tag="CtCNB1_0612"
FT   CDS_pept        695668..696159
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0612"
FT                   /product="conserved hypothetical protein"
FT                   /note="COG1316, LytR, Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0612"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31358"
FT                   /db_xref="InterPro:IPR015005"
FT                   /db_xref="UniProtKB/TrEMBL:D0IZA8"
FT                   /protein_id="ACY31358.1"
FT                   /translation="MIEAPQSNLSGMQLERNAHGRLVLTLGNGLVYEAVVPVRAFPIAA
FT                   PAEGLSLIAADGKEALWVARMADLHPEHRQLIEQDLAVREFVPTIERILKVSSFSTPST
FT                   WELQTDRGLTQMVLKAEEDIRKLAGRTRLQITGQDGVQYRIPDSSKLDRHSRKLLERFL
FT                   "
FT   gene            696455..696802
FT                   /locus_tag="CtCNB1_0613"
FT   CDS_pept        696455..696802
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0613"
FT                   /product="conserved hypothetical protein"
FT                   /note="COG3701, TrbF, Type IV secretory pathway"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0613"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31359"
FT                   /db_xref="UniProtKB/TrEMBL:D0IZA9"
FT                   /protein_id="ACY31359.1"
FT                   /translation="MRPVNAVNATESVDKIGEGRSVREPEKPSAPDTENRDWTLAEEVK
FT                   QKEEVEEPPKEPISKQLIEFIQSMWRASAQAVEQAQETSKSEDLLQSKQQARNEPLTYS
FT                   EPRVKRSGNAK"
FT   gene            complement(696869..697336)
FT                   /locus_tag="CtCNB1_0614"
FT   CDS_pept        complement(696869..697336)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0614"
FT                   /product="putative signal transduction protein with"
FT                   /note="COG5126, FRQ1, Ca2+-binding protein (EF-Hand
FT                   superfamily)"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0614"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31360"
FT                   /db_xref="GOA:D0IZB0"
FT                   /db_xref="InterPro:IPR002048"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="UniProtKB/TrEMBL:D0IZB0"
FT                   /protein_id="ACY31360.1"
FT                   /translation="MALICTAMSKAKNHPFVARSSSVMKTAMGVLLTSAVLLLPTVRAE
FT                   ETAGDRMAERQGTQLSKGEIKAQQQFKMLDFNQDGKLSRKEVAIIPKLAAAFDETDTNK
FT                   DGFVTYEEVRAFAVKYRAAREKAKAAEAVAAAPAKDDAHKSEADSAVPESK"
FT   gene            complement(697408..698325)
FT                   /locus_tag="CtCNB1_0615"
FT   CDS_pept        complement(697408..698325)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0615"
FT                   /product="5-nucleotidase"
FT                   /note="COG0566, SpoU, rRNA methylases"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0615"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31361"
FT                   /db_xref="GOA:D0IZB1"
FT                   /db_xref="InterPro:IPR010394"
FT                   /db_xref="UniProtKB/TrEMBL:D0IZB1"
FT                   /protein_id="ACY31361.1"
FT                   /translation="MAMTLNDKLVVAISSRALFDFEEENRLFEDSDPATYLRLQRERLN
FT                   VPAAPGVAFSLVKKLLAFNTEAQQHVEVVLLSRNDPVSGMRVFRSAQAHGLHSIQRGVF
FT                   TQGRDPFGYLRPLGAQLFLSANADDVTQALQLGYPAAHVFTDSMRASSSHPREVRIAFD
FT                   GDAVLFSDEAERIFQAQGLEAFQQHELEKAAQPLPEGPFKPLLAALHRLQQADVAGMRV
FT                   RTALVTARSAPAHERALNTLMDWKIDVDEAMFLGGLAKGGFLREFEPDFFFDDQTGHVR
FT                   NAAGHVPSGHVRSGIAHDKTALPT"
FT   gene            complement(698387..699589)
FT                   /locus_tag="CtCNB1_0616"
FT   CDS_pept        complement(698387..699589)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0616"
FT                   /product="Rh-like protein/ammonium transporter"
FT                   /note="COG0004, AmtB, Ammonia permease"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0616"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31362"
FT                   /db_xref="GOA:D0IZB2"
FT                   /db_xref="InterPro:IPR018047"
FT                   /db_xref="InterPro:IPR024041"
FT                   /db_xref="InterPro:IPR029020"
FT                   /db_xref="UniProtKB/TrEMBL:D0IZB2"
FT                   /protein_id="ACY31362.1"
FT                   /translation="MQALKQGADALFILMGAVMVLAMHAGFAFLELGTVRRKNQVNALV
FT                   KILVDFSVSTVVYFALGYGVAYGTHFFVGAEQLTALNGYGLVKFFFLLTFAAAIPAIIS
FT                   GGIAERAKFWPQLIATAMIVGLIYPFFEGIAWNQHFGVQAWIKELTGAEFHDFAGSVVV
FT                   HAVGGWIALGAVLLLGPRSNRYRQGGAIAATPPSSIPFLALGAWILIVGWFGFNVMSAQ
FT                   SLDKISGLVAVNSLMAMVGGTLAALAVGKNDPGFVHNGPLAGLVAVCAGSDLMHPLGAL
FT                   VVGAAAGAIFVFMFTLTQNKWKIDDVLGVWPLHGLCGAWGGIAAGIFGTQALGGLGGVH
FT                   PLAQLIGTLMGVAWAALGGLLVYGLLKKTMGLRLSQEQEFDGADLSIHHISATPEREAN
FT                   W"
FT   gene            complement(699709..700932)
FT                   /locus_tag="CtCNB1_0617"
FT   CDS_pept        complement(699709..700932)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0617"
FT                   /product="general secretion pathway protein F"
FT                   /note="COG1459, PulF, Type II secretory pathway"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0617"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31363"
FT                   /db_xref="GOA:D0IZB3"
FT                   /db_xref="InterPro:IPR003004"
FT                   /db_xref="InterPro:IPR011850"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="InterPro:IPR042094"
FT                   /db_xref="UniProtKB/TrEMBL:D0IZB3"
FT                   /protein_id="ACY31363.1"
FT                   /translation="MPAFTFEALDAQGQTRKGTLEADNARAARSQLRSQALVPLQVEPV
FT                   AAGKGQGRAGASGWFTRPVFNSTSLAVWTRQLSGLVSSGLPIERALAALSEEAEDERQH
FT                   QLVAALRAEVNAGSSFARALEQHPREFSDIFCAVIGAGESSGSLGPVLENLADDLEARQ
FT                   ALQSKLIGASLYPAIVTLVAIVIVIFLVSYVVPQVAGVFAGTKRALPFLTVVMLGISDF
FT                   VRHYGWFMLAVLLLAAVGFRLALRNEAFRERFDAQWLRLPLIGRLSRSYNAARFAGTLA
FT                   MLAGAGVPILKALQAAAETLNNRALRADAMDALVLVREGAPLASALAQKKRFPGLVAMF
FT                   ARLGEQTGQLPLMLQRAATQLSTEVQRRAMHLATILEPLLIVVMGLVVMLIVLAVLMPI
FT                   IQLNQFVK"
FT   gene            701093..701842
FT                   /locus_tag="CtCNB1_0618"
FT   CDS_pept        701093..701842
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0618"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="COG1028, FabG, Dehydrogenases with different
FT                   specificities (related to short-chain alcohol
FT                   dehydrogenases)"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0618"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31364"
FT                   /db_xref="GOA:D0IZB4"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D0IZB4"
FT                   /protein_id="ACY31364.1"
FT                   /translation="MLKDKVALVTGAASGIGRCVALTWAREGARVVLADLNEEQGQESA
FT                   ALVRELGAEALYLRADAGSPADHEALVALTMRHFGRLDVACNNAGIGGASAPTADYPLD
FT                   AWEQVLRVNLSGVFYACKYQIAAMLQGGGGSIINMASILGAVGFANSAAYTAAKHGVLG
FT                   LTKAAALEYSARGVRINAVGPGFVQTPMISGLEQDPATHAALVAAHPMGRLGQPEEIAE
FT                   LVAWLASDRASFVTGAYYPVDGGYLAR"
FT   gene            complement(701914..702570)
FT                   /locus_tag="CtCNB1_0619"
FT   CDS_pept        complement(701914..702570)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0619"
FT                   /product="Putative GSH-dependent dehydroascorbate
FT                   reductase"
FT                   /note="COG0625, Gst, Glutathione S-transferase"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0619"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31365"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="InterPro:IPR040079"
FT                   /db_xref="UniProtKB/TrEMBL:D0IZB5"
FT                   /protein_id="ACY31365.1"
FT                   /translation="MSTPQQPKLRFFSNPRSRARMVRWMLEECGADYETVDLEFGPEMK
FT                   SPEYLSINPMGKVPALQHGDAVVTETGAILAYLAELFPEKRLAPAMGSPERASYFRWLF
FT                   FVAGPVEAVTTARNEGWLQSQTHQQAISAGFGRFDDVLNTLLHAVAGKRYACGDHFTAA
FT                   DLYLASYIGWSMMDGSLPRRPEFEAYATPLLQRAASVRADEIDGDMQAAAMAPVV"
FT   gene            complement(702664..703353)
FT                   /locus_tag="CtCNB1_0620"
FT   CDS_pept        complement(702664..703353)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0620"
FT                   /product="Helix-turn-helix, type 11"
FT                   /note="COG2378, Predicted transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0620"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31366"
FT                   /db_xref="InterPro:IPR013196"
FT                   /db_xref="InterPro:IPR026881"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D0IZB6"
FT                   /protein_id="ACY31366.1"
FT                   /translation="MSRSARLLQLLDTLRRARQPQTGPELAQALGISLRTLYRDIATLR
FT                   TQGADILGDPGIGFEMRPGFLLPPLMFNADELEALLLGARWASLQADPQLAQAATAAMD
FT                   RIRSALPLELRIAVDTSGLLVPNMQNDPPPEPWQAALRRAIRAEHKIVLHYRDQHGVPS
FT                   QRRVWPFAMAYFERSRVVSAWCELRQAFRHFRADRVDALENLGERYPQRRQVLIQRWLD
FT                   ETGYTLD"
FT   gene            complement(703478..704485)
FT                   /locus_tag="CtCNB1_0621"
FT   CDS_pept        complement(703478..704485)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0621"
FT                   /product="luciferase-like protein"
FT                   /note="COG2141, Coenzyme F420-dependent N5"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0621"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31367"
FT                   /db_xref="GOA:D0IZB7"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR019949"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:D0IZB7"
FT                   /protein_id="ACY31367.1"
FT                   /translation="MKSLNNVKLSMLDLVAVREGGTVADALQIAVRTAQQAEKLGFTRY
FT                   WLAEHHNMPGIASSATAVLIGHIAGATQKIRVGSGGIMLPNHAPLVVAEAFGTLAELYP
FT                   GRIDLGLGRAPGTDGATMRALRRDRVETEEDFPRDVQELQRLLGDHQDGARIIAMPGAG
FT                   THVPIWLLGSSLFSAQLAAHMGLPYAFASHFAPRMLHQALAIYRQTFQPSATLAKPYAI
FT                   VGVPVIAAPSDEEARFLASSTYQRVLGILTGNRTRLMPPIPDFWEQLDGRAQAAIADFL
FT                   AVGVIGGPDTVRQGLQNLADETQADEFMIVSDVYDAELRLRSLEITAGAMNTAS"
FT   gene            complement(704531..704815)
FT                   /locus_tag="CtCNB1_0622"
FT   CDS_pept        complement(704531..704815)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0622"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0622"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31368"
FT                   /db_xref="GOA:D0IZB8"
FT                   /db_xref="UniProtKB/TrEMBL:D0IZB8"
FT                   /protein_id="ACY31368.1"
FT                   /translation="MLENLRTSVQPYGGDLFLLLIALAVISLAVLFNLKARLPVDQLRR
FT                   VIRMAALVALLGSVFAMQVGSTYYAMAAVLLAWGVLVGIVLGREIGRKR"
FT   gene            complement(704911..706869)
FT                   /locus_tag="CtCNB1_0623"
FT   CDS_pept        complement(704911..706869)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0623"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0623"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31369"
FT                   /db_xref="UniProtKB/TrEMBL:D0IZB9"
FT                   /protein_id="ACY31369.1"
FT                   /translation="MSQALTTTPFIRRSVSLGTLILIASIAGCGGGSDSASPAPSPSPA
FT                   PAPATTSVSTTVIDGALQNVKVCLDRNDNGSCDSEEPSAVTNASGKASLEVPEADVGKY
FT                   PILALVTKDSVDADTGAVPVAFILRAPADQPGIVSPLSTLVHAHSQATGSTTSDAAAAI
FT                   QSQLGLGTSALADFTQDGSNAGKLAATMARLIVVTTQTQLTNTAGATGVDGAPLTSVQL
FT                   NAAVNSVLLQQLQTLATAVLDNPALSDTSTSMKDKQSAMETAAQQVASASGVTAGNVGL
FT                   IAAMQAQTTSPEVGAPAPSTQLRWLSFTDTSNYYIRAFEATAEQNTPDANGKRYFTEFR
FT                   ERMVGGQEQPWSRPQVYWTGSEWFACPTDFVQQVTSLASGETESLYCKSLVSRAKQSVR
FT                   NIAGLKMRDIVTEIRSAPWQDSADGSFANWGPRPDQVPAETTFPSGSTLSYRTVTDLGG
FT                   SDYYLSNNVNRATIPRADAPNNPDSSTWRSATLAEFIAWNAGDFAPNVSAADVHGNNAR
FT                   VLVGRRDYLKPDGSAAYKRYMVGFENGGEQRARFYECEGDMSTLPSNRTLFINGVSTCK
FT                   TILVSNYSIATQADVKVLRFTQEPTQLNVSNFQNYRLFVERGGITYVGYRDKQMVSNQQ
FT                   RLNGTAADALLATLGLN"
FT   gene            707043..708221
FT                   /locus_tag="CtCNB1_0624"
FT   CDS_pept        707043..708221
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0624"
FT                   /product="transcriptional regulator, LuxR family"
FT                   /note="COG2771, CsgD, DNA-binding HTH domain-containing
FT                   proteins"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0624"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31370"
FT                   /db_xref="GOA:D0IZC0"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:D0IZC0"
FT                   /protein_id="ACY31370.1"
FT                   /translation="MAVAHLPLMLQERLPALIAAIYESALEPARWQGFLALFGAALRSP
FT                   ASVIWANDFAQRTVDLDGGFGTFGASQGFAAAELESFAAHYCQCNVWLQDQSLHRPGTV
FT                   VNSSTLFPDHSLPGTEWYGDWLQPQDLFYSCAAVVDNQHDRSFNITVVRPHAVGAYSAE
FT                   ELGLVQQLMPHLQTAFAMHRRLYRTQALLNASLAVLEDLPVGVVLLDERASVMHASSRA
FT                   LRLMEQSQLMYRAADESLQATNAADQRWLQKAMRDCVATGLGKALHHGRASRFTGLAGQ
FT                   QLQVMVSPLPIHSSPYGERSAAMLLISDPALSIPSLQDLLRNLYRLTLAEAQLAQALIN
FT                   GWTLQEFAERQGLSIHTARSQFKSAAVKVGVGRQADFVRVLLTGPAMLRWRE"
FT   gene            complement(708233..709594)
FT                   /locus_tag="CtCNB1_0625"
FT   CDS_pept        complement(708233..709594)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0625"
FT                   /product="general secretory pathway protein E"
FT                   /note="COG2804, PulE, Type II secretory pathway"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0625"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31371"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037257"
FT                   /db_xref="UniProtKB/TrEMBL:D0IZC1"
FT                   /protein_id="ACY31371.1"
FT                   /translation="MRYPLPYGFARSSQLLIEDDGQEPVLWHGPQPDWSAISEVQRKHA
FT                   VQRWQLLDSGALAHRISAAYAQSDSSAAMVVSEVESDADLTRMMQDLPAVEDLLETADD
FT                   APIIRMLNALLTQAARDGASDIHIEPYERHSSVRFRVDGDLREVVQPNRALHAALISRL
FT                   KIMADLDIAEKRLPQDGRISLRLGTRAIDVRVSTLPSAHGERAVLRLLDKSESKLSLEA
FT                   VGMGGETLRRFTHLTAQPHGIVLVTGPTGSGKTTTLYAALQRMDASHSNIMTVEDPIEY
FT                   ELAGVGQTQVNAKIELTFAKALRALLRQDPDVIMIGEIRDFETAQIAIQASLTGHLVLA
FT                   TLHTNDAPSAVTRLIDMGVEPFLLSSSLLGVLAQRLVRKVDQSEPSGYRGRTGIFELLA
FT                   VDDAIRAQIHRGASEAEIRETAMAAGMQLMREDGERLVREGITTQAEVMRVTRD"
FT   gene            complement(709608..711989)
FT                   /locus_tag="CtCNB1_0626"
FT   CDS_pept        complement(709608..711989)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0626"
FT                   /product="general secretion pathway protein D"
FT                   /note="COG1450, PulD, Type II secretory pathway"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0626"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31372"
FT                   /db_xref="GOA:D0IZC2"
FT                   /db_xref="InterPro:IPR001775"
FT                   /db_xref="InterPro:IPR004846"
FT                   /db_xref="InterPro:IPR005644"
FT                   /db_xref="InterPro:IPR013356"
FT                   /db_xref="InterPro:IPR038591"
FT                   /db_xref="UniProtKB/TrEMBL:D0IZC2"
FT                   /protein_id="ACY31372.1"
FT                   /translation="MTQHSRTAWQNTLHSIAVASLAVCISAPIHAQTQSGQANATPSLR
FT                   PGEPVTLNFTNADIEAVSRAMAAITNRNVVVDPRVKGQITLLTDKAVSPATAYQQYLAA
FT                   LRMQGFTVTESAGLFKVIPEADAKLQSSEVSVGQGGRGSQAGGGQIVTQIFKLNYENAN
FT                   NLVPVLRPLISPNNTINVNPGNNSLIITDYADNLQRISRIIASTDVSNATDVEVISLRH
FT                   AVAADMVALVNRLMEGGSATAGGVVQAGAGAAAGQADTSFRTSILAEPRSNSVLIRAAN
FT                   PAKLSQIRSLIARLDQPAMTGNGDDGNIHVVYLKNADAVSLAATLRAAINAQTSASTAL
FT                   GGQPGMTAAAGSTTNAASSQPVISRGTDGSATVGLGGGNSGPSSRFGTAQQPSTGGMIQ
FT                   ADPTTNSLIITAPGPLYRQLRTVIDKLDGRRAQVLIEALIVEVSADKAAQLGVQWSSVI
FT                   RNNGRVLGVLGNGTSISGISNIFGLSGAVGNLVNGTPLTDSQASAIGGMKGMNLGFTQN
FT                   VNGNTSLGALVNLMQGDGDTNILSTPNLMTLDNEEASIMVGENVPFPTGSYTNTAGTSG
FT                   SVNPFTTYERKDVGTLLKIRPQINENGTIKMAVYQENSAVKQGTANAQSGATTTKRSIE
FT                   SNVLVEDGAIVVLGGLIADEYSQSQERVPLLGDIPLLGNLFRNTSRERKKTNLMVFLRP
FT                   TVLRDANSTSQLSQDRYESIRGMQQTVQPDPNLLMRNVNAAPLLPASSSATPARAANVV
FT                   IVPGAKPEIVDFTRPGQPTVNGQPVTVTPVTPATLPPGTL"
FT   gene            complement(711993..712823)
FT                   /locus_tag="CtCNB1_0627"
FT   CDS_pept        complement(711993..712823)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0627"
FT                   /product="putative general secretory pathway N
FT                   transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0627"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31373"
FT                   /db_xref="GOA:D0IZC3"
FT                   /db_xref="InterPro:IPR022792"
FT                   /db_xref="UniProtKB/TrEMBL:D0IZC3"
FT                   /protein_id="ACY31373.1"
FT                   /translation="MKLSRSRPASQALRRQRDAGDPRSPRRWAVGGALLGALLTVLVQA
FT                   PAAWLAAGVQSITADQVQLQEPRGTLWRGSARLVLTGGKDSQDQSSLPTRLNWTLRPGL
FT                   SGASISLQSDCCTSTPMLAQLQPGWNAMTVRLKDSVLQLPADMLAGLGTPWNTVALQGQ
FT                   LRLSTVGLTLQYRAGRATSQGLTRLEALAVSSRLSSLRPLGSYRLDIQGGDNAQLNLTT
FT                   LGGDLQLSGQGQWVDSRLHFRGEASASPEREAALSNLLNILGRRQGARSIITFG"
FT   gene            complement(712833..713375)
FT                   /locus_tag="CtCNB1_0628"
FT   CDS_pept        complement(712833..713375)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0628"
FT                   /product="conserved hypothetical protein"
FT                   /note="COG3149, PulM, Type II secretory pathway"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0628"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31374"
FT                   /db_xref="GOA:D0IZC4"
FT                   /db_xref="InterPro:IPR007690"
FT                   /db_xref="InterPro:IPR023229"
FT                   /db_xref="UniProtKB/TrEMBL:D0IZC4"
FT                   /protein_id="ACY31374.1"
FT                   /translation="MKQKNALKTALAPLRQRWSALAQREQNLLLIAASVVLLALLWWVA
FT                   LAPALHSLRTAPARHAAAERELQNMLQMQAQAELLRQQPQGNSADARTQLEQSLKTELG
FT                   NSAQLQWLGNRAQVSLSNAAAPALARWLAQVRDNSHASVAEMKLNRNLGESVDGAAVTR
FT                   WSGNLLLDLPDNAGGQN"
FT   gene            complement(713372..714598)
FT                   /locus_tag="CtCNB1_0629"
FT   CDS_pept        complement(713372..714598)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_0629"
FT                   /product="General secretion pathway L"
FT                   /note="COG3297, PulL, Type II secretory pathway"
FT                   /db_xref="EnsemblGenomes-Gn:CtCNB1_0629"
FT                   /db_xref="EnsemblGenomes-Tr:ACY31375"
FT                   /db_xref="InterPro:IPR024230"
FT                   /db_xref="InterPro:IPR025691"
FT                   /db_xref="UniProtKB/TrEMBL:D0IZC5"
FT                   /protein_id="ACY31375.1"
FT                   /translation="MSTLLIQLSAKHANSATEYLYVLSDDGQSIQRSGQAAASLLPATG
FT                   RTAQITAVIPAAQLSWHAVTLPLGLNVQSRRQQRLRAVLEGLLEEKLLDEPSAMHLALD
FT                   AGSAAGQTCWVAACDKGWLQSHLQALEQHGHAASRLVPEQWPSSKAQLLLSGDSTLPQL
FT                   SATGLDAQTCLVVLPLHADGGLLQPLLARLPEDLPVLAEPHLAHSAETLQRPVSIFTAA
FT                   QRLLQSHGYAGDLAQFDLDLGGSTRAKRRLLDAWHGFAKAPQWRAARWAAGIAVVAQLA
FT                   GLNAWAFRENRAIELRQQQAKQVLQTTFPHVPVIIDAPAQMQRELDLLRSNSGALSASD
FT                   LEALLAASAGIQGVQNAKSLQYQDKQLRISGLDLSPEALGDAQQSLQANGYMLQREGAD
FT                   LVLSAKARP"
FT   gene            complement(714644..715630)
FT                   /locus_tag="CtCNB1_0630"
FT   CDS_pept        complement(714644..715630)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CtCNB1_06