(data stored in SCRATCH3701 zone)

EMBL: CP001227

ID   CP001227; SV 1; circular; genomic DNA; STD; PRO; 1288492 BP.
XX
AC   CP001227;
XX
PR   Project:PRJNA31309;
XX
DT   31-MAY-2009 (Rel. 101, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 6)
XX
DE   Rickettsia peacockii str. Rustic, complete genome.
XX
KW   .
XX
OS   Rickettsia peacockii str. Rustic
OC   Bacteria; Proteobacteria; Alphaproteobacteria; Rickettsiales;
OC   Rickettsiaceae; Rickettsieae; Rickettsia; spotted fever group.
XX
RN   [1]
RC   Publication Status: Online-Only
RP   1-1288492
RX   DOI; 10.1371/journal.pone.0008361.
RX   PUBMED; 20027221.
RA   Felsheim R.F., Kurtti T.J., Munderloh U.G.;
RT   "Genome sequence of the endosymbiont Rickettsia peacockii and comparison
RT   with virulent Rickettsia rickettsii: identification of virulence factors";
RL   PLoS One 4(12):E8361-E8361(2009).
XX
RN   [2]
RP   1-1288492
RA   Felsheim R.F., Kurtti T.J., Munderloh U.G.;
RT   ;
RL   Submitted (10-NOV-2008) to the INSDC.
RL   Entomology, University of Minnesota, 1980 Folwell Ave, St. Paul, MN 55108,
RL   USA
XX
DR   MD5; 42e008976aad1f4da661892c93e92833.
DR   BioSample; SAMN02604073.
DR   EnsemblGenomes-Gn; EBG00001225243.
DR   EnsemblGenomes-Gn; EBG00001225244.
DR   EnsemblGenomes-Gn; EBG00001225245.
DR   EnsemblGenomes-Gn; EBG00001225246.
DR   EnsemblGenomes-Gn; EBG00001225247.
DR   EnsemblGenomes-Gn; EBG00001225248.
DR   EnsemblGenomes-Gn; EBG00001225249.
DR   EnsemblGenomes-Gn; EBG00001225250.
DR   EnsemblGenomes-Gn; EBG00001225251.
DR   EnsemblGenomes-Gn; EBG00001225252.
DR   EnsemblGenomes-Gn; EBG00001225253.
DR   EnsemblGenomes-Gn; EBG00001225254.
DR   EnsemblGenomes-Gn; EBG00001225255.
DR   EnsemblGenomes-Gn; EBG00001225256.
DR   EnsemblGenomes-Gn; EBG00001225257.
DR   EnsemblGenomes-Gn; EBG00001225258.
DR   EnsemblGenomes-Gn; EBG00001225259.
DR   EnsemblGenomes-Gn; EBG00001225260.
DR   EnsemblGenomes-Gn; EBG00001225261.
DR   EnsemblGenomes-Gn; EBG00001225262.
DR   EnsemblGenomes-Gn; EBG00001225263.
DR   EnsemblGenomes-Gn; EBG00001225264.
DR   EnsemblGenomes-Gn; EBG00001225265.
DR   EnsemblGenomes-Gn; EBG00001225266.
DR   EnsemblGenomes-Gn; EBG00001225267.
DR   EnsemblGenomes-Gn; EBG00001225268.
DR   EnsemblGenomes-Gn; EBG00001225269.
DR   EnsemblGenomes-Gn; EBG00001225270.
DR   EnsemblGenomes-Gn; EBG00001225271.
DR   EnsemblGenomes-Gn; EBG00001225272.
DR   EnsemblGenomes-Gn; EBG00001225273.
DR   EnsemblGenomes-Gn; EBG00001225274.
DR   EnsemblGenomes-Gn; EBG00001225275.
DR   EnsemblGenomes-Gn; EBG00001225276.
DR   EnsemblGenomes-Gn; EBG00001225277.
DR   EnsemblGenomes-Gn; EBG00001225278.
DR   EnsemblGenomes-Gn; EBG00001225279.
DR   EnsemblGenomes-Gn; EBG00001225280.
DR   EnsemblGenomes-Gn; EBG00001225281.
DR   EnsemblGenomes-Gn; EBG00001225282.
DR   EnsemblGenomes-Gn; EBG00001225283.
DR   EnsemblGenomes-Gn; EBG00001225284.
DR   EnsemblGenomes-Gn; EBG00001225285.
DR   EnsemblGenomes-Gn; RPR_r07840.
DR   EnsemblGenomes-Gn; RPR_r07841.
DR   EnsemblGenomes-Gn; RPR_r07842.
DR   EnsemblGenomes-Gn; RPR_t07772.
DR   EnsemblGenomes-Gn; RPR_t07774.
DR   EnsemblGenomes-Gn; RPR_t07776.
DR   EnsemblGenomes-Gn; RPR_t07778.
DR   EnsemblGenomes-Gn; RPR_t07780.
DR   EnsemblGenomes-Gn; RPR_t07782.
DR   EnsemblGenomes-Gn; RPR_t07784.
DR   EnsemblGenomes-Gn; RPR_t07786.
DR   EnsemblGenomes-Gn; RPR_t07788.
DR   EnsemblGenomes-Gn; RPR_t07790.
DR   EnsemblGenomes-Gn; RPR_t07792.
DR   EnsemblGenomes-Gn; RPR_t07794.
DR   EnsemblGenomes-Gn; RPR_t07796.
DR   EnsemblGenomes-Gn; RPR_t07798.
DR   EnsemblGenomes-Gn; RPR_t07800.
DR   EnsemblGenomes-Gn; RPR_t07802.
DR   EnsemblGenomes-Gn; RPR_t07804.
DR   EnsemblGenomes-Gn; RPR_t07806.
DR   EnsemblGenomes-Gn; RPR_t07808.
DR   EnsemblGenomes-Gn; RPR_t07810.
DR   EnsemblGenomes-Gn; RPR_t07812.
DR   EnsemblGenomes-Gn; RPR_t07814.
DR   EnsemblGenomes-Gn; RPR_t07816.
DR   EnsemblGenomes-Gn; RPR_t07818.
DR   EnsemblGenomes-Gn; RPR_t07820.
DR   EnsemblGenomes-Gn; RPR_t07822.
DR   EnsemblGenomes-Gn; RPR_t07824.
DR   EnsemblGenomes-Gn; RPR_t07826.
DR   EnsemblGenomes-Gn; RPR_t07828.
DR   EnsemblGenomes-Gn; RPR_t07830.
DR   EnsemblGenomes-Gn; RPR_t07832.
DR   EnsemblGenomes-Gn; RPR_t07834.
DR   EnsemblGenomes-Gn; RPR_t07836.
DR   EnsemblGenomes-Gn; RPR_t07838.
DR   EnsemblGenomes-Tr; EBT00001794016.
DR   EnsemblGenomes-Tr; EBT00001794017.
DR   EnsemblGenomes-Tr; EBT00001794018.
DR   EnsemblGenomes-Tr; EBT00001794019.
DR   EnsemblGenomes-Tr; EBT00001794020.
DR   EnsemblGenomes-Tr; EBT00001794021.
DR   EnsemblGenomes-Tr; EBT00001794022.
DR   EnsemblGenomes-Tr; EBT00001794023.
DR   EnsemblGenomes-Tr; EBT00001794024.
DR   EnsemblGenomes-Tr; EBT00001794025.
DR   EnsemblGenomes-Tr; EBT00001794026.
DR   EnsemblGenomes-Tr; EBT00001794027.
DR   EnsemblGenomes-Tr; EBT00001794028.
DR   EnsemblGenomes-Tr; EBT00001794029.
DR   EnsemblGenomes-Tr; EBT00001794030.
DR   EnsemblGenomes-Tr; EBT00001794031.
DR   EnsemblGenomes-Tr; EBT00001794032.
DR   EnsemblGenomes-Tr; EBT00001794033.
DR   EnsemblGenomes-Tr; EBT00001794034.
DR   EnsemblGenomes-Tr; EBT00001794035.
DR   EnsemblGenomes-Tr; EBT00001794036.
DR   EnsemblGenomes-Tr; EBT00001794037.
DR   EnsemblGenomes-Tr; EBT00001794038.
DR   EnsemblGenomes-Tr; EBT00001794039.
DR   EnsemblGenomes-Tr; EBT00001794040.
DR   EnsemblGenomes-Tr; EBT00001794041.
DR   EnsemblGenomes-Tr; EBT00001794042.
DR   EnsemblGenomes-Tr; EBT00001794043.
DR   EnsemblGenomes-Tr; EBT00001794044.
DR   EnsemblGenomes-Tr; EBT00001794045.
DR   EnsemblGenomes-Tr; EBT00001794046.
DR   EnsemblGenomes-Tr; EBT00001794047.
DR   EnsemblGenomes-Tr; EBT00001794048.
DR   EnsemblGenomes-Tr; EBT00001794049.
DR   EnsemblGenomes-Tr; EBT00001794050.
DR   EnsemblGenomes-Tr; EBT00001794051.
DR   EnsemblGenomes-Tr; EBT00001794052.
DR   EnsemblGenomes-Tr; EBT00001794053.
DR   EnsemblGenomes-Tr; EBT00001794054.
DR   EnsemblGenomes-Tr; EBT00001794055.
DR   EnsemblGenomes-Tr; EBT00001794056.
DR   EnsemblGenomes-Tr; EBT00001794057.
DR   EnsemblGenomes-Tr; EBT00001794058.
DR   EnsemblGenomes-Tr; RPR_r07840-1.
DR   EnsemblGenomes-Tr; RPR_r07841-1.
DR   EnsemblGenomes-Tr; RPR_r07842-1.
DR   EnsemblGenomes-Tr; RPR_t07772-1.
DR   EnsemblGenomes-Tr; RPR_t07774-1.
DR   EnsemblGenomes-Tr; RPR_t07776-1.
DR   EnsemblGenomes-Tr; RPR_t07778-1.
DR   EnsemblGenomes-Tr; RPR_t07780-1.
DR   EnsemblGenomes-Tr; RPR_t07782-1.
DR   EnsemblGenomes-Tr; RPR_t07784-1.
DR   EnsemblGenomes-Tr; RPR_t07786-1.
DR   EnsemblGenomes-Tr; RPR_t07788-1.
DR   EnsemblGenomes-Tr; RPR_t07790-1.
DR   EnsemblGenomes-Tr; RPR_t07792-1.
DR   EnsemblGenomes-Tr; RPR_t07794-1.
DR   EnsemblGenomes-Tr; RPR_t07796-1.
DR   EnsemblGenomes-Tr; RPR_t07798-1.
DR   EnsemblGenomes-Tr; RPR_t07800-1.
DR   EnsemblGenomes-Tr; RPR_t07802-1.
DR   EnsemblGenomes-Tr; RPR_t07804-1.
DR   EnsemblGenomes-Tr; RPR_t07806-1.
DR   EnsemblGenomes-Tr; RPR_t07808-1.
DR   EnsemblGenomes-Tr; RPR_t07810-1.
DR   EnsemblGenomes-Tr; RPR_t07812-1.
DR   EnsemblGenomes-Tr; RPR_t07814-1.
DR   EnsemblGenomes-Tr; RPR_t07816-1.
DR   EnsemblGenomes-Tr; RPR_t07818-1.
DR   EnsemblGenomes-Tr; RPR_t07820-1.
DR   EnsemblGenomes-Tr; RPR_t07822-1.
DR   EnsemblGenomes-Tr; RPR_t07824-1.
DR   EnsemblGenomes-Tr; RPR_t07826-1.
DR   EnsemblGenomes-Tr; RPR_t07828-1.
DR   EnsemblGenomes-Tr; RPR_t07830-1.
DR   EnsemblGenomes-Tr; RPR_t07832-1.
DR   EnsemblGenomes-Tr; RPR_t07834-1.
DR   EnsemblGenomes-Tr; RPR_t07836-1.
DR   EnsemblGenomes-Tr; RPR_t07838-1.
DR   EuropePMC; PMC2791219; 20027221.
DR   EuropePMC; PMC3557878; 23171714.
DR   EuropePMC; PMC3837795; 24077705.
DR   EuropePMC; PMC4540899; 26135877.
DR   EuropePMC; PMC4734531; 26811941.
DR   EuropePMC; PMC5366151; 28340608.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01774; rpsL_ricks.
DR   RFAM; RF01849; alpha_tmRNA.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   SILVA-LSU; CP001227.
DR   SILVA-SSU; CP001227.
XX
CC   Bacteria (Rickettsia peacockii Rustic) is available from Dr. Ulrike
CC   Munderloh at the University of Minnesota.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1288492
FT                   /organism="Rickettsia peacockii str. Rustic"
FT                   /strain="Rustic"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:562019"
FT   gene            1..825
FT                   /locus_tag="RPR_00005"
FT   CDS_pept        1..825
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_00005"
FT                   /product="hypothetical protein"
FT                   /note="COG1806 Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_00005"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47018"
FT                   /db_xref="GOA:C4K0B5"
FT                   /db_xref="InterPro:IPR005177"
FT                   /db_xref="InterPro:IPR026565"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4K0B5"
FT                   /protein_id="ACR47018.1"
FT                   /translation="MTKLIIHLVSDSSVQTAKYAANSALAQFTSVKPKLYHWPMIRNLE
FT                   LLNEVLSKIEYKHGIVLYTIADQELRKTLTKFCYELKIPCISVIGKIIKEMSVFSGIEI
FT                   EKEQNYNNYKFDKTYFDTLNAIDYAIRHDDGQMLNELSEADIILIGPSRTSKTPTSVFL
FT                   AYNGLKAANIPYVYNCPFPDFIEKDIDQLVVGLVINPNRLIEIREARLNLLQINENKSY
FT                   TDFNIVQKECLEVRKICDQRNWPVIDVSTRSIEETAALIMRIYYNRKNKYNK"
FT   gene            1043..1360
FT                   /locus_tag="RPR_00010"
FT   CDS_pept        1043..1360
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_00010"
FT                   /product="thioredoxin"
FT                   /note="COG0526 Thiol-disulfide isomerase and thioredoxins"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_00010"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47019"
FT                   /db_xref="GOA:C4K0B6"
FT                   /db_xref="InterPro:IPR005746"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:C4K0B6"
FT                   /protein_id="ACR47019.1"
FT                   /translation="MANNVMDSSFKKEVLESDLPVLVDFWAEWCGPCKMLTPIIDEISK
FT                   ELQGKVKVLKMNIDENPNTPSEYGIRSIPTIMLFKNGEQKDTKIGLQQKNSLLDWINKS
FT                   I"
FT   gene            1371..2120
FT                   /locus_tag="RPR_00015"
FT   CDS_pept        1371..2120
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_00015"
FT                   /product="O-antigen export system ATP-binding protein RfbE"
FT                   /note="COG1134 ABC-type polysaccharide/polyol phosphate
FT                   transport system, ATPase component"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_00015"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47020"
FT                   /db_xref="GOA:C4K0B7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C4K0B7"
FT                   /protein_id="ACR47020.1"
FT                   /translation="MSLSYPKVFIEITNGYVEGIDTHKRAQGLKHFFLKKGVSLSPNIP
FT                   ILNNINFSCYEGEKIAFIGSNGSGKSSFLKLIAGIYPLKSGTVKVHGDIAAIIDMGVGF
FT                   ESEQTGRENIKMLMLYNNMLDKYSKKIEKEIIDFSELGSKIDLPIKIYSSGMLSRLAFS
FT                   VSIFQNPQILLLDEVFAAGDSYFIEKSLSLMKNKFKNTPISIIVSHQEEIIKDNCDRCI
FT                   LLKDGNIIGDGTPSEMFKIYNQQQGNS"
FT   gene            2121..2897
FT                   /locus_tag="RPR_00020"
FT   CDS_pept        2121..2897
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_00020"
FT                   /product="O-antigen export system permease protein RfbA"
FT                   /note="COG1682 ABC-type polysaccharide/polyol phosphate
FT                   export systems, permease component"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_00020"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47021"
FT                   /db_xref="GOA:C4K0B8"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:C4K0B8"
FT                   /protein_id="ACR47021.1"
FT                   /translation="MIKYFFSKKYWRAIALLVKASIIRQNKDSFLGSLWSLIQPFIHIM
FT                   VISYFFGFLLKQPREFMVMNLVGGIPLWSFIVSSLTICSSSLVTRDQIIKKVRISKTFF
FT                   PVADSLGQLYTLICSFSAMYFAFILLFPEKFSWQIIFMPILILPLIICVISGSIAVAFL
FT                   TPYIRDIPQMLSVILGVIYWSIPIVYPYSLIPESKKIYFEFNPFFLVIRPVQALVIDGT
FT                   LPGMMLIVKSIIVAFITVCISYLIYRQFSKRVIYYL"
FT   gene            2894..5995
FT                   /locus_tag="RPR_00025"
FT   CDS_pept        2894..5995
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_00025"
FT                   /product="putative bifunctional glutamate synthase subunit
FT                   beta/2-polyprenylphenol hydroxylase"
FT                   /note="COG0493 NADPH-dependent glutamate synthase beta
FT                   chain and related oxidoreductases"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_00025"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47022"
FT                   /db_xref="GOA:C4K0B9"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C4K0B9"
FT                   /protein_id="ACR47022.1"
FT                   /translation="MKLGFNLNFNELDLTGLKKLDQIFLDYLFKADRSLHKDLMLFRST
FT                   PLSIIPKDYSEFLLKISPHLDDFLAELFCISKEITISRLKYKDFDIIYECKRKFVQRVA
FT                   VKKYPLEKIKDIDFEDVYLKLTDLIGANFTSREFAKQIIIWQQAEESFAEELDIAARYA
FT                   AYRVYLCESIKPQDNILFNLPQKLDKENLIDDKKILKYQKNERVDFDYTDSFLNLDEAL
FT                   NHSHYCIYCHKQDKDSCSKGLLQPQNRHCEERSDVAISGDLTRLPRSLQSLAMTDLKQG
FT                   CPLKQKISEMNYVKAQGFNLSALAIIVIDNPMVAATGHRICNDCSKACIYQKQDPVNIP
FT                   LIESNILEETLKLPYGLEIYLLLTRWNPLNIYAPLPKEPTNYNILVTGLGPAGFSLSYY
FT                   LLRSGHNVVAIDGLRITLLPFDVHKPIKFWHEYKNLLSERMPRGFGGVAEYGITVRWDK
FT                   NNLDILRLILERNNNFKYYDGVALDFNITKEQAFDLGFDYIAFCIGAGQPKVLDIENFE
FT                   AKGVKTASDFLMTLQNGGAFLKNSSTNMVIRMPIAVIGGGLTSLDAATESLYYYKKQVE
FT                   EFAEDYIEKDLTEEDKEIAEEFIAHAKLFKEAKNNEELRKVFNKLGGATVYYRGRLQDS
FT                   PAYKLNHEELIYALALGVDFKENMQPLRINIDKYGHVESVEFENRNRHCEQSKTAWQSQ
FT                   EFDLTRLPRQCYAFPRNDIKTKTVIMAIGIENNTQFDEDKYSYFGDCNPKYSGSVVKAL
FT                   ASTKEGYDAINKKLINNNPSFKGSYKDFCTQLDYLLTSRVNKINILDDKTFELIIHSPL
FT                   AAKNFKFGQFFRLQNYSEDAAKLIEPVALSPIDIDVEKGLISFIVFEVGKSTSLCKTLS
FT                   ENEKVVLMGPTGSSLEIPQNKKIVIVDFEVGNIGLLKVLKENNNEVIFVTYPDIKIRKL
FT                   VLVDIVIINASPEIIEELQSLKNEIFSENTKIIVSVNSSMQCMMKGICGQCIQKVKGEQ
FT                   KYIFACSQQNQNAEIVDFKSLKTRLRQNSLQEKMRKLVANSSII"
FT   gene            complement(6040..6279)
FT                   /locus_tag="RPR_00030"
FT   CDS_pept        complement(6040..6279)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_00030"
FT                   /product="hypothetical protein"
FT                   /note="COG2337 Growth inhibitor"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_00030"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47023"
FT                   /db_xref="GOA:C4K0C0"
FT                   /db_xref="InterPro:IPR003477"
FT                   /db_xref="UniProtKB/TrEMBL:C4K0C0"
FT                   /protein_id="ACR47023.1"
FT                   /translation="MLGVISGDYGKPRSAVVVQSNLYKNHPSITVCLHNGFNRCPTTFH
FT                   LLLTPTELNGFNLESHIMVDEISAIRSDKIQKNW"
FT   gene            complement(6625..7419)
FT                   /locus_tag="RPR_00035"
FT   CDS_pept        complement(6625..7419)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_00035"
FT                   /product="UDP-N-acetylglucosamine acyltransferase"
FT                   /EC_number="2.3.1.129"
FT                   /note="COG1043 Acyl-[acyl carrier
FT                   protein]--UDP-N-acetylglucosamine O-acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_00035"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47024"
FT                   /db_xref="GOA:C4K0C1"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR010137"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR029098"
FT                   /db_xref="InterPro:IPR037157"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4K0C1"
FT                   /protein_id="ACR47024.1"
FT                   /translation="MSNSNIHTTAVIAEGTKLGNNVKIGPYCIIGPKVVLHDNVELKSH
FT                   VVIEGITEIGENTVIYPFASIGQPPQILKYANERSSTIIGSNNTIREYVTVQAGSQGGG
FT                   MMTRVGNNNLFMVGVHIGHDCKIGNNVVFANYVSLAGHIGVGDYAIIGGLSAVHQYARI
FT                   GEYSMIGGLSPVGADVIPFGLVSSKRAVLEGLNLIGMNRKGFDKVKSLSALKAIEEIFS
FT                   GEGNFAERIKQVAEKYNNNSIVIQIIDFLNQDSSRAFCRFEK"
FT   gene            complement(7427..7864)
FT                   /gene="fabZ"
FT                   /locus_tag="RPR_00040"
FT   CDS_pept        complement(7427..7864)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fabZ"
FT                   /locus_tag="RPR_00040"
FT                   /product="(3R)-hydroxymyristoyl-ACP dehydratase"
FT                   /note="COG0764 3-hydroxymyristoyl/3-hydroxydecanoyl-(acyl
FT                   carrier protein) dehydratases"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_00040"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47025"
FT                   /db_xref="GOA:C4K0C2"
FT                   /db_xref="InterPro:IPR010084"
FT                   /db_xref="InterPro:IPR013114"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4K0C2"
FT                   /protein_id="ACR47025.1"
FT                   /translation="MIIDITEIMDWIPHRYPFLLVDRVLKIDPNKSITGIKNVTVNEPQ
FT                   FTGHFPARPVMPGVLMVEAMAQLAAILVAKSLGSTKNKEVFLMTIENAKFRRIVQPGDT
FT                   MHIHAVIDQQRANVWKFSSTVTVEGEIAAESKFTAMIKDKT"
FT   gene            complement(8060..9100)
FT                   /gene="lpxD"
FT                   /locus_tag="RPR_00045"
FT   CDS_pept        complement(8060..9100)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lpxD"
FT                   /locus_tag="RPR_00045"
FT                   /product="UDP-3-O-[3-hydroxymyristoyl] glucosamine
FT                   N-acyltransferase"
FT                   /note="COG1044 UDP-3-O-[3-hydroxymyristoyl] glucosamine
FT                   N-acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_00045"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47026"
FT                   /db_xref="GOA:C4K0C3"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR007691"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR020573"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4K0C3"
FT                   /protein_id="ACR47026.1"
FT                   /translation="MVSSNFYKNLGPRKLTAIIDFLHDIIAPPKIHEDIAIHDIKILQE
FT                   ASPNDISFLSNPKYSEFLKTTKAAACIVPKNFTGEANPNTVLLHAQNSYFAYSKLIDFF
FT                   YAPIKSYPTKIMKSAIVADSATIGKNCYIGHNVVIEDDVIIGDNSIIEAGSFIGRGVNI
FT                   GRNARIEQHVSINYAIIGDDVVILAGAKIGQDGFGFSTEKGVHHKIFHIGIVKIGNNVE
FT                   IGANTTIDRGSLQDTIIKDLCRIDNLVQIGHGVKIGKGSIIVAQTGIAGSSTIGKYCAL
FT                   GGQVGIAGHLNIGDGAQVAAQGGVAQNIEAGKIVGGSPAIPIMDWHRQSIIMKQLLKTS
FT                   NSKLKK"
FT   gene            9930..10484
FT                   /locus_tag="RPR_00050"
FT   CDS_pept        9930..10484
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_00050"
FT                   /product="alpha-beta hydrolase family esterase"
FT                   /note="COG1752 Predicted esterase of the alpha-beta
FT                   hydrolase superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_00050"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47027"
FT                   /db_xref="GOA:C4K0C4"
FT                   /db_xref="InterPro:IPR002641"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="UniProtKB/TrEMBL:C4K0C4"
FT                   /protein_id="ACR47027.1"
FT                   /translation="MTVFPEILSYENAPDEKVVKFVYASGAFPIYFQPVQKTVQGVVST
FT                   YVDGGVTNNYLVEVFDDKTAARSLPQTDNKNYKTLGFKPINKEILEAYQNGTEPKPFVD
FT                   TTTVVDQLYALAEVLTSFDLISCFQNHDRTVFIDDHNISALSFDITAEQKEALINSGYS
FT                   ATYDYVMRIENIMLAGLGVND"
FT   gene            complement(11128..11874)
FT                   /locus_tag="RPR_00055"
FT   CDS_pept        complement(11128..11874)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_00055"
FT                   /product="putative cytoplasmic protein"
FT                   /note="COG3022 Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_00055"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47028"
FT                   /db_xref="InterPro:IPR005583"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4K0C5"
FT                   /protein_id="ACR47028.1"
FT                   /translation="MFAIISSAKTLNFEKLAPKTELTIPMFLTLTNKLLSTLQSYSENQ
FT                   LSKIMNISAKLAHINKERFKDFDNQESKAAIFAYAGDVFNNIHIEKLTNHALNFLQSHL
FT                   LIISGLYGVLKPLDTIKPYRLEMATKLNEINLTNFWQDEVTNYINKILAKQENKYLLNL
FT                   ASQEYSSVINPNKLKYQLVNVHFKENRNGKLSTIGINAKKARGAMVKVIANNLIDSPEL
FT                   LKNFSYLGYAFSTKHSSDNELVFIKS"
FT   gene            complement(12639..12881)
FT                   /gene="himD"
FT                   /locus_tag="RPR_00060"
FT   CDS_pept        complement(12639..12881)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="himD"
FT                   /locus_tag="RPR_00060"
FT                   /product="integration host factor beta-subunit"
FT                   /note="COG0776 Bacterial nucleoid DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_00060"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47937"
FT                   /db_xref="GOA:C4K0C6"
FT                   /db_xref="InterPro:IPR000119"
FT                   /db_xref="InterPro:IPR010992"
FT                   /db_xref="UniProtKB/TrEMBL:C4K0C6"
FT                   /protein_id="ACR47937.1"
FT                   /translation="MITKNYLIDKIHDKLNYLSKEDVKDSVDLILDYLNESLKQQKRIE
FT                   IRNFGNFSIRKRKFPESEKFYNTVYYRMPKNLFKE"
FT   misc_feature    complement(12884..13789)
FT                   /note="authentic frameshifts: common BLAST hit:
FT                   gi|15892681|ref|NP_360395.1| protease IV"
FT   gene            complement(13914..15290)
FT                   /gene="rho"
FT                   /locus_tag="RPR_00090"
FT   CDS_pept        complement(13914..15290)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rho"
FT                   /locus_tag="RPR_00090"
FT                   /product="transcription termination factor Rho"
FT                   /note="COG1158 Transcription termination factor"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_00090"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47029"
FT                   /db_xref="GOA:C4K0C7"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004665"
FT                   /db_xref="InterPro:IPR011112"
FT                   /db_xref="InterPro:IPR011113"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036269"
FT                   /db_xref="InterPro:IPR041703"
FT                   /db_xref="UniProtKB/TrEMBL:C4K0C7"
FT                   /protein_id="ACR47029.1"
FT                   /translation="MNTTNKESTTELNNTESNNNYNNFAENGNIINLKQLKRKLPEELQ
FT                   AQAEELKIENINSLLKQELVFAILKKSVEQGVLIVGEGVLEVLPDGFGFLRSPEVNYLA
FT                   GPDDIYISPSQIRRFGLRTGDTVEGQIRAPKAGERYFALLKVNRVNFEDPSKAYHRVHF
FT                   DNLTPLYPDEKLGLELENNSKDSKDFSTRVIELVAPMGKGQRALIVAPPRTGKTVLLQN
FT                   IAHAITTNNPEVFLIVLLIDERPEEVTDMQRSVRGEVVSSTFDEPASRHVQLAEMVIKK
FT                   AKRLVEHKKDVVILVDAITRLARAYNTVVPSSGKVLTGGVDANALQRPKRFFGAARNIE
FT                   NGGSLTIIGTALIETGSRMDEVIFEEFKGTGNSEIVLDRKIADKRIYPAIDITRSGTRK
FT                   EDLLVDKIILNKMWVLRRIIDPMGSSEAIEFLLKKLENTKTNGEFFEMMKSPERPKNGL
FT                   "
FT   misc_feature    complement(15676..16998)
FT                   /note="authentic internal stop codon: common BLAST hit:
FT                   gi|157964582|ref|YP_001499406.1| methyltransferase class I"
FT   gene            complement(17042..18805)
FT                   /locus_tag="RPR_00105"
FT   CDS_pept        complement(17042..18805)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_00105"
FT                   /product="single-stranded-DNA-specific exonuclease RecJ"
FT                   /note="COG0608 Single-stranded DNA-specific exonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_00105"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47030"
FT                   /db_xref="GOA:C4K0C8"
FT                   /db_xref="InterPro:IPR001667"
FT                   /db_xref="InterPro:IPR003156"
FT                   /db_xref="InterPro:IPR004610"
FT                   /db_xref="InterPro:IPR038763"
FT                   /db_xref="InterPro:IPR041122"
FT                   /db_xref="UniProtKB/TrEMBL:C4K0C8"
FT                   /protein_id="ACR47030.1"
FT                   /translation="MKPQASINGKIWQQKLINEDIVTELCRSFKISDLLARIVSLRVNN
FT                   LEEVENFLRPKIKNLLPDPFHLLDMEKAVDRTVTAILNNQKICIFADYDVDGATSAALL
FT                   KNIFRDLNILCDIYVPDRIAEGYGPTPFAMQKIKDNGTELLITVDCGAMAHEALKYAKD
FT                   VNLDVIVIDHHIATEILPDAVAIVNPNRIDEKSEYKHLAAVGVAFLFATAILSNLKKQN
FT                   YFTQTMLQPNLMQYLDLVALGTVCDMMKLTGLNRAFVASGLKVIQQRQNIGIKTLYDMA
FT                   GLHEIPKCYHLGFILGPRINAGGRVGKSSLGAHLLSTSCSNEANKLAKELEKHNNERKV
FT                   IELLMIEEAMEIALTQQDSSLLFIVKEGWHPGVIGIVAGKLKEKFDKPVAVIALNDGIG
FT                   KASCRSILGIDFGAEIINAKSKDLLIAGGGHAMAAGFTVTAEKLQELQNFFNNAFRISI
FT                   TKLENYKHAEYDIDLTVNSVNFPLMEELNTLEPFGQENHEPIFKFDDLFVLKADIVGSK
FT                   HIKCMLVPNKRGFGNKALSAIAFNSVGTAFEDVLLSPKAKNIAAIGTLKTNNWQDNYTI
FT                   QLIIKDILLKE"
FT   gene            complement(18964..20031)
FT                   /gene="prfA"
FT                   /locus_tag="RPR_00110"
FT   CDS_pept        complement(18964..20031)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prfA"
FT                   /locus_tag="RPR_00110"
FT                   /product="peptide chain release factor 1"
FT                   /note="COG0216 Protein chain release factor A"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_00110"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47031"
FT                   /db_xref="GOA:C4K0C9"
FT                   /db_xref="InterPro:IPR000352"
FT                   /db_xref="InterPro:IPR004373"
FT                   /db_xref="InterPro:IPR005139"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4K0C9"
FT                   /protein_id="ACR47031.1"
FT                   /translation="MRFSDNLAKILDKYENLGNTLSSGIMGDEFVKASKEYAELEDVVA
FT                   KIKEYNKAKSELEEANNFKLEVGLDNATLEMIEDEIYTLENSLPKLERAVKIALLPKDD
FT                   ADSKSAIIEVRAGSGGEEAALFAAVLFNMYQRYAELKGWRFEILAISDTGIGGYKEASA
FT                   SIKGKDVFSKLKFESGVHRVQRVPETESQGRIHTSAATVAVLPEAEEVDIKIEDKDLRI
FT                   DTYRASGAGGQHVNTTDSAVRITHIPTGITVALQDEKSQHKNKAKALKILRARIYEEER
FT                   RKKEQERADSRRGQVGSGDRSERIRTYNFPQGRVSDHRINLTLYKIDEVVKNGQLDEFV
FT                   EALIADDEAKKLLEI"
FT   gene            complement(20164..21402)
FT                   /locus_tag="RPR_00115"
FT   CDS_pept        complement(20164..21402)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_00115"
FT                   /product="branched-chain alpha-keto acid dehydrogenase
FT                   subunit E2"
FT                   /note="COG0508 Pyruvate/2-oxoglutarate dehydrogenase
FT                   complex, dihydrolipoamide acyltransferase (E2) component,
FT                   and related enzymes"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_00115"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47032"
FT                   /db_xref="GOA:C4K0D0"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001078"
FT                   /db_xref="InterPro:IPR003016"
FT                   /db_xref="InterPro:IPR004167"
FT                   /db_xref="InterPro:IPR006257"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR036625"
FT                   /db_xref="UniProtKB/TrEMBL:C4K0D0"
FT                   /protein_id="ACR47032.1"
FT                   /translation="MPIKILMPALSPTMTEGNLARWLKKEGDKVNPGEVIAEIETDKAT
FT                   MEVEAVDEGILAKIVIPQNSQNVPVNSLIAVLSEEGEEKTDIDAFIAKNNSVSPSPKTD
FT                   ANLPKPHENITNVEEQVTVIKHDASKIFASPLAKRLAKMRNIRFESVKGSGPHGRIVKQ
FT                   DILSYTPNTAHNKIVSRNPEEYRLVPNNNIRKIIAKRLLESKQTVPHFYLSIECNVDKL
FT                   LDIREDINKSFSEDKSTRISVNDFIILAVAKALQEVPNANASWGEDAIRYYNNVDISVA
FT                   VAIENGLVTPIVKNANQKNILELSREMKALIKKAKDNKLTPEEFQGGGFTISNLGMYGI
FT                   KNFNAIINPPQSCIMGVGASAKRAIVKNDQITIATIMDVTLSADHRVVDGAVGAEFLAA
FT                   FKKFIESPVLMLI"
FT   gene            complement(21548..22021)
FT                   /gene="infC"
FT                   /locus_tag="RPR_00120"
FT   CDS_pept        complement(21548..22021)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="infC"
FT                   /locus_tag="RPR_00120"
FT                   /product="translation initiation factor IF-3"
FT                   /note="COG0290 Translation initiation factor 3 (IF-3)"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_00120"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47033"
FT                   /db_xref="GOA:C4K0D1"
FT                   /db_xref="InterPro:IPR001288"
FT                   /db_xref="InterPro:IPR019813"
FT                   /db_xref="InterPro:IPR019814"
FT                   /db_xref="InterPro:IPR019815"
FT                   /db_xref="InterPro:IPR036787"
FT                   /db_xref="InterPro:IPR036788"
FT                   /db_xref="UniProtKB/TrEMBL:C4K0D1"
FT                   /protein_id="ACR47033.1"
FT                   /translation="MRLVGENGEMHGVVNIREALDMAERAGLDLVEISPNAVPPVCKIL
FT                   DFGKFKYESKKRLHEARKKQKIIVLKEMKFKPNISIGDFETKLRKIKEFLKDGDKVKIS
FT                   LWFKGREILHKEVGQELFKRIEVGLEGLVKIDQHAKMEGKQMIMIVSSDIKVQ"
FT   gene            complement(22172..22501)
FT                   /locus_tag="RPR_00125"
FT   CDS_pept        complement(22172..22501)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_00125"
FT                   /product="hypothetical protein"
FT                   /note="COG5346 Predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_00125"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47034"
FT                   /db_xref="GOA:C4K0D2"
FT                   /db_xref="InterPro:IPR019284"
FT                   /db_xref="UniProtKB/TrEMBL:C4K0D2"
FT                   /protein_id="ACR47034.1"
FT                   /translation="MKETKHFFNKNNRLNKGYAKTFSVNEPDNNFYRKKFEHILPPIDL
FT                   ISEYESIYPGTLQELMHMAQQEQAHKHAIDLKNLKIQARVAKLTRICLLIFGICLVVSI
FT                   FFKTF"
FT   gene            complement(22851..23135)
FT                   /locus_tag="RPR_00135"
FT   CDS_pept        complement(22851..23135)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_00135"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_00135"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47035"
FT                   /db_xref="InterPro:IPR019228"
FT                   /db_xref="UniProtKB/TrEMBL:C4K0D3"
FT                   /protein_id="ACR47035.1"
FT                   /translation="MSIAIEEVITKLTNFVYCFQIKRASGEELNLTNSDHAIKSEERVF
FT                   LPNSSLDLKEAEFNDSAQNHIIIEGIFEENGYYNGGQIIFSKIVLTVKC"
FT   gene            complement(23132..23608)
FT                   /locus_tag="RPR_00140"
FT   CDS_pept        complement(23132..23608)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_00140"
FT                   /product="putative cytoplasmic protein"
FT                   /note="COG5448 Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_00140"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47036"
FT                   /db_xref="InterPro:IPR011740"
FT                   /db_xref="UniProtKB/TrEMBL:C4K0D4"
FT                   /protein_id="ACR47036.1"
FT                   /translation="MKILSQLTSQKYLIKNARLSSTEFEQFNSFFKARCGSNFALRFRN
FT                   YADYRGINEVIAKGDGNLNKFQLRKIYGDPIAPYERVITKPVNNSVILYINNVRTMGIV
FT                   DYNDGIVTLPSPLGQDVILTAYFTFDVAVRFSIDSFCNDGSIALYNIELVEVII"
FT   gene            complement(24069..24881)
FT                   /locus_tag="RPR_00145"
FT   CDS_pept        complement(24069..24881)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_00145"
FT                   /product="biotin--protein ligase"
FT                   /note="COG0340 Biotin-(acetyl-CoA carboxylase) ligase"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_00145"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47037"
FT                   /db_xref="GOA:C4K0D5"
FT                   /db_xref="InterPro:IPR003142"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="InterPro:IPR004408"
FT                   /db_xref="UniProtKB/TrEMBL:C4K0D5"
FT                   /protein_id="ACR47037.1"
FT                   /translation="MNIGKFKLIVFDKLDSTNSEAMKMAQNAKVDSNYAVLAKSQTNGR
FT                   GRSGKNWQSRSGNLHVSLLIKPDKELELLPQLSFVTALSVYDSITSLCHSHSSLCHSRF
FT                   RGNDIRNENNIIQLKWPNDVLINSRKIAGILLESVKVENNYYLIIGIGINITYHPDNID
FT                   QPTTSLISENLPPMEPQALLEILIENFEEYYQIWHNNGFPFIRKKWLEYAYKLYENISV
FT                   KYQNDIVTGLFKDIDNTGRIILQLPSKKIISFSTAELFFSKNITKFKL"
FT   misc_feature    complement(24897..26787)
FT                   /note="authentic frameshifts: common BLAST hit:
FT                   gi|157964571|ref|YP_001499395.1| putative esterase of the
FT                   alpha/beta hydrolase superfamily protein"
FT   gene            complement(26792..27421)
FT                   /locus_tag="RPR_00170"
FT   CDS_pept        complement(26792..27421)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_00170"
FT                   /product="superoxide dismutase"
FT                   /note="COG0605 Superoxide dismutase"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_00170"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47038"
FT                   /db_xref="GOA:C4K0D6"
FT                   /db_xref="InterPro:IPR001189"
FT                   /db_xref="InterPro:IPR019831"
FT                   /db_xref="InterPro:IPR019832"
FT                   /db_xref="InterPro:IPR019833"
FT                   /db_xref="InterPro:IPR036314"
FT                   /db_xref="InterPro:IPR036324"
FT                   /db_xref="UniProtKB/TrEMBL:C4K0D6"
FT                   /protein_id="ACR47038.1"
FT                   /translation="MTYCNKSNQTSYPFILPDLPYEKESFKPHFTLETFDYHHGKHHNT
FT                   YVQNLNNLLKDKEELQKKDLEEIIEWSSQNSNAAIFNNAAQIWNHTFFWHSIKPQGGGK
FT                   PSGKILEQINKDFGSFEEFCEQFKQEAVGQFGSGWAWLVYHDNRLQIIKTANAGTPIAH
FT                   GMKPLLACDVWEHAYYIDYRNKRPDYVDIFIKHMINWKFVEDNLIK"
FT   gene            complement(27592..28872)
FT                   /locus_tag="RPR_00180"
FT   CDS_pept        complement(27592..28872)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_00180"
FT                   /product="folylpolyglutamate synthase"
FT                   /note="COG0285 Folylpolyglutamate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_00180"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47039"
FT                   /db_xref="GOA:C4K0D7"
FT                   /db_xref="InterPro:IPR001645"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR018109"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:C4K0D7"
FT                   /protein_id="ACR47039.1"
FT                   /translation="MLIPHFPVPTWKNNIKYDLENIARLLRALGNSHLRLPPVIHIAGT
FT                   NGKGSSSAMLKSIFTLAGYKVHCYTSPHLLEFNERIVVAGEKISDNELWQVCEQVRVAS
FT                   EKFNIEPSFFEGTTAAAFLAFEKTKADILILETGLGGRLDATNIVEQPLITLITPISYD
FT                   HMHMLGNTLPLIAVEKAGIMKSCVPCVISMQVLEVYETLFAKAEELEVPSFCYEYDFGI
FT                   KKTDNGFIYSSRNFTYEFPTPSLLGDHQLINAASVIALISLINKQFNINNEVIAKGLQN
FT                   TIWPARIEKIEPKKYSKLIGDNVQIWIDVAHNNSGAQVLANWMRDNLKSSIYLILGMTK
FT                   NRNIEEFCSYFKDLTIKGYGVKVLSEPLSHSAETINLEGRKSGIDFSESDSLEEAISDI
FT                   KKINGDNKANIIITGSLYLTSDFYKLL"
FT   misc_feature    complement(29106..29608)
FT                   /note="authentic frameshifts: common BLAST hit:
FT                   gi|157964568|ref|YP_001499392.1| BioY family protein"
FT   gene            29684..30436
FT                   /locus_tag="RPR_00200"
FT   CDS_pept        29684..30436
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_00200"
FT                   /product="putative N-terminal of biotin-protein ligase"
FT                   /note="COG4285 Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_00200"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47040"
FT                   /db_xref="GOA:C4K0D8"
FT                   /db_xref="InterPro:IPR015834"
FT                   /db_xref="InterPro:IPR019197"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:C4K0D8"
FT                   /protein_id="ACR47040.1"
FT                   /translation="MKIKIYNDLGVSKESIKHCVHTLRLYAPKHNVDYITAQEIIDEKW
FT                   VQNTLLLILLGGRDLYYVQKLQGKGNANIKNYIKNGGNFLGICAGSYYSGNYVEFAKGT
FT                   NIEVISKRELKIFNGTVRGPLLAPYYYNSHKGARAAYLKINPTLNLNIKDCYAFYNGGG
FT                   YFIDAENTKDTEIIASYEDSQAAIIKCTYGDGTAILSGVHLEYEPALIKNQSLNNIHKI
FT                   LKAHDTERIKLLNYILDFFGNALIERNL"
FT   gene            complement(30548..31216)
FT                   /locus_tag="RPR_00205"
FT   CDS_pept        complement(30548..31216)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_00205"
FT                   /product="glutathione S-transferase family protein"
FT                   /note="COG0625 Glutathione S-transferase"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_00205"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47041"
FT                   /db_xref="GOA:C4K0D9"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="InterPro:IPR040079"
FT                   /db_xref="UniProtKB/TrEMBL:C4K0D9"
FT                   /protein_id="ACR47041.1"
FT                   /translation="MKKLYHNPICPLSRQARVFLKALDIEFTTIKEDYWQFNKDFLKIN
FT                   PAGTLPILAESYGLFVVGIYPFVEYLNSKYPNFNFLDEDIDICCEIRRLFFWFNDKFYR
FT                   EVTKIIIDEKVIRSIAKMSSPRTEFLRVAKNNLNYHLEYITSLLEKRSYLVSDSLTIAD
FT                   IAASCHLSVLDYFGEIYWDKWTLIKHWYSLIKSRPAFRLLLQDRIPGFTPPNYYTDLDF
FT                   "
FT   gene            32147..34783
FT                   /locus_tag="RPR_00210"
FT   CDS_pept        32147..34783
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_00210"
FT                   /product="pyruvate phosphate dikinase"
FT                   /EC_number="2.7.9.1"
FT                   /note="COG0574 Phosphoenolpyruvate synthase/pyruvate
FT                   phosphate dikinase"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_00210"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47042"
FT                   /db_xref="GOA:C4K0E0"
FT                   /db_xref="InterPro:IPR000121"
FT                   /db_xref="InterPro:IPR002192"
FT                   /db_xref="InterPro:IPR008279"
FT                   /db_xref="InterPro:IPR010121"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018274"
FT                   /db_xref="InterPro:IPR023151"
FT                   /db_xref="InterPro:IPR036637"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:C4K0E0"
FT                   /protein_id="ACR47042.1"
FT                   /translation="MKKLIYYFGSNGSDGNASMKNILGNKGAGLAEMSNLKLPIPDGFT
FT                   ITTELCNYFYTHNNNFPKNFQSELKKAITELEIITGKIFGSTSNPLLLSVRSGSTVSMP
FT                   GMMDTILNLGMNNEVCNALADSCGDKRFALDSYKRFLEMYGSTVLSIPSDLFEQIYEKH
FT                   KMQADIHKDSDITVELLEKIIDDFKRLHIKYTKQLINDPYEQLESAIKTVLHSWMSNRA
FT                   VIYRKINNIAEDFGTAINIQAMVFGNLGKTSATGVAFTRSPSTGEKKLFGEFLINAQGE
FT                   DIVSGTRTPMPIIANDSNSMQAMMPEVFKELSQIAQKIEEHYLDMQDIEFTIENNKLYI
FT                   LQTRTAKRTAIAAINIAVQMVEEKLISKEQALMRIDPESLNQLLHTRIDYSKGLTSIAE
FT                   GLPASPGAATGIAVFSPYDAEKLSHHHKVILVRHDTSPEDINGMHVSSGILTIRGGMTS
FT                   HAAVVARGMGKPCVCGTSNLSIDEKKQILTAGDIVIKQGDIITIDGGSGKIFLGEMPLI
FT                   QPTFSEESKLILDWADEISSLKVRANAETVNDALVSVKFGAQGIGLCRSEHMFFDKNKI
FT                   PLVRDMIIAPDIERRKLAVQKLLPLQTEDFKALFRVMKDKPVNIRLLDPPLHEFLPTTE
FT                   EDKKNLANSLNLPLSMINQRLHAMHEVNPMLGHRGCRLGICSPEIYQMQIEAIFTAIFE
FT                   LHKKEHIECNLELMIPLISNVGEIKKLKMDIYAVIEELEQRYSYKFSFTLGTMIELPRA
FT                   ALGSKKIAKEVDYFSFGTNDLTQTTYGISRDDIASFLPYYLEEKIFESDPFTTLDEEGV
FT                   GELIEIAIKRGKSSNANLKLGACGEHAGNPASIEFFHRMNLNYVSCSPYRIPIARIAAA
FT                   QAKIKHG"
FT   gene            35046..36854
FT                   /locus_tag="RPR_00215"
FT   CDS_pept        35046..36854
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_00215"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_00215"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47043"
FT                   /db_xref="GOA:C4K0E1"
FT                   /db_xref="UniProtKB/TrEMBL:C4K0E1"
FT                   /protein_id="ACR47043.1"
FT                   /translation="MIIIPILSIFGFSSFFAKYFKTKLTFAIPITISILVPILYCFAML
FT                   KLLPATTYIYYFIGIFLAFMSFLHFIGVVVGGGSAPVIPRLDRGIQLKMFSIFKLYFWI
FT                   PWSSHGMTPHAFLDLRNNTSFMSFLWKQESRENIIEIIVFTLLILLFFLYTRDASLHSY
FT                   DDFSHWGIFTKELLYFGVFENQSSLTSIITTHAHYPRGVAVYHYFMLLLSGYSDGNVLF
FT                   AHFLLHLAFLAPLAANKKLWQTGMLFSLLLCGVVLYTTGIRSIYNDSTIGLMFGAIFAI
FT                   YILAEDKKKALLLILPITILLASFREIGTWLASFASIILIAHYTIFYKKPKKSSDYITY
FT                   LILLTLPILCNFIWMSYFKNTHDFFDRCEHSFSNLVYIAENFNEQHRSLLLNYGKFLLL
FT                   FLLKEGSLVVYTICIAAWYGIRKYKPDLLKEYKFFLISTFACFIIFALWRLYLYFFNFS
FT                   YEEAIRGASLLRYLGCYVIAIGMIAASYVKNSIFLHKQSNKELFIFLLLLAVSTFSVVK
FT                   NILRIKHLNLEQKNFIQQTTEVKKLLEQGNKIEFNFSGKKDNLQCYILNYNLVPYLGKK
FT                   SSQECIKAPKEAIIETKEEAVYAPFK"
FT   gene            37090..37785
FT                   /locus_tag="RPR_00220"
FT   CDS_pept        37090..37785
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_00220"
FT                   /product="hypothetical protein"
FT                   /note="COG0235 Ribulose-5-phosphate 4-epimerase and related
FT                   epimerases and aldolases"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_00220"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47044"
FT                   /db_xref="InterPro:IPR001303"
FT                   /db_xref="InterPro:IPR036409"
FT                   /db_xref="UniProtKB/TrEMBL:C4K0E2"
FT                   /protein_id="ACR47044.1"
FT                   /translation="MDIKYNLAAAYRIMAYLSLDDHTYTHLSARPKNAVFYYIYPFGLR
FT                   FEEVTTENLLKVSLDGQILEGEEYQYNKTGYFIHGSIYKTRPDISAIFHYHTPAAIAVS
FT                   ALKCGLLPISQWALHFYDRISYYNYNSLVLDADKQSSRLVTDLKQNYVMLLRNHGAITC
FT                   GKTIHEAMFYTYHLEQACKTQCLLNSTKEQELIIPSVEICKQTVKDLLSFEEDLGKRDW
FT                   AAWLRLVKM"
FT   gene            complement(37786..38190)
FT                   /locus_tag="RPR_00225"
FT   CDS_pept        complement(37786..38190)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_00225"
FT                   /product="toxin of toxin-antitoxin system"
FT                   /note="COG4113 Predicted nucleic acid-binding protein,
FT                   contains PIN domain"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_00225"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47045"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:C4K0E3"
FT                   /protein_id="ACR47045.1"
FT                   /translation="MVSFVLDSSIALSWLMPDEVASLDILDKTITEGAIVPAIWGLEIG
FT                   NVLLCAERAKRLTANQRHQAIYTLKDLYIKIDQITLEHIWFETMDLAVQYGLTLYDASY
FT                   LELVLRCGLPIATLDKSLKQASKAAGVVVL"
FT   gene            complement(38194..38448)
FT                   /locus_tag="RPR_00230"
FT   CDS_pept        complement(38194..38448)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_00230"
FT                   /product="hypothetical protein"
FT                   /note="COG4118 Antitoxin of toxin-antitoxin stability
FT                   system"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_00230"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47046"
FT                   /db_xref="InterPro:IPR006442"
FT                   /db_xref="InterPro:IPR036165"
FT                   /db_xref="UniProtKB/TrEMBL:C4K0E4"
FT                   /protein_id="ACR47046.1"
FT                   /translation="MKNTITAFDAKTHFSKLLDRVSKGEEILITKRGKAAAKIVPIDSH
FT                   NNIEIAKIAALRLRKLAKEINLQPSDLEVWLNYKNEGKK"
FT   gene            complement(38659..39210)
FT                   /locus_tag="RPR_00235"
FT   CDS_pept        complement(38659..39210)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_00235"
FT                   /product="polypeptide deformylase"
FT                   /note="COG0242 N-formylmethionyl-tRNA deformylase"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_00235"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47047"
FT                   /db_xref="GOA:C4K0E5"
FT                   /db_xref="InterPro:IPR023635"
FT                   /db_xref="InterPro:IPR036821"
FT                   /db_xref="UniProtKB/TrEMBL:C4K0E5"
FT                   /protein_id="ACR47047.1"
FT                   /translation="MNQDKPYYQIVYTPNDIFKKQAEYIDIVDDNIRTIVDKMLQNLHI
FT                   ARAVGLGANMVGILKRIAVVDLHENNKSSPIVFINPDITYFSEEKQTFIEGSLSFPGIE
FT                   ASITRSKAIKVKYLDYNGNKQELSAEGFLATVIQHEIDYLNGKTFLDYLSKLKRDILLK
FT                   KMLKHIKLHPPHIHGSGCRH"
FT   gene            complement(39503..40225)
FT                   /locus_tag="RPR_00240"
FT   CDS_pept        complement(39503..40225)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_00240"
FT                   /product="putative cytoplasmic protein"
FT                   /note="COG1496 Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_00240"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47048"
FT                   /db_xref="InterPro:IPR003730"
FT                   /db_xref="InterPro:IPR011324"
FT                   /db_xref="InterPro:IPR038371"
FT                   /db_xref="UniProtKB/TrEMBL:C4K0E6"
FT                   /protein_id="ACR47048.1"
FT                   /translation="MEGLINGSVYYKIFDKTFNNSSHRYIKKNNSINETEIVENKKSIT
FT                   TYFKAQDILILNQVHGNQIVNADESIITVPEADGSITTKKNLVLAVQSADCVPVLLASG
FT                   DGKIIGAAHAGWKGSINNIISNIVTKITEKGAKNLIAVIGPAIAQSSYEVDDEYYKAFL
FT                   SKDINNKQFFINSIKENHYMFDLPAFVELKLKEAGVKDIKNIAEDTYTNPLKYPSKRRS
FT                   YHLQEPYNQNILSAIVMK"
FT   gene            40224..41054
FT                   /locus_tag="RPR_00245"
FT   CDS_pept        40224..41054
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_00245"
FT                   /product="Glutamine synthetase/guanido kinase, catalytic
FT                   region"
FT                   /note="IPR014746 Glutamine synthetase/guanido kinase,
FT                   catalytic region"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_00245"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47049"
FT                   /db_xref="GOA:C4K0E7"
FT                   /db_xref="InterPro:IPR008146"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="UniProtKB/TrEMBL:C4K0E7"
FT                   /protein_id="ACR47049.1"
FT                   /translation="MKISHINYNSFINTLSGRLQKNKQLEKIIAQFHQDYNLIPIISVE
FT                   IEFYLSHNIDIAKFEILSRKYLARFKIAKIKKEKGNNQFEIDLPPSVNLIQYIKNILEK
FT                   TILKKMAQQLNGYIDFSPKPFLDDYGNSMHFHINFHSEFNDYYIILAAQGLCHYMLDTL
FT                   LAFMPTTLDYSRINKKFMAPTHISYGGNNRSIAVRTPNAFPKRLEHCLSSPETDPYIAI
FT                   FTILKSILLALKSPSSLQTIEKIYGNAFDPQYNLTPLPTSSQASFMLFKPDFFK"
FT   gene            complement(41204..42031)
FT                   /locus_tag="RPR_00250"
FT   CDS_pept        complement(41204..42031)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_00250"
FT                   /product="ribonuclease BN, putative"
FT                   /note="COG1295 Predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_00250"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47050"
FT                   /db_xref="GOA:C4K0E8"
FT                   /db_xref="InterPro:IPR017039"
FT                   /db_xref="UniProtKB/TrEMBL:C4K0E8"
FT                   /protein_id="ACR47050.1"
FT                   /translation="MRKIFNCLYVALFRTIEDDGVEHSGYMSFMILLSIFPFLVFLLAL
FT                   TSFLGASELGQNFIQIFLESLPEQATESIEKRIRELLSAPPQSLMNLAIVGSIWTASSF
FT                   VECLRTILNRVYQIKSPPPYIRRRLLSIIQFLIISALITFTMFLLVVIPILFTKIPIIL
FT                   ETIEKYKIILNFIRYFLILILLFLGASSLYYILPNVKLNFIDVFPGALLTVILWIISGY
FT                   LLSTYIVYYNQLNLMYGSLGSIIVTLIFFYIINMIFIYGAEFNYLMKNYENIE"
FT   gene            42565..42942
FT                   /locus_tag="RPR_00255"
FT   CDS_pept        42565..42942
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_00255"
FT                   /product="transcriptional regulator"
FT                   /note="COG1396 Predicted transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_00255"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47051"
FT                   /db_xref="GOA:C4K0E9"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:C4K0E9"
FT                   /protein_id="ACR47051.1"
FT                   /translation="MGRKNDIIQKIDSFIGKKIYSLRLAKGLSRQQLAEVIDVTHQQLQ
FT                   KYEKAINRISVGRLVLIAEALDRNIDYFFEGLEEANKPQPVHTQHQRMCIEVSRNFMKI
FT                   NSTEEQQAVNNLVKCLAGKKN"
FT   gene            complement(43061..46117)
FT                   /locus_tag="RPR_00260"
FT   CDS_pept        complement(43061..46117)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_00260"
FT                   /product="antigenic heat-stable 120 kDa protein (cell
FT                   surface protein Sca4)"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_00260"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47052"
FT                   /db_xref="InterPro:IPR020954"
FT                   /db_xref="UniProtKB/TrEMBL:C4K0F0"
FT                   /protein_id="ACR47052.1"
FT                   /translation="MSKDGNLDTSEFDPLANKEYTEEQKQTLEQEQQEFLSQTITPALE
FT                   ADDGFIVTSASSAQSTPSMSALSGNISPDSQTSDPITKAVRETIIQPQKDNLIEQILKD
FT                   LAALTDRDLAEQKRKEIEEEKDKTLSTFFGNPANREFIDKALENPELKKKLESIEIAGY
FT                   KNVHNTFSAASGYPGGFKPVQWENHVSASDLRATVVKNDAGDELCTLNETTVKTKPFTL
FT                   AKQDGTQVQISSYREIDFPIKLDKADGSMHLSMVALKADGTKPSKDKAVCFTAHYEEGP
FT                   NGKPQLKEISSPKPLKFAGTGDDAIAYIEHGGEIYTLAVTRGKYKEMMKEVELNQGQSV
FT                   DLSQAEDIIIGQGQSKEQPLITPQQTTSSSVEPPQYKQQVPPITPTNQPLQPETSQMPQ
FT                   SQQVNPNLLNAATALSGSMQDLLNYVNAGLTKEIDSNKQIDLIKEAATAILNNEKSDIA
FT                   EKQANIIALAENTVNNKNLKPDAKVAGVNAVLETIKNDQNTPDLEKSKMLEATVAIVLN
FT                   SENLEPKQKQQMLEKAVDVGLSLKDDASRAAAIDGIKDVVIKSNLSNAMLIAVGDKVNV
FT                   SELSNAEKQKLLGSVLKKGVEAQVLSPAQQQLMQQHLDKIMAEQTKKDTIKKVNDILFD
FT                   PLSNTELKTTNIQAIISNVLDGPATAAVKGEIIQEITNTVAGSSLEAQDKAAIVKGVGE
FT                   TIATHSDTSLSLPNKALIMASTEKGIAESQTNLPDRELMTKGLVDGIYEDKGAPEITKA
FT                   VSSGIDNSNINDSEKEALKKAKDAASETALDRDTQNLTEGLKGQNIEEHKPHDDIYNKA
FT                   REVINAVNPVIEALEKSKEPVVSAEERIVQETSSILNNISKLAVEKVNNFRAMLSPNGN
FT                   LKTLEEKKEESIKKVDELVKAFGTKSSTEEQQSFIKTNLIDDKTLSKEVRLQTIDKLLQ
FT                   EQKRAEAIENPSVKTEDVRVVSGKSKLKPISKDNPDIEKAKMVVGRDRVNIKGNIKIMG
FT                   TLMNARDIIQSENLNKSTPIKRESSPPQR"
FT   gene            complement(46410..47945)
FT                   /locus_tag="RPR_00265"
FT   CDS_pept        complement(46410..47945)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_00265"
FT                   /product="ADP,ATP carrier protein"
FT                   /note="COG3202 ATP/ADP translocase"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_00265"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47053"
FT                   /db_xref="GOA:C4K0F1"
FT                   /db_xref="InterPro:IPR004667"
FT                   /db_xref="UniProtKB/TrEMBL:C4K0F1"
FT                   /protein_id="ACR47053.1"
FT                   /translation="MTINPSNIENSSSKINSYFSKLADYIWPIKRHEVSKFLFITLLMF
FT                   CILFIQNLIRALKDSIVTTMIGAEIISFLKFWGVMPSAFLMTAIYVKLVNKMKAENIFY
FT                   LIISIFLTFFVLFAYVIFPNHEMLHFSPVTVQNLTASLPNLKWFILLLSKWSFSLFYII
FT                   AELWPNVVFALLFWQFVNNITTVEESKRFYPLFGLLSQTGIYLAGQFLENLSNINDYVT
FT                   NKFALQSSFHTLSIQIILTIVLILGIIAIKTFWLLNHKVLDKEHMALLRFKAKKKSMTI
FT                   AESFQMLLSSRHIRLIATLLICYGIAINLVEGPWKAAATKIYKTPTEYAAFIGSYLSYT
FT                   GVFTILFVVLGSNIVRRLGWFTAAVITPLIVFITGILFFAVNNFERFAGLIIANFILTD
FT                   PALIAITIGAIQNVLSKSSKYTLFDSTKEMAYVPLDPEIKIKGKAAADVIGTKLGKSGS
FT                   AFLQSLVFIILPSASYQSISICLMIIFIITCLTWLWVTKALNKEYKNSIKFSQ"
FT   gene            48030..49067
FT                   /gene="truB"
FT                   /locus_tag="RPR_00270"
FT   CDS_pept        48030..49067
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="truB"
FT                   /locus_tag="RPR_00270"
FT                   /product="tRNA pseudouridine synthase B"
FT                   /note="COG0130 Pseudouridine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_00270"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47054"
FT                   /db_xref="GOA:C4K0F2"
FT                   /db_xref="InterPro:IPR002501"
FT                   /db_xref="InterPro:IPR005728"
FT                   /db_xref="InterPro:IPR014780"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR032819"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4K0F2"
FT                   /protein_id="ACR47054.1"
FT                   /translation="MSNYWLNIYKPRGISSAQLVSIVKKILGRTKIGHAGTLDVEAEGI
FT                   LPFAVGEATKLIHLLIDARKTYIFTVKFGMQTNSGDCAGKVIATKYCVPSQEEAYAVCS
FT                   KFIGNVTQIPPAFSALKVNGVRAYKLAREEKKVELKPRNTTIYDLKCLNFDEKNATATY
FT                   YTECSKGTYIRTLAEDLALSLQSLGFVIELRRTQVGIFKEENAIRIKSPDEITKNALEE
FT                   KSIKIEAILDDILVLDATDSQAQQIKYGQKCLFNYEKDFRHLAKFAYREEFKGNTERST
FT                   TAYTLVREDASTGLTYKLPLEVEFGKMSIDLVWVRYKGTLLAIGSLNKSCFNSLRVFNL
FT                   TQDFF"
FT   gene            49103..49378
FT                   /gene="rpsO"
FT                   /locus_tag="RPR_00275"
FT   CDS_pept        49103..49378
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsO"
FT                   /locus_tag="RPR_00275"
FT                   /product="30S ribosomal protein S15"
FT                   /note="COG0184 Ribosomal protein S15P/S13E"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_00275"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47055"
FT                   /db_xref="GOA:C4K0F3"
FT                   /db_xref="InterPro:IPR000589"
FT                   /db_xref="InterPro:IPR005290"
FT                   /db_xref="InterPro:IPR009068"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4K0F3"
FT                   /protein_id="ACR47055.1"
FT                   /translation="MSITTERKQKLIKEYAITENDTGSSAVQCAILTERINNLTEHFKS
FT                   NHKDHTSRRGLLILVGRRRRLLNYIKKNNVSKYLDLISKLGIRKIK"
FT   gene            49526..51772
FT                   /locus_tag="RPR_00280"
FT   CDS_pept        49526..51772
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_00280"
FT                   /product="polynucleotide phosphorylase/polyadenylase"
FT                   /note="COG1185 Polyribonucleotide nucleotidyltransferase
FT                   (polynucleotide phosphorylase)"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_00280"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47056"
FT                   /db_xref="GOA:C4K0F4"
FT                   /db_xref="InterPro:IPR001247"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR004088"
FT                   /db_xref="InterPro:IPR012162"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR015847"
FT                   /db_xref="InterPro:IPR015848"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR027408"
FT                   /db_xref="InterPro:IPR036345"
FT                   /db_xref="InterPro:IPR036456"
FT                   /db_xref="InterPro:IPR036612"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4K0F4"
FT                   /protein_id="ACR47056.1"
FT                   /translation="MFNEITKSVTWNGQVLELSTGKIARQADGAVTVKMGNSVLLCTAV
FT                   VANKAKEGIGLLPLTINYREMAYAAGKIPGGFFKHEGKASDREVLVSRLIDRPIRPLFH
FT                   PAFVNETHVTCSVLSYDPETPVDILAIIGASAALSLSPAPYLEIVAASKVGLINGEFVL
FT                   NPTLALLKTSQLDLVVAGTSGSVMMVESEAHLLSEEQMLEAVKFGFESFQPVIKIIKEL
FT                   AEEAKKPKLEMQALYPASLKKEIEKLFVKEIEQAFAIKSKQERSTNLDLIPEKVLTHFV
FT                   SDIENKKYSNYQIESALKAIESDILRNEILEKNRRIDGRSTTDIRQIACEIGLLPSAHG
FT                   SALFTRGETQSLVSTTFGTSLDEQIVDSLEGEYKERFMLNYIFPPYSVNEAMPMKAPSR
FT                   REVGHGKLAWRAINPILPNKVQFPYSIRVVAETTESNGSSSMATVCGSSLALMYAGVPI
FT                   KAPVAGIAMGLVKEGKNFAVLSDILGDEDYFGDMDFKVAGTSEGITALQMDIKISGVDF
FT                   KIMKVALEQARLGRLHILEQMNKVISKPNNELSKNAPSTTTIKIDKDKIRDIIGPSGKV
FT                   IKEICETSGAKIDISDDGTVSVYASDRDKLKVALDKIKAIVVEPEIGEIFNGTVVKVLD
FT                   SGAFINYVGNKDGFVHISEVSGERIETVSSVLKQGDIVKVKLIGFDNKGKAKLTIKNAD
FT                   KDKSSNNTKPKTHVNNTKDNSEPEQRRDSSKKRAWNEDNNAEIAEVITERKYFN"
FT   gene            51972..52931
FT                   /locus_tag="RPR_00285"
FT   CDS_pept        51972..52931
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_00285"
FT                   /product="arabinose-5-phosphate isomerase"
FT                   /note="COG0794 Predicted sugar phosphate isomerase involved
FT                   in capsule formation"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_00285"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47057"
FT                   /db_xref="GOA:C4K0F5"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR004800"
FT                   /db_xref="InterPro:IPR035474"
FT                   /db_xref="UniProtKB/TrEMBL:C4K0F5"
FT                   /protein_id="ACR47057.1"
FT                   /translation="MTNTNNYRIIAKRVISSEASALEKLSENIPEDFNRIIEFLLSFKG
FT                   RIILTGIGKSGYIARKIAASFSSTGMPAFYLHPAEASHGDLGMVTRNDLVIMLSNSGET
FT                   KELFNIIEYCKNSSIKIAAMTMNKNSTLAKRSDFLLIVPEYQEASVIGVPTISSLIMLS
FT                   LGDALMTVIHEKRGFTKDDFKIYHPGGTIGANLTKIKNLMRSGDEIPLVYEDTSFAKTI
FT                   IIMNKKRLGCTLVTDKNQNLVGIITDGDLRRHINDQIHLKTASSIMTKNPIHISSEIFA
FT                   KEALNLMKAKNITNIPIVDDNIIIGIIHIHDLLRIGVS"
FT   gene            52937..53533
FT                   /locus_tag="RPR_00290"
FT   CDS_pept        52937..53533
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_00290"
FT                   /product="hypothetical protein"
FT                   /note="COG5375 Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_00290"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47058"
FT                   /db_xref="GOA:C4K0F6"
FT                   /db_xref="InterPro:IPR010664"
FT                   /db_xref="UniProtKB/TrEMBL:C4K0F6"
FT                   /protein_id="ACR47058.1"
FT                   /translation="MPSSYKRRKKIWKSVYLLITVGILYIGYILIKSGYINEKNDINVT
FT                   KKSLKDNKNFDLKYNIILKDSIFEGVSKNLNAYKIKTERAIKESNNKYKLDIINAIYNV
FT                   HQDQTLIINAKEGFLDEESSILDLKNDVKLFFDKIIFNTNDARIDLVNKNITGHSPAKL
FT                   LYKNSSITSDSFNTKDENNIIIFKGNVSTIIDLSD"
FT   gene            53577..54086
FT                   /locus_tag="RPR_00295"
FT   CDS_pept        53577..54086
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_00295"
FT                   /product="hypothetical protein"
FT                   /note="COG1934 Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_00295"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47059"
FT                   /db_xref="InterPro:IPR005653"
FT                   /db_xref="InterPro:IPR005728"
FT                   /db_xref="UniProtKB/TrEMBL:C4K0F7"
FT                   /protein_id="ACR47059.1"
FT                   /translation="MECSTAAYKEVLEDTSTDSTSKLPLEAKFGKMSIIKLVLLLIISN
FT                   IIYANDKNISNLHITSDSLIIDRTKQKAAYLGNVIVYFDNAILRTQELYIFYKTIDEKQ
FT                   TIDHIVVPTKLTVERKINNELLLADSAKYFCDNKQLILLGNVILQRDDNVLKTNKLIYY
FT                   VDIIKK"
FT   gene            54269..54991
FT                   /locus_tag="RPR_00300"
FT   CDS_pept        54269..54991
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_00300"
FT                   /product="ABC transporter ATP-binding protein"
FT                   /note="COG1137 ABC-type (unclassified) transport system,
FT                   ATPase component"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_00300"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47060"
FT                   /db_xref="GOA:C4K0F8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030921"
FT                   /db_xref="UniProtKB/TrEMBL:C4K0F8"
FT                   /protein_id="ACR47060.1"
FT                   /translation="MDSLHVKNISKSYKKRNILTDISLNIKQGEIVGLFGPNGAGKTTC
FT                   FNIIIGLMKLDSGQLLLNDINITNLPIYLRARLGLGYLLQEPSIFRELSVEDNIKAVVE
FT                   ISNNDKEVIEQKTHNLLEKFSIVHLKDLSAASLSGGERRRLEIARALAIEPKFIMLDEP
FT                   LAGIDPLAISDIKNLITYLREFNIGILITDHNVRDTLDIVDRAYVIFEGKVLLEGSAKE
FT                   IANSKKVKEVYLGESFSF"
FT   gene            55162..56550
FT                   /locus_tag="RPR_00310"
FT   CDS_pept        55162..56550
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_00310"
FT                   /product="phosphomannomutase"
FT                   /note="COG1109 Phosphomannomutase"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_00310"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47061"
FT                   /db_xref="GOA:C4K0F9"
FT                   /db_xref="InterPro:IPR005841"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR016066"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/TrEMBL:C4K0F9"
FT                   /protein_id="ACR47061.1"
FT                   /translation="MQINKEIFRAYDIRGNSLKDLTEEVAYKIGFGFAEMTITKDNDKI
FT                   CVGLDGRLSSPTLCKALELGLTNAGAEIINIGVVPTPVLYFADKHFTPAGSIMVTGSHN
FT                   PRDDNGFKILQNGKPFFGDQIQELLTKILDNYSNTTPASPYVIPAKAGIHNIQSKYLKR
FT                   ILDGININPKLKVAWDCGNGATGDIVEELKKHLSNKNIIIHSKIDGNFPSHHPDPTNPA
FT                   NLQELIKVVKEQNCDLGIAFDGDGDRIGIISSSGKILLGDQILCIFAEDILKENPNATI
FT                   IVDVKVSQFIVAKIKSYGGHPIIWRTGHPFIKSKMLETKALLAGEMSGHIFFADKYFGF
FT                   DDAIYAALRFLDLLSRSSKTLDEIIEDVPKSYSTPEIKIVVPSELKLQIIKEIKEKSLE
FT                   EKIEFNDIDGVRVNTAHGWWLLRSSNTESIIVARAESDSKNGLEEIITIINKYLEKYGL
FT                   LINC"
FT   gene            56621..56947
FT                   /locus_tag="RPR_00315"
FT   CDS_pept        56621..56947
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_00315"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_00315"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47062"
FT                   /db_xref="UniProtKB/TrEMBL:C4K0G0"
FT                   /protein_id="ACR47062.1"
FT                   /translation="MLKISNINHSFVDTKLVTITPIGVNTLNINIEAPLVIKHKDLEPN
FT                   DNPLNSDVAASNGLNSLTIDYSDAGLFSGPTISYDNKLGTITFSGPADSNANTDTLGNT
FT                   NETV"
FT   gene            57110..58174
FT                   /gene="miaA"
FT                   /locus_tag="RPR_00320"
FT   CDS_pept        57110..58174
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="miaA"
FT                   /locus_tag="RPR_00320"
FT                   /product="tRNA delta(2)-isopentenylpyrophosphate
FT                   transferase"
FT                   /EC_number="2.5.1.75"
FT                   /note="COG0324 tRNA delta(2)-isopentenylpyrophosphate
FT                   transferase"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_00320"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47063"
FT                   /db_xref="GOA:C4K0G1"
FT                   /db_xref="InterPro:IPR018022"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR039657"
FT                   /db_xref="UniProtKB/TrEMBL:C4K0G1"
FT                   /protein_id="ACR47063.1"
FT                   /translation="MYFLVKQVTKKEIYSNDLENGNVKRGASTHSLYLIGDPKFCRNNS
FT                   SKQKSIIILCGPTASGKSYLGHELAKAYNGEIINIDSMQVYKEISIITASPPKSYKTEI
FT                   LYHLYNFLSMTEDFSVIKYLKLATEKIKEITDRGKLPILIGGTGLYINSLVFGYNNIPD
FT                   ISEDLQAQVRNLHVKIGNIELWGKLEKFDPLAASKINQNDTQRLIRAYEVFMQTGKSIF
FT                   SFQTLPKEQILSDFNFKIIFLNPERKFLYKTCDERLDKIFKEGAIDEIALIKKQFAPKD
FT                   YTNLKAVGIKEILAYLNGNLTLDEALNAAQIRTRQYAKRQVTWFKNQIQDKITLEYANQ
FT                   EEFTQTLKNPFKTI"
FT   misc_feature    complement(58186..60123)
FT                   /note="more fragments homologous to RrIowa_0780"
FT   misc_feature    complement(60263..63106)
FT                   /note="authentic internal stop codon in hypothetical
FT                   rickettsial gene, homolog of RrIowa_0780"
FT   gene            complement(60728..63106)
FT                   /locus_tag="RPR_00340"
FT   CDS_pept        complement(60728..63106)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_00340"
FT                   /product="hypothetical protein"
FT                   /note="truncated homolog of RrIowa_0780"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_00340"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47938"
FT                   /db_xref="InterPro:IPR001646"
FT                   /db_xref="UniProtKB/TrEMBL:C4K0G2"
FT                   /protein_id="ACR47938.1"
FT                   /translation="MAVINNKNYQKVVEQVLSSSNANKVLKSAIQDLSSSKSISLRTIL
FT                   LGARFILTNPVNTYNLVKLANSSKIYLDPEFQKSLLKQSPIWEFLKKHSDDLPKIGQIL
FT                   ANAGFREFQDKSALDEKGLEILKECFKNEQVLKNLQEIAVEVKQELPDWNKVTSRTLDM
FT                   LVTDKNFQKFFNEKSEDITKYIRTGATEILPSDYIKTFDDILQKPEKKNLLKIFNEQPD
FT                   FKQELAKNINNPNTLKRFNKLSPEKQIIIENFLEEAKEQAKPFLKEHFETYKIDLKILD
FT                   IIPTLLNKMPETKEIFDTLNAPNQGVMISLEKSLERVAGDDKLKSFFANNKTILPNIAL
FT                   GIIENTPSVQSVTKEYNFDKQMLSIVGEVMSKPEVAHEIIADLNKGDYMSLTGNIISAL
FT                   NDPSFKLKDILVEQSKGGLFDNLITGVLEQDAKNSQTIKQQLINYGLEASDVTKLTSIM
FT                   PILLDQSESLKKVFRDFIQGDYTGMAKELIALTKDNPEIKKYLNNNREISILDKTLVEI
FT                   PGINNLDKKELYNVLPSMLNHPNELVKVIEEVEKSNYREAASAIYNLAQKTNYLEGQLP
FT                   NIIKAGFSYATEKLKDVFSPSQDFKDKTIDAITLRNNLHKIQNGKFSLEGAILVGDLSN
FT                   LDFSGVSLKNADLTKVTSLKDCNFKNINLAEAKLPDNLMLLTDTYNLDKAIPPLVPKLI
FT                   KEQQAKLIDKAIDKLFLQIQAEGKRNVLSKKNFAQQVKRLYEENQTIKDYIIEKLNSLP
FT                   MNMVTNLATPRTNQYKHITNHVNSPLQILNPLYENIANK"
FT   gene            complement(63254..64240)
FT                   /gene="nrdF"
FT                   /locus_tag="RPR_00350"
FT   CDS_pept        complement(63254..64240)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nrdF"
FT                   /locus_tag="RPR_00350"
FT                   /product="ribonucleotide-diphosphate reductase subunit
FT                   beta"
FT                   /EC_number="1.17.4.1"
FT                   /note="COG0208 Ribonucleotide reductase, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_00350"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47064"
FT                   /db_xref="GOA:C4K0G3"
FT                   /db_xref="InterPro:IPR000358"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012348"
FT                   /db_xref="InterPro:IPR033909"
FT                   /db_xref="UniProtKB/TrEMBL:C4K0G3"
FT                   /protein_id="ACR47064.1"
FT                   /translation="MSLLDASPIYKPFSYPWAYEAWHTQQKIHWLPEEVPLADDVKDWK
FT                   YNLTPGEKHLLTQIFRFFTQADIEVNNCYMKHYSRVFKPTEILMMLSAFSNMETVHIAA
FT                   YSHLLDTVGMPEVEYSAFLKYKEMKDKYDYMQQFGVDAKEDIATTLAVFGAFTEGLQLF
FT                   ASFAIMLNFPRFNKMKGMGQIIAWSVRDETLHTNSIITLFKTFVRENPEVWTETLRKRI
FT                   YEACTTIVHFEDAFIELAFEVGGIEGLTAYEVRQYIRYIADRRLMQLGLKDVYLVNHNP
FT                   LPWLDEMLNGVEHTNFFENRTTEYSKAATTGSWEEVFTEMDATAEAK"
FT   gene            complement(65101..66924)
FT                   /locus_tag="RPR_00365"
FT   CDS_pept        complement(65101..66924)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_00365"
FT                   /product="ribonucleotide-diphosphate reductase subunit
FT                   alpha"
FT                   /EC_number="1.17.4.1"
FT                   /note="COG0209 Ribonucleotide reductase, alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_00365"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47065"
FT                   /db_xref="GOA:C4K0G4"
FT                   /db_xref="InterPro:IPR000788"
FT                   /db_xref="InterPro:IPR008926"
FT                   /db_xref="InterPro:IPR013509"
FT                   /db_xref="InterPro:IPR039718"
FT                   /db_xref="UniProtKB/TrEMBL:C4K0G4"
FT                   /protein_id="ACR47065.1"
FT                   /translation="MNTFKKNKFQITINNNHNNLLTPFGKAILRDRYLMKGEDFQDLFA
FT                   RVSSYYAENKQHAQKLYEYMSKMWFMPATPILSNGGTDRGLPISCFLNETDDSLDDIVN
FT                   LWTENVWLAARGGGIGSYWGNVRAINEGIRDKGHSSGIIPFIKVMDSMTLAISQGSIRR
FT                   GSSAVYLPINHPEIEEFIDIRRPTGGDVNRKALNIHHGIAITDEFMKAVENNTDFDLVS
FT                   PATKKVVNKVRARDLWVKLLTTRIETGEPYLLFIDSVNKSIPEHHKKLGLQVKMSNLCS
FT                   EITLPTGIDHLGKSRTAVCCLSSLNLEYYEEWKDDKEFIHSIMLFLDNVLEDFINKAPD
FT                   TMARAKYSALRERSVGLGVMGFHSFLQMKKVPIESVMAKVWNKKIFEYISAETDKASIE
FT                   IGKEKGACPDALDAGSNERFSNKTAIAPTASISVIAGNASPGIEPFAANSFVQKTLTGS
FT                   FNVRNKHLEKLLEEKGFNNDQVWSSIATHEGSVQHLTFLSEEEKQVFKTAYEIDQNWLI
FT                   ELASDRTPYITQAQSLNIFLPGNVSKKYLNNIHFKAWTKGVKSLYYCRSTSIQRADKVS
FT                   HDVLKADFKDLEEQNDKLAEAGNYEECLACQ"
FT   gene            complement(67341..67592)
FT                   /locus_tag="RPR_00370"
FT   CDS_pept        complement(67341..67592)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_00370"
FT                   /product="chitin binding domain-containing protein"
FT                   /note="COG3397 Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_00370"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47066"
FT                   /db_xref="UniProtKB/TrEMBL:C4K0G5"
FT                   /protein_id="ACR47066.1"
FT                   /translation="MQMTKAEFTFENRLKHDDLEEIYSELSDQFPYWDHTLVPSKMIEV
FT                   TFPDREPGYYVVEVDWIVADTPRLLHRLLLNIRMRLHR"
FT   gene            complement(67651..67968)
FT                   /locus_tag="RPR_00375"
FT   CDS_pept        complement(67651..67968)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_00375"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_00375"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47067"
FT                   /db_xref="UniProtKB/TrEMBL:C4K0G6"
FT                   /protein_id="ACR47067.1"
FT                   /translation="MKNEEQHNPPTPKHGRIIFPLYTMGKVCVDKKLIDEEWKLNEFET
FT                   GKGSDERFGNDVAGEPLPLDGHILNGGRTDDTDWVNATNEEIRAELKDPTFNWINYTIR
FT                   R"
FT   gene            complement(68116..68592)
FT                   /locus_tag="RPR_00380"
FT   CDS_pept        complement(68116..68592)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_00380"
FT                   /product="hypothetical protein"
FT                   /note="COG5430 Uncharacterized secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_00380"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47068"
FT                   /db_xref="InterPro:IPR007893"
FT                   /db_xref="UniProtKB/TrEMBL:C4K0G7"
FT                   /protein_id="ACR47068.1"
FT                   /translation="MALLATCNPSVPTVNFGSFNVGTISTTSVTASVTCGVLLSLLVSY
FT                   TVTFSTGAANIYNPRNMINGVRKLNYNLYKDAGFTQILGNGTSSTVTFTNSYTLGLEPV
FT                   TKNYTVYARLPSQPLAAAGTFQDTITVTQPWLYNKKSLKSKCFSLGSNFVACMD"
FT   misc_feature    complement(68739..71037)
FT                   /note="authentic frameshifts: common BLAST hit:
FT                   gi|67459098|ref|YP_246722.1| P pilus assembly protein FimD"
FT   gene            complement(71222..71536)
FT                   /locus_tag="RPR_00420"
FT   CDS_pept        complement(71222..71536)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_00420"
FT                   /product="hypothetical protein"
FT                   /note="COG3121 P pilus assembly protein, chaperone PapD"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_00420"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47069"
FT                   /db_xref="GOA:C4K0G8"
FT                   /db_xref="InterPro:IPR008962"
FT                   /db_xref="InterPro:IPR016147"
FT                   /db_xref="UniProtKB/TrEMBL:C4K0G8"
FT                   /protein_id="ACR47069.1"
FT                   /translation="MTVQNNDYAPKKFQLIRLKRTYTDGIEEYKETKDLVATPITFTLH
FT                   DGKIQLIRVALKNTQNYSTKTKDYRIFIKELPRRVKLENSVTSTVDLVVQHSIAITISG
FT                   "
FT   gene            complement(71646..71846)
FT                   /locus_tag="RPR_00425"
FT   CDS_pept        complement(71646..71846)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_00425"
FT                   /product="protein U precursor"
FT                   /note="COG5430 Uncharacterized secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_00425"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47070"
FT                   /db_xref="InterPro:IPR007893"
FT                   /db_xref="UniProtKB/TrEMBL:C4K0G9"
FT                   /protein_id="ACR47070.1"
FT                   /translation="MLTLIVIYLIIFTPMQGERRIGENQSSDWGMGTGLDQTLTIYGKI
FT                   PQGANVPSDTYNDTITIIVAY"
FT   gene            72660..73682
FT                   /locus_tag="RPR_00435"
FT   CDS_pept        72660..73682
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_00435"
FT                   /product="thioredoxin reductase"
FT                   /note="COG0492 Thioredoxin reductase"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_00435"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47071"
FT                   /db_xref="GOA:C4K0H0"
FT                   /db_xref="InterPro:IPR022890"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C4K0H0"
FT                   /protein_id="ACR47071.1"
FT                   /translation="MYNTDVVIIGAGPVGLFAVFQAGMLGMKCHVIDAQEVIGGQCITL
FT                   YPEKPIYDIPAYPKIAAEELIKQLALQAAPFNPIYHLNQQAIELNKQDDFFEIKTSKNT
FT                   LIKSKVIIIAAGAGSFGPNKPPLANIEDFESKSVFYFINDKSKFAGKNIVIAGGGDSAV
FT                   DWAISLSDIANKIYLVHRRDKFTAAPESVRQLRHIAETDKIELITGYQLNALDGNNSEL
FT                   QSVIVKDLQNNTRKLDANILLPFFGLKQDLGSLANWGLNVKLHHIEVDSSYYQTNIEGI
FT                   YAIGDIAHYVGKLKLILTGFAEAASSLHHAYSRVFDGKALHFEYSTTKNTGKRSKSVTK
FT                   "
FT   gene            73832..74926
FT                   /locus_tag="RPR_00440"
FT   CDS_pept        73832..74926
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_00440"
FT                   /product="transposase ISRpe1"
FT                   /note="COG2801 Transposase and inactivated derivatives"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_00440"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47072"
FT                   /db_xref="GOA:C4K0H1"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:C4K0H1"
FT                   /protein_id="ACR47072.1"
FT                   /translation="MNLNQKIIKPKIGLLELAKSLGSISSACKAMGYSRDSYYRFKALY
FT                   ETGGEEALYEISRRKPIIANRVDPAIEKAVMDMAIEYPAYGQLRVSNELKKSGILVSPG
FT                   GVRSIWLRNDLNNISKRLKALEAKMAQDGIVLTESQLQVLEERRNEREAHGETETQHPG
FT                   YLGCQDTYYVGNFKGIGKVYSQVFIDSYTRVADAKLYTDKTALTAADMLNDRVLPWYET
FT                   QGIPILRILTDRGSEYKGNIEHHAFELFLSIEGIEHTTTKAYSPQTNGMCERFNKTMKQ
FT                   EFFDTAMRKKIYTDLDDLQLDLDIWLEHFNNERPHSGKYCYGKTPMQTFKDSKKLAVEK
FT                   NNEILYLEYVSDSQNVTDNQVQNL"
FT   gene            75015..75881
FT                   /locus_tag="RPR_00445"
FT   CDS_pept        75015..75881
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_00445"
FT                   /product="methenyltetrahydrofolate cyclohydrolase"
FT                   /note="COG0190 5,10-methylene-tetrahydrofolate
FT                   dehydrogenase/Methenyl tetrahydrofolate cyclohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_00445"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47073"
FT                   /db_xref="GOA:C4K0H2"
FT                   /db_xref="InterPro:IPR000672"
FT                   /db_xref="InterPro:IPR020630"
FT                   /db_xref="InterPro:IPR020631"
FT                   /db_xref="InterPro:IPR020867"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4K0H2"
FT                   /protein_id="ACR47073.1"
FT                   /translation="MNNIIDGKALANEILADLKLEIQELTSHTNASPKLAIVLVGDNPA
FT                   SIIYVRNKIKNAHKIGIYTVLINLSATIHTNDLISKINELNLDNEISGIIVQLPLPSSI
FT                   DKNKILSAVSPSKDIDGFHPLNVGYLHSGISQGFIPCTALGCLAAIKKYEPNLTGKNVV
FT                   IIGRSNIVGKPLSALLLKENCSVTICHSKTHNLRSITSKADIVVAAIGSPLKLTAEYFN
FT                   PESIVIDVGINRISSNKIIGDVDFENVQSKVQYITPIPGGIGPMTIAFLLKNTVKAFKD
FT                   SLYTLDT"
FT   gene            complement(75912..76427)
FT                   /locus_tag="RPR_00450"
FT   CDS_pept        complement(75912..76427)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_00450"
FT                   /product="carbonic anhydrase"
FT                   /note="COG0663 Carbonic anhydrases/acetyltransferases,
FT                   isoleucine patch superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_00450"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47074"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="UniProtKB/TrEMBL:C4K0H3"
FT                   /protein_id="ACR47074.1"
FT                   /translation="MLIIPYKGVTPRIDKSAYIAESSSLIGDVEIGSNSSIWFNTVLRG
FT                   DVESIKIGNNTNVQDGSVIHASRFNGPVEIGDNITIGHLSLIHACTIHNNAFIGMSATI
FT                   MDYAVIEEYAFIAASSLILPKKIIKSQELWMGSPAKFVRYLTDQDLEYMQDNVRHYVEL
FT                   ANVYKILV"
FT   gene            complement(76427..77005)
FT                   /locus_tag="RPR_00455"
FT   CDS_pept        complement(76427..77005)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_00455"
FT                   /product="ribosome-associated factor Y"
FT                   /note="COG1544 Ribosome-associated protein Y (PSrp-1)"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_00455"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47075"
FT                   /db_xref="GOA:C4K0H4"
FT                   /db_xref="InterPro:IPR003489"
FT                   /db_xref="InterPro:IPR032528"
FT                   /db_xref="InterPro:IPR036567"
FT                   /db_xref="InterPro:IPR038416"
FT                   /db_xref="UniProtKB/TrEMBL:C4K0H4"
FT                   /protein_id="ACR47075.1"
FT                   /translation="MIISVSGQHISIGNNLQEYSKERATQVVKKYFTDIINIDIHFSKE
FT                   GINFKCDIIVKYGSGKHNIVKSNDSCSDIYVAFDKAMSKLEKQLRKYKSKFKNHHAGKV
FT                   KISEIAYAGTKYIINPQSDSETSNAEDNDNPAIIAEKPVEILKLSVKEAVMQMDLEDLP
FT                   AVVFKNINNDRINIVYYRKDGNISWVDYN"
FT   gene            complement(77122..77430)
FT                   /locus_tag="RPR_00460"
FT   CDS_pept        complement(77122..77430)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_00460"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_00460"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47076"
FT                   /db_xref="UniProtKB/TrEMBL:C4K0H5"
FT                   /protein_id="ACR47076.1"
FT                   /translation="MTKPYVIKLTTPFERIKLYNSIPDIALRSAIIMQAIIDATNTSTK
FT                   KEATKAEYNAKKWLVENNENFNATCLEIGIEPNYVRKTAKKLIKSQQNKDKRPKLYG"
FT   gene            77826..77902
FT                   /locus_tag="RPR_t07772"
FT   tRNA            77826..77902
FT                   /locus_tag="RPR_t07772"
FT                   /product="tRNA-Asp"
FT   misc_feature    complement(78280..80282)
FT                   /note="authentic frameshifts in rickettsial Sca3 gene
FT                   fragment"
FT   gene            complement(80774..83110)
FT                   /locus_tag="RPR_00490"
FT   CDS_pept        complement(80774..83110)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_00490"
FT                   /product="ATP-dependent endopeptidase Lon"
FT                   /note="COG0466 ATP-dependent Lon protease, bacterial type"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_00490"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47077"
FT                   /db_xref="GOA:C4K0H6"
FT                   /db_xref="InterPro:IPR003111"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004815"
FT                   /db_xref="InterPro:IPR008268"
FT                   /db_xref="InterPro:IPR008269"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027065"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027543"
FT                   /db_xref="UniProtKB/TrEMBL:C4K0H6"
FT                   /protein_id="ACR47077.1"
FT                   /translation="MHKKSLPLMALRDMVVFPGVIAPIFVGRPKSLQALSHTTISEEDN
FT                   SKYILVTLQKKFDQENPSTHELYNTAILAKIIQIVKLPNNTAKILIEAVARVKLSNIKG
FT                   DEAFEANYEIIPDEEIFDVNNMRSLVDNAVQLFSKYAINDKKVNAEIIETINKEISNST
FT                   NFIDIINILASHLITSLEAKQHLLEETSPFKRITTVISTLTANIVNSETEQALQQRVRK
FT                   QIEKTQRDYYLHEQMKAIQKELDEDKSELADIEKKIKSLKLSKEAKEKAEAELKKLRTM
FT                   NQMSAESGVTRNYLETLLSLPWGKYDNSKIDINQAEKILNRDHFGLEKVKERIIEYLAV
FT                   LQRSSKIRGPILCLIGPPGVGKTSLVKSIAEGMGRKYTKLTLGGVRDEAEIRGHRKTYL
FT                   GSMPGKILGQLKKVKTSNPVMLLDEIDKMSSDFRGDPASALLEVLDPEQNSHFVDHYLE
FT                   VEYDLSNVIFIATANSHDLPRALSDRMEKIYISGYVEETKLQIARNYLVPKQFKMHKIK
FT                   KDEITISETAILDLIRYYTKESGVRALEREIGALTRKALKQILADKSVKHIAIDSNHLE
FT                   EFLGAKKYNFGLAEKEDQIGSTTGLAYTEVGGELLTIEALAFPGKGEIKTTGKLGDVMK
FT                   ESAMAAYSCFRSRATNFGLKYDNYKDFDIHIHVPAGAIPKDGPSAGCALFTTIVSLMTK
FT                   IPVHRTVAMTGEITLRGNVLPIGGLKEKLLAASRGGIKTVLIPEENVKDLQDIPPNIKE
FT                   SLEIISVSNIDQVLKHALVGTPINK"
FT   gene            83196..84227
FT                   /locus_tag="RPR_00495"
FT   CDS_pept        83196..84227
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_00495"
FT                   /product="threonine dehydratase"
FT                   /EC_number="4.3.1.19"
FT                   /note="COG1171 Threonine dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_00495"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47078"
FT                   /db_xref="GOA:C4K0H7"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:C4K0H7"
FT                   /protein_id="ACR47078.1"
FT                   /translation="MNLLLQPPQNVAAAHNRIKQYLHLTPIVHSESLNEMLGHEIFFKV
FT                   ESLQKTGAFKVRGVLNHLLELKEQGKLPDKIVGYSTGNHGIGLAYASKLFGIKTRIYLP
FT                   LNTSKVKQQAALYYGGEVIYTYTRQEAEEKAKEDEKQGFYYMHPSDSDSTIAGAGTLCY
FT                   EALQQLGFSPDAIFASCGGGGLISGAYLAKELISPTSLLIGSEPLNANDAYLSVKDNKT
FT                   YRFNYAPNTIADGLKTLSISARTFEYLKKLDDFYLAEEYEIYYWTAWLTHLLKVICEPS
FT                   SSINMVSVVNFLKTQSKPQKLLVLISGGNIDPILYNELWKEAYLSISPKSLCSDVISAK
FT                   AAI"
FT   misc_feature    complement(84401..84643)
FT                   /note="hypothetical rickettsial gene (AIG_03530 homolog)
FT                   disrupted by transposon insertion, COG0419: ATPase involved
FT                   in DNA repair"
FT   gene            complement(84662..85756)
FT                   /locus_tag="RPR_00505"
FT   CDS_pept        complement(84662..85756)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_00505"
FT                   /product="transposase ISRpe1"
FT                   /note="COG2801 Transposase and inactivated derivatives"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_00505"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47079"
FT                   /db_xref="GOA:C4K0H1"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:C4K0H1"
FT                   /protein_id="ACR47079.1"
FT                   /translation="MNLNQKIIKPKIGLLELAKSLGSISSACKAMGYSRDSYYRFKALY
FT                   ETGGEEALYEISRRKPIIANRVDPAIEKAVMDMAIEYPAYGQLRVSNELKKSGILVSPG
FT                   GVRSIWLRNDLNNISKRLKALEAKMAQDGIVLTESQLQVLEERRNEREAHGETETQHPG
FT                   YLGCQDTYYVGNFKGIGKVYSQVFIDSYTRVADAKLYTDKTALTAADMLNDRVLPWYET
FT                   QGIPILRILTDRGSEYKGNIEHHAFELFLSIEGIEHTTTKAYSPQTNGMCERFNKTMKQ
FT                   EFFDTAMRKKIYTDLDDLQLDLDIWLEHFNNERPHSGKYCYGKTPMQTFKDSKKLAVEK
FT                   NNEILYLEYVSDSQNVTDNQVQNL"
FT   misc_feature    complement(85809..86297)
FT                   /note="hypothetical rickettsial gene (AIG_03530 homolog)
FT                   disrupted by transposon insertion, COG0419: ATPase involved
FT                   in DNA repair"
FT   gene            complement(86384..86545)
FT                   /locus_tag="RPR_00515"
FT   CDS_pept        complement(86384..86545)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_00515"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_00515"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47080"
FT                   /db_xref="UniProtKB/TrEMBL:C4K0H9"
FT                   /protein_id="ACR47080.1"
FT                   /translation="MSEELQREKQAPNIVKQNKTIPQGYKSSISTPISHVENLNKSRES
FT                   GQQSGHSK"
FT   gene            complement(86661..87266)
FT                   /locus_tag="RPR_00520"
FT   CDS_pept        complement(86661..87266)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_00520"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_00520"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47081"
FT                   /db_xref="UniProtKB/TrEMBL:C4K0I0"
FT                   /protein_id="ACR47081.1"
FT                   /translation="MNDEKRNGLSEDEVMDIKKPLEKAMLELANQKISKEQYREKLIDK
FT                   TLDNLKENVSATTLGNYRKFLTKNTTPKLDKQEQINDPKQVEALTQAALKIAEFLKITF
FT                   QTNEKEAKALSSINELGVNEPNIIKTLLPAISKLPSEKMIEQGKEIIKNFAPLLESSNS
FT                   ALVNGTKRVLAELNPGYLRNTRMGGESIALELQRVTKP"
FT   gene            complement(87332..89293)
FT                   /locus_tag="RPR_00525"
FT   CDS_pept        complement(87332..89293)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_00525"
FT                   /product="DNA helicase II"
FT                   /note="COG0210 Superfamily I DNA and RNA helicases"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_00525"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47082"
FT                   /db_xref="GOA:C4K0I1"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR005751"
FT                   /db_xref="InterPro:IPR013986"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="UniProtKB/TrEMBL:C4K0I1"
FT                   /protein_id="ACR47082.1"
FT                   /translation="MQNQDFIHTLNPEQQKAVLHTEGPLLLLAGAGTGKTKVLTSRIAN
FT                   IIHQNLASPQNILAVTFTNKAAKEMAERVNSLINCYGLNIGTFHSMAARILRDQIEHLN
FT                   LGLNNRFTIISHDDQLKLVKDIVKLKDIDTKKYAPKLIHIIISRWKDQGLLPTKLSVSD
FT                   TNLPLQRIAKLVYEEYQKNLLISNVLDFGDLLLYNNELFIKNSEILRYYQEKYRYILID
FT                   EYQDTNVVQYLWARMLASLYKNICCVGDDDQSIYGWRGAEVGNILRFEKDFAGATIIKL
FT                   EQNYRSTLPILAAASNVINNNKNRHGKTLWTDRENGEKIKIISCWSDKEEARYIAGEID
FT                   KLVRENRYNAGNIAILVRAGFQTRSFEEAFINSAMPYKIIGGLRFYERMEIRDVLAYIR
FT                   ISLNQNDNLALERIINVPKRAIGAASLNKIRGYALERNISNFAAIKEMLEIDEIKAKSY
FT                   ETLKDLVTKIDNWYERFSIDAPINVVKAILDDSGYLEMLQEEKTEEAFGRIENINEMLR
FT                   AIAEFNDVHDFIEHSSLVMENEVLETNYGGSVTIMTLHAAKGLEFDVVFLPGWEEGVFP
FT                   SQRSLDEDGEKGLEEERRIAYVGITRAKKDLYITHAESRKIFYEIVRSYPSRFITEIPD
FT                   EITIRTSSIKKYNSFYKF"
FT   gene            complement(89371..90216)
FT                   /locus_tag="RPR_00530"
FT   CDS_pept        complement(89371..90216)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_00530"
FT                   /product="glycosyl transferase"
FT                   /note="COG0463 Glycosyltransferases involved in cell wall
FT                   biogenesis"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_00530"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47083"
FT                   /db_xref="GOA:C4K0I2"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:C4K0I2"
FT                   /protein_id="ACR47083.1"
FT                   /translation="MHSNLPKISIVLPVYNRKTLLPCAIESCLNQSFKDFELIIIDDCS
FT                   KDNSVIVARTYAEQDSRIKVIVNETNKRLPASLNIAFKEAKGEYFTWTSDDNLFHENAL
FT                   EKMVKILDNSPEIGLVYTDYTLIDDHGKVGIRLYQEPPEFLPIRNCVGACFLYRADLAR
FT                   QVGGYNENMQLVDDYEYWLRFGLVTKFAHIPESLYFYRVHDQSLTIERKVEAKQAKRVL
FT                   KALFKDQYIIPAEIKPINDLYNWFIEDRNLSSYFRLFKIIICSPIITISYIIKNLRRIR
FT                   "
FT   gene            complement(90209..90556)
FT                   /locus_tag="RPR_00535"
FT   CDS_pept        complement(90209..90556)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_00535"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_00535"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47084"
FT                   /db_xref="UniProtKB/TrEMBL:C4K0I3"
FT                   /protein_id="ACR47084.1"
FT                   /translation="MLVLVDNIEVQIEKIYEVFDLIDNEGADLLLWAVSDCLAELLAQY
FT                   KESLTIEYVDPLMQLIKRFEEQNTIIPKMLNNALSNILLILEDGCKAEESELIENIINS
FT                   LNTLDMLGGHA"
FT   gene            complement(90724..92133)
FT                   /locus_tag="RPR_00540"
FT   CDS_pept        complement(90724..92133)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_00540"
FT                   /product="succinate-semialdehyde dehydrogenase (NADP+)"
FT                   /note="COG1012 NAD-dependent aldehyde dehydrogenases"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_00540"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47085"
FT                   /db_xref="GOA:C4K0I4"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniProtKB/TrEMBL:C4K0I4"
FT                   /protein_id="ACR47085.1"
FT                   /translation="MNLLKNITGKNYINGEFIEFGKQISVINPATLKEIATVPNLGLSE
FT                   INSAINNTVTNFSLWSQSSFEARIAILRRWYNLVIENIEELSHILTLEQGKVLAESKKE
FT                   ILYGASFIDWYTYAIHNIHSTIKPGNSNTHKIVTQYEPVGPSAAITPWNFPNAMIACKV
FT                   IPAAIAAGCSVILKPSSLTPLSALVLAKFASDAGLPAGVFNVITGSSDIIGKAFCEDFR
FT                   LRKLSFTGATNVGKILYQNAANTLKRLSLELGSNAPFIITADNNLEKVVSDLVIAKTRN
FT                   SGQSCTSPNRIFIEESIYEKFIEILKAKFTKLKAGDGFDKESDVGPLINSAAIEKIQKL
FT                   LADAQSKGATLICGGKTVDNFIEPTIIIDCLDNMDIFRIEIFGPVVACYKFKDLDEVIE
FT                   HANNTEYGLQGYVYSNNISVAQMIASKLDFGMVSINDPLPANAKAPFAGRKASGFGVEG
FT                   SFEGIFEYLNI"
FT   gene            complement(92258..92410)
FT                   /locus_tag="RPR_00545"
FT   CDS_pept        complement(92258..92410)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_00545"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_00545"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47086"
FT                   /db_xref="UniProtKB/TrEMBL:C4K0I5"
FT                   /protein_id="ACR47086.1"
FT                   /translation="MNLILNAIAPEDIINDDIINIIKHANLANISYDVLESQMGGEDFG
FT                   INNSL"
FT   gene            complement(92519..92746)
FT                   /locus_tag="RPR_00550"
FT   CDS_pept        complement(92519..92746)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_00550"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_00550"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47087"
FT                   /db_xref="UniProtKB/TrEMBL:C4K0I6"
FT                   /protein_id="ACR47087.1"
FT                   /translation="MISLESQLINPKKKYYSDISSEVIEYAWGNIKGVKGNYLEPFKNL
FT                   IAFGKEEISPSELWVKIAEAIKVDKVSNLL"
FT   gene            complement(92808..93104)
FT                   /locus_tag="RPR_00555"
FT   CDS_pept        complement(92808..93104)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_00555"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_00555"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47088"
FT                   /db_xref="UniProtKB/TrEMBL:C4K0I7"
FT                   /protein_id="ACR47088.1"
FT                   /translation="MKNTNLEIELAEAAFSQKFLIYSAIKSYLNHFYPNSQSVKFTELE
FT                   ITRVRYDQVIKAPDIRLATDKPTTTNIFKNLTLDSICYIRIGFLMEMTQMVGC"
FT   gene            complement(93324..94256)
FT                   /locus_tag="RPR_00560"
FT   CDS_pept        complement(93324..94256)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_00560"
FT                   /product="thioredoxin reductase"
FT                   /note="COG0492 Thioredoxin reductase"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_00560"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47089"
FT                   /db_xref="GOA:C4K0I8"
FT                   /db_xref="InterPro:IPR005982"
FT                   /db_xref="InterPro:IPR008255"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C4K0I8"
FT                   /protein_id="ACR47089.1"
FT                   /translation="MKITTKVLIIGSGPAGLSAAIYTARAALKPILINGMQPGGQLTIT
FT                   TGVENYPGFAETVQGPWLMEQMSMQAKNVGTEIVSDYVEKVDLSKRPFKVFTGAGNEYD
FT                   AESIIICTGAEAKWLGIASEQKFRGFGVSACATCDGFFFKNQEIVVVGGGNSAVEEALY
FT                   LTNHANKVTIVHRRDSFRAEKILQDRLFKNSKISVIWDHVVDEIVGSNKPKSVTGVKIQ
FT                   NVHTKEISLLNCSGVFIAIGHAPNTGLFTGQIVMDDDNYIITKSGTTRTSVEGVFAAGD
FT                   VQDKIYRQAVTAAGTGCMAALEAEKFLNK"
FT   gene            complement(94458..95330)
FT                   /locus_tag="RPR_00565"
FT   CDS_pept        complement(94458..95330)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_00565"
FT                   /product="2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate
FT                   hydrolase"
FT                   /note="COG0596 Predicted hydrolases or acyltransferases
FT                   (alpha/beta hydrolase superfamily)"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_00565"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47090"
FT                   /db_xref="GOA:C4K0I9"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C4K0I9"
FT                   /protein_id="ACR47090.1"
FT                   /translation="MKINSIKIGPYINLLPLQYIPKHKISYLEFGDPKNKNIIVCAHGL
FT                   TRNAHDFDKIAKELSKNYRVIAINYPGRSDSENFKKANHYNYTTYIKDTLFFLKRLNIK
FT                   NPIWLGTSMGGIIGMVLASKYKNIFKALILNDIGAFIDAAPLIKIGGYAKKTILLDDLA
FT                   SAKEHLKLIYAQSGIKDEEDWDYLTKYSVISTFGGKYKMNYDPAITKGMKNASNQEDIK
FT                   LWSVWNKITCRILVIHGMKSQILTKSTLKKMKETKIFDLYEIKYAGHAPSLMNHEEINY
FT                   VKSWLEKKS"
FT   gene            complement(95399..96328)
FT                   /locus_tag="RPR_00570"
FT   CDS_pept        complement(95399..96328)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_00570"
FT                   /product="permease"
FT                   /note="COG0679 Predicted permeases"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_00570"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47091"
FT                   /db_xref="GOA:C4K0J0"
FT                   /db_xref="UniProtKB/TrEMBL:C4K0J0"
FT                   /protein_id="ACR47091.1"
FT                   /translation="MIIFSIVFFKTVSVLLSVVIGFLAGKYSNVERDSISSLLFYFISP
FT                   IVFFTIPASTTLTLAALSVTVVTFVIATLLSLFSYYFFGKFWQDHTRNIIALSAGTANG
FT                   GYFMLPIAAALFDDYTLSIYMMAVIGVNIYECSVGFYICMRSFANTTDSILKVVKLPIL
FT                   NAFFLGCLFSFCGFTLPDFLDDFIYNMKGSFSILGMVMVGLALSSLQKFEVNIKFTLAT
FT                   FTAKFLFYPLGVGLFIMFDHFVTKWYNNDYYNALKLLSTAPLAANTIVIANLQKFYPEK
FT                   VAATVFLSLLFAVIYMPTMVSIFLSDLN"
FT   misc_feature    complement(96554..97530)
FT                   /note="authentic frameshift: common BLAST hit:
FT                   gi|165933209|ref|YP_001649998.1| NAD(P)H-dependent
FT                   glycerol-3-phosphate dehydrogenase"
FT   gene            complement(97778..99460)
FT                   /locus_tag="RPR_00585"
FT   CDS_pept        complement(97778..99460)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_00585"
FT                   /product="hypothetical protein"
FT                   /note="COG0595 Predicted hydrolase of the
FT                   metallo-beta-lactamase superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_00585"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47092"
FT                   /db_xref="GOA:C4K0J1"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR004613"
FT                   /db_xref="InterPro:IPR011108"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="InterPro:IPR042173"
FT                   /db_xref="UniProtKB/TrEMBL:C4K0J1"
FT                   /protein_id="ACR47092.1"
FT                   /translation="MSSFNIKNHKNDLLFVPLGGSNEIGMNLNLYHYQGQWLMIDCGSG
FT                   FADDYLPGVDMIIADSSFIEKYKKDIVGLILTHAHEDHLGGVQYLWNRLKCPIYITTFT
FT                   ANFLKIRLNEYDFAKNIKIHEVKPGSKINLDPFSLEMVPLTHSAPEMQAIMIRTDAGNI
FT                   LHTGDWKFDNDPILGKKADEELLKSYGDEGVLALVCDSTNVFNKGSSGSEGDVRKSLVD
FT                   IIAGCPQMVVVSTFASNLARLDTIIHAAGLAGRKVVLTGRSLHRMMLAAQESGYLKDIA
FT                   PLISERDVSRFRREELLVIATGCQGEPMAATAKLASNSHPSIKLVPKDTMIFSSKIIPG
FT                   NEKKIFRLFNIFVKAGVEVITERDHFVHVSGHPSIDELQKMYSLIRPNICIPVHGEPVH
FT                   IHEHVKLAKKNGIKQVVEVENGSVVLLEPNNAKVISKVENGYLAVDGNYLLPVESPIFK
FT                   ARRRMRESGIVVASVVINKKGLLAANPMLSMPGLLDPKEDMALVNLIKNDIKELVTIQN
FT                   KQAKKALSDEQVIEAIKGTIRKTLKQEINKSPVIIVNLEKAVE"
FT   gene            99547..100314
FT                   /gene="ppnK"
FT                   /locus_tag="RPR_00590"
FT   CDS_pept        99547..100314
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ppnK"
FT                   /locus_tag="RPR_00590"
FT                   /product="inorganic polyphosphate/ATP-NAD kinase"
FT                   /EC_number="2.7.1.23"
FT                   /note="COG0061 Predicted sugar kinase"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_00590"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47093"
FT                   /db_xref="GOA:C4K0J2"
FT                   /db_xref="InterPro:IPR002504"
FT                   /db_xref="InterPro:IPR016064"
FT                   /db_xref="InterPro:IPR017437"
FT                   /db_xref="InterPro:IPR017438"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4K0J2"
FT                   /protein_id="ACR47093.1"
FT                   /translation="MNINKIALIYNHNSKHLAIIEEIKKLYNYCKIEEAEVIIVIGGDG
FT                   ELLHNIHRYMHLNIPFYGVNLGNLGFLMNPLDTKKLLQNIHESTVSILNPLLMQVEDTS
FT                   GQIYTALAINEVSIFRKTNQAAKFRIEVNGIERMSELVADGALVATPAGSSAYNLSASG
FT                   PILPLESNMLCLTPICSFRPRRWHGALLLSSATIKFEILNTNKRPVNATADFQEFNNIT
FT                   NVTVKSTKDKPVKLLFNKNHTLEDRIIKEQFGG"
FT   misc_feature    100494..102170
FT                   /note="authentic frameshifts in hypothetical rickettsial
FT                   gene"
FT   gene            complement(102192..102797)
FT                   /gene="recR"
FT                   /locus_tag="RPR_00600"
FT   CDS_pept        complement(102192..102797)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recR"
FT                   /locus_tag="RPR_00600"
FT                   /product="recombination protein RecR"
FT                   /note="COG0353 Recombinational DNA repair protein (RecFOR
FT                   pathway)"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_00600"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47094"
FT                   /db_xref="GOA:C4K0J3"
FT                   /db_xref="InterPro:IPR000093"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR015967"
FT                   /db_xref="InterPro:IPR023627"
FT                   /db_xref="InterPro:IPR023628"
FT                   /db_xref="InterPro:IPR034137"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4K0J3"
FT                   /protein_id="ACR47094.1"
FT                   /translation="MNETNDNDIDQLIYLFSKLPGLGIRSARRIALYLLQDKDVRLKSL
FT                   INNLVEIDKKIVKCEICGNMDTENICRICSSEYRDKSIIAIVETVAELWAMERSGNFKG
FT                   LYHVFGHNLSAASRQNPSILRLPELLTRCFAENIKEVIIATNSTLEGQTTAYFITEYLK
FT                   EHPAKISRLASGIPIGGELDYLDDGTVSAAINLRQPFE"
FT   gene            complement(102955..103476)
FT                   /locus_tag="RPR_00605"
FT   CDS_pept        complement(102955..103476)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_00605"
FT                   /product="hypothetical protein"
FT                   /note="COG1714 Predicted membrane protein/domain"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_00605"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47095"
FT                   /db_xref="GOA:C4K0J4"
FT                   /db_xref="InterPro:IPR010432"
FT                   /db_xref="UniProtKB/TrEMBL:C4K0J4"
FT                   /protein_id="ACR47095.1"
FT                   /translation="MKKQIIYPDFIARIFSTALDLSVFAFIAIPISQFCSFNLLWLFFN
FT                   DYFLSNNINLHNPNEMFNSVMSQEFYEYLKAGNFNKYILFNISIFATNILVIGSYFITL
FT                   WYYKGATLSKMFLRMKIVDAVTLNRPTLKQLIKRFLGYMTFPIGIFFILFSSKKQALHD
FT                   KIAGTVVIKS"
FT   gene            103619..104053
FT                   /locus_tag="RPR_00610"
FT   CDS_pept        103619..104053
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_00610"
FT                   /product="hypothetical protein"
FT                   /note="COG1238 Predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_00610"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47096"
FT                   /db_xref="GOA:C4K0J5"
FT                   /db_xref="UniProtKB/TrEMBL:C4K0J5"
FT                   /protein_id="ACR47096.1"
FT                   /translation="MNQFKAYSLLFVDSFVSNLVIGFQNELIFHSMKMFGGYNSLIMLL
FT                   VAICASLSGNAINYIFGKIVLNIFYASKNTQNILRHKNLTKLYYKYEIFIIFLMAFSFW
FT                   GSFISLFSGFFKTKFLKFLGIGCLAKACYYALELYIFFNA"
FT   gene            104050..104412
FT                   /gene="rbfA"
FT                   /locus_tag="RPR_00615"
FT   CDS_pept        104050..104412
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rbfA"
FT                   /locus_tag="RPR_00615"
FT                   /product="ribosome-binding factor A"
FT                   /note="COG0858 Ribosome-binding factor A"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_00615"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47097"
FT                   /db_xref="GOA:C4K0J6"
FT                   /db_xref="InterPro:IPR000238"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR020053"
FT                   /db_xref="InterPro:IPR023799"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4K0J6"
FT                   /protein_id="ACR47097.1"
FT                   /translation="MKKLTKTHSHRQQKLASIINEALIEILRRGKMLDSRLFDCPLTIT
FT                   KVIVTTDLKIANCYFLPFNTKLTIDEIMDALNNSKNAIRNFITNKINMKFSPDIRFHYD
FT                   HGFDNAIKVAHLLKDL"
FT   misc_feature    104589..105512
FT                   /note="authentic internal stop codon in acyltransferase 3
FT                   family member"
FT   gene            105840..106475
FT                   /locus_tag="RPR_00625"
FT   CDS_pept        105840..106475
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_00625"
FT                   /product="hypothetical protein"
FT                   /note="COG4395 Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_00625"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47098"
FT                   /db_xref="GOA:C4K0J7"
FT                   /db_xref="InterPro:IPR007379"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:C4K0J7"
FT                   /protein_id="ACR47098.1"
FT                   /translation="MSPQIIELLIFAVIAFYIINKLITTLGSTSEEEQTKQKSYFGEPV
FT                   IKDVTYSIVKSNKEEKNIPTAQDIKVFKDIIVEHNITAVVDGMEQVHKRLYSFDPVKFI
FT                   NNAKTAFQMIIEAAYKKDAKELSELIDKRYLEEFEKITPSYGDFFDSSALSAKYSEIYM
FT                   FGNNIFIKLLFQGKNVVDKIEDLKEEWTFTRNANTKEVDWFLSNIERV"
FT   gene            106563..108611
FT                   /locus_tag="RPR_00630"
FT   CDS_pept        106563..108611
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_00630"
FT                   /product="acylamino-acid-releasing enzyme"
FT                   /note="COG1506 Dipeptidyl
FT                   aminopeptidases/acylaminoacyl-peptidases"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_00630"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47099"
FT                   /db_xref="GOA:C4K0J8"
FT                   /db_xref="InterPro:IPR001375"
FT                   /db_xref="InterPro:IPR002470"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C4K0J8"
FT                   /protein_id="ACR47099.1"
FT                   /translation="MSKIFYIIGTIYIIGTILIISVGIFMFQTITDNNQIIPRKVLFGN
FT                   PDKARVSLTHDGQYILYVAPKDGVLNIWLAPSDDISKAEAITHDKGRGIWSYAKAYNNK
FT                   NILYTQDFNGDENDRIYSYNIETKETKLLTPAKGVKAKIAGASHKKPNEILIYLNERNP
FT                   EYFDIYKLNLDTLEKELIYKNDRFTDYVTDENLNLRFGSLLDKDGAVEYYELKDGEPKL
FT                   FTKISMEDSFNTSILGFDASGETLYMLEGRNRNTSVLKAITLATGSEEILAEDAKADIG
FT                   LFTVHPTKQTSQAVSIDYDRVSYKILDKDIEDDIKYLQSIDRGDLIINSRTLDDKTWIV
FT                   AYMADNAPVKYYKYDRANKKAEFLFTNRKELEQYNLAKMIPIIIKSRDGLDLVSYITFP
FT                   NDVKLDKNNIPDRKVPLILNVHGGPWVRDSWGYNPEHQWLANRGYAVLSINYRGSTGFG
FT                   KDFLNAGNLEYAGKMHTDLIDGVNWAIKNNIVDSDKVCIMGGSYGGYATLVGLTMTPDV
FT                   FACGIDVVGMSNLLTHVQSKAPYMTPLLSIYKTRIGPWDTEEEKEFLRQRSPINFVDNI
FT                   KKPLFIAQGVHDVRVVQAESEQIVNSMQAKHIPVVYALYKDEGHGFAKAGNRISYYALA
FT                   EQFLAKVLKGRAEHIGDDLKNANLILNDKEKISSTEAEKIIDTAVGN"
FT   misc_feature    108778..109229
FT                   /note="authentic frameshifts in cytochrome b561 family
FT                   gene"
FT   gene            109389..109643
FT                   /locus_tag="RPR_00645"
FT   CDS_pept        109389..109643
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_00645"
FT                   /product="hypothetical protein"
FT                   /note="COG2002 Regulators of stationary/sporulation gene
FT                   expression"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_00645"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47100"
FT                   /db_xref="GOA:C4K0J9"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="UniProtKB/TrEMBL:C4K0J9"
FT                   /protein_id="ACR47100.1"
FT                   /translation="MSKSARVVISSKGQVVIPKYIRNKLGLHSGSELIINYKKNETLEL
FT                   LPIKKDIYSFFGKGKHKAKNGPVDVDEAISIAVIENDRN"
FT   gene            109630..110019
FT                   /locus_tag="RPR_00650"
FT   CDS_pept        109630..110019
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_00650"
FT                   /product="hypothetical protein"
FT                   /note="COG5611 Predicted nucleic-acid-binding protein,
FT                   contains PIN domain"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_00650"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47101"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:C4K0K0"
FT                   /protein_id="ACR47101.1"
FT                   /translation="MIGIDTNILTRTFLEDDEIQGKAAQNFLKHNITNKIFIASYALLE
FT                   FVWVLKVNKFTRQEIYEAVINLIDNSGFIIGHQDIIISATEKYIKGKADFADYMIIAEG
FT                   EVNSANKFITFDKDIVREVKNASYP"
FT   gene            110052..111212
FT                   /gene="sucC"
FT                   /locus_tag="RPR_00655"
FT   CDS_pept        110052..111212
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sucC"
FT                   /locus_tag="RPR_00655"
FT                   /product="succinyl-CoA synthetase subunit beta"
FT                   /EC_number="6.2.1.5"
FT                   /note="COG0045 Succinyl-CoA synthetase, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_00655"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47102"
FT                   /db_xref="GOA:C4K0K1"
FT                   /db_xref="InterPro:IPR005809"
FT                   /db_xref="InterPro:IPR005811"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013650"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016102"
FT                   /db_xref="InterPro:IPR017866"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4K0K1"
FT                   /protein_id="ACR47102.1"
FT                   /translation="MNIHEYQAKEILRKYGVPTSTGLVVTQTEKINETIDKLNTEVYVV
FT                   KAQIHAGGRGKAGGVKVVKSKEEAKKVAHDMFGINLVTHQTGPQGQKVNRLYIESGCDI
FT                   LKEYYFSIVFDRSASCITFIASTEGGVDIEEVAEKTPEKIIKFSVDPATGLQDFHMRGI
FT                   AYELGFKDNQAKQMKEIVKSVYNAFIETDAAQIEINPLIVNSDGHLLALDAKITFDDNG
FT                   LLRHPNITAMRDHDEEDPLETRAANAGLSYVKMDGNIGCMVNGAGLAMATMDIIKLYGA
FT                   SPANFLDVGGGADRERVKEALKIILSDKEVQGILVNIFGGIMRCDIIAEGIIAAAKDIG
FT                   IKVPLVVRLAGTNVEKGEEILSNSGLEIIPAHDLADAANKIVEAIR"
FT   gene            111388..112266
FT                   /locus_tag="RPR_00660"
FT   CDS_pept        111388..112266
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_00660"
FT                   /product="succinyl-CoA synthetase subunit alpha"
FT                   /EC_number="6.2.1.5"
FT                   /note="COG0074 Succinyl-CoA synthetase, alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_00660"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47103"
FT                   /db_xref="GOA:C4K0K2"
FT                   /db_xref="InterPro:IPR003781"
FT                   /db_xref="InterPro:IPR005810"
FT                   /db_xref="InterPro:IPR005811"
FT                   /db_xref="InterPro:IPR016102"
FT                   /db_xref="InterPro:IPR017440"
FT                   /db_xref="InterPro:IPR033847"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C4K0K2"
FT                   /protein_id="ACR47103.1"
FT                   /translation="MAILINKKTQVICQGFTGLQGTFHSEQAIAYGTNMVGGVTPGKGG
FT                   HTHLDLPVYNTVHEAKAKTGANASVIYVPPGFAADSILEAIDAEIEVVVCITEGIPVLD
FT                   MMKVKRALVGSKTRLIGPNCPGVITPGECKIGIMPGHIHKRGTIGIVSRSGTLTYEAVA
FT                   QTTAVGLGQSTCVGIGGDPVNGTNFVDCIEMFLKDDETKAIIMIGEIGGNAEEDAAEFI
FT                   KQSKIKKPIVSFIAGITAPPGKRMGHAGAIIVGRTGSAEDKLEALQSAGVIITRSPADI
FT                   GKTMLDVEVKI"
FT   gene            complement(112278..113372)
FT                   /locus_tag="RPR_00665"
FT   CDS_pept        complement(112278..113372)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_00665"
FT                   /product="transposase ISRpe1"
FT                   /note="COG2801 Transposase and inactivated derivatives"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_00665"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47104"
FT                   /db_xref="GOA:C4K0K3"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:C4K0K3"
FT                   /protein_id="ACR47104.1"
FT                   /translation="MNLNQKIIKPKIGLLELAKSLGSISSACKAMGYSRDSYYRFKALY
FT                   ETGGEEALYEISRRKPIIANRVDPAIKKAVMDMAIEYPAYGQLRVSNELKKSGILVSPG
FT                   GVRSIWLRNDLNNISKRLKALEAKMAQDGIVLTESQLQVLEERRNEREAHGETETQHPG
FT                   YLGCQDTYYVGNFKGIGKVYSQVFIDSYTRVADAKLYTDKTALTAADMLNDRVLPWYET
FT                   QGIPILRILTDRGSEYKGNIEHHAFELFLSIEGIEHTTTKTYSPQTNGMCERFNKTMKQ
FT                   EFFDTAMRKKIYTDLDDLQLDLDIWLEHFNNERPHSGKYCYGKTPMQTFKDSRKLAVEK
FT                   NNEILYLEYVSDSQNLTDNQVQNL"
FT   gene            115478..116854
FT                   /locus_tag="RPR_00670"
FT   CDS_pept        115478..116854
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_00670"
FT                   /product="NADH dehydrogenase subunit N"
FT                   /EC_number="1.6.5.3"
FT                   /note="COG1007 NADH:ubiquinone oxidoreductase subunit 2
FT                   (chain N)"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_00670"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47105"
FT                   /db_xref="GOA:C4K0K4"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="InterPro:IPR010096"
FT                   /db_xref="UniProtKB/TrEMBL:C4K0K4"
FT                   /protein_id="ACR47105.1"
FT                   /translation="MLLLLPEITLTLIALLGQFFAIMIPNKNRIISNIIILLCILSIFL
FT                   TFKYSSYEGVWYSFATGINIGISKSIVLLFTIISMIIYRDYSILVADELKFEFITLMLL
FT                   SVVGIFVAISSRNFLLLFCGMELTALTSYALAGFKLNDMKSSEGALKYFILGSLVSCLS
FT                   LFGISFIYGFGGSLQFEDILYKLNDNSGMNLGLIIGIVLFLSSIFFKLSSVPLHFWVPD
FT                   VYEGSPITSVTYFNAASKIGMVIVLLNISKLIIGNYYPINYNLIKIIAILSMLFGAFGA
FT                   IRQTSLKRLMAYSTILNIGYVLIGVLLHNQEGYKAALLYILIYAVGSIGFFTCLIILLG
FT                   KDVNKASFKTIQGIAEYHKTIAAVISIVMFSMIGIPPLTGFFGKYYLFYQAINQEEFAL
FT                   AYCGIFTSVVAAFYYLKVVKAMYFSKKIEIIKLPMQYGLLLINYLVVGFLLLGSFIISF
FT                   "
FT   gene            complement(116841..118382)
FT                   /locus_tag="RPR_00675"
FT   CDS_pept        complement(116841..118382)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_00675"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_00675"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47106"
FT                   /db_xref="InterPro:IPR040519"
FT                   /db_xref="UniProtKB/TrEMBL:C4K0K5"
FT                   /protein_id="ACR47106.1"
FT                   /translation="MTQNKKSVFKGWNFLKPKGGGANEVGEHGGVYQSLDGKITAMIKK
FT                   EVSSSKNIAEFLGSQIFEAISPGNGAKVNLIAPDDFNKSKAVDLQIYVKSEFFENYSSD
FT                   MYVDMDKHMSAKTKPSSWFRKDCGRPLFMGARNKLFRTLENAFKEIKYQNFENIMPASL
FT                   LIGDFDIHVGNIGVIRDQKNPKTLPKLVRIDFAGSFDNLTNNIYPHSRAKHLPGFGPTN
FT                   HFREFPSNLRTKNPNFADSLLAVSKIDLSKTIDKSFDALTKYYSNEAIAEFAKQAMPKQ
FT                   FNNKQSKEITPEEIKASLIDTMKKRQESLKEYGLEIKVNSLISKKYSFPYYEVKEQGLK
FT                   TLMKEYPDYFAKILNYEERKKGGQKLKLRNKITTNFARILEILGIRDSAKKHLIKTIKS
FT                   LNEDIKDERNLAGSSDKIKKEPKQKLVKTNIYANREYVDALEKFKKEVGTDDTVSVTPS
FT                   QLGLAKKAKQKDQDLLKLDEENLKHIKNLKEKVMKPTQTTAASVVNKKSTPAKTR"
FT   gene            complement(118447..119463)
FT                   /locus_tag="RPR_00680"
FT   CDS_pept        complement(118447..119463)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_00680"
FT                   /product="delta-aminolevulinic acid dehydratase"
FT                   /EC_number="4.2.1.24"
FT                   /note="COG0113 Delta-aminolevulinic acid dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_00680"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47107"
FT                   /db_xref="GOA:C4K0K6"
FT                   /db_xref="InterPro:IPR001731"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:C4K0K6"
FT                   /protein_id="ACR47107.1"
FT                   /translation="MYPHIRLRRNRKAFWLRELISESNLSVSDLVLPLFVVEGHNERQE
FT                   IKTMPGIYRLSIDQIVETAKEAAELGINVIALFPSIDQSLKSENADEAYNLDNLICRTI
FT                   RNIKNANIDIGIICDVALDPYTTHGHDGIVHHGEVDNDRSVRALCNQALVLAKAGVDIV
FT                   APSDMMDGRIRAIREYLDKEGFINVGILAYAAKYASSFYGPFRDAVKSNKKNYLDKSSY
FT                   QMDVRNIKEAMLEIEHDIAEGADMVMVKPGMPFLDVIREAANNLNAKIFAYQVSGEYAM
FT                   LKFAAEAGAMDWERALMESLISFKRAGATGIFTYAALEVAEILKNNKIRYKTASDIK"
FT   gene            119677..120573
FT                   /locus_tag="RPR_00685"
FT   CDS_pept        119677..120573
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_00685"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_00685"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47108"
FT                   /db_xref="UniProtKB/TrEMBL:C4K0K7"
FT                   /protein_id="ACR47108.1"
FT                   /translation="MGKKSKNMSNNPPKNTKPAVPLKPTSEQIKAWNEAHKKQTDLTTH
FT                   SQALDIFVDTPSPQVETQKPIIFSKPAPEQTKVPETTPQKQSNLTVKEKIEQFFKDHNI
FT                   DTKDALIPEFSHYIALSGSMAGKRLDVTIKAYEQSLGRLIKQVGVPQKEFVSFIEDDLI
FT                   KNYPHKDKFEKINQHYKLPEPPTLSDIIDNLRELVNNDDIIAHLKQSRKHIEFKEKVNN
FT                   IIQIYDDNKHNPAAIAKVEAKLQEVGKWCEETTKMDNNPIWKNIGNFIQYSFTGDKAKA
FT                   AFYKDTIKILLKILKKL"
FT   gene            complement(120659..122605)
FT                   /locus_tag="RPR_00690"
FT   CDS_pept        complement(120659..122605)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_00690"
FT                   /product="primosome assembly protein PriA"
FT                   /note="COG1198 Primosomal protein N' (replication factor Y)
FT                   - superfamily II helicase"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_00690"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47109"
FT                   /db_xref="GOA:C4K0K8"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR005259"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040498"
FT                   /db_xref="InterPro:IPR041222"
FT                   /db_xref="InterPro:IPR041236"
FT                   /db_xref="InterPro:IPR042115"
FT                   /db_xref="UniProtKB/TrEMBL:C4K0K8"
FT                   /protein_id="ACR47109.1"
FT                   /translation="MRIAKILLPVAKLFPLDYLIPEDLELNIGDLVVVPFRNKELTGIV
FT                   WELVSNSEAKKIKTIRAKVPLNLNITSEVLELIKWMSSYYMSELGSIAKLVLPMDIAEK
FT                   PIKVKEQKVNNNFVLPDLLEEQKQAVTILNESNKPTLVKGVTGSGKTEIYFHLIADYLA
FT                   KGKQVLVMLPEIALSTQIINRFIERFGFEPIIWNSSVTKAHKKMILRGILSDKVKVVIG
FT                   ARSSLFLPFKNLGLIVIDEEHDDSYKQDDGILYNARDTAIVRGTFDKAQIVLCSATPSI
FT                   ETIHNIEIGKYQLVTLVNRYKNVALPNIEIIDMTKEKLSKNSYLSKLLIEAIKGNLDNK
FT                   KQVLLFLNRRGYAPLMLCKACGHRLTCKFCSSWMVVHKATKKLECHHCGYQSKIFSSCP
FT                   ECLEDETLTICGPGIERIEEEAKALFPESKIAVISKDHAKSPEKIAQLLHQMENLEIDI
FT                   LIGTQIITKGYHFPNLTLVGVIDADLGSNNADLRASERTFQLLHQVGGRAGRGDSKGVV
FT                   YLQSYYPDNTIFSYVKAGDEDSFFANELEIRKSADMPPFSKTASVILSGSSEAKILEIA
FT                   RDMVRIAPKANVKILGPASSLMSKLAGKYRYRILIIADKKFNLQKYLKFWLSLIKIPSF
FT                   CHLKIDIDPKSFY"
FT   gene            122667..123242
FT                   /locus_tag="RPR_00695"
FT   CDS_pept        122667..123242
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_00695"
FT                   /product="aromatic acid decarboxylase"
FT                   /note="COG0163 3-polyprenyl-4-hydroxybenzoate
FT                   decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_00695"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47110"
FT                   /db_xref="GOA:C4K0K9"
FT                   /db_xref="InterPro:IPR003382"
FT                   /db_xref="InterPro:IPR004507"
FT                   /db_xref="InterPro:IPR036551"
FT                   /db_xref="UniProtKB/TrEMBL:C4K0K9"
FT                   /protein_id="ACR47110.1"
FT                   /translation="MNKETKIVIAISGASGAIYGIRLLEVLKQQNIETHLVISEGAALT
FT                   IKLETKYSIDKVKLLANYYYDDKDLGATISSGSFKTSGMIIAPCSMKTLASIAHSMEDN
FT                   LISRAAGVVLKDRRKLILMTRETPLHIGHLENMLKVASYGGIISPPVPAFYNNPVSIDD
FT                   IVNHSITRVLDFFDIETNLIKRWDSYEQ"
FT   gene            123609..125093
FT                   /locus_tag="RPR_00705"
FT   CDS_pept        123609..125093
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_00705"
FT                   /product="replicative DNA helicase"
FT                   /note="COG0305 Replicative DNA helicase"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_00705"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47111"
FT                   /db_xref="GOA:C4K0L0"
FT                   /db_xref="InterPro:IPR007692"
FT                   /db_xref="InterPro:IPR007693"
FT                   /db_xref="InterPro:IPR007694"
FT                   /db_xref="InterPro:IPR016136"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036185"
FT                   /db_xref="UniProtKB/TrEMBL:C4K0L0"
FT                   /protein_id="ACR47111.1"
FT                   /translation="MARNKINNETNILADNEDNLPIPRVLPSNVQAEQMLLGAILTNNE
FT                   LLNYVSEFLRDAHFFEPIHKKIYKAIEKITEKGLTATPITLRSMLTQDALFQEVEGAEY
FT                   LAKLITMSMMVINPVDYGKIIYDLAIKRNLINIGEEVVNNAYNSSLEVEAKEQIEHAEA
FT                   KLYDLASEGLNEKSFTKIGISISESLASINRAMKNNDHIIGISTGLIDLDNKLCGFHNS
FT                   DLIILAGRPSMGKTAFAINLALNTCNNMRLKNIRDNQEIQSVGFFSLEMSSEQLTTRLL
FT                   SMCAEIDSTSLRTGILGEEKYNRLRKEANTLSELQFFIDDTPALSISAIRTRARRMKRK
FT                   HNLGILFIDYLQLIRGVSKSENRVSEISEITQGLKAIAKELNIPVIALSQLSRAVELRE
FT                   DKKPMLSDLRESGTIEQDADIVMFIYREEYYLTRKEPAAGDAKHAAWLDKLNKVYNIAD
FT                   IIVAKHRNGPVGNVPLYYDSQFSKFGNLETRTFNSN"
FT   gene            complement(125254..125463)
FT                   /locus_tag="RPR_00710"
FT   CDS_pept        complement(125254..125463)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_00710"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_00710"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47112"
FT                   /db_xref="UniProtKB/TrEMBL:C4K0L1"
FT                   /protein_id="ACR47112.1"
FT                   /translation="MIIGNNIETIKHVRNNGQISVRKKYAGKQIQVLTSSDGTIIIKPG
FT                   KFIPYNEMWLYRNNNNEVFDKAIG"
FT   misc_feature    complement(125529..126571)
FT                   /note="authentic frameshifts in COG0814 amino acid permease
FT                   gene"
FT   gene            126964..127656
FT                   /locus_tag="RPR_00735"
FT   CDS_pept        126964..127656
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_00735"
FT                   /product="ribosomal large subunit pseudouridine synthase B"
FT                   /note="COG1187 16S rRNA uridine-516 pseudouridylate
FT                   synthase and related pseudouridylate synthases"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_00735"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47113"
FT                   /db_xref="GOA:C4K0L2"
FT                   /db_xref="InterPro:IPR000748"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR018496"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="InterPro:IPR042092"
FT                   /db_xref="UniProtKB/TrEMBL:C4K0L2"
FT                   /protein_id="ACR47113.1"
FT                   /translation="MHRLAKIISNAGVCSRRDAEKLIVEGQVKVDGITILSPTTNVDIS
FT                   NQIEVSGTLINNIHKPRLWIYYKPVGLITTHKDPLSRKTVFEQLTGLPRVISIGRLDLN
FT                   SEGLLLLTNSGDLARQFELPSSRLKRVYHVRAYGKYDILLKSNYKNLEIDGIFYNPHSI
FT                   KLLKQNKTNCWFEVVLFEGKNREIRRIFEYCGLKVNKLIRIQYGNFTIDNLKPGDYKEI
FT                   NNKILENN"
FT   gene            127703..130582
FT                   /locus_tag="RPR_00740"
FT   CDS_pept        127703..130582
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_00740"
FT                   /product="hypothetical protein"
FT                   /note="COG1357 Uncharacterized low-complexity proteins"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_00740"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47114"
FT                   /db_xref="GOA:C4K0L3"
FT                   /db_xref="InterPro:IPR001646"
FT                   /db_xref="UniProtKB/TrEMBL:C4K0L3"
FT                   /protein_id="ACR47114.1"
FT                   /translation="MTNLNIYTCAEKDLNDYLGYIKDNPSVSLNDFIKNKYFAEDNDNI
FT                   IITSLENMEINADLANADFQGTILTDAVFNNCDLTNTILCDSDLTNVKFNDCTFIGTDF
FT                   RGANLHYTDFNYKDYDYDNYKIPNLKDKIRDIKLSFSDLERLNQYIDKDLEQEHIKEIV
FT                   IDEATKTKKYILAGEDEKTLWNIKSKELKTKQEELETLKQNLDNPGIATNLLNAFWNSA
FT                   ETIARNRQNELEKINKLQHEVNKLETEVYALDNLRMFCGKGLDGIFEQLKDEEIQITLD
FT                   PSYIIGSTAKERDIPKEYIKLTSAEFDLYLAEAAKQSNTKLSLTEFVRKQKNLSEDLNI
FT                   VPDLSAINLSGKTLTNLNLKNTLFASANLENVKISNCNLDFTNFEGANLQNAVFQNVTA
FT                   RNAGFLFADLKKSKIENSDMSRAYMPKVDLSEVEVTNSKFNAVMMVNADAEKLIIKDSE
FT                   WKNSNLTGISLAYADMQRVQMQGVVLNNALLDQANIVSTNLENVFMNKTHALEAKFKEQ
FT                   CNMQGITARNAYFSYAEFENILSLKEADLREAIMQRVKLKNADLTKAQLDKANLEYADL
FT                   TNATLTNAIAQFAKLSNATLEKAEAEGLNISDAIAKNINAKEANFKNAIMQRADLTKAN
FT                   FTKAVLENADMQAVEAAEAIFKEANLKQANLKAANLVGINKEGADFDKAKINDATKMHD
FT                   TKGEAKGNLDHQDKDDKKTSVNVNKHAKLQDKIHAREKSGWFLKTGVGQLCTKLAKSTT
FT                   SGISRVTNFLASKKFLVGLAVVAGLAVAAAPFVAMPVLLVTGTALTTKAVILGAGILAG
FT                   GLVATGTYKLTQKPLRNLQKSFENLTSSIDKYISPPPKNIDELVTAKQQARQKAETEKS
FT                   KEREENLNNVNNYIDKAKEQDLLKQAQNNLNQATPKVEIKEKKDKTVEKQQAKSNTFAA
FT                   KFKPNTQGKGFATKIKDEKKSRSIKEAYN"
FT   gene            130587..131324
FT                   /locus_tag="RPR_00745"
FT   CDS_pept        130587..131324
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_00745"
FT                   /product="hypothetical protein"
FT                   /note="COG0742 N6-adenine-specific methylase"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_00745"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47115"
FT                   /db_xref="GOA:C4K0L4"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR005728"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C4K0L4"
FT                   /protein_id="ACR47115.1"
FT                   /translation="MLKIISGKYRNQIIPTAKNIKYRPSTGKLKEAIFSILTSGEFTGN
FT                   KLFNANTHILDLFAGSGSLAFERLSRGAGFATLIDIDTSSLKIAEGFAKSLNIENNVNF
FT                   VNINALNLPKATRHLFKPAYRDGSKGDTEHSTAAYTLVREDASTGSTSKLPLEAKFGKM
FT                   SNKSFDLVFIDPPYHKNIVPKVMKLLIKNNWLKDGAIIVIEMAKTDDYILDENIEIIRE
FT                   KLYGKSKLLVLSFTVIPAKAGIQ"
FT   gene            131445..132779
FT                   /locus_tag="RPR_00750"
FT   CDS_pept        131445..132779
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_00750"
FT                   /product="DNA repair protein RadA"
FT                   /note="COG1066 Predicted ATP-dependent serine protease"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_00750"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47116"
FT                   /db_xref="GOA:C4K0L5"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004504"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020588"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041166"
FT                   /db_xref="UniProtKB/TrEMBL:C4K0L5"
FT                   /protein_id="ACR47116.1"
FT                   /translation="MTKKHYICSNCGNISPKWSGQCFDCGVWGSIVEEIISTNQAIVKV
FT                   GSKQDFDKLSGHVTEQLRIPTPIGEFNRVLGGGLVLGSAILIGGDPGIGKSTLLLQLAA
FT                   SNFASKMNCLYITGEESLDQIKLRAIRLNLTNYNTDILAATNLEDIIASIEANKNNIDL
FT                   IVIDSIQTITTKELSSPPGTVSQIRTCANELVNYAKQNNIIILLSCHITKDGQLAGPKI
FT                   LEHLVDTVLYFEGDHNNHFRILRSYKNRFGGVGEIGVFEMNGSGLIEVTNPSELFLMQR
FT                   EQNVIGTSIFAGIEGSRPLLMEVQALIVPSNMVTPRRSAVGWDANRLSMILAVLSSRIG
FT                   LNLANYEVYLSIAGGLKIADPASDLAVTASLISAATGNPVPEHSVFFGEISLSGEIRKT
FT                   AKAETRIKEAVKLGFNKIICSKFENLTYDFISSVSHLKDLKEIIK"
FT   gene            132776..133090
FT                   /locus_tag="RPR_00755"
FT   CDS_pept        132776..133090
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_00755"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_00755"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47117"
FT                   /db_xref="UniProtKB/TrEMBL:C4K0L6"
FT                   /protein_id="ACR47117.1"
FT                   /translation="MSIVYEIRNLEEARNFLSSVEEQLILTNHASSVKYYGMLAIDYMF
FT                   KTLSKEFPEKVLDLTVNVGEDHAALFTAIKLGYKNISYTGNSEEARGLLYGYQTVIASD
FT                   "
FT   gene            133213..133926
FT                   /gene="recO"
FT                   /locus_tag="RPR_00760"
FT   CDS_pept        133213..133926
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recO"
FT                   /locus_tag="RPR_00760"
FT                   /product="DNA repair protein RecO"
FT                   /note="COG1381 Recombinational DNA repair protein (RecFOR
FT                   pathway)"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_00760"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47118"
FT                   /db_xref="GOA:C4K0L7"
FT                   /db_xref="InterPro:IPR003717"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022572"
FT                   /db_xref="InterPro:IPR037278"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4K0L7"
FT                   /protein_id="ACR47118.1"
FT                   /translation="MNIKDIGVIIAKKPLKENTFIITVFTKNHGLYSGVVKEFSKKSKF
FT                   IYQEGNIIDFLWQARLHEHIGMAKCELIKSYTGYFITNKAKLYAFNSVISLIKELFHER
FT                   EEHSKFFLFLINYLDNLSKNFCFRDYINFELALLAETGYKLDLTKCGVSHVTTDLIYVS
FT                   PKSARALSYEVGKPYKDKLLMLPRFLLSDNSEITLEEKRQALALTNYFFNRYLFHNNRQ
FT                   VEARQTFIEYTLNNF"
FT   gene            134478..135170
FT                   /locus_tag="RPR_00770"
FT   CDS_pept        134478..135170
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_00770"
FT                   /product="glycoprotease family protein"
FT                   /note="COG1214 Inactive homolog of metal-dependent
FT                   proteases, putative molecular chaperone"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_00770"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47119"
FT                   /db_xref="GOA:C4K0L8"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR022496"
FT                   /db_xref="UniProtKB/TrEMBL:C4K0L8"
FT                   /protein_id="ACR47119.1"
FT                   /translation="MKILAFDTANNTASVAISENENILACIEELRPSMQAENLMPMIED
FT                   VMKSAKCSYDDLDYLAVTNGPGSFTGIRIGLASAKGILFSKENIKAVAVSNFEYAYFRA
FT                   VTQVKDYDKIYVFLNAYRSQLYMQVFHKSGQIEEPLLIDFEYAIKLLINEKGNIVCCGS
FT                   GLEFIYHQIMHLPNIITLPRFARVKAWVTCRYIASRLSSDVKLNSSIEPLYIRPPDAKI
FT                   AINYAIPS"
FT   gene            complement(135227..136489)
FT                   /locus_tag="RPR_00775"
FT   CDS_pept        complement(135227..136489)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_00775"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_00775"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47120"
FT                   /db_xref="UniProtKB/TrEMBL:C4K0L9"
FT                   /protein_id="ACR47120.1"
FT                   /translation="MAITSIFNKLQNLIPNNTSPKSASYLAHDEFEFITSPTKQEENTD
FT                   FLAALDNSIKQYDEKSARCNKKIVEAQAKYPFLNSKIIFQEAVKGQPDTLGISQIRFTD
FT                   LLNKLDGSEKVTNTPKSKGFFSTFSSSLKTVYDFGVKSFNIIKNISSILSSKVAETFNF
FT                   VSNKVFSYLNNNAEETFNLLDQLETLPDNELVEAILNTSENALDEVFEKITYKKLVELI
FT                   NNISDEQAQKLVHYILPEHFEKLMQFIPLDKLNTYMDTTLSLEKLTEQELKKLSDEDIS
FT                   DEQLENIIILAGEEKLAENFDIIPNKNLVRIMSHISNDKLAPIISHASDESLVRIIDII
FT                   NSDNHDLSKSLVGQIIALIHDKKCVKQESGAVSDSDSGFFDYEDEIKVSDNQVEHSNSD
FT                   FTMKLSYNFGVFNYEDDVVYL"
FT   gene            complement(136860..139355)
FT                   /gene="infB"
FT                   /locus_tag="RPR_00780"
FT   CDS_pept        complement(136860..139355)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="infB"
FT                   /locus_tag="RPR_00780"
FT                   /product="translation initiation factor IF-2"
FT                   /note="COG0532 Translation initiation factor 2 (IF-2;
FT                   GTPase)"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_00780"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47121"
FT                   /db_xref="GOA:C4K0M0"
FT                   /db_xref="InterPro:IPR000178"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006847"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR015760"
FT                   /db_xref="InterPro:IPR023115"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036925"
FT                   /db_xref="UniProtKB/TrEMBL:C4K0M0"
FT                   /protein_id="ACR47121.1"
FT                   /translation="MTDNQEIKPKKLTLGNSKLSLNKSFDSLTGAQSFVNAKSKTLVEV
FT                   RKSSTGSATTLSLNKERNSLDQTVIDANKEEFNRRLSILKKAAEQSQLNDPSKISTLSK
FT                   LASINQSANSKIEPLETDKEVEQTQQNTEENKVEVSAKIVQDDEDIPSQIPKKKEETFV
FT                   KSPLVGMRTRYGIESEKELDKTADSKIIAPKIKLEEPKKFKKADLFNMLSDDESGSGRT
FT                   RSLASIKRAREKEKRKLVSQAPEKVYREVTIPEVIGVGDLANAMSERVADVIKELMKLG
FT                   ILANASQTIDADTAELVATNLGHTVKRVQESDVENVLISDDKVEDLRTRAPVVTVMGHV
FT                   DHGKTSLLDALKSTDIAAGELGGITQHIGAYRVTLADGRAITFIDTPGHEAFSEMRSRG
FT                   AKVTDIVIIVVAADDGIKTQTVEAINHAKAAGVPIIVAINKIDKPDIDIERVKNELYVH
FT                   EIIGEEAGGDVMIIPISALKKINLDKLEEAILLIAEMQDLKANPFGSAAGVVIESKIEQ
FT                   GRGTLTTILVQRGTLRNSDIIIAGTAYGKVKKMTNDKGLEIVEATPSVPVEIQGLNEVP
FT                   FAGDKFNIVQNEKQAKDIAEYRMRLAKEKKISIAPRSSLEDLFLKASGNSKIKELPLII
FT                   KGDVQGSVEAISGSLLKLPSDEIKLRILHSGVGPITESDVSLAHASSAIIVGFNVRAGA
FT                   NALTAAEKEKVDIRYYSIIYHLIDDIKAIMSGMLDPIVREQYIGSAEIRQIFNITKVGK
FT                   IAGSYVTKGIIKKGAGVRLLRDNVVIHEGKLKTLKRFKDEVKEVREGYECGIAFENYED
FT                   IREGDTVEVFELIQEQRQL"
FT   gene            complement(139586..141097)
FT                   /gene="nusA"
FT                   /locus_tag="RPR_00785"
FT   CDS_pept        complement(139586..141097)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nusA"
FT                   /locus_tag="RPR_00785"
FT                   /product="transcription elongation factor NusA"
FT                   /note="COG0195 Transcription elongation factor"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_00785"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47122"
FT                   /db_xref="GOA:C4K0M1"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR010213"
FT                   /db_xref="InterPro:IPR010214"
FT                   /db_xref="InterPro:IPR010995"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013735"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR025249"
FT                   /db_xref="InterPro:IPR030842"
FT                   /db_xref="InterPro:IPR036555"
FT                   /db_xref="UniProtKB/TrEMBL:C4K0M1"
FT                   /protein_id="ACR47122.1"
FT                   /translation="MSNIGNVEILQIIDSVAREKGISKEILISTVEQAVQAAGRKKYGN
FT                   EYNIKAQINRKTGEINLLRILKIVEDVEDYLTQISLEEALIKNPEAKIGDEIYEYLPPI
FT                   DHARVSAQTAKQVITQRVIEAEREKQYHDFKDRKGEIINGIVKRIEYGDIIVDLSRAEA
FT                   IIKKDQLIKGENFKPNDRIKAYVQDVRQETKGPQIFLSRVDNQMLVKLFKLEVPEILES
FT                   IIQIKSVARDPGSKAKIAVFASDSSIDPVGSCVGIRGNRVKAVTNELNGEKIDIVLWSN
FT                   DLAQFIVNALAPLAPGEITKILIDEDRHKVEVVVSQENQSIAIGRRGQNVRLASQLTGW
FT                   NIDIMTEEQESKRRNEEFLTSTALFMEALDVEEVIGQLLSVTGFNSVEQIASSEISTLT
FT                   RIEGFEEELAVEIKNRAINYVDLKNEKIIKKLEDLGVEQELIDILELSLELILQFAEYG
FT                   IKTIEDLGEMSVNEFKNLAPNSNITDENIKLLIKTARQHGALKYS"
FT   gene            complement(141176..142270)
FT                   /locus_tag="RPR_00790"
FT   CDS_pept        complement(141176..142270)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_00790"
FT                   /product="transposase ISRpe1"
FT                   /note="COG2801 Transposase and inactivated derivatives"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_00790"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47123"
FT                   /db_xref="GOA:C4K0M2"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:C4K0M2"
FT                   /protein_id="ACR47123.1"
FT                   /translation="MNLNQKIIKPKIGLLELAKSLGSISSACKAMGYSRDSYYRFKALY
FT                   ETGGEEALYEISRRKPIIANRVDPAIKKAVMDMAIEYPAYGQLRVSNELKKSGILVSPG
FT                   GVRSIWLRNDLNNISKRLKALEAKMAQDSIVLTESQLQVLEKRRNEREAHGETETQHPG
FT                   YLGCQDTYYVGNFKGIGKVYSQVFIDSYTRVADAKLYTDKTALTAADMLNDRVLPWYET
FT                   QGIPILRILTDRGSEYKGNIEHHAFELFLSIEGIEHTTTKAYSPQTNGMCERFNKTMKQ
FT                   EFFDTAMRKKIYTDLDDLQLDLDIWLEHFNNERPHSGKYCYGKTPMQTFKDSRKLAVEK
FT                   NNEILYLEYVSDSQNVTDNQVQNL"
FT   misc_feature    complement(142335..142512)
FT                   /note="conjugative transfer protein TraV, partial,
FT                   truncated by transposon"
FT   gene            complement(142512..143930)
FT                   /locus_tag="RPR_00800"
FT   CDS_pept        complement(142512..143930)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_00800"
FT                   /product="F pilus assembly protein TraB"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_00800"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47124"
FT                   /db_xref="GOA:C4K0M3"
FT                   /db_xref="InterPro:IPR005498"
FT                   /db_xref="UniProtKB/TrEMBL:C4K0M3"
FT                   /protein_id="ACR47124.1"
FT                   /translation="MNQDFNKQEELQSKVEDHTLSSAFSKRLLGLIEIIKNRPLVTLAC
FT                   IGVIMVLVFYGLSENEVKTSLDLQEERQAREISGIEKAIDPRAKWTAEILNEVKNMQNH
FT                   LEKLIENKYLETKTNIDDFSQKLESLENPREETILYDGNDFNNNQKIEDLLDNNVEQSI
FT                   AAAPTALVKRLLGYVKRADLGVKKDVKDYITTGSFARGLLLTGVVVGTGTNNAASPEPI
FT                   MIRLVDTAIFSKGYKTEQIKEAILIGSCTGDISSERAKCRLETVSLLNSHGKIIEKSVE
FT                   GWLIGEDGRPGIKGIVVDRSSDVARMAVLNGVLGGIAQFFQNQATNSIFPVSPITGQQN
FT                   ALKVQDSLKAGVYAGTGNALAKLADFAIKRAESMSPVIVVASGRVIDVVFRKGFDLRED
FT                   KEAAKVDRLLPPTTTDYAQNRINYSNYQNYSGNKVTSFTKAKTKLQERFTADNGTYEMT
FT                   DIDLQSEQQHLGNF"
FT   gene            complement(143956..144288)
FT                   /locus_tag="RPR_00805"
FT   CDS_pept        complement(143956..144288)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_00805"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_00805"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47125"
FT                   /db_xref="GOA:C4K0M4"
FT                   /db_xref="UniProtKB/TrEMBL:C4K0M4"
FT                   /protein_id="ACR47125.1"
FT                   /translation="MNVKNKDIIEKENNKQYLRIIYPLLPVLLIFCVNVILSEVALGET
FT                   LEGQLDRIGGLSTGKLKTIGISGATILSSIWAVVRGNLRLARAIVAIGIILGFYLEWVS
FT                   GGMKIS"
FT   gene            complement(144248..144703)
FT                   /locus_tag="RPR_00810"
FT   CDS_pept        complement(144248..144703)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_00810"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_00810"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47126"
FT                   /db_xref="UniProtKB/TrEMBL:C4K0M5"
FT                   /protein_id="ACR47126.1"
FT                   /translation="MKSLKSELQILVVFVGIMLASFSSNAYGISYMLHADSLLELQIAK
FT                   DAPTRINIEGEKINDIFIHPEEAAEVVVHDSGCLFILPQQDQTKLYLTLIGENSTIQDL
FT                   MLNFTKIKPTPIRLIKFDLEQEVIKLTNNKEEKHHECKKQRYNRKRK"
FT   gene            complement(144707..145258)
FT                   /locus_tag="RPR_00815"
FT   CDS_pept        complement(144707..145258)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_00815"
FT                   /product="conjugative transfer protein TraE"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_00815"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47127"
FT                   /db_xref="GOA:C4K0M6"
FT                   /db_xref="InterPro:IPR007973"
FT                   /db_xref="UniProtKB/TrEMBL:C4K0M6"
FT                   /protein_id="ACR47127.1"
FT                   /translation="MDHLFKQSSIQQLVKYNKSLLLITLLLAVTSLLRMMKTVSTEEKW
FT                   LLIPAIEPDRRMIVSSKSYHETYLKEWAVFVMKELFTISPEEVERQIADMKVVSSNTEQ
FT                   LDKFFKEHLDFVKGSNISSVFFPKKVKVIEDGVLINGTFRYWFSENKHVAADKTYLLTY
FT                   KRGANHLLLLTGIKEEEANK"
FT   gene            complement(145258..145566)
FT                   /locus_tag="RPR_00820"
FT   CDS_pept        complement(145258..145566)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_00820"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_00820"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47128"
FT                   /db_xref="GOA:C4K0M7"
FT                   /db_xref="UniProtKB/TrEMBL:C4K0M7"
FT                   /protein_id="ACR47128.1"
FT                   /translation="MDNNCANQRLYWSLSTSLKYMGLSLDEWFVILLGIVPGIVLLNSG
FT                   HAKLGVICIIGGIVLCYIFKKFKKLSEYFVLKSYLVAKKWLYAPTSYPNLLGKKVGK"
FT   gene            complement(145974..147758)
FT                   /locus_tag="RPR_00830"
FT   CDS_pept        complement(145974..147758)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_00830"
FT                   /product="leucine-rich repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_00830"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47129"
FT                   /db_xref="InterPro:IPR001611"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="UniProtKB/TrEMBL:C4K0M8"
FT                   /protein_id="ACR47129.1"
FT                   /translation="MPYKTMIDNLKDNQSLSLSNIGEGDVKSLAQALKGTQITRLDLSN
FT                   NNIGCNGLKYLTQVLRDTQITTLNLTNNNIMDEGVKYLTESLKETQITELDLSENKIGS
FT                   DAAQYLNKMLSNTKMRSLYLDIHYTEDGDVNKYISQRSYCDIKNIHITLHNNKIGIKGA
FT                   QYLNKTFQNIAIAELTLDRQNLEADDAQYLAQAFKNTKISELKMSYNHIMQLNGIQYLV
FT                   QALKDSQIAKLNVHAEKIRTTGAQYLAEFLRAVKVLDLDLGLNYIGDEGMKYLVPVLKN
FT                   SDIMYIDLAWNDIEAEGARYLSEILQNSKILFIDLCNNSIGADGARYLADGLPYSQITG
FT                   IHLHGNMIEYSGYQYLIDVVDNTNISWVNLHGNNIEAGLEEGTKLWPYSIPRNTTPVEC
FT                   KIRHVFKELVSLNPMSNEFEFIVPRKNTYPPVDIAQYAFLVRTLNDNPNSKVHIFDMMC
FT                   KKDHGNDYDFNIMNKINEFIAIMPNKFNTFIDSKLPDLVKSFDSYNYVNLVKQFEDMKL
FT                   YDIVQNLLLHRVLYYVDENQEILHPYIYKMLDKYSMPLYNEQLEPNKKEEIIAYYQSHQ
FT                   EIDGVQEIIDLLGSESFK"
FT   misc_feature    complement(147796..148944)
FT                   /note="authentic frameshifts: common BLAST hit:
FT                   gi|91205255|ref|YP_537610.1| integrase"
FT   gene            149237..149311
FT                   /locus_tag="RPR_t07774"
FT   tRNA            149237..149311
FT                   /locus_tag="RPR_t07774"
FT                   /product="tRNA-OTHER"
FT   misc_feature    complement(149427..151479)
FT                   /note="authentic frameshifts in hypothetical rickettsial
FT                   gene fragment"
FT   gene            complement(152605..152871)
FT                   /locus_tag="RPR_00900"
FT   CDS_pept        complement(152605..152871)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_00900"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_00900"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47130"
FT                   /db_xref="UniProtKB/TrEMBL:C4K0M9"
FT                   /protein_id="ACR47130.1"
FT                   /translation="MFEENINSIDKFGRTLLMLASKKGIIAVSLEFIKLLPPEMIIRAD
FT                   NNGNMAASYADTDKAFAEVKELLQEKQQNLLKNLASFLNKTFL"
FT   gene            complement(152911..153387)
FT                   /locus_tag="RPR_00905"
FT   CDS_pept        complement(152911..153387)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_00905"
FT                   /product="ankyrin repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_00905"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47131"
FT                   /db_xref="GOA:C4K0N0"
FT                   /db_xref="UniProtKB/TrEMBL:C4K0N0"
FT                   /protein_id="ACR47131.1"
FT                   /translation="MVQFQPWPPLFLTLNPVILYLQLNFYCICKLIFVILINFRLIRIN
FT                   YVYTYKKIFGIHKESTPEESDEILYNQLISLLEKLTCVIHAKDEDKKEVEKLIDKIKNT
FT                   NLFNQSDEDGNTVLILAADAGLEEGCLKLIPKMSDEAINTIENIRGQPALTKAM"
FT   gene            complement(153361..153436)
FT                   /locus_tag="RPR_t07776"
FT   tRNA            complement(153361..153436)
FT                   /locus_tag="RPR_t07776"
FT                   /product="tRNA-Phe"
FT   gene            153687..154706
FT                   /locus_tag="RPR_00910"
FT   CDS_pept        153687..154706
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_00910"
FT                   /product="nifR3-like protein"
FT                   /note="COG0042 tRNA-dihydrouridine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_00910"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47132"
FT                   /db_xref="GOA:C4K0N1"
FT                   /db_xref="InterPro:IPR001269"
FT                   /db_xref="InterPro:IPR004652"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018517"
FT                   /db_xref="InterPro:IPR024036"
FT                   /db_xref="InterPro:IPR035587"
FT                   /db_xref="UniProtKB/TrEMBL:C4K0N1"
FT                   /protein_id="ACR47132.1"
FT                   /translation="MFIFITVFMIKIGNIELSSNIILAPMSGVTDLEFRRLVKRFGAGL
FT                   VVSEMVASRAMIVESRQSLKKSAIMRDDATSACVQLAGCEPNVIAEAAKMNEGMGAKII
FT                   DLNFGCPAKKVVGGYSGSALMRDEQLAAKIFEATVEAVKLPVTVKMRMGWDDNTKNAPT
FT                   LAKIAESSGVQMITVHGRTRCQFYSGNADWDFIRSVKESVKIPVIANGDITNFAKAKAA
FT                   LQKSGADGIMVGRGAYGKPWLISQIDHYLKTGEEKSAPSIAEQLDIVTEHYEAILDYYG
FT                   ESVGVPIARKHIGWYSSGLPNSAEFRGAVNLMNDPLAVKEKIAEFYTSVMETNKLKEF"
FT   gene            154724..155413
FT                   /locus_tag="RPR_00915"
FT   CDS_pept        154724..155413
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_00915"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_00915"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47133"
FT                   /db_xref="UniProtKB/TrEMBL:C4K0N2"
FT                   /protein_id="ACR47133.1"
FT                   /translation="MFFSLSYASEKAVIITDYKLVFLPVITENKKIRIAIRSYLNNEKS
FT                   YFVLVDPNSFKTEIALQELVILPTNKIEKENLLKKLSKTPYIKVLNKYSSTPYIQQNYG
FT                   ATSSMYKVKGQFLTIDMCPSSKSFEEDFFKKLVELSIKLNKPIPIAICVSGLWINKHTE
FT                   EFLWLLKQQENGYLQITWVNHSFSHPYFKDKPLEDNFLLSNKDDFENEVLEAGKILVSY
FT                   NIVEVKI"
FT   misc_feature    complement(155425..156518)
FT                   /note="authentic frameshift: common BLAST hit:
FT                   gi|157964614|ref|YP_001499438.1| transposase ISRpe1"
FT   gene            complement(156571..157026)
FT                   /locus_tag="RPR_00930"
FT   CDS_pept        complement(156571..157026)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_00930"
FT                   /product="ATPase YjeE, truncated by transposon"
FT                   /note="ATPase YjeE, predicted to have essential role in
FT                   cell wall biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_00930"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47134"
FT                   /db_xref="GOA:C4K0N3"
FT                   /db_xref="InterPro:IPR003442"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C4K0N3"
FT                   /protein_id="ACR47134.1"
FT                   /translation="MHTLNSEEKTKKLAKLLAQSLKPNDIVLLNGDLGAGKTFFCREII
FT                   KYFCGENTSIISPTFNLLQTYKASNFTIYHYDLYRLKSPEEIYELGFEEALNGNFILIE
FT                   WSEIIKHLLTPPLIEVNLEVLDNNKRLCSIITNHKENSQESSFICNS"
FT   gene            complement(157014..157967)
FT                   /locus_tag="RPR_00935"
FT   CDS_pept        complement(157014..157967)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_00935"
FT                   /product="zinc/manganese ABC transporter substrate binding
FT                   protein"
FT                   /note="COG0803 ABC-type metal ion transport system,
FT                   periplasmic component/surface adhesin"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_00935"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47135"
FT                   /db_xref="GOA:C4K0N4"
FT                   /db_xref="InterPro:IPR006127"
FT                   /db_xref="UniProtKB/TrEMBL:C4K0N4"
FT                   /protein_id="ACR47135.1"
FT                   /translation="MRASTSNRHCEEKLKILTKQSRAKILRLPRSFQSLAMTIWYQRKQ
FT                   TFTEMTYLALLFLTFLSLTSYAKPKIVVSITPIGSIVSMLVKDKADIESLAISSDCPHH
FT                   YNLKPSDLVKVKNSDIAIYINEQFDGFAEKLIDNHSKNIIKISDIKSLTTIKDNWHIWL
FT                   DLNNAVILLQEFAQIFSEKFPELQEDINNNLSTALKKLNKLQEIKNNELATIKDVILLS
FT                   DSSEYFFLNTNIKTAKLYSESQKSLRYISKLEDLIKESNNKCLVLSNEQNSRLYDKLNA
FT                   KIIILNSENWNVQNIGSNTFQNQYLQMIYQVKKCIH"
FT   gene            complement(158047..159273)
FT                   /locus_tag="RPR_00940"
FT   CDS_pept        complement(158047..159273)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_00940"
FT                   /product="poly(A) polymerase"
FT                   /note="COG0617 tRNA nucleotidyltransferase/poly(A)
FT                   polymerase"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_00940"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47136"
FT                   /db_xref="GOA:C4K0N5"
FT                   /db_xref="InterPro:IPR002646"
FT                   /db_xref="InterPro:IPR005728"
FT                   /db_xref="InterPro:IPR032828"
FT                   /db_xref="UniProtKB/TrEMBL:C4K0N5"
FT                   /protein_id="ACR47136.1"
FT                   /translation="MQVTHKILKIPSKGYRKILSLLSEKGQARLIGGCVRDALLDLLHN
FT                   KTNKEEFEGDMERRIAMYINVREDSSTGSTYKLPLEASYPRDRLEKGSRDIDIATNLTP
FT                   SEVTNILSGAKIKTIPTGLKFGTITATLNNEKFEITTLRKDIECNGRHAKVIFTNDFAE
FT                   DAARRDFTINALSYCPFKNEIYDYFEGFKDLQQEKVVFIGEALDRIKEDYLRILRFFRF
FT                   SSYYANQLDDGSFKACKALKDGLKTLSRERIKSEMDKIIVSKRAAQILKAMFEIGILEL
FT                   IFSIQNYEIKFFEQANDFKLELVTRYALLLYCQKDLNLKVFLDWKFSKHEAMQILSITN
FT                   FLNDAKFNMKKIWFEKKNYKEYLLAARIIGKLNHSQVKEFILKYDALLRPKFQVNGNDL
FT                   LNMNIEKKR"
FT   gene            complement(160072..160809)
FT                   /locus_tag="RPR_00950"
FT   CDS_pept        complement(160072..160809)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_00950"
FT                   /product="DNA translocation competence protein"
FT                   /note="COG0658 Predicted membrane metal-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_00950"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47137"
FT                   /db_xref="GOA:C4K0N6"
FT                   /db_xref="InterPro:IPR004477"
FT                   /db_xref="UniProtKB/TrEMBL:C4K0N6"
FT                   /protein_id="ACR47137.1"
FT                   /translation="MQDMRQNGISHVLCVSGLHLSLVVMIIFLTTRFLLNLSNYLAYNF
FT                   NIKLISAYCSLIGSFGYLELSGMQIAATRAFITAAIFIYGIIFIGRSCFPLHSLAIAAF
FT                   IILSLNPEYIFHPSFQLSFIAVLSLVAGYEFYLKNSWLLGEKKGIFGAVKFYTASNIYS
FT                   SFLASIITAPVVINQLFIFATYSVPANLIIVPITSFFLMPLALLSLPFTMIGFDNYILK
FT                   LMGFFIDIIIKSAAYFNSLPAAV"
FT   gene            complement(161183..162277)
FT                   /locus_tag="RPR_00960"
FT   CDS_pept        complement(161183..162277)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_00960"
FT                   /product="transposase ISRpe1"
FT                   /note="COG2801 Transposase and inactivated derivatives"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_00960"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47138"
FT                   /db_xref="GOA:C4K0H1"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:C4K0H1"
FT                   /protein_id="ACR47138.1"
FT                   /translation="MNLNQKIIKPKIGLLELAKSLGSISSACKAMGYSRDSYYRFKALY
FT                   ETGGEEALYEISRRKPIIANRVDPAIEKAVMDMAIEYPAYGQLRVSNELKKSGILVSPG
FT                   GVRSIWLRNDLNNISKRLKALEAKMAQDGIVLTESQLQVLEERRNEREAHGETETQHPG
FT                   YLGCQDTYYVGNFKGIGKVYSQVFIDSYTRVADAKLYTDKTALTAADMLNDRVLPWYET
FT                   QGIPILRILTDRGSEYKGNIEHHAFELFLSIEGIEHTTTKAYSPQTNGMCERFNKTMKQ
FT                   EFFDTAMRKKIYTDLDDLQLDLDIWLEHFNNERPHSGKYCYGKTPMQTFKDSKKLAVEK
FT                   NNEILYLEYVSDSQNVTDNQVQNL"
FT   gene            complement(162330..163091)
FT                   /locus_tag="RPR_00965"
FT   CDS_pept        complement(162330..163091)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_00965"
FT                   /product="hemolysin"
FT                   /note="COG1189 Predicted rRNA methylase"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_00965"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47139"
FT                   /db_xref="GOA:C4K0N8"
FT                   /db_xref="InterPro:IPR002877"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR004538"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:C4K0N8"
FT                   /protein_id="ACR47139.1"
FT                   /translation="MTKIRLDEYLLQKGFVTDITIARSLIIQGKVHNKHEQLIKPGIQV
FT                   NINDTDIKVKLPQHNYVSRGALKLIAALDYFKIDPENLVCIDIGSSTGGFTEVLLERKA
FT                   KLIFAVDVGYGELHPKLRDNPHIKVLEKTNARYLTDKQIITKPDLIVCDASFISLTTIL
FT                   PTALNLVKEDCILIALIKPQFEVEKHEVEQGGVIKNPLLHQKVCDKIKDWLEKEHNFKI
FT                   FGIIASPILGAKGNQEFLICGKRKTLIFCKS"
FT   gene            complement(163250..164485)
FT                   /locus_tag="RPR_00970"
FT   CDS_pept        complement(163250..164485)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_00970"
FT                   /product="tyrosyl-tRNA synthetase"
FT                   /EC_number="6.1.1.1"
FT                   /note="COG0162 Tyrosyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_00970"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47140"
FT                   /db_xref="GOA:C4K0N9"
FT                   /db_xref="InterPro:IPR002305"
FT                   /db_xref="InterPro:IPR002307"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR024088"
FT                   /db_xref="InterPro:IPR024107"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4K0N9"
FT                   /protein_id="ACR47140.1"
FT                   /translation="MRFIEEFINKGYFHQCTDLDRLTAITKETKIAAYIGFDCTATSLH
FT                   IGSLMQIMILRLLQQHGHKPIVIIGGGTSKIGDPTWKDEVRKILSKEDIAKNAEGIKKS
FT                   LSKFIKFGDGKSDAIMLDNAEWLDSFNYLDFLRDFGSYFSVNRMLTMDSVKLRLEREQH
FT                   LSFLEFNYMLLQAYDFYYLSKHYNCSLQLGGSDQWGNIVMGADLIRKISGKEVFGMTTP
FT                   LLTTSSGAKMGKTAAGAVWLNEDLLSPYDYYQYWRNCEDADIVRFAKLYSEFTQEELNR
FT                   FESLAAEDINAAKKQLAYELTKLCHSEQAAKSALETAVKIFEEGQIDENLPTVVLEQEV
FT                   LQAGISAYELFHEAGLATSKSEARKLIRGNGAKINDRLVADENMIINTNFLLDKKVIKL
FT                   SAGKKRHILVRV"
FT   gene            166666..166742
FT                   /locus_tag="RPR_t07778"
FT   tRNA            166666..166742
FT                   /locus_tag="RPR_t07778"
FT                   /product="tRNA-Arg"
FT   misc_feature    complement(166844..167937)
FT                   /note="authentic frameshift: common BLAST hit:
FT                   gi|157964614|ref|YP_001499438.1| transposase ISRpe1"
FT   misc_feature    168002..168098
FT                   /note="3' end of ScaI CDS"
FT   gene            168208..168282
FT                   /locus_tag="RPR_t07780"
FT   tRNA            168208..168282
FT                   /locus_tag="RPR_t07780"
FT                   /product="tRNA-Glu"
FT   misc_feature    168571..171277
FT                   /note="authentic frameshifts in homolog of R. bellii
FT                   A1I_04380"
FT   gene            complement(171283..171777)
FT                   /locus_tag="RPR_01045"
FT   CDS_pept        complement(171283..171777)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_01045"
FT                   /product="F0F1 ATP synthase subunit B"
FT                   /EC_number="3.6.3.14"
FT                   /note="COG0711 F0F1-type ATP synthase, subunit b"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_01045"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47141"
FT                   /db_xref="GOA:C4K0P0"
FT                   /db_xref="InterPro:IPR002146"
FT                   /db_xref="UniProtKB/TrEMBL:C4K0P0"
FT                   /protein_id="ACR47141.1"
FT                   /translation="MNFLDESFWLAVSFVIFLYLVYRPAKKAILNSLDAKILEVQEKVL
FT                   QAEKLKEDAALLFKHTNAQIKKLETLRSQLIEESNEVTKKIIQEKTKEIEEFLEHKKSD
FT                   AIQLMQNQKSTASKELQDEFCDEVIKLVSEYFQSVKLSESNIAKNLMDKSDFPQDEGKA
FT                   T"
FT   gene            complement(171777..172250)
FT                   /locus_tag="RPR_01050"
FT   CDS_pept        complement(171777..172250)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_01050"
FT                   /product="F0F1 ATP synthase subunit B'"
FT                   /EC_number="3.6.3.14"
FT                   /note="COG0711 F0F1-type ATP synthase, subunit b"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_01050"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47142"
FT                   /db_xref="GOA:C4K0P1"
FT                   /db_xref="InterPro:IPR003319"
FT                   /db_xref="UniProtKB/TrEMBL:C4K0P1"
FT                   /protein_id="ACR47142.1"
FT                   /translation="MPQFDIATYYSQIFWLIVTFGLLYIFVYKFITPKAEEIFNNRQTN
FT                   IQDNITQADTLTIEVEKLNKYYNEEIDKTNAEIDRLKKEKIDSLESEFLIKKKNLEQDL
FT                   KNAINQNIEDINLAAKQFRTNKSAAIIKLAVNIIEKIAGTKADMNLLQNIKVK"
FT   gene            complement(172269..172493)
FT                   /locus_tag="RPR_01055"
FT   CDS_pept        complement(172269..172493)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_01055"
FT                   /product="F0F1 ATP synthase subunit C"
FT                   /EC_number="3.6.3.14"
FT                   /note="COG0636 F0F1-type ATP synthase, subunit
FT                   c/Archaeal/vacuolar-type H+-ATPase, subunit K"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_01055"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47143"
FT                   /db_xref="GOA:C4K0P2"
FT                   /db_xref="InterPro:IPR000454"
FT                   /db_xref="InterPro:IPR002379"
FT                   /db_xref="InterPro:IPR020537"
FT                   /db_xref="InterPro:IPR035921"
FT                   /db_xref="InterPro:IPR038662"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4K0P2"
FT                   /protein_id="ACR47143.1"
FT                   /translation="MDMVSLKFIGTGLMAIGMYGAALGVSNIFSSLLSSIARNPSATEN
FT                   LQRMALIGAGLAEAMGLFSFVIAMLLIFS"
FT   gene            complement(172689..173417)
FT                   /locus_tag="RPR_01060"
FT   CDS_pept        complement(172689..173417)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_01060"
FT                   /product="F0F1 ATP synthase subunit A"
FT                   /EC_number="3.6.3.14"
FT                   /note="COG0356 F0F1-type ATP synthase, subunit a"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_01060"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47144"
FT                   /db_xref="GOA:C4K0P3"
FT                   /db_xref="InterPro:IPR000568"
FT                   /db_xref="InterPro:IPR023011"
FT                   /db_xref="InterPro:IPR035908"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4K0P3"
FT                   /protein_id="ACR47144.1"
FT                   /translation="MTHSPLAQFDIKKLIDIKMFGFDVSFTNSSIYMLLASILALTYFY
FT                   LAFYNRKLVPSRLQVSAEIVYNLVADMLNQNIGVKGRKFIPLVFSLFIFILFCNLLGMT
FT                   PYSFTATSHIIVTFTLAILVFLIVTIVGFVKHGLRFLTLFLPHGTPLWLAPLIIVIELF
FT                   TYLARPVSLSLRLAANMMAGHVLLKVIAGFTVSLMIYLKFLPIPIMVILIGFEIFVAIL
FT                   QAYIFTILSCMYLNDAINLH"
FT   gene            complement(173422..173685)
FT                   /locus_tag="RPR_01065"
FT   CDS_pept        complement(173422..173685)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_01065"
FT                   /product="hypothetical protein"
FT                   /note="COG5336 Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_01065"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47145"
FT                   /db_xref="GOA:C4K0P4"
FT                   /db_xref="InterPro:IPR032820"
FT                   /db_xref="UniProtKB/TrEMBL:C4K0P4"
FT                   /protein_id="ACR47145.1"
FT                   /translation="MNTEKLKDIKARIKDLTTPKFSNPKIRQEISPFTIAVDLVSGTMV
FT                   GVVIGIFTDKIFNSKPLFLITFTIIGMIAGFNIIRKKVNNKK"
FT   gene            complement(173796..174629)
FT                   /locus_tag="RPR_01070"
FT   CDS_pept        complement(173796..174629)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_01070"
FT                   /product="Periplasmic thiol:disulfide interchange protein
FT                   DsbA"
FT                   /note="COG1651 Protein-disulfide isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_01070"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47146"
FT                   /db_xref="GOA:C4K0P5"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:C4K0P5"
FT                   /protein_id="ACR47146.1"
FT                   /translation="MRSIFIILIFLLFLSSCSEEKAQDKNHEEKQIIEHETQNNETSKE
FT                   TNQEAVNSENTAESIVPANDNNQTDEVSTPASQKQKNPAIKPVKVTFKVDDNDMVLGNK
FT                   KSNVIVVEYFSPTCPHCAYYHQTIFPELKKKYIDTNKIAYVVREFIATKQDLDAAILAR
FT                   CKGDTNSFTQLHNIILIQQDKWAYSNKYRELLTDIGQLGGISPEEYKQCLNNDKITAIL
FT                   IANTNFVAKAPQFIGTPSFFVNGVQTGSYSIDTISTAVDKALEEQKEKAKNEKSL"
FT   gene            174793..175314
FT                   /locus_tag="RPR_01075"
FT   CDS_pept        174793..175314
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_01075"
FT                   /product="carD-like transcriptional regulator"
FT                   /note="COG1329 Transcriptional regulators, similar to M.
FT                   xanthus CarD"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_01075"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47147"
FT                   /db_xref="InterPro:IPR003711"
FT                   /db_xref="InterPro:IPR036101"
FT                   /db_xref="InterPro:IPR042215"
FT                   /db_xref="UniProtKB/TrEMBL:C4K0P6"
FT                   /protein_id="ACR47147.1"
FT                   /translation="MANTTQSEQKSEFKIGQRIVYPAHGVGEITNIEYHTIAGTEIKVY
FT                   VISFSQDKMTLKVPVSRAAVVGLRAVASRKDLDVIYSTLQGKPKQGNRMWSRRAQEYEG
FT                   KINSGNIVAIAEVLRDLHKNVDNDRSYSERTLYESALNRLAGELAILENIHPTEAINKL
FT                   VEVLREKLVA"
FT   gene            complement(175561..177165)
FT                   /locus_tag="RPR_01080"
FT   CDS_pept        complement(175561..177165)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_01080"
FT                   /product="hypothetical protein"
FT                   /note="COG0500 SAM-dependent methyltransferases"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_01080"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47148"
FT                   /db_xref="InterPro:IPR018773"
FT                   /db_xref="InterPro:IPR025714"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C4K0P7"
FT                   /protein_id="ACR47148.1"
FT                   /translation="MTKQANKISYDEVPYSPFTFSYTSPPYLRTIGKLFGLNPPPLETA
FT                   KILELGCGIGVNLLNFAETYPKSQSLGVDLSKTQIELGKKIISDLKINNAELKALSILD
FT                   LDESYGKFDYIVCHGVYSWVPEEVQDKILKVCNKLLNPNGIAFVSYNTLPGWNMQRTIR
FT                   EMIMFHSELFNTSHDKLQQAKLLLKFINDSLESSTTPYSNFLRDETKLLSAYTDSYVLH
FT                   EYLGEINTGIYFHQFIEKAQKNHLNYLGDTSLTAMFIGNLPTQAAEKLQAVNDIVRTEQ
FT                   YMDFITNRKFRSTLLCHQNIPINRKIEFNNLKEFFTSLNIRPVILEKAVDLTNEQENVS
FT                   FYYENLPEPFISTTSPIMKAILYVYAENISNPISLEQVAKEAFKKLGKYQLQDFLAALE
FT                   QHFIIFIFQGYLKIFETKPHAIATITEKPKTSEFARYQAKQAYFNNVTSVFSVTNRLND
FT                   MVGIPIHEKYILEMLDGTHNIDDIKKGVLEKINSKLLTARDDKGQEVTDPKLLKEFVDY
FT                   VVNTSLEKFRMNYLLVE"
FT   gene            complement(177598..178680)
FT                   /gene="recF"
FT                   /locus_tag="RPR_01090"
FT   CDS_pept        complement(177598..178680)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recF"
FT                   /locus_tag="RPR_01090"
FT                   /product="recombination protein F"
FT                   /note="COG1195 Recombinational DNA repair ATPase (RecFOR
FT                   pathway)"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_01090"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47149"
FT                   /db_xref="GOA:C4K0P8"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4K0P8"
FT                   /protein_id="ACR47149.1"
FT                   /translation="MKNIFLHSLSLENYRNFKNLELKTDNTPIILIGENGSGKTNILEA
FT                   ISLFYPGRGLRSAKLANVCKTSEDHCLVKALLQSKLGLAEFTTQFKRSSNRRITEYNES
FT                   KIANNELSKFTSMVWLTPHMEGIFTSGSNDRRKFLDRIVYNFDPKHAELVSKYEYYMHE
FT                   RNKILVEDIRDDNWLKIIEEKMADISNHIANNRLKTLEFMQQAIDDLENEFPKADLSID
FT                   GIVEQKILNGKENIVSFITAELYQTRSKDKLLGRTSFGVHKSDFLVKHQKKNILAKFCS
FT                   TGEQKAILIAIILAEMNYAIKLTKIAPILLLDEVFVHLDDKRRQYLIEFLTGLNMQLWV
FT                   TTTNLEGIENFATKAQLIKL"
FT   misc_feature    complement(178704..179342)
FT                   /note="authentic frameshifts in COG5424 Pyrroloquinoline
FT                   quinone (Coenzyme PQQ) biosynthesis protein C"
FT   misc_feature    complement(179344..179481)
FT                   /note="dihydrofolate reductase FolA gene fragment"
FT   gene            complement(179513..180607)
FT                   /locus_tag="RPR_01100"
FT   CDS_pept        complement(179513..180607)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_01100"
FT                   /product="transposase ISRpe1"
FT                   /note="COG2801 Transposase and inactivated derivatives"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_01100"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47150"
FT                   /db_xref="GOA:C4K0H1"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:C4K0H1"
FT                   /protein_id="ACR47150.1"
FT                   /translation="MNLNQKIIKPKIGLLELAKSLGSISSACKAMGYSRDSYYRFKALY
FT                   ETGGEEALYEISRRKPIIANRVDPAIEKAVMDMAIEYPAYGQLRVSNELKKSGILVSPG
FT                   GVRSIWLRNDLNNISKRLKALEAKMAQDGIVLTESQLQVLEERRNEREAHGETETQHPG
FT                   YLGCQDTYYVGNFKGIGKVYSQVFIDSYTRVADAKLYTDKTALTAADMLNDRVLPWYET
FT                   QGIPILRILTDRGSEYKGNIEHHAFELFLSIEGIEHTTTKAYSPQTNGMCERFNKTMKQ
FT                   EFFDTAMRKKIYTDLDDLQLDLDIWLEHFNNERPHSGKYCYGKTPMQTFKDSKKLAVEK
FT                   NNEILYLEYVSDSQNVTDNQVQNL"
FT   misc_feature    complement(180660..180803)
FT                   /note="dihydrofolate reductase FolA gene fragment"
FT   misc_feature    complement(180800..182117)
FT                   /note="authentic frameshift: common BLAST hit:
FT                   gi|67458431|ref|YP_246055.1| folate synthesis bifunctional
FT                   protein"
FT   gene            complement(182576..183247)
FT                   /locus_tag="RPR_01120"
FT   CDS_pept        complement(182576..183247)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_01120"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_01120"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47151"
FT                   /db_xref="InterPro:IPR020171"
FT                   /db_xref="UniProtKB/TrEMBL:C4K0Q0"
FT                   /protein_id="ACR47151.1"
FT                   /translation="MTNNQFSEDTKKKIADQIKDALMGISDDLVLESKEVEEIFEELSQ
FT                   NEEFEYEMERMLSILNEQTMDLTQLQSRIILLIRKYLGKTKNLKLKMLKMDEKLINKNV
FT                   AEVSNYLMHQHSKIVRDANKNLTNPKDKLQGLTKQARIDLKRLLKSFAVYQIYMFMNPK
FT                   RIAGETKLMNFAYNMIKGGMKLAKKYEGGKKQEIKSYSPRLIKKLEKAHVGFKKSGGIS
FT                   I"
FT   misc_feature    complement(183329..185545)
FT                   /note="authentic frameshifts in hypothetical rickettsial
FT                   gene similar to RF_0041"
FT   misc_feature    186175..186749
FT                   /note="authentic frameshift: Cytochrome oxidase biogenesis
FT                   protein Sco1/SenC/PrrC, putative copper metallochaperone"
FT   gene            complement(186760..187329)
FT                   /locus_tag="RPR_01165"
FT   CDS_pept        complement(186760..187329)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_01165"
FT                   /product="hypothetical protein"
FT                   /note="COG1678 Putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_01165"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47152"
FT                   /db_xref="InterPro:IPR003774"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4K0Q1"
FT                   /protein_id="ACR47152.1"
FT                   /translation="MSDKIFHNLSGKTLVATPHVITKGIYHKSLIYMLSHTEEGAIGLI
FT                   FNRLVNHIDLKSFFKIKNDEITTPVMVPIYLGGPVEHEKGFFLHSSDYNKNLLLDFHND
FT                   LAVSSNLEISEDIAFGKGPKNSLFIIGYTAWKPGQLEEELETNLWLVMDCNKEFIFADN
FT                   PESKWHNALKHLGIDEIHFSSQIGNA"
FT   gene            187395..188063
FT                   /locus_tag="RPR_01170"
FT   CDS_pept        187395..188063
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_01170"
FT                   /product="hypothetical protein"
FT                   /note="COG1286 Uncharacterized membrane protein, required
FT                   for colicin V production"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_01170"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47153"
FT                   /db_xref="GOA:C4K0Q2"
FT                   /db_xref="InterPro:IPR003825"
FT                   /db_xref="UniProtKB/TrEMBL:C4K0Q2"
FT                   /protein_id="ACR47153.1"
FT                   /translation="MITFFDITIFAIITLFSFFGLYQGIIGFATRILGFITSIMLGYFL
FT                   YPYISDLIGKYMDNEVIRIIIAGVISYVIALILCVFIVYKFLAIISFMRNGFIDRFLGL
FT                   LAGFAVGTTISLVLFFITMIFTSENYFKSKSLKDFVVSSKQSKYGGVLKVAVTTDYLDK
FT                   LSKNIIVIIPNETLKSIEIFENKDLNNFKNSLKKSNDSNDDEDVFSRELQDELSNIDDE
FT                   "
FT   misc_feature    complement(188491..188784)
FT                   /note="Gene fragment of homolog of A1G_01175"
FT   gene            188949..190010
FT                   /locus_tag="RPR_01180"
FT   CDS_pept        188949..190010
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_01180"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_01180"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47154"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C4K0Q3"
FT                   /protein_id="ACR47154.1"
FT                   /translation="MPTYKNSKHISTKKLAYIGLDLAYKTDDLNIYKLKASKVNEQLTD
FT                   SGWDILTASCENINTAKYAYKAVAFINKDTKEVHIASAGTKFNIYDLLDDLLIALHYLP
FT                   TKLTPIQDFVNEIINKLGGLSKATEYSFNTSGHSLGAIIADLTLVEIHSRNLHFNKSTT
FT                   FDSPGSKPIIERGIEKNLFTGKVTTPIKELATHSKIYNAKHNLINITNKHFGQTTMVLP
FT                   GKKTTLSQSEEWASYLYNFAKQKVTKYLGINGIVEGFEEIIAGISKHGLVNFSDLKQNI
FT                   TLTIDDWEAATPKYAKNTLNLKNNLYNQIVETETGANLVGMYNNFQSCSQEYAQEVQTT
FT                   GDISNYHLYPLIC"
FT   gene            complement(190061..190744)
FT                   /locus_tag="RPR_01185"
FT   CDS_pept        complement(190061..190744)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_01185"
FT                   /product="cell division protein ftsJ"
FT                   /note="COG0293 23S rRNA methylase"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_01185"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47155"
FT                   /db_xref="GOA:C4K0Q4"
FT                   /db_xref="InterPro:IPR002877"
FT                   /db_xref="InterPro:IPR015507"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4K0Q4"
FT                   /protein_id="ACR47155.1"
FT                   /translation="MTNNLSGYRNKFVRVKTSKKRTVSSSNWLRRQLNDPYVAKARIDG
FT                   FRSRAAYKLLEIHEKFKLFIPNMKIVDLGAAPGGWSQVASKLIKASDNNLNNKIISIDV
FT                   LEIEHVAGVEFVQKDFFEADTEELIIQALDGRADIVMSDMASNTIGHKATDHIRTLLLC
FT                   EQAFEFALKVLKPSGHFIAKIFRGGAENELLHKVKREFKTVKHFKPSSSRSESTEIYLV
FT                   ALNKK"
FT   gene            complement(190879..191349)
FT                   /gene="nusB"
FT                   /locus_tag="RPR_01190"
FT   CDS_pept        complement(190879..191349)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nusB"
FT                   /locus_tag="RPR_01190"
FT                   /product="transcription antitermination protein NusB"
FT                   /note="COG0781 Transcription termination factor"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_01190"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47156"
FT                   /db_xref="GOA:C4K0Q5"
FT                   /db_xref="InterPro:IPR006027"
FT                   /db_xref="InterPro:IPR011605"
FT                   /db_xref="InterPro:IPR035926"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4K0Q5"
FT                   /protein_id="ACR47156.1"
FT                   /translation="MSSNKINKKSIARIAAVQAIYQNILQNNDDMDDIMQNVLSFYQNN
FT                   NSITDLPENLKISLSISHFKMLVKSVFENIHKLDEIIDNHLTNDKDPAHMPILLRALLR
FT                   VSICELLFCPTTPAKVVINEYTDIANDMLNEHEIGFVNSVLDKIAKEHTRLI"
FT   gene            191631..192704
FT                   /locus_tag="RPR_01195"
FT   CDS_pept        191631..192704
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_01195"
FT                   /product="M50 family membrane endopeptidase"
FT                   /note="COG0750 Predicted membrane-associated Zn-dependent
FT                   proteases 1"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_01195"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47157"
FT                   /db_xref="GOA:C4K0Q6"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR004387"
FT                   /db_xref="InterPro:IPR008915"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="InterPro:IPR041489"
FT                   /db_xref="UniProtKB/TrEMBL:C4K0Q6"
FT                   /protein_id="ACR47157.1"
FT                   /translation="MLSIIGFIITISILVFIHEFGHYCIARYFNVKVEEFSIGFGKALI
FT                   GITDKKGVRWKICLIPLGGYVKIYGYDRSLMDKTKEVNEKVAFDAKSCLERFLIVAAGP
FT                   LINYLLAIIIFAGFYCYFGKTEIPPIIGNVVASSPAERADLRAGDKIVKVNDKSVKDFG
FT                   DVQREILINGFSSSTLTIERKSEEFIVNIMPQEIIISPPEEKQVKKTLRIGIIAKNEPI
FT                   HTKIGILGGLWEAINTTIDMSALTLNAISQMIVGKRSFDEIGGPIAIAKESGKSIAGGT
FT                   QMYLLFIAMLSVNLGLLNLLPIPVLDGGHLVFILYEAITGKLPHPKTKNILLQLGAIII
FT                   IFLIIIAVSNDIQNLFS"
FT   gene            192945..195251
FT                   /locus_tag="RPR_01200"
FT   CDS_pept        192945..195251
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_01200"
FT                   /product="outer membrane protein assembly factor"
FT                   /note="COG4775 Outer membrane protein/protective antigen
FT                   OMA87"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_01200"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47158"
FT                   /db_xref="GOA:C4K0Q7"
FT                   /db_xref="InterPro:IPR000184"
FT                   /db_xref="InterPro:IPR010827"
FT                   /db_xref="InterPro:IPR023707"
FT                   /db_xref="InterPro:IPR034746"
FT                   /db_xref="InterPro:IPR039910"
FT                   /db_xref="UniProtKB/TrEMBL:C4K0Q7"
FT                   /protein_id="ACR47158.1"
FT                   /translation="MTIRSISKLTILLLTIFYYHISLADSVIRKITIEGNHRVERSTIE
FT                   RYLKLKVGETYNNSKEDEVIKRLYATSLFRNINMHITNDGNLIVNVTETPFISSVVFSG
FT                   NSKIKTNMLAKEIYTMSGESLSQAKIELDVKKILEIYKRSGHFATTVTPKIENLENNRV
FT                   KVIFDIAEGPKTGINYIYFSGNENYSDSELKSIVLTKESRWFRFLESNDTYDPDRMEYD
FT                   KELLREFYQSVGFADFRVISASAELNNTKEYFTLTYSIEEGEKYSFGNITIDNKLTNID
FT                   ITPLNKIVNIKQGKVFNMKKVDDIAEKIGEYFTANGYPAVNVYPDIMKNANHTADIKFI
FT                   IEKADKVYINKINIINNLKTEDPVIRREFKIEESDIINRSYIEKGERNLRNLDYFEKVA
FT                   ISLAPTKAKDKYDVNVEVDEKSTSSIGFDLGYNTAGGLFGRFSFLERNLVGTGKLLNAG
FT                   VQVSKNTTSYYGGITAPHFLDHDLSLGVNIFRNYTGRGASVLNTTDQSYKLHSIGVKTS
FT                   LGYEIKEDLGHEIDYLIKRDILSAPTPSSSIFLKEQMGRFITSAIGHTITYDQTDNKIV
FT                   PKNGYLVSGTQEFAGVGGDNKYIKHEVDGKYYKSFIHNKLTLKLSASGGDIAGLGGKII
FT                   RISDRFNLGDYSLRGFASGGVGPREKITNEGLGGERYYTFSTELNFPTPIPEEFNLTGT
FT                   VFMDLGSVWGVGLNKKQYQTPNGFYNDKSLRASIGFGFIWVTRFAPIRMDWGFPVKKKK
FT                   YDDTQHFHLRFSTHL"
FT   gene            195424..195499
FT                   /locus_tag="RPR_t07782"
FT   tRNA            195424..195499
FT                   /locus_tag="RPR_t07782"
FT                   /product="tRNA-Thr"
FT   gene            195949..196539
FT                   /locus_tag="RPR_01205"
FT   CDS_pept        195949..196539
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_01205"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_01205"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47159"
FT                   /db_xref="UniProtKB/TrEMBL:C4K0Q8"
FT                   /protein_id="ACR47159.1"
FT                   /translation="MTDKLWYAKINEEDAYIRKTLQEYIDLYFFDSVEFKAVEDITLEN
FT                   LGEFLEVMLKHYQQYHFHLGELYDTGEILEEYFDYVFMDDEKYIHYPKYSKEDRPNLGW
FT                   LLIVTYIQMCNPRLFPEDVPHLIEFLHAKDGEVTKAQEKLNTYLAQFDLMKRQDEDYRC
FT                   WEAITKERQQAIAENKPLPIRPMSIELSKCLKE"
FT   gene            197595..199154
FT                   /locus_tag="RPR_01225"
FT   CDS_pept        197595..199154
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_01225"
FT                   /product="multidrug resistance protein B"
FT                   /note="COG0477 Permeases of the major facilitator
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_01225"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47160"
FT                   /db_xref="GOA:C4K0Q9"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR004638"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C4K0Q9"
FT                   /protein_id="ACR47160.1"
FT                   /translation="MSNDNLQPPALSKKQLFAFFGMVVGMFMSVLDIQIVASSLSVIAA
FT                   GLAASSDELSWVQTSYLISEVIIIPITGFLARLLTTRISYFIAALGFTVMSVLCSFATN
FT                   IESMIIFRALQGFFGGAMIPTVFSTVFILFPASQRPIVTILIGLVVTVAPTLGPTLGGY
FT                   ITEILSWHFMFLLNVIPGIFVCTVVFLYGDFDKPNYKLLKNFDFLGILLMALTLGLLQY
FT                   VLEEGNKKGWLEDNLILFLSITVVLGFILLIIRELTFINPILDLKTFLYKDFTFGCLYS
FT                   FVMGIGLYGAVYILPLFLFTIAGYDTLQIGATMMVAGGAQFLSAPLAGRMLGLGVDLRL
FT                   MLIIGLGGFALGCHLNSFLTPDSKFAAFVLPQFIRGLSLMFCFIPTNNIALGNMPKERV
FT                   GNASGLYNLTRNLGGAVGLAIISTILTNDTKTFMQYLSENISSTSIMALEQLDSYTELL
FT                   SGKVLNPEKASYLLLANKLNHDAFVIAINNIFNMIGLLFVFIMLLIPFTSNIKLTENVN
FT                   AH"
FT   gene            199138..199461
FT                   /locus_tag="RPR_01230"
FT   CDS_pept        199138..199461
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_01230"
FT                   /product="putative monovalent cation/H+ antiporter subunit
FT                   E"
FT                   /note="COG1863 Multisubunit Na+/H+ antiporter, MnhE
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_01230"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47161"
FT                   /db_xref="GOA:C4K0R0"
FT                   /db_xref="InterPro:IPR002758"
FT                   /db_xref="UniProtKB/TrEMBL:C4K0R0"
FT                   /protein_id="ACR47161.1"
FT                   /translation="MLMLTKIKFILYFPWLLLEIWKSAFAVIKIIWQRKIGIEPVFEWV
FT                   DAEGLEEIGEIIYGNSITLTPGTVTLDINNNMLLVHALNKSSITDLQRGIMIKKIKQIL
FT                   KTT"
FT   gene            199470..200198
FT                   /gene="pyrH"
FT                   /locus_tag="RPR_01235"
FT   CDS_pept        199470..200198
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrH"
FT                   /locus_tag="RPR_01235"
FT                   /product="uridylate kinase"
FT                   /EC_number="2.7.4.22"
FT                   /note="COG0528 Uridylate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_01235"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47162"
FT                   /db_xref="GOA:C4K0R1"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR011817"
FT                   /db_xref="InterPro:IPR015963"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="UniProtKB/TrEMBL:C4K0R1"
FT                   /protein_id="ACR47162.1"
FT                   /translation="MISDINALKYKKVLLKVSGEALMGDKQFGHEYDVIKKIAIDIKEV
FT                   IDLGVEVAIVVGGGNIYRGINAALVGMDRASADYIGMLATVINALTLQNVMESLNIYTR
FT                   VLSAIPMMSVCEPYIRRKAKRHMEKKRVVIFAGGTGNPFCTTDSAAVLRAIEMNCDILL
FT                   KATQVDGVYDSDPKKNPDAKKYFTISYKDVITNNLQVMDTAAIAVARENKLPIRVFSIK
FT                   EQGNFARVIQDKGEYTTIEE"
FT   gene            200486..201046
FT                   /gene="frr"
FT                   /locus_tag="RPR_01240"
FT   CDS_pept        200486..201046
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="frr"
FT                   /locus_tag="RPR_01240"
FT                   /product="ribosome recycling factor"
FT                   /note="COG0233 Ribosome recycling factor"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_01240"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47163"
FT                   /db_xref="GOA:C4K0R2"
FT                   /db_xref="InterPro:IPR002661"
FT                   /db_xref="InterPro:IPR023584"
FT                   /db_xref="InterPro:IPR036191"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4K0R2"
FT                   /protein_id="ACR47163.1"
FT                   /translation="MDKEHLKKNLQEKMEKALKVLDHELKGLRTGRASVNLLDSVTVEA
FT                   YGSKMPLSQVASLSTPDARTINVQVWDKSMVSSVEKGITIANLGLTPATDGQLIRLPIP
FT                   ALTEERRTELVKLAHKYGEDTKISLRNIRRDGNEALKKLEKDNVIAKDEHHSLSEQVQK
FT                   LTDDYSSKVDSVIKQKEQEIMTV"
FT   gene            201828..202130
FT                   /gene="gatC"
FT                   /locus_tag="RPR_01250"
FT   CDS_pept        201828..202130
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gatC"
FT                   /locus_tag="RPR_01250"
FT                   /product="aspartyl/glutamyl-tRNA amidotransferase subunit
FT                   C"
FT                   /note="COG0721 Asp-tRNAAsn/Glu-tRNAGln amidotransferase C
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_01250"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47164"
FT                   /db_xref="GOA:C4K0R3"
FT                   /db_xref="InterPro:IPR003837"
FT                   /db_xref="InterPro:IPR036113"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4K0R3"
FT                   /protein_id="ACR47164.1"
FT                   /translation="MITKEEAQKIAKLARLKFEEDTIEKFFTQLSTIMDMIDILNEIDC
FT                   KDIEPLTSVCNMNARMREDAVTSSDLSSELFDNVSGNSAQLAKEVKYFITPKVVE"
FT   gene            202133..203614
FT                   /gene="gatA"
FT                   /locus_tag="RPR_01255"
FT   CDS_pept        202133..203614
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gatA"
FT                   /locus_tag="RPR_01255"
FT                   /product="aspartyl/glutamyl-tRNA amidotransferase subunit
FT                   A"
FT                   /note="COG0154 Asp-tRNAAsn/Glu-tRNAGln amidotransferase A
FT                   subunit and related amidases"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_01255"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47165"
FT                   /db_xref="GOA:C4K0R4"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR004412"
FT                   /db_xref="InterPro:IPR020556"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4K0R4"
FT                   /protein_id="ACR47165.1"
FT                   /translation="MTELNKLTVADSIKGLKNKDFTSTELIGAHIKQIEKHRNLNAYVT
FT                   ETFDLALKQAEAADQNYAQNNARTLEGIPFAAKDLFCTKGIRTTACSNILKNFIPNYES
FT                   SVTQNIFDKGGVMLGKTNMDEFAMGSANITSCFGNVISPWKANDDNADLVPGGSSGGSA
FT                   AAVSGFMASAALGSDTGGSVRQPASFTGLVGFKPTYGRCSRYGMISFASSLDQAGIFTR
FT                   SVLDSSIMLEAMMGFDEKDSTSIKAEVPELQSAIGSSMKNMKIGVPLSLGEGSIIEPDI
FT                   MKMWQDTIELLKNAGAEIVDITLPHAKYGVAVYYVIAPAEASSNLSRYDGIRYGLRVER
FT                   ENMTLDEMYEMTRSTGFGEEVKRRIMIGTYVLSSSGMDAYYLKAQKVRRLVANDFNNAF
FT                   AKVDAILLPAAPTAAFKIGEKQNDPTIMYLNDLFTIPASLAGLPCASVPAGLSARGLPL
FT                   GIQIIGKQLDEYNVLKVASTIESGVKHIKFEPKGF"
FT   gene            203617..205068
FT                   /gene="gatB"
FT                   /locus_tag="RPR_01260"
FT   CDS_pept        203617..205068
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gatB"
FT                   /locus_tag="RPR_01260"
FT                   /product="aspartyl/glutamyl-tRNA amidotransferase subunit
FT                   B"
FT                   /note="COG0064 Asp-tRNAAsn/Glu-tRNAGln amidotransferase B
FT                   subunit (PET112 homolog)"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_01260"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47166"
FT                   /db_xref="GOA:C4K0R5"
FT                   /db_xref="InterPro:IPR003789"
FT                   /db_xref="InterPro:IPR004413"
FT                   /db_xref="InterPro:IPR006075"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR017958"
FT                   /db_xref="InterPro:IPR017959"
FT                   /db_xref="InterPro:IPR018027"
FT                   /db_xref="InterPro:IPR023168"
FT                   /db_xref="InterPro:IPR042114"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4K0R5"
FT                   /protein_id="ACR47166.1"
FT                   /translation="MAYIEGDTGKWEYVIGLEIHAQISSKSKLFSGSSTIFAANPNSQV
FT                   SYVDAAMPGMLPVLNKHCVHQAIKTGLGLKAKINKYSVFDRKNYFYADLPQGYQISQFY
FT                   YPIVQNGTMEIPTSTGDLKTIRINRLHLEQDAGKSMHDQSPHYSFIDLNRAGIGLMEIV
FT                   TEPDISSPEEAAEFVKKLRNLLRYIGSCDGDMEKGSMRCDANISVRRSGEPLGTRCEIK
FT                   NINSIRNIIKAIEFEAKRQVDLLESGEEIIQETRLFNADSGETRTMRLKEEALDYRYFP
FT                   DPDLLPLVISDELINELKANLPELPDQKIEKYTKEFSLSKYDAEVIVADESVAEYFEQA
FT                   ANECNPKMLTNWLTSELFGQLNKASIGINECKITPSNFAKLVKLIENDTISGKIAKTVF
FT                   EIMFETGKAPDKIVEEKGLVQVSDNNVLNTVIDEVIAENPESVEGYRSGKDKLFGFFVG
FT                   QVMKKTGGKANPTLVNQLLKEKLSS"
FT   gene            205325..206050
FT                   /locus_tag="RPR_01265"
FT   CDS_pept        205325..206050
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_01265"
FT                   /product="glutamine-binding protein"
FT                   /note="COG0834 ABC-type amino acid transport/signal
FT                   transduction systems, periplasmic component/domain"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_01265"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47167"
FT                   /db_xref="GOA:C4K0R6"
FT                   /db_xref="InterPro:IPR001320"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:C4K0R6"
FT                   /protein_id="ACR47167.1"
FT                   /translation="MKFLKIFLLSCLLVSCEKKETEKTLIVGTAADNPPYEFIQDGEIV
FT                   GIDIDIIKAISERLNKKVIIKNFDFNGLLAALVSENIDVAVAELSVTPERAEYISFSDN
FT                   YATARFAIIYRTGDNIQNSKDLENKIVGVQLGSVLEKKAHDLSQTINIKVHSLANHLML
FT                   VEELKARVIDAIISEEFQCKKLKENNSNLESSTLEEFSSDFAIGMSKNSGLINEINEAI
FT                   DSLKKDGTINKIMKKWLGQ"
FT   gene            206035..206514
FT                   /locus_tag="RPR_01270"
FT   CDS_pept        206035..206514
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_01270"
FT                   /product="flavoprotein oxygenase DIM6/NTAB family protein"
FT                   /note="COG1853 Conserved protein/domain typically
FT                   associated with flavoprotein oxygenases, DIM6/NTAB family"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_01270"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47168"
FT                   /db_xref="GOA:C4K0R7"
FT                   /db_xref="InterPro:IPR002563"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:C4K0R7"
FT                   /protein_id="ACR47168.1"
FT                   /translation="MAGTVTESQFKDAMSRFPQGVTIITTNCNNELFGFTASSLTSVSL
FT                   KPPLILFCLNKNSFSINSFQKSDKFAISILAENQIDISKHFAKSQSNKFTKIDYELGNK
FT                   TDCPLINGATYHIECNKYASYDAGDHVIFIGEVINTAIKNDLKPLLYFHKSYTKI"
FT   gene            206795..207514
FT                   /locus_tag="RPR_01275"
FT   CDS_pept        206795..207514
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_01275"
FT                   /product="dihydrodipicolinate reductase"
FT                   /EC_number="1.17.1.8"
FT                   /note="COG0289 Dihydrodipicolinate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_01275"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47169"
FT                   /db_xref="GOA:C4K0R8"
FT                   /db_xref="InterPro:IPR000846"
FT                   /db_xref="InterPro:IPR022663"
FT                   /db_xref="InterPro:IPR022664"
FT                   /db_xref="InterPro:IPR023940"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4K0R8"
FT                   /protein_id="ACR47169.1"
FT                   /translation="MLNIGLSGSTGKMGETILERIDKFKDCKIAAKFNSTNNLDDLDNF
FT                   CKNSDVIIDFSTPEILEKLINYALKHNTKLVIGTTGLQPQHFKLLEKAAQTLPVLYSAN
FT                   MSIGANLLSYLAKEVTKILDDYDVEILETHHRNKKDSPSGTAVMLAETIASKKGLNITF
FT                   NRGNRLRSEKEIGISSLRGGNVHSIHEISFLGDDEIITLKHEALNKNSFSIGAIKAAIW
FT                   LQDKPSALYSMQDIYKI"
FT   gene            207600..208310
FT                   /locus_tag="RPR_01280"
FT   CDS_pept        207600..208310
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_01280"
FT                   /product="stabilizing membrane protein"
FT                   /note="COG0670 Integral membrane protein, interacts with
FT                   FtsH"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_01280"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47170"
FT                   /db_xref="GOA:C4K0R9"
FT                   /db_xref="InterPro:IPR006214"
FT                   /db_xref="UniProtKB/TrEMBL:C4K0R9"
FT                   /protein_id="ACR47170.1"
FT                   /translation="MIDYTKTLTATSKNKTFDEGLRQYMLKVYNYMALALLLTGVAAVT
FT                   TIAVEPIYNLMFQTGFGTIIMFAPLGIALYFFMGFGQMNLQTAQILFWVYAGLTGMSLA
FT                   YLALIYTGASIARTFFICSSVFGAMSLYGYSTSRDLTSMGSFFAMGLIGLIIASLVNLF
FT                   LKSSALSFATSLIGIVIFMGLIAWDTQKIKSMYYMAGNDEVGQKLSIMAAFTLYLDFIN
FT                   LFLYLMRFLGNRRD"
FT   gene            208694..210808
FT                   /locus_tag="RPR_01285"
FT   CDS_pept        208694..210808
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_01285"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_01285"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47171"
FT                   /db_xref="UniProtKB/TrEMBL:C4K0S0"
FT                   /protein_id="ACR47171.1"
FT                   /translation="MSKEKTQQELLLQEQLFKALKTNDTELNAKISRTCKSIAESVIGL
FT                   SNDQSPTAESLYISYMALADLNTKDLAKVTTIIKNSFPGDKNKKLREIIDAPLLEHLVM
FT                   IEAIERQVGLDDSRYNADYRKLEEIRNPNDPKKVIDAMLRDKRVAQQDEFEEKGQKAAG
FT                   VSAGYVAKDNAGNTFILKHFYKTHAACQKIQGNHAQRQAMADRRDGVQELIGSTMYQFL
FT                   LHDRAPKEGLVTADEKHPDSLYVRSKFFDNAVTLTEFSGLSGETRVRANDQNLKKLEGF
FT                   EKAIAACHMLGEVDYHAGNLMVQDGKTITKIDHGRSFLAFHKNFSSMIQSTAEMFTHPG
FT                   VGYSAAIKAGNFSFSIDKYSESLNQMISQFDEKQMEAIVDQKIDELKKAGFDPKNIMLS
FT                   TNIQNFDDLRKHYKSSIKENLVNMQEVTKGAEIVTKFSNVSPEFKNGGWLEAFANSPVK
FT                   DPVLYAIDNNITIEGKDAKEWAYENNYQIKIAIGLKKEIIKEQQWSKDLDEKWKEKEVE
FT                   VKTDKVEVQFSDPAKSMRIQDKSTGEKLASLIVDFTKQATTKNVTDKAVAKFYDNIMKV
FT                   LKKANYLTEQDIKGIKKNLKYQDNIENTTNLLNAKSFKLNYKDTIYYKVGIFCEKRGLP
FT                   SISNYFMKQISPENLNKIHNTEKLIAESIKIGNVLQQKKQERLQTKRVETVKEIAFSQL
FT                   QARKERHQQR"
FT   gene            210966..212060
FT                   /locus_tag="RPR_01290"
FT   CDS_pept        210966..212060
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_01290"
FT                   /product="transposase ISRpe1"
FT                   /note="COG2801 Transposase and inactivated derivatives"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_01290"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47172"
FT                   /db_xref="GOA:C4K0H1"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:C4K0H1"
FT                   /protein_id="ACR47172.1"
FT                   /translation="MNLNQKIIKPKIGLLELAKSLGSISSACKAMGYSRDSYYRFKALY
FT                   ETGGEEALYEISRRKPIIANRVDPAIEKAVMDMAIEYPAYGQLRVSNELKKSGILVSPG
FT                   GVRSIWLRNDLNNISKRLKALEAKMAQDGIVLTESQLQVLEERRNEREAHGETETQHPG
FT                   YLGCQDTYYVGNFKGIGKVYSQVFIDSYTRVADAKLYTDKTALTAADMLNDRVLPWYET
FT                   QGIPILRILTDRGSEYKGNIEHHAFELFLSIEGIEHTTTKAYSPQTNGMCERFNKTMKQ
FT                   EFFDTAMRKKIYTDLDDLQLDLDIWLEHFNNERPHSGKYCYGKTPMQTFKDSKKLAVEK
FT                   NNEILYLEYVSDSQNVTDNQVQNL"
FT   misc_feature    complement(212207..213758)
FT                   /note="authentic frameshifts in homolog of RF_0206"
FT   gene            complement(214174..219141)
FT                   /locus_tag="RPR_01315"
FT   CDS_pept        complement(214174..219141)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_01315"
FT                   /product="outer membrane protein B (cell surface antigen
FT                   sca5)"
FT                   /note="COG4625 Uncharacterized protein with a C-terminal
FT                   OMP (outer membrane protein) domain"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_01315"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47173"
FT                   /db_xref="GOA:C4K0S2"
FT                   /db_xref="InterPro:IPR005546"
FT                   /db_xref="InterPro:IPR006315"
FT                   /db_xref="InterPro:IPR022095"
FT                   /db_xref="InterPro:IPR036709"
FT                   /db_xref="UniProtKB/TrEMBL:C4K0S2"
FT                   /protein_id="ACR47173.1"
FT                   /translation="MAQKPNFLKKLISAGLVTASTATIVASFAGSAMGAAIQQNRTTNG
FT                   AATTVDGAGFDQTAVLANVGVALNAVITANANNGINLNTPAGSFNGLFLNTANHLAVTV
FT                   SEDTTLGFITSAVNNAHSFNLTLNAGKTLTITGQGITNAQAAATKNAQNVVVQFNNGAA
FT                   IDNNDLKGVGRIDFGAAASTLVFNLANPTTQKAPLILGDNAVIVHGNNGTLNVTNGFIQ
FT                   VSNKSFATVKAINIGDGQGIMFNTDANNANALNLQAGGTTINFNGTDGTGRLVLLSKNA
FT                   AATNFNVTGSLGGNLKGIIEFNTVAVDGQLIANAGPANAVIGTNNGAGRAAGFIVSVDN
FT                   GKVATIDGQVYAKDMVIQSANAAGQVNFRHIVDVGTDGTTAFKTAASKVTITQNSNFGN
FT                   TDFGNLAAQIKVPNAMTLTGNFTGDASNPGNTAGVITFDANGTLESASADANVAVTNNI
FT                   TAIEASGAGVVQLSGTHAAELRLGNAGSIFKLADGTVINGKVNQTALVGGVLAAGTITL
FT                   DGSATITGDIGNAGGAAALQGITLANDATKTLTLGGANIIGANGGTIDFQANGGTIKLT
FT                   STQNNIVVDVDLAIATDQTGVVDASSLTNAQTLTINGKIGTIGANNNKTLGQFNIGSSK
FT                   TALSDGNVAINELFIGNDGAVQFAHNTYLITRTTNAAGQGKIIFNPVVNNNTTLAAGTN
FT                   LGSATNPLAEINFGSKGVNVDTVLNVGEGVNLYATNITTTDANVGSFVFNAGGTNIVSG
FT                   TVGGQQGNKFNTVALDNGTTVKFLGNATFNGNTTIAANSTLQIGGNYTADFVASADGTG
FT                   IVEFFNTGPITVTLNKQAAPVNALKQITVSGPGNVVINEIGNAGNYHGAVTDTIAFENS
FT                   SLGAVVFLPRGIPFNDAGNTIPLTIKSTVGNKTATGFDVPSVIVLGVDSVITDGQVISD
FT                   QNNIVGLGLGSDNGIIVNATTLYARIGTINNNQGTVTLSGGVPNTPGTVYGLGTGIGAS
FT                   KFKQVTFTTDYNNLGNIIATNATINDGVTVTTGGIAGTGFDGKITLGSVNGNGNVRFAD
FT                   GILSNSTSMIGTTKTNNGTVTYLGNAFVGNIGDSDTPVASVRFTGSDGGAGLQGNIYSQ
FT                   VIDFGTYNLGILNTNIILGGGTTAINGKINLVTNTLTFASGTSTWGNNTSIETTLTLAN
FT                   GNIGHIVILEGAQVNATTTGTTTIKVQDNANANFSGTQTYTLIQGGARFNGTLGGPNFA
FT                   VTGSNRFVNYGLIRAANQDYVITRTNNAENVVTNDIANSPFGGAPGVGQNVTTFVNATN
FT                   TAAYNNLLLAKNSANSANFVGAIVTDTSAAITNAQLDVAKDIQAQLGNRLGALRYLGTP
FT                   ETAEMAGPEAGAIPAAVAAGDEAVDNVAYGIWAKPFYTDAHQSKKGGLAGYKAKTTGVV
FT                   IGLDTLANDNLMIGAAIGITKTDIKHQDYKKGDKTDVNGFSFSLYGAQQLVKNFFAQGS
FT                   AIFSLNQVKNKSQRYFFYANGNMSKQIAAGHYDNMTFGGNLTVGYDYNAMQGVLVTPMA
FT                   GLRYLKSSDENYKETGTTVANKQVNSKFSDRTDLIVGAKVAGSTMNITDLAVYPEVHAF
FT                   VVHKVTGRLSKTQSVLDGQVTPCISQPDRTAKTSYNLGLSASIRSDAKMEYGIGYDAQI
FT                   SSKYTAHQGTLKVRVNF"
FT   gene            complement(219535..220140)
FT                   /locus_tag="RPR_01320"
FT   CDS_pept        complement(219535..220140)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_01320"
FT                   /product="guanosine polyphosphate
FT                   pyrophosphohydrolase/synthetase-like protein"
FT                   /note="COG0317 Guanosine polyphosphate
FT                   pyrophosphohydrolases/synthetases"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_01320"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47174"
FT                   /db_xref="GOA:C4K0S3"
FT                   /db_xref="InterPro:IPR007685"
FT                   /db_xref="UniProtKB/TrEMBL:C4K0S3"
FT                   /protein_id="ACR47174.1"
FT                   /translation="MICDIINLLKEDLNKADIENEIYMRLKESYSVLKKMKRKEVPIDA
FT                   LKDLIACRIIVKSKALCYNALDVVKSSPHLDWLYTKDYINRPKSNGYQSLHNIMQLLHS
FT                   KRNFEIQIRSENMHKDAELGRAAHLNYKEEQDRHLQKVFDVTNDTILSKARQMVKQFEG
FT                   FEEQIVEYEKEIMRIWHTKYDEMLKWANTAEVLIFNKD"
FT   gene            complement(220505..221449)
FT                   /locus_tag="RPR_01325"
FT   CDS_pept        complement(220505..221449)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_01325"
FT                   /product="putative beta-glucosidase"
FT                   /note="COG1472 Beta-glucosidase-related glycosidases"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_01325"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47175"
FT                   /db_xref="GOA:C4K0S4"
FT                   /db_xref="InterPro:IPR001764"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR036962"
FT                   /db_xref="UniProtKB/TrEMBL:C4K0S4"
FT                   /protein_id="ACR47175.1"
FT                   /translation="MTIRQMVKPVIIGISGPELTDAERELFEEHNPLGVVLFRRNIRKN
FT                   DNGAQAKEALIKLIADIKEVLGENTIISIDQEGGRVQRLIAPTFYDAPAAQTFTDPQAC
FT                   KQNYSDIAKELREVGINLDFAPVADLLHEGADKIVGDRSFGGEPEVVVPLCLAAIDGLQ
FT                   EEKVGTCIKHIPGHGRAKVDSHKKLPIVDVDIEELAKTDFKVFKELAKHDNIKLAMTAH
FT                   IIYKALDPENPATLSKKVIDYIKNNIGFKGLIISDAIDMKALSGSMADMTKEVLDAGVD
FT                   IVLECTGEFNKMSEVLCSVSESSIDKFSDLFIA"
FT   gene            complement(221998..222285)
FT                   /gene="himA"
FT                   /locus_tag="RPR_01330"
FT   CDS_pept        complement(221998..222285)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="himA"
FT                   /locus_tag="RPR_01330"
FT                   /product="integration host factor alpha-subunit"
FT                   /note="COG0776 Bacterial nucleoid DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_01330"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47176"
FT                   /db_xref="GOA:C4K0S5"
FT                   /db_xref="InterPro:IPR000119"
FT                   /db_xref="InterPro:IPR010992"
FT                   /db_xref="UniProtKB/TrEMBL:C4K0S5"
FT                   /protein_id="ACR47176.1"
FT                   /translation="MTITKAKIAAMLSSKLGFSNNLCEAIVHTVFSNILEIAKAQKLTL
FT                   KNFGSFEVKQKNPRPGINFHTKAPVIIESKKHLRFVPSSKLKALINESTR"
FT   gene            223379..223849
FT                   /locus_tag="RPR_01345"
FT   CDS_pept        223379..223849
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_01345"
FT                   /product="thioredoxin peroxidase"
FT                   /note="COG1225 Peroxiredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_01345"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47177"
FT                   /db_xref="GOA:C4K0S6"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR024706"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:C4K0S6"
FT                   /protein_id="ACR47177.1"
FT                   /translation="MTLELGKKLPDLSLHIGQDNVIKLSDLKGKFVILYFYPKDDTPGC
FT                   TIEAQDFNKLKPEFDKLNTVIIGVSKDKLDSHDKFKEKYSLGFDLASDANSNLCEQLGV
FT                   WIEKSMFGKKYMGIDRATFLLDKEGIVKHIWRSVNAKNHAQEVLEKLRTMLS"
FT   gene            complement(223969..224841)
FT                   /locus_tag="RPR_01350"
FT   CDS_pept        complement(223969..224841)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_01350"
FT                   /product="lipid A biosynthesis lauroyl acyltransferase"
FT                   /note="COG1560 Lauroyl/myristoyl acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_01350"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47178"
FT                   /db_xref="GOA:C4K0S7"
FT                   /db_xref="InterPro:IPR004960"
FT                   /db_xref="UniProtKB/TrEMBL:C4K0S7"
FT                   /protein_id="ACR47178.1"
FT                   /translation="MKKFLKKLRYLIEYFIVVIFLKVIGIFGVDKAADICSFIARKVGI
FT                   LFAVNKIARRNIKVVFGDMCDVEKIIDQTWDNFGRFIGEFTYVSKMDEAELERRIAIIG
FT                   IENIKKLEGQPFLLFSGHFANWDISIKILHKFYPKVAVIYRKANNPYVNKLVNESRAGD
FT                   KLRLIPKGSEGSRALVRAIKESESIVMLVDQKMNDGIEVPFLGHPAMTASAIAKIALQY
FT                   KYPIIPCQIIRTKGSYFKVIVHPQLKLEQTGDNKADCYNIMLNINQMLGEWVKQNPAQW
FT                   FWFHNRWKK"
FT   gene            complement(224816..225781)
FT                   /gene="lpxK"
FT                   /locus_tag="RPR_01355"
FT   CDS_pept        complement(224816..225781)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lpxK"
FT                   /locus_tag="RPR_01355"
FT                   /product="tetraacyldisaccharide 4'-kinase"
FT                   /EC_number="2.7.1.130"
FT                   /note="COG1663 Tetraacyldisaccharide-1-P 4'-kinase"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_01355"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47179"
FT                   /db_xref="GOA:C4K0S8"
FT                   /db_xref="InterPro:IPR003758"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4K0S8"
FT                   /protein_id="ACR47179.1"
FT                   /translation="MIKLLYPEFWQKRNIIAYLLLPISLIYQFLGYLRASLARPIMLPA
FT                   KVICVGNCSVGGTGKTQIVMYLAKLLKARNVSFVIVTKAYGSNLKSATTIHQGHTALEV
FT                   GDEGVILAKYGAVIATKNIKEIVPLINELKPDIIIVDDFLQNPYFHKDFTIVSVDSQRL
FT                   FGNGFLIPAGPLRQYPNKALDAADLIFLVSSHQDKIPKILTPYVNKLINAQIVPSHNID
FT                   KTKNYFAFSGIGNPERFFATLKNYGLNITGYKIFPDHYNYLQADLENLYSLAKEHNATL
FT                   VTTRKDHVKFNDLNNNIVCLDVELSINHPDLLNEKIFKKA"
FT   gene            complement(225785..226639)
FT                   /locus_tag="RPR_01360"
FT   CDS_pept        complement(225785..226639)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_01360"
FT                   /product="putative periplasmic protein"
FT                   /note="COG0739 Membrane proteins related to
FT                   metalloendopeptidases"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_01360"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47180"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="UniProtKB/TrEMBL:C4K0S9"
FT                   /protein_id="ACR47180.1"
FT                   /translation="MSFKKYIFLLFIVFLVQGCSSIKKSSDTTLVATTSSQLKQKYKIS
FT                   HADLVVQYDLTNKNSKCIYAKNLGLIINNPKQNKIFLHKLHNKNPAEFNKAAEIKIANI
FT                   KAVVTKLHSKYKFLSKPEASYFAKKQTHRNNISELTKLDKIISTIPLMMPEYEPKITSH
FT                   YGTRTSPHKKKRKKKCFHSGIDLQAKKAAPIYAAASGIVIKAARAPDYGNFVEIKHGRK
FT                   FVTKYAHLKEMSVKEGNKIKRGQFIGIQGSTGNATGEHLHFEILLDNKAINPFDFIFNY
FT                   HKC"
FT   gene            complement(226639..227361)
FT                   /locus_tag="RPR_01365"
FT   CDS_pept        complement(226639..227361)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_01365"
FT                   /product="protein involved in external DNA uptake"
FT                   /note="COG2961 Protein involved in catabolism of external
FT                   DNA"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_01365"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47181"
FT                   /db_xref="GOA:C4K0T0"
FT                   /db_xref="InterPro:IPR007473"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C4K0T0"
FT                   /protein_id="ACR47181.1"
FT                   /translation="MNYRHIYHAGNFADIVKHLVLISILEQLKKKEKPFAVLDAFTGLG
FT                   LYDLNSEAASKTLESDTGINKLLQATDPIPQLLQTFLNIINIAGKSHYPGSPFIIKQLL
FT                   RPNDTHNIDAYNAIKALLPFKENRGLIFLDPPFEVKNEFQKLLEALKKIKLRVLNKTVL
FT                   IWYPIKDLSLVRDFYHNYKNIGFKETMIIEYELLNSDKNMVKCGLMLINPPNIRGELEK
FT                   LIEYLSGTLNLKFTYIYL"
FT   gene            complement(228071..230140)
FT                   /gene="ligA"
FT                   /locus_tag="RPR_01370"
FT   CDS_pept        complement(228071..230140)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ligA"
FT                   /locus_tag="RPR_01370"
FT                   /product="NAD-dependent DNA ligase LigA"
FT                   /EC_number="6.5.1.2"
FT                   /note="COG0272 NAD-dependent DNA ligase (contains BRCT
FT                   domain type II)"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_01370"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47182"
FT                   /db_xref="GOA:C4K0T1"
FT                   /db_xref="InterPro:IPR001357"
FT                   /db_xref="InterPro:IPR001679"
FT                   /db_xref="InterPro:IPR004149"
FT                   /db_xref="InterPro:IPR004150"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013839"
FT                   /db_xref="InterPro:IPR013840"
FT                   /db_xref="InterPro:IPR018239"
FT                   /db_xref="InterPro:IPR033136"
FT                   /db_xref="InterPro:IPR036420"
FT                   /db_xref="InterPro:IPR041663"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4K0T1"
FT                   /protein_id="ACR47182.1"
FT                   /translation="MQNIDLISEEEAQKLLEELADKIAAYNHAYYIEDNPLVSDSEYDQ
FT                   LFNTNLKLEQKFPHLILENSPSKKVGAKIANKFAKVMHQVPMLSLSNAFDEQDVRDFVD
FT                   RIKIFLRLNEFAPIFCEPKIDGLSFSAVYKHGVLTTGATRGDGYVGEDITANIKTIKNF
FT                   PHKIDNVPEFLEVRGEIYIEKQDFLNLNKEQEEQGKDKFANPRNAAAGSLRQLDSSITA
FT                   KRPLKYFVYSGGVTEQNLASSQDQLLTKLKECGFNINEISKLASSEEEIFAFYEYLKTN
FT                   RENLPYEIDGVVYKLNDFALQNRMGFIARSPRFATAHKFPAIIGQTKLLSITVQVGRTG
FT                   TLTPVAELEPIEIGGVTVSRATLHNFQEIARKDLRIKDYVFLQRAGDVIPKIMGVDFDK
FT                   RPNDTETFDTPLFCLSCNSKLHYTPEDIIIRCDNGLNCPAQNYERIHHFVSKNAMDIEG
FT                   LGRKQVEFLIDKGLISNPLDIFFLKEKNDSSLAKLENMDGWGKKSVENLFKNIEKSKNV
FT                   SLPRFIYALGIRHIGEQNAKLLARAFGSYNNFIAQMELLRTNEPDIYQKLNNLEGIGDK
FT                   ILVDIIDFFDVKENIELIKKLGEILNIEDYKETREQSSLTDKIVVFTGSLPTISRAEAK
FT                   ATAEKLGAKVAVGVSSNTDLVVAGVDAGSKLKKAKELNIKIIDEEEWLTLIKNV"
FT   misc_feature    complement(230172..230367)
FT                   /note="authentic frameshift in COG2161 Antitoxin of
FT                   toxin-antitoxin stability system"
FT   gene            complement(230426..231511)
FT                   /gene="tgt"
FT                   /locus_tag="RPR_01385"
FT   CDS_pept        complement(230426..231511)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tgt"
FT                   /locus_tag="RPR_01385"
FT                   /product="queuine tRNA-ribosyltransferase"
FT                   /EC_number="2.4.2.29"
FT                   /note="COG0343 Queuine/archaeosine tRNA-ribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_01385"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47183"
FT                   /db_xref="GOA:C4K0T2"
FT                   /db_xref="InterPro:IPR002616"
FT                   /db_xref="InterPro:IPR004803"
FT                   /db_xref="InterPro:IPR036511"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4K0T2"
FT                   /protein_id="ACR47183.1"
FT                   /translation="MSKFSFNIYHQHKKARSGIIVTAHGEMRTPAFMPVGTRGTVKAML
FT                   PESVAETGADILLGNTYHLMLQPTAERIVQLGGLHKFMNWDKPILTDSGGFQVMSLSKL
FT                   CKITEEGVSFSSHINGDKYMLTPERSTEIQYLLGSTITMAFDECTPYPATFEEAKTSMQ
FT                   LTTRWANRSRNAFVKREGYAQFGIIQGSVYEELREQSSKDLVELDFEGYAVGGLAVGEG
FT                   QELMFKVLDYAPDFLPQNKPRYLMGVGKPADIIGAVSRGIDMFDCVIPTRSGRNGQAFT
FT                   KYGTVNIRNSKYADDNKPLEHDCLCPACRNYSKAYLHHLVRIGEILGSMLMTWHNLTYF
FT                   QNLMSRIRAYIKLGKDFDFDS"
FT   misc_feature    232152..232806
FT                   /note="authentic frameshifts in COG0317 Guanosine
FT                   polyphosphate pyrophosphohydrolases/synthetases"
FT   misc_feature    complement(232801..234166)
FT                   /note="authentic frameshift: common BLAST hit:
FT                   gi|67458578|ref|YP_246202.1| proline/betaine transporter"
FT   gene            234436..235023
FT                   /locus_tag="RPR_01425"
FT   CDS_pept        234436..235023
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_01425"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_01425"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47184"
FT                   /db_xref="GOA:C4K0T3"
FT                   /db_xref="UniProtKB/TrEMBL:C4K0T3"
FT                   /protein_id="ACR47184.1"
FT                   /translation="MKSKNTILLLVVIIKYIQNMLFQSLNLYSILVAGLTATFIVFMRQ
FT                   LSYYKQQIINKDLKIIPAYFDKKMLYKILNNNCDRYSALEMIKSYFKLKTARSLSYEEL
FT                   ENDKQLSELFRDSLNYFIDDFISKSDKSVTVNKVFSIQDEHNNTHKSYAFLEKNKISDK
FT                   THQMLIYVKVHYIMTKDDEESLNTFINLAKIM"
FT   gene            complement(235202..235654)
FT                   /locus_tag="RPR_01430"
FT   CDS_pept        complement(235202..235654)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_01430"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_01430"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47185"
FT                   /db_xref="GOA:C4K0T4"
FT                   /db_xref="UniProtKB/TrEMBL:C4K0T4"
FT                   /protein_id="ACR47185.1"
FT                   /translation="MLKSLIYELLKSSIKQEEKSYGKPFVYFFNILGLVLIIIANYCYC
FT                   SDSLEFYFLMQSGIISIISSMVIEAVRCYLKYKNRYRTLDCLRSKSRELVESISTSFTD
FT                   LVSTKTLIRYLPTIIRYVPSTVLTFLVCTYIKRKFLKNVTYPLLGK"
FT   gene            complement(236111..236560)
FT                   /locus_tag="RPR_01445"
FT   CDS_pept        complement(236111..236560)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_01445"
FT                   /product="toluene transport system protein"
FT                   /note="COG1463 ABC-type transport system involved in
FT                   resistance to organic solvents, periplasmic component"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_01445"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47186"
FT                   /db_xref="GOA:C4K0T5"
FT                   /db_xref="InterPro:IPR003399"
FT                   /db_xref="InterPro:IPR030970"
FT                   /db_xref="UniProtKB/TrEMBL:C4K0T5"
FT                   /protein_id="ACR47186.1"
FT                   /translation="MQQNIIETIIGFVVLIIALLFLIFAYKTGSSITSSKGYQVTAHFQ
FT                   SAEGIAVGSDVMISGIKIGSVKQITLDPNSFDASVYLNINDDVKIPKDSKAQVVTSGLL
FT                   GGKYISIVPGNDDENLAANEEIKYTQSAINIESLINKIVSSFGSK"
FT   gene            complement(236585..236884)
FT                   /locus_tag="RPR_01450"
FT   CDS_pept        complement(236585..236884)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_01450"
FT                   /product="hypothetical protein"
FT                   /note="COG3761 NADH:ubiquinone oxidoreductase 17.2 kDa
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_01450"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47187"
FT                   /db_xref="GOA:C4K0T6"
FT                   /db_xref="InterPro:IPR007763"
FT                   /db_xref="UniProtKB/TrEMBL:C4K0T6"
FT                   /protein_id="ACR47187.1"
FT                   /translation="MSWIDKYFITFFHKKVGEDEFLNQYYESRNIDYLGRPRRFVIYKN
FT                   VNEPTKILPSWHAWLHHLVNEIPKNIQLFPWQKNNKIVKKLPKTSNLKYNRWQP"
FT   gene            complement(236872..237339)
FT                   /gene="rnhA"
FT                   /locus_tag="RPR_01455"
FT   CDS_pept        complement(236872..237339)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rnhA"
FT                   /locus_tag="RPR_01455"
FT                   /product="ribonuclease H"
FT                   /EC_number="3.1.26.4"
FT                   /note="COG0328 Ribonuclease HI"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_01455"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47188"
FT                   /db_xref="GOA:C4K0T7"
FT                   /db_xref="InterPro:IPR002156"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR022892"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:C4K0T7"
FT                   /protein_id="ACR47188.1"
FT                   /translation="MHIMDSKVVIYTDGACAGNPGPGGWGALLQFNDTSKEVFGYELDT
FT                   TNNRMEITAALEALRILKKSCNVEIYTDSKYLQQGITAWIHNWIKNNWCKSNNEPVKNA
FT                   DLWQKLYAELSKHTIIWKWVKGHANNSGNIAADKLAVQGRETAIEILKCRG"
FT   gene            complement(237339..237812)
FT                   /locus_tag="RPR_01460"
FT   CDS_pept        complement(237339..237812)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_01460"
FT                   /product="hypothetical protein"
FT                   /note="COG3814 Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_01460"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47189"
FT                   /db_xref="InterPro:IPR007481"
FT                   /db_xref="InterPro:IPR036760"
FT                   /db_xref="UniProtKB/TrEMBL:C4K0T8"
FT                   /protein_id="ACR47189.1"
FT                   /translation="MNIEYKKFVHEYMLEFVKKILTKIQHENLYWDQLIYISYRTDNPA
FT                   VILPSKVKQAYPKQITIVLQYQFENLIVNDTGFSLTVSFDGVKEIIYVPFDALISFVDS
FT                   NNNYNLTFNQSLNIHENPQHEEAISNNKSYQTSSSSSPNVIMLDKFRNSSKPS"
FT   gene            238591..239403
FT                   /locus_tag="RPR_01465"
FT   CDS_pept        238591..239403
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_01465"
FT                   /product="hypothetical protein"
FT                   /note="COG3494 Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_01465"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47190"
FT                   /db_xref="InterPro:IPR010415"
FT                   /db_xref="InterPro:IPR041255"
FT                   /db_xref="UniProtKB/TrEMBL:C4K0T9"
FT                   /protein_id="ACR47190.1"
FT                   /translation="MLPNLGIIAGRGSLPYLIAGNYTKQGGNCYIAAIKDEADIEQIKD
FT                   FEYKILKIGMVGEAIKYFKEHKVKNIIFIGGVNRPNFKNLAVDKIGGLLLFKIVGQKIR
FT                   GDDSLLKIVADFFESYGFKVISSNEIYKNQQGNSNIITDTNPISSDKNDIELGIKLLNH
FT                   LSAFDIAQSVIVESGYILGIEAVEGTDNLITRCADLRKNPHGGVLVKIAKLGQDNRLDI
FT                   PTIGPNTIKNLAKYNYKGVAIQKNNVIIVEEELTIKLANEHKIFITKC"
FT   gene            239397..239972
FT                   /gene="coaE"
FT                   /locus_tag="RPR_01470"
FT   CDS_pept        239397..239972
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="coaE"
FT                   /locus_tag="RPR_01470"
FT                   /product="dephospho-CoA kinase"
FT                   /EC_number="2.7.1.24"
FT                   /note="COG0237 Dephospho-CoA kinase"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_01470"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47191"
FT                   /db_xref="GOA:C4K0U0"
FT                   /db_xref="InterPro:IPR001977"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C4K0U0"
FT                   /protein_id="ACR47191.1"
FT                   /translation="MLAIGITGSYASGKTFMLDYLAEKGYKTFCADRCIKELYQDVVLQ
FT                   TQILKLLPELESFNIRKISNLIYNNDLAREKLQNFIYPLLIDKLILFKKENANSKFGFA
FT                   EIPLLYEAKFEKYFDFVVTIYCSEEIRMQRAITRSSFDIEIYNKIKEIQLSQESKIAKA
FT                   DFAINSGVDMLDLEKQIAKLIKDLECRV"
FT   gene            239960..240649
FT                   /locus_tag="RPR_01475"
FT   CDS_pept        239960..240649
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_01475"
FT                   /product="DNA polymerase III subunit epsilon"
FT                   /note="COG0847 DNA polymerase III, epsilon subunit and
FT                   related 3'-5' exonucleases"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_01475"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47192"
FT                   /db_xref="GOA:C4K0U1"
FT                   /db_xref="InterPro:IPR006054"
FT                   /db_xref="InterPro:IPR006309"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:C4K0U1"
FT                   /protein_id="ACR47192.1"
FT                   /translation="MSSLREIILDTETTGLDPRQGHRIVEIGAIEMVNKVLTGRNFHFY
FT                   INPERDMPFEAYRIHGISGEFLKDKPLFHTIADDFLEFISDSKLIIHNAPFDIKFLNHE
FT                   LSLLKRTDIKLLELANTIDTLVMARSIFPGSKYNLDALCKRFKVDNSGRQLHGALKDAA
FT                   LLAEVYVELMGGRQSAFKMVDKSAVINNLATNQVNNKTEQTTIVIKPTKEELQKHKEFL
FT                   SRILKTA"
FT   gene            240776..241498
FT                   /locus_tag="RPR_01480"
FT   CDS_pept        240776..241498
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_01480"
FT                   /product="surfeit locus protein 1"
FT                   /note="COG3346 Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_01480"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47193"
FT                   /db_xref="GOA:C4K0U2"
FT                   /db_xref="InterPro:IPR002994"
FT                   /db_xref="UniProtKB/TrEMBL:C4K0U2"
FT                   /protein_id="ACR47193.1"
FT                   /translation="MKTNFLVFITFTILISLGFWQLSRLKEKKLFLASMQANLTSPAIN
FT                   LAEIQDGLPYHKVKITGQFLPNKDIYLYGRRSMSSAKDGYYLVTPFKTIEDKVILVARG
FT                   WFSNRNKNIITQATNDRQHEIIGVTMPSEKTRIYLPANDIKNNVWLTLNLKETSKVLGL
FT                   DLENFYIIAEGKDISNLDILLPLAINHLAAIRNDHLEYALTWFGLAISLIVIYVIYRRR
FT                   YMAVNVIPRACSGIQKNN"
FT   gene            241554..244022
FT                   /locus_tag="RPR_01485"
FT   CDS_pept        241554..244022
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_01485"
FT                   /product="ATP-dependent helicase"
FT                   /note="COG1074 ATP-dependent exoDNAse (exonuclease V) beta
FT                   subunit (contains helicase and exonuclease domains)"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_01485"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47194"
FT                   /db_xref="GOA:C4K0U3"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="UniProtKB/TrEMBL:C4K0U3"
FT                   /protein_id="ACR47194.1"
FT                   /translation="MSDLQREASDPNYSVWVSASAGTGKTKILTDRFLRLLITGVEPSN
FT                   ILCLTFTNAAAIEMQVRINSRLKYLSLCNAEKLEEALFLMSGNKPSPQDTENAKTLYDK
FT                   ILNSNKLLNIYTIHAFCQKILNTFPLEAGITPEFTILEETKLQDIFLNIRNEIYLSDEH
FT                   NDLMKILLNRFHEITLQDIFTEIIEQQIKFRKLFINKQIPKEISNKRLALGELNNIYDK
FT                   VKNLFAEYDVEIAPKEIFFTKDGKKRKSLLSKELIRKYPKLLLELEKITSEIYRLDELR
FT                   RIEELEYHTNLLTKLAHIILKKYDSYKEENNLLDYDDLIYYTEKLLNNKTTHKWLLHKL
FT                   ESEINHILVDEAQDTSPSQWNIITTLITEFNAVERPNNSVFIVGDDKQSIFSFQGADLR
FT                   NFNLVNERLKANLTNANKKFKNITLEYSYRSCTEILQFTYNVLKNIKSNYPSLFLSNNP
FT                   LISSFRTHQGSVTVWPLVTSEKQEELFWALPKDYENSKSAADLLIEKIVNFIKEQIESE
FT                   EILPSTANRISEKDFMILVRKRDEFSNNLIKELSKAKLKVEVSDRMNLKENLTIMDLIS
FT                   LAKFVLLPDDDLNLAGLLKSPIIGISEQQLYELLVNKSENSLWDILSSHEEIYNKLDSL
FT                   IEIYKISIVENFFDLVVHNLNLRELYDDDSDDMINELLTLSKNYANDIDNSLQGFVAWF
FT                   ENNDIYIKRDIEHSDKIRVMTVHGSKGLETPIVILCDSTTLPISSNKFIWDDKGEMFFS
FT                   ANAADTPEFLQELKEAEKLKDLQEYIRLLYVAMTRAKDRLIICGFSNKSTTPENCWYEI
FT                   AKQTCDKSLN"
FT   gene            complement(244528..245070)
FT                   /locus_tag="RPR_01490"
FT   CDS_pept        complement(244528..245070)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_01490"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_01490"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47195"
FT                   /db_xref="UniProtKB/TrEMBL:C4K0U4"
FT                   /protein_id="ACR47195.1"
FT                   /translation="MKLKEYFKKLESTAFGPWLAAFKKLFSKEALEEEILNIKLKESEK
FT                   QEVNKKDLVILSNNVIEIGQKDTIAHEVSRVNQYKENIGLVFTLITNIQLEKFAEFISN
FT                   LPKKHSEFKDYFRSEEQKDGFFKEDAYKKVVNKGKLVEKFQNSYKYNYEKIEQNVHELQ
FT                   AYLDSYEYNCGILNLIY"
FT   gene            245279..246223
FT                   /locus_tag="RPR_01495"
FT   CDS_pept        245279..246223
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_01495"
FT                   /product="malonyl-CoA-[acyl-carrier-protein] transacylase"
FT                   /note="COG0331 (acyl-carrier-protein) S-malonyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_01495"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47196"
FT                   /db_xref="GOA:C4K0U5"
FT                   /db_xref="InterPro:IPR001227"
FT                   /db_xref="InterPro:IPR004410"
FT                   /db_xref="InterPro:IPR014043"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR016036"
FT                   /db_xref="InterPro:IPR020801"
FT                   /db_xref="InterPro:IPR024925"
FT                   /db_xref="UniProtKB/TrEMBL:C4K0U5"
FT                   /protein_id="ACR47196.1"
FT                   /translation="MKTAFIFPGQGLQLIGMGKDFYDNFKPAKETFQIVDEVLNRKLTD
FT                   IIFNGPSEELTLTTNAQPALMAVSMAIINIIKAETGKSLDSLCDYAAGHSLGEYSALCS
FT                   TESINLETAAKLLHIRSTSMQEACPEGEGSMAACINIPLQKLEEILEEINKINLCQIAN
FT                   DNIEGQIVISGKTTAIDHAISIIKDLGYKAIKLKVSAPFHCSLMKPAEEKMRVALDKAV
FT                   INKPLIPIIQNYTAKPTLDPTEIKQNLMLQICGRVRWRETLELFHKLEIAHIVEIGAGS
FT                   VLTNMLRKINYPYKLSNISNLEELQHCLDNISQ"
FT   gene            complement(246294..247388)
FT                   /locus_tag="RPR_01500"
FT   CDS_pept        complement(246294..247388)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_01500"
FT                   /product="transposase ISRpe1"
FT                   /note="COG2801 Transposase and inactivated derivatives"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_01500"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47197"
FT                   /db_xref="GOA:C4K0U6"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:C4K0U6"
FT                   /protein_id="ACR47197.1"
FT                   /translation="MNLNQKIIKPKIGLLELAKSLGSISSACKAMGYSRDSYYRFKALY
FT                   ETGGEEALYEISRRKPIIANRVDPAIEKAVMDMAIEYPAYGQLRVSNELKKSGILVSPG
FT                   GVRSIWLRNDLNNISKRLKALEAKMAQDGIVLTESQLQVLEERRNEREAHGETETQHPG
FT                   YLGCQDTYYVGNFKGIGKVYSQVFIDSYTRVADAKLYTDKTALTAADMLNDRVLPWYET
FT                   QGIPILRILTDRGSEYKGNIEHHAFELFLSIEGIEHTTTKAYSPQTNGMCERFNKTMKQ
FT                   EFFDTAMRKKIYTDLDDLQLDLDIWLEHFNNERPHSGKYCYGKTPMQTFKDSRKLAVEK
FT                   NNEILYLEYVSDSQNVTDNQVQNL"
FT   misc_feature    247459..248603
FT                   /note="authentic frameshifts in homolog of RF_0170"
FT   gene            248666..248757
FT                   /locus_tag="RPR_t07784"
FT   tRNA            248666..248757
FT                   /locus_tag="RPR_t07784"
FT                   /product="tRNA-Ser"
FT   misc_feature    complement(252834..253838)
FT                   /note="authentic frameshift: common BLAST hit:
FT                   gi|67458557|ref|YP_246181.1| superfamily I DNA/RNA
FT                   helicase"
FT   gene            253944..255038
FT                   /locus_tag="RPR_01580"
FT   CDS_pept        253944..255038
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_01580"
FT                   /product="transposase ISRpe1"
FT                   /note="COG2801 Transposase and inactivated derivatives"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_01580"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47198"
FT                   /db_xref="GOA:C4K0U7"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:C4K0U7"
FT                   /protein_id="ACR47198.1"
FT                   /translation="MNLNQKIIKPKIGLLELAKSLGSISSACKAMGYSRDSYYRFKALY
FT                   ETGGEEALYEISRRKPIIANRVDPAIEKAVMDMAIEYPAYGQLRVSNELKKSGILVSPG
FT                   GVRSIWLRNDLNNISKRLKALEAKMAQDGIVLTESQLQVLEERRNEREAHGETETQHPG
FT                   YLGCQDTYYVGNFKGIGKVYSQVFIDSYTRVADAKLYTDKTALTAADMLNDRVLPWYET
FT                   QGIPILRILTDRGSEYKGNIEHHAFELFLSIEGIEHTTTKAYSPQTNGMCERFNKTMKQ
FT                   EFFDTAMRKKIYTDLDDLQLDLDIWLEHFNNERPHSGKYCYGKTPMQTFKDSRKLAVEK
FT                   NNEILYLEYVSDSQNLTDNQVQNL"
FT   gene            complement(255648..256700)
FT                   /locus_tag="RPR_01590"
FT   CDS_pept        complement(255648..256700)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_01590"
FT                   /product="multidrug resistance protein A"
FT                   /note="COG1566 Multidrug resistance efflux pump"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_01590"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47199"
FT                   /db_xref="GOA:C4K0U8"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="InterPro:IPR039562"
FT                   /db_xref="UniProtKB/TrEMBL:C4K0U8"
FT                   /protein_id="ACR47199.1"
FT                   /translation="MPSVLQQAIDKYKHHPFTKYVIIIALIIFIYLGYRIYVWANTQST
FT                   DNAYIDADISNVSAEVSGVLTKLFVTDNTKVNKGDLIGEIDDRDYKAKLAALEASIEAC
FT                   IKNIEIIEQKISIGQSSLEQAAEKLKLNKISFDIVATDFMRVQELNKARFASSKTLDDS
FT                   KNAYQKAKTDYKQAQLDLDISKQHLQLLDLEKAAEQEKLKELTENKKVTLRSLQNTKLI
FT                   AMVPGIFGNSSLEVGNYIVPGRALFSIVQDNTMYIQANFKETQIQKFKSGMKVKIEFDA
FT                   LPKKVIYGKIRNIAPATGSKFSLIPPDHATGNFTKSVQRVPVLIDFESPNANLVPGMSA
FT                   IVSIRTDQSM"
FT   gene            complement(256709..257473)
FT                   /locus_tag="RPR_01595"
FT   CDS_pept        complement(256709..257473)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_01595"
FT                   /product="CDP-diacylglycerol--serine
FT                   O-phosphatidyltransferase"
FT                   /note="COG1183 Phosphatidylserine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_01595"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47200"
FT                   /db_xref="GOA:C4K0U9"
FT                   /db_xref="InterPro:IPR000462"
FT                   /db_xref="InterPro:IPR004533"
FT                   /db_xref="InterPro:IPR012616"
FT                   /db_xref="UniProtKB/TrEMBL:C4K0U9"
FT                   /protein_id="ACR47200.1"
FT                   /translation="MLKIRKSIITKPVPLIKLIPNFITLLGLVTGMSSIKFALDSRWEL
FT                   AVYCIIVAAIIDGIDGRIARMLNAVSPFGAELDSLCDFANFGIAPAYLIYLWSFQQYEY
FT                   KVFSSAVMLLFIVCMALRLARFNVGIYQPKQDKTDYFFTGVPAPCGALLALMPVMIDFE
FT                   IGTLLNINTRTHTITINIYLAIIAFLLASRLPTISTKNLSIKPEYLSLAMILVAIVIIN
FT                   LIIYPWYSLPLIAVIYILSIPICYFFKHRGYW"
FT   gene            complement(257735..258430)
FT                   /locus_tag="RPR_01600"
FT   CDS_pept        complement(257735..258430)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_01600"
FT                   /product="phosphatidylserine decarboxylase"
FT                   /EC_number="4.1.1.65"
FT                   /note="COG0688 Phosphatidylserine decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_01600"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47201"
FT                   /db_xref="GOA:C4K0V0"
FT                   /db_xref="InterPro:IPR003817"
FT                   /db_xref="InterPro:IPR033175"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4K0V0"
FT                   /protein_id="ACR47201.1"
FT                   /translation="MKQYNDLFKIIHREGYIFIASFALVSFLLASFNEKLGCIGCIATA
FT                   WCIYFFRNPDRFVPISDDLVISPADGIIQEIKEALPPPELGLGDVEMIRVSIFLNIFNV
FT                   HVNRIPANGKILALHYNPGKFFNASLDKASIYNERQSVLMETAQGQKIVFVQIAGLIAR
FT                   RIVCDLEEGNEVKTGERYGIIRFGSRVDVYLPLKTALLVSKGQTAIGGETIIADFGRKK
FT                   TTEFKFDRK"
FT   gene            complement(258464..258787)
FT                   /locus_tag="RPR_01605"
FT   CDS_pept        complement(258464..258787)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_01605"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_01605"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47202"
FT                   /db_xref="InterPro:IPR021277"
FT                   /db_xref="UniProtKB/TrEMBL:C4K0V1"
FT                   /protein_id="ACR47202.1"
FT                   /translation="MAHYKEFEFDCDFSGQRAKFKFYIGTPQEGHHPLQFQAKWLSDER
FT                   GGTIPDDVMKAISQLNDLAKKNGVPLPDLCVYALGSAQEVQATPQDEDENESENQEDKA
FT                   EQA"
FT   gene            complement(258859..259605)
FT                   /locus_tag="RPR_01610"
FT   CDS_pept        complement(258859..259605)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_01610"
FT                   /product="extragenic suppressor protein suhB"
FT                   /note="COG0483 Archaeal fructose-1,6-bisphosphatase and
FT                   related enzymes of inositol monophosphatase family"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_01610"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47203"
FT                   /db_xref="GOA:C4K0V2"
FT                   /db_xref="InterPro:IPR000760"
FT                   /db_xref="UniProtKB/TrEMBL:C4K0V2"
FT                   /protein_id="ACR47203.1"
FT                   /translation="MQPITNLLINALRKAVKFLHRDFLELEMLQKNSVRNEEFCKRSYL
FT                   KLKTLLCEELQKYTQYLFFPEDKFDLNNNYESVFLINPIDSPNNFARSIPFFAISVTYL
FT                   KRNQEVLIPTSTVIYFPALNEIYYAEKGKGTWIEKNNLNSNYQGLRLRVSDNADLKNCL
FT                   AIIEGVNHNDLEEIEVDNIRSFGSLCYGATLVASGKADLICLSLLNFTLYYAFELFIKE
FT                   AGGIIIDSSDKFLYSNRYIAKKLKKY"
FT   gene            complement(259833..260399)
FT                   /locus_tag="RPR_01615"
FT   CDS_pept        complement(259833..260399)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_01615"
FT                   /product="elongation factor P"
FT                   /note="COG0231 Translation elongation factor P
FT                   (EF-P)/translation initiation factor 5A (eIF-5A)"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_01615"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47204"
FT                   /db_xref="GOA:C4K0V3"
FT                   /db_xref="InterPro:IPR001059"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR011768"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013185"
FT                   /db_xref="InterPro:IPR013852"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR015365"
FT                   /db_xref="InterPro:IPR020599"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4K0V3"
FT                   /protein_id="ACR47204.1"
FT                   /translation="MKISANSIRTGNILVYNNDLWVVSKTPEHTQPGKGGAYVQVEMKN
FT                   LKTGTKRNERFSSADYLDKAELEQKDYQFLYFEGDDLVLMDTKHFDQINISKEMLEEKL
FT                   SFLTENIIVKVEFYNDKPLNIELPPTVILEISETDPVIKGATATASYKPAILENGIKVK
FT                   VPQYLEIGEKIVVKTDDMTYVERAK"
FT   gene            260475..261827
FT                   /gene="pleD"
FT                   /locus_tag="RPR_01620"
FT   CDS_pept        260475..261827
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pleD"
FT                   /locus_tag="RPR_01620"
FT                   /product="response regulator PleD"
FT                   /note="COG3706 Response regulator containing a CheY-like
FT                   receiver domain and a GGDEF domain"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_01620"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47205"
FT                   /db_xref="GOA:C4K0V4"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:C4K0V4"
FT                   /protein_id="ACR47205.1"
FT                   /translation="MTTILVVDDIEPNIKLLTAKLLKEYYTVLTANSGKEALAILKKEK
FT                   IDIILLDVMMPEMDGCEVCKTIKTDPETTHIPVVMVTALSDIDDRVKGLEAGADEFLTK
FT                   PINDTALFVRLKSLSRMKSLIDELKLRNSTNALLGVTNIEMHDTFADKKILLINDDVVQ
FT                   AKNIKQMLLKLTQNVKVISNSDELDIINEYTPDLVIISSTLENDDPLRISVILRGKAEI
FT                   SGVVIILQIDEDGMPLVVKGIELGINDYFVYPIEESELLARIRTQLRRKQYQDNLRNDL
FT                   EQSVNLAVKDGLTGLFNRRYFDIHLKQIIEKTNKESIKLYLLMCDIDNFKHVNDTYGHQ
FT                   AGDKVLTIVSRILKNTLRVTDLIARFGGEEFTILLTDIDISKAIETAERVRIKIEYMNF
FT                   HIEDQIEPLKTTISIGVTKYKKEESIESFIERADKAMYEAKTTGKNKVVKL"
FT   gene            261852..262337
FT                   /locus_tag="RPR_01625"
FT   CDS_pept        261852..262337
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_01625"
FT                   /product="dinucleoside polyphosphate hydrolase"
FT                   /note="COG0494 NTP pyrophosphohydrolases including
FT                   oxidative damage repair enzymes"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_01625"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47206"
FT                   /db_xref="GOA:C4K0V5"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR022927"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4K0V5"
FT                   /protein_id="ACR47206.1"
FT                   /translation="MSNSSKKHLDLPYRPGVGMMILNADNHIFVGKRIDTKISAWQMPQ
FT                   GGIVPGETPSIAAMREMLEEIGSDKGYIIAESKFWYSYDVPSFLIPKLWNGNFRGQKQR
FT                   WFLIRFTGNNEDININTSNPEFDQWRWASLDELLSIIIPFKRKLYQAVVKEFESLIQ"
FT   gene            complement(263186..263515)
FT                   /locus_tag="RPR_01640"
FT   CDS_pept        complement(263186..263515)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_01640"
FT                   /product="putative pterin-4-alpha-carbinolamine dehydratase
FT                   (PHS)"
FT                   /note="COG2154 Pterin-4a-carbinolamine dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_01640"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47207"
FT                   /db_xref="GOA:C4K0V6"
FT                   /db_xref="InterPro:IPR001533"
FT                   /db_xref="InterPro:IPR036428"
FT                   /db_xref="UniProtKB/TrEMBL:C4K0V6"
FT                   /protein_id="ACR47207.1"
FT                   /translation="MTVFSEKRCIPCEGGVPPLEKKEIDKLLVQLQSEWQVNALGPLYK
FT                   KYKFSNFIKAMEFANKITEIAEQEAHHPDLTISWGACSVEIWTHKIDGLMENNFILAAK
FT                   IESKI"
FT   gene            complement(264686..264762)
FT                   /locus_tag="RPR_t07786"
FT   tRNA            complement(264686..264762)
FT                   /locus_tag="RPR_t07786"
FT                   /product="tRNA-Met"
FT   gene            complement(265002..265481)
FT                   /gene="rpsI"
FT                   /locus_tag="RPR_01655"
FT   CDS_pept        complement(265002..265481)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsI"
FT                   /locus_tag="RPR_01655"
FT                   /product="30S ribosomal protein S9"
FT                   /note="COG0103 Ribosomal protein S9"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_01655"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47208"
FT                   /db_xref="GOA:C4K0V7"
FT                   /db_xref="InterPro:IPR000754"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020574"
FT                   /db_xref="InterPro:IPR023035"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4K0V7"
FT                   /protein_id="ACR47208.1"
FT                   /translation="MPELKIKTEKVEKQLTKEPLVLKTPKEKIDNLGKFYATGKRKNAI
FT                   ARVWLKVGKGKIVVNKKTIAQYFPSETYVKTILQPFVLTKTIDQYDIICTVRGGGISGQ
FT                   KGAILHGISKALDKSAPDFHAILRKGGLLTRDSRVVERKKYGQRKARKKTQFSKR"
FT   gene            complement(265488..265955)
FT                   /gene="rplM"
FT                   /locus_tag="RPR_01660"
FT   CDS_pept        complement(265488..265955)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplM"
FT                   /locus_tag="RPR_01660"
FT                   /product="50S ribosomal protein L13"
FT                   /note="COG0102 Ribosomal protein L13"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_01660"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47209"
FT                   /db_xref="GOA:C4K0V8"
FT                   /db_xref="InterPro:IPR005822"
FT                   /db_xref="InterPro:IPR005823"
FT                   /db_xref="InterPro:IPR023563"
FT                   /db_xref="InterPro:IPR036899"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4K0V8"
FT                   /protein_id="ACR47209.1"
FT                   /translation="MKTYSAKPSEIEKKWWVIDAKNIVLGRLASRVANMLRGKHKPSFT
FT                   PHLDCGDNIIIINAEHVKLTGKKANPKDGKIYYRYTGFPGGIKDTTAGKILSGKHPERV
FT                   IKMAVKRMITRNALGAKQMSNLYVYANGDHPHMAQQPTVYDFASQNPKNKK"
FT   gene            complement(266048..267292)
FT                   /locus_tag="RPR_01665"
FT   CDS_pept        complement(266048..267292)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_01665"
FT                   /product="PQQ repeat-containing protein"
FT                   /note="COG1520 FOG: WD40-like repeat"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_01665"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47210"
FT                   /db_xref="InterPro:IPR002372"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR018391"
FT                   /db_xref="UniProtKB/TrEMBL:C4K0V9"
FT                   /protein_id="ACR47210.1"
FT                   /translation="MTKKIALLLLPFILIACNGLGPTRVKNIVELTPKLAIQTHEPIYL
FT                   DSNANIYAFNANMLKNKQYSFARSKTITEPVFIGDMIYALDIRSNISAFSIEKNKIIWS
FT                   YNLSRHKKDNYIGGGILHHNGKLYVTYGSRLLVVLDAKSGYEIIRKELPDIIRIKPIVL
FT                   NDNTVLVQTISNQTIALNAETLKTLWEHESLAEVLSASYFMTPIVQHDNVIVTYNSGQI
FT                   LALNITNGEVKWNFEFTNLNDRTAIPNFDESSILCTPVHDNMNLYIATGLGKLIKLNVA
FT                   TGSVIWQVNAEDIQSMSLIGNSLFVTNNARQIAAFNPETGKVKFVADLNDGQDPKKLKS
FT                   AAFLVPFVGVNNNNKRSLNVISVNGVLYSFDVDNNGLHMIPHVVKIIKNIRYYGLRANN
FT                   NLYFSTDRKIIFGSK"
FT   gene            complement(267315..267977)
FT                   /locus_tag="RPR_01670"
FT   CDS_pept        complement(267315..267977)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_01670"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_01670"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47211"
FT                   /db_xref="GOA:C4K0W0"
FT                   /db_xref="InterPro:IPR022588"
FT                   /db_xref="UniProtKB/TrEMBL:C4K0W0"
FT                   /protein_id="ACR47211.1"
FT                   /translation="MTDILDEVLSDQNEEKRLIFFKKLLPIIIIISIIAITIMVVINNN
FT                   KDKRIKNNQKNGDILVKTVGLETTKDNEELAFNTLENLVTTSNTKIKEIAALEQVAIKI
FT                   SKKKYSEAKDLLNKIIENKEYSEISTSYARISWCSLVIDDHNLDIQDKEKLTKYLNYFD
FT                   DEKKPFWATATIIKAMWDIKNNMKPQAETNLKNLLISNNISDLIKDQAKALLVNLNK"
FT   gene            complement(267990..268727)
FT                   /locus_tag="RPR_01675"
FT   CDS_pept        complement(267990..268727)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_01675"
FT                   /product="Tol system periplasmic component"
FT                   /note="COG1729 Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_01675"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47212"
FT                   /db_xref="GOA:C4K0W1"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR014162"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR034706"
FT                   /db_xref="UniProtKB/TrEMBL:C4K0W1"
FT                   /protein_id="ACR47212.1"
FT                   /translation="MKLIVLLFTFLFSMFSFGESETIKGKPLKYAANNDFENRLDEQEQ
FT                   EIRRLIGKVEVLQHKIDMLTQNSNISNQEENTEVLEAGDSKKQDVFDIALLKDMPDNAP
FT                   KKPIAVNKDIAPDKQAYDLALAAYKDNKLTEAKDKFKNFIQKYPNSLLISNAYFWYGEC
FT                   FFKQKDYNGAAVNYLKGYKELPKGAKSSDGLLKLALSLGELKKTQEACNMLAKFDKEFP
FT                   TNRTAASKKMAEDAKIKFGCKNK"
FT   gene            complement(268793..270286)
FT                   /locus_tag="RPR_01680"
FT   CDS_pept        complement(268793..270286)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_01680"
FT                   /product="sensory transduction protein kinase"
FT                   /note="COG0642 Signal transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_01680"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47213"
FT                   /db_xref="GOA:C4K0W2"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C4K0W2"
FT                   /protein_id="ACR47213.1"
FT                   /translation="MNHNKYIVRLSFIILFLNIVINMMFYRYFMIKEMIVKQVALEHTK
FT                   IVELYTDNIWNTHQNVISKLHKFDYLKLLQDQDFINFAKITAQWFTNLNINISLYDLKG
FT                   NKFITSNMLHMYSVDNYKDDSLVEIVTAKIDKFFLKSFTSKAPLQDAFEGITSHILLPR
FT                   VVIENESDLTVEEASFVTSYIPVINNNLDFPVDAVFEINTNITSQWQNITSLEQKVFIT
FT                   FIIIFIIFCTIIISNTNYARQIIEEQLEINRNLKAQIVKVEKTSSSNTKFFANISHELR
FT                   TPLNAIIGFSEILMSERDAEKSKNYIKDINDAGKHLLSMINDILDLSKASADKLKVDSI
FT                   DLDLNKLIRSSLILVKPRADQAEVALISRLPKEHVVIKADPKRLKQVFLNLLSNAVKFT
FT                   NSGGSVTIALEKDELAKLVYIKVIDTGIGIEEKDIPKTLSAFGQIDSELSRKYEGTGLG
FT                   LPLTKKLVELMNGKFDLQSKINEGTTITITFTYDGSIEI"
FT   gene            complement(270501..271871)
FT                   /locus_tag="RPR_01685"
FT   CDS_pept        complement(270501..271871)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_01685"
FT                   /product="tail-specific protease precursor"
FT                   /note="COG0793 Periplasmic protease"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_01685"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47214"
FT                   /db_xref="GOA:C4K0W3"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR004447"
FT                   /db_xref="InterPro:IPR005151"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:C4K0W3"
FT                   /protein_id="ACR47214.1"
FT                   /translation="MLLRLIITLFFIINSICAFAEGEKETENKISNQEAYKQFQDVFER
FT                   IEKAYVQVPDRQKMIDEAINGMLNSLDPHSSYYTDEDLEDIFTFTKGEFGGIGVEIMYD
FT                   SGAIKIISPIDDLPAFKAGLKGGDYIVGVNDELVSTLGPNKAIKEMRGTPGTKVKLLII
FT                   KEEEAKPQELELTREIVKIKPIKAHLEKNNIAYIRITTFNESTISELKAAVKKLKTESK
FT                   DDLKGIILDLRNNAGGILDQAIAVSDYFIDSGVIVTTKGRTTSSNSEIKANEFSLKVPK
FT                   VPMIVLINGNSASASEIVAGALQDHKRAIILGTKSFGKGSVQALTQINSRAAVKLTISK
FT                   YYTPSGRSIQAEGIEPDILIEPAKVEYPEVKKIDKRFSESSLKNYLKNDNEKNKDNSSK
FT                   NKDSQKETKAQNNKQEENELSELYKKDYQFARAYDVITGLIINKKLETKERVKQEDK"
FT   gene            complement(272000..273988)
FT                   /locus_tag="RPR_01690"
FT   CDS_pept        complement(272000..273988)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_01690"
FT                   /product="DNA topoisomerase IV subunit B"
FT                   /note="COG0187 Type IIA topoisomerase (DNA gyrase/topo II,
FT                   topoisomerase IV), B subunit"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_01690"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47215"
FT                   /db_xref="GOA:C4K0W4"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR005737"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C4K0W4"
FT                   /protein_id="ACR47215.1"
FT                   /translation="MSDLFSFNKEKKNKLVDNNYSAKDIEVLEGLEPVRKRPGMYIGGT
FT                   DSNAMHHLVSEVLDNAMDEAVAGFASIITIKMHHDHSITIFDNGRGIPIDNHPKFPDKS
FT                   ALEVILTTLHSGGKFSNNVYHTAGGLHGVGISVVNALSKHLEIKVYKQGKLYSQSYSKG
FT                   EKLTDLICEEASKRLRGTSINFTPDPEIFSEKLHFNPKKIYELARSKAYLYRGVTIEWV
FT                   CEVEVQSDIPKKALISFPNGLKDYLSSKITLDNLVIPEIFAGNIESTPDRIKLEWAICW
FT                   QNNDSSAFVQSYCNTVPTPQGGTHEQGLKSAILRGLKAYGEMIGNKKAANLTIEDILET
FT                   TSVVLSIFIAEPSFQGQTKEKLVSNGVSKPVENIIKDHFDHFLSSDKALATNLLEHVIS
FT                   IAEFRISKKNEKNISRKNATQKLRLPGKLADCTRTSPEGTELFIVEGDSAGGSAKQARN
FT                   RETQAVLPLWGKVLNVASSTLEKIVNNQAIQDLEIALACGSLKNYKKENLRYEKIIIMT
FT                   DADVDGAHIASLLMTFFFLRMPKLVEEGHLYLAKPPLYRLTQSNKTYYAGDEEEKAKLT
FT                   DKLLKASKAKIEVGRFKGLGEMMPAQLKETTMHPEKRSLLKVTLEDFQNVDKIVDDLMG
FT                   KKPEKRFQFIYEQALVKMDKIISELDI"
FT   gene            complement(274198..275919)
FT                   /locus_tag="RPR_01695"
FT   CDS_pept        complement(274198..275919)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_01695"
FT                   /product="hypothetical protein"
FT                   /note="COG0666 FOG: Ankyrin repeat"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_01695"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47216"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="InterPro:IPR036770"
FT                   /db_xref="UniProtKB/TrEMBL:C4K0W5"
FT                   /protein_id="ACR47216.1"
FT                   /translation="MLNKLCKILFFINLLLVIVQSYASPPPLPPSLPAAEVDTKDKDVR
FT                   SSADISFFDKFKQFFSKPKKKDIPPKQANEQTKAAHQEEPKLASQEPNDNEQAEPFIDV
FT                   GNTALPSATSDNVHTNPSHESSVNLASHDIQESNEAEASEPFIDIGSATLPSVTSNEMH
FT                   EAQVASNEHNDTNLASNIIIPNVPRPIVSMPPAQAGSYVVPPQRPVQIYKPTNLPPVHK
FT                   PIPLNPPPDANKEEESVAPIAPPSITNIPAVSPPVVSPPVTQDNTSSTMPTTVPPAVPS
FT                   NVPAPSVMPTNQPSTQPITPTSPNTPVTTPSKVIPTTDSSAELNNSQETFVAVSDVPKK
FT                   QDWNTPLIPVVVVKLNQLQPLQINNNQTTNNQEKSPPASSPNVTIQKQDNNVNNETSEL
FT                   VTKFVKDETQMLLLPDDDIVLGKLTEQATLEQMDMYAYIKLFQKKAEWIASAERRKVVE
FT                   SFIKYDNDINKKKDIYANLSYCSAVENAFRAVDRNNLFGLRALLDVYPILQEKGRSGET
FT                   LLTAAIYNDNYYLAKFLVIRGIKISTLNDECQYPLDIALAQGNANIACMLIKAKGY"
FT   gene            complement(275968..276117)
FT                   /locus_tag="RPR_01700"
FT   CDS_pept        complement(275968..276117)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_01700"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_01700"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47217"
FT                   /db_xref="UniProtKB/TrEMBL:C4K0W6"
FT                   /protein_id="ACR47217.1"
FT                   /translation="MSLLAKSGGGVWLVYVIPAEAGIQQLKGIYTVSFNIKSSIYPGFL
FT                   LSQE"
FT   gene            complement(276126..276524)
FT                   /locus_tag="RPR_01705"
FT   CDS_pept        complement(276126..276524)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_01705"
FT                   /product="hypothetical protein"
FT                   /note="COG3827 Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_01705"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47218"
FT                   /db_xref="InterPro:IPR019632"
FT                   /db_xref="UniProtKB/TrEMBL:C4K0W7"
FT                   /protein_id="ACR47218.1"
FT                   /translation="MSKDNKKNQDMSIEDILKSIKGVINERKNPIHENDSEDEDVLELT
FT                   EIVNQDEEEKLISTKSAEEVGDIFKNFTDTIKDKKLDNNISSKNALEELVVEMLKPELK
FT                   AWLDKNLPVLVKELVEIEIKKLVKNSKR"
FT   gene            complement(276526..277902)
FT                   /locus_tag="RPR_01710"
FT   CDS_pept        complement(276526..277902)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_01710"
FT                   /product="type I secretion outer membrane protein, TolC
FT                   precursor"
FT                   /note="COG1538 Outer membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_01710"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47219"
FT                   /db_xref="GOA:C4K0W8"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="UniProtKB/TrEMBL:C4K0W8"
FT                   /protein_id="ACR47219.1"
FT                   /translation="MRKLITFIVTLLLTSSVAAVDLQGALTEGYKNNEELKAARIKFLD
FT                   SIEQFPRAFSGFMPSAGLQINRQHNKTKYNKKYADRLGLTPRETDSDQGALTIQQSLFN
FT                   GGSSVAALKAAQAGFRAARGAYYAGEQKILLNLITAYLDCFESKAKYDISESRVRTNIQ
FT                   QVNTVEEKLRLGEATEVDIATARAGLAAAETNKLAAYADFQGKKANFIKVFGIEPTNIT
FT                   MPELPKMLPASLDELTGRAAKLNPDIDSARHNVTAAKALEMAEKGKLLPQVSVQLQSGR
FT                   TYYNPQGDINARNVNAINNRSYTTTLSVNIPIYPEGGAQYSRIRSAKNQTRNSAVQLDN
FT                   VIKQTQAGVVSVWEGFEAAKSRIVAANQGVDAAQISYDGTVQEEIVGSKTILDVLTAEE
FT                   KLYEAKITRVDAYKSSVLAAYQMKLLTGELTAQSLKLKVKYFSPEEEFKTIKKKMFIGF
FT                   "
FT   gene            278232..278447
FT                   /locus_tag="RPR_01715"
FT   CDS_pept        278232..278447
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_01715"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_01715"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47220"
FT                   /db_xref="UniProtKB/TrEMBL:C4K0W9"
FT                   /protein_id="ACR47220.1"
FT                   /translation="MNVKDLEDLILYFTKFFNELSHTENIDVAKIEKLFNRTIQESITT
FT                   LSEALEKAYQEQLKKQKISFYLTGLL"
FT   gene            278652..279116
FT                   /locus_tag="RPR_01725"
FT   CDS_pept        278652..279116
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_01725"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_01725"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47221"
FT                   /db_xref="UniProtKB/TrEMBL:C4K0X0"
FT                   /protein_id="ACR47221.1"
FT                   /translation="MPKITKLHNDIKEIREEAKSHEKLENIYEKAKKVATISEISKEPT
FT                   RKIIEIANKNPNNQASLENIVKATKAIPKNKDEVEEKITELKSNIESAIPQDTNIDKLN
FT                   SVKNTISGNLNEAKTELLKVLHPEASCSEKIESLCKAAEKATKVVSDIKK"
FT   gene            279313..279729
FT                   /locus_tag="RPR_01735"
FT   CDS_pept        279313..279729
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_01735"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_01735"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47222"
FT                   /db_xref="GOA:C4K0X1"
FT                   /db_xref="InterPro:IPR022589"
FT                   /db_xref="UniProtKB/TrEMBL:C4K0X1"
FT                   /protein_id="ACR47222.1"
FT                   /translation="MSNSNTHILIAIGCLLALLLIFLMYKKIAARKKNILPAEGGNIDD
FT                   SPNVALNSQKPENKKLTLQERIELSWKFLYNITEVMLNKFSKEDVIQVNKCGQVLFENG
FT                   VRYEHVVDLAIPQVKSHTQTVEQEQSKGKKALGV"
FT   misc_feature    279931..280715
FT                   /note="authentic frameshifts in hypothetical rickettsial
FT                   gene"
FT   misc_feature    complement(280764..282446)
FT                   /note="authentic frameshifts in ABC-type multidrug
FT                   transport system, ATPase and permease components"
FT   gene            complement(282774..282998)
FT                   /locus_tag="RPR_01775"
FT   CDS_pept        complement(282774..282998)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_01775"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_01775"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47223"
FT                   /db_xref="UniProtKB/TrEMBL:C4K0X2"
FT                   /protein_id="ACR47223.1"
FT                   /translation="MRTIINIADSQIKILDKLSKNKISRDKIIGQALTSYIASNDHNNK
FT                   AFENAFGLWKDKNLDSVEYQAKLCNEWNE"
FT   gene            complement(283086..284993)
FT                   /gene="thrS"
FT                   /locus_tag="RPR_01780"
FT   CDS_pept        complement(283086..284993)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thrS"
FT                   /locus_tag="RPR_01780"
FT                   /product="threonyl-tRNA synthetase"
FT                   /EC_number="6.1.1.3"
FT                   /note="COG0441 Threonyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_01780"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47224"
FT                   /db_xref="GOA:C4K0X3"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002320"
FT                   /db_xref="InterPro:IPR004095"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="InterPro:IPR012947"
FT                   /db_xref="InterPro:IPR018163"
FT                   /db_xref="InterPro:IPR033728"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4K0X3"
FT                   /protein_id="ACR47224.1"
FT                   /translation="MINISFPDGSIKQFAKNITAYEVANAISMSLAKAAMVAEINGELQ
FT                   DLSIVIDNDCKLRILTAKDPECLEIIRHDAAHLTAEAVKELFPETQVTIGPAIENGYYY
FT                   DFARDTPFTTDDLAVIEAKMQELSQKNEQVTRELWDRDKAVEFFKSIGEHYKAEIIASI
FT                   PAGEPITLYRQGNFIDLCRGPHAPSTGVVKHFKLMKVAGAYWRGDSRNEMLQRIYGTAW
FT                   ATKEQLDSYLLMLEEAEKRDHRKLGRELDLFHFQEEAQGMVFWHDKGWSIYNTIEQYIR
FT                   KKIRKNGYTEVKTPVLVDKSLWEASGHWEKFRDDMFALETDDKTLALKPMNCPCHVQIF
FT                   KQGIKSYRDLPLRMSEFGLCHRNEASGALHGLMRVRSLVQDDAHIFCAAEQITDETVSF
FT                   CKLLTEVYKDFGFTDIKVKFSDRPEIRAGSNEVWDKAENALKEAVEQAGFTYTLNPGEG
FT                   AFYGPKLEFVLTDAIGRQWQCGTLQMDFVLPERLDASYVAASGEKKRPVMLHRAILGSL
FT                   ERFIGILIEEYAGRFPLWLAPVQVAIATITSDLNDYALEVQKALIDNGVRTDFNISPDK
FT                   INYKIREFSNQKIPMIAVIGKQEQKNKQVAIRRLGTTDQEVLSVEQLIAVVKEENEKYL
FT                   "
FT   gene            complement(285109..286677)
FT                   /locus_tag="RPR_01785"
FT   CDS_pept        complement(285109..286677)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_01785"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_01785"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47225"
FT                   /db_xref="UniProtKB/TrEMBL:C4K0X4"
FT                   /protein_id="ACR47225.1"
FT                   /translation="MKIRFIIISFIALILVGWGYAAYKFEHQSKENIISILDKYEEYIT
FT                   YDAIKVNKYGFSVTLNKVMLKPIDFYFDEIVIRHIPFLNITKIDSYGNNVKITTAQDEK
FT                   NIFYSPDHHTTIWFRKSLFNREPDYWKLSLSDNKSTLYSSLDAEKLAESDISNSVITNT
FT                   KTSDNLNLLILDGKNTVSFISENYRRNLYDKIFEFLRDQIANDSDTAFFEYGLTKLDIL
FT                   NLPISYNSKLKLKYSDELVALGKLLIQNFSLDQRQDENMHAVIFMQMLGELVKGKPFLF
FT                   ACDIERKGKVESNLYKLNIEKDKIFDFALNIKSTIEPSETYQKTAAEALGSYFSNGLNK
FT                   RAELDKFFKLTSPITQEDGERVMGVFAKINNSEFNLKCEFDPEAKKLSGKTNLVMDDFN
FT                   FAINIDMPTIDNPLNLESVIKLSDPSVVINNFVHYTNNAIVPVLNKIEDSKEFALNLGQ
FT                   QSSIIKQYGFRAIEVFSKNSELKDGESLVVDVKSKDAGLTFNDKAIDQILSDARVLEFI
FT                   NAMAL"
FT   gene            complement(286897..287607)
FT                   /locus_tag="RPR_01790"
FT   CDS_pept        complement(286897..287607)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_01790"
FT                   /product="phosphoribosylaminoimidazole-succinocarboxamide
FT                   synthase"
FT                   /EC_number="6.3.2.6"
FT                   /note="COG0152
FT                   Phosphoribosylaminoimidazolesuccinocarboxamide (SAICAR)
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_01790"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47226"
FT                   /db_xref="GOA:C4K0X5"
FT                   /db_xref="InterPro:IPR028923"
FT                   /db_xref="InterPro:IPR033934"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4K0X5"
FT                   /protein_id="ACR47226.1"
FT                   /translation="MKKKLYEGSSKILYSAEEDFLLIMAFSDKAILETGEIVDISGKGV
FT                   LNNNISSFLMDKLEMIGIENHFIEKINMREQLIQYVEVFPIQVIISSVACSRFVKEFGI
FT                   DEGYVFDKPIIDFKVRSREFKYPIVNEYQILNFGWLTRDEIKAVKEQALRIYDFLSGLF
FT                   IGVGIRLVECKLEFGRVFNGEESIIMLTDEISPDNCRLWHINSNEKLGFELLEKEPNKV
FT                   FESYQLIADRLKEK"
FT   gene            complement(287761..288999)
FT                   /locus_tag="RPR_01795"
FT   CDS_pept        complement(287761..288999)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_01795"
FT                   /product="protease"
FT                   /note="COG0612 Predicted Zn-dependent peptidases; similar
FT                   to mitochondrial protease"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_01795"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47227"
FT                   /db_xref="GOA:C4K0X6"
FT                   /db_xref="InterPro:IPR001431"
FT                   /db_xref="InterPro:IPR007863"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="InterPro:IPR011765"
FT                   /db_xref="UniProtKB/TrEMBL:C4K0X6"
FT                   /protein_id="ACR47227.1"
FT                   /translation="MKENFNVSKLKNGLTILTYNMPYVNSVAINLIAKVGARYENAEED
FT                   GISHFLEHMAFKGTKTRTAKQIAEAFDSIGGHFNAYTGHENTVYYARVLSENCDKALNI
FT                   LADIIQNSIFSDEEIAKEYQVIMQEIAHHQDNPDDLVYEKFYNKVYREQPLGKSILGTA
FT                   KTLATFTKEHFFNFIDKHYNAENLYLSIAGNIDHDKIVIIAEQLFSSLKQGVKSSFIPA
FT                   KYIGGNGFINKELEQTSLVLGFEGTSYINLEKLYQTHLLSIIFGGGMSSRLFQSIREKL
FT                   GLAYAVGSYNSAYFDSGVFTIYASTAHDKLELLYREIKNEIIKMTEQVSTEEILRAKTQ
FT                   LRSNLQMAQEKNTYKSEEIGKNYSVFGQYISPEEIMEIIMSIKADDIINTANKIFSGTT
FT                   TSAIIGPNDLQGF"
FT   gene            complement(289076..289924)
FT                   /locus_tag="RPR_01800"
FT   CDS_pept        complement(289076..289924)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_01800"
FT                   /product="beta 1,4 glucosyltransferase"
FT                   /note="COG0463 Glycosyltransferases involved in cell wall
FT                   biogenesis"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_01800"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47228"
FT                   /db_xref="GOA:C4K0X7"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:C4K0X7"
FT                   /protein_id="ACR47228.1"
FT                   /translation="MNKSLTEKISAFIITKNESTRVARAINSVKNITDEVIVVDSESTD
FT                   DTVAIAEKLGAKVVIKPWLGYVGQKSFAESLCVNDWVLNIDADEELSKELQDKIEYIFA
FT                   SHNQDRYLAYQIKLLIMHRNDQKPRMFAPFNKCTRLYNKKFASFANTVNSTTHDSVIFN
FT                   KDVDFAGKIYLLNEAAYHYSGTSIEQLVTKANFYSNEQAKDLVKQGKKLSNFRLTTEMI
FT                   WWFFKAFFIRRYFVFGFDGFVDSIIFAFARFLRLTKLRESSLKSKNVIASDYKERGNCM
FT                   K"
FT   gene            complement(289917..290174)
FT                   /locus_tag="RPR_01805"
FT   CDS_pept        complement(289917..290174)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_01805"
FT                   /product="Putative toxin of toxin-antitoxin (TA) system"
FT                   /note="COG4115 Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_01805"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47229"
FT                   /db_xref="GOA:C4K0X8"
FT                   /db_xref="InterPro:IPR009614"
FT                   /db_xref="InterPro:IPR035093"
FT                   /db_xref="UniProtKB/TrEMBL:C4K0X8"
FT                   /protein_id="ACR47229.1"
FT                   /translation="MYIIRYTIQAQKDAKKIVQAGLKNKVEVLLNIVTDPWKIYPPYEK
FT                   LVGDFSGCYSRRINIQHRLVYEVYKQEKVVKILRMYTYYE"
FT   gene            complement(290185..290427)
FT                   /locus_tag="RPR_01810"
FT   CDS_pept        complement(290185..290427)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_01810"
FT                   /product="RelB"
FT                   /note="COG2161 Antitoxin of toxin-antitoxin stability
FT                   system"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_01810"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47230"
FT                   /db_xref="InterPro:IPR006442"
FT                   /db_xref="InterPro:IPR036165"
FT                   /db_xref="UniProtKB/TrEMBL:C4K0X9"
FT                   /protein_id="ACR47230.1"
FT                   /translation="MEIYNTSEARSKLYKLIDYVSDVHKPVYIKGKRNNVVIISEEDYH
FT                   NMEETLYLLSIPNMHKSIIEGRAEPIAKCSDKLNW"
FT   gene            complement(290629..291648)
FT                   /locus_tag="RPR_01815"
FT   CDS_pept        complement(290629..291648)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_01815"
FT                   /product="cytochrome d ubiquinol oxidase subunit II"
FT                   /note="COG1294 Cytochrome bd-type quinol oxidase, subunit
FT                   2"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_01815"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47231"
FT                   /db_xref="GOA:C4K0Y0"
FT                   /db_xref="InterPro:IPR003317"
FT                   /db_xref="UniProtKB/TrEMBL:C4K0Y0"
FT                   /protein_id="ACR47231.1"
FT                   /translation="MLNFAPYIDLPLVWGGLVATAICLYVLLDGFDLGVGILFPFAPTN
FT                   DCRHKMINSIAPVWDGNETWLVLGGGGLFAAFPLAYSLLMPALYIPIILMLLGLIFRGV
FT                   AFEFRFKAHIGHRYIWDYAFHFGSMITVFCQGLMLGTFVQGIEIEGREFAGGSFDFLTP
FT                   FSVMTGIALIFGYALLGATWLILKTEKTTQDWAYKSALYILFYVALFMGLVSLWVPFLN
FT                   NHINHRWFSVPNIYYLSIVPIVTALIFIKLIKAVKQKKEVKPFIYTILLFLLGYLGLAI
FT                   SIWPYIVPYKVTLETAAAAPESQSLLLIGAGIFLPVILGYTFYCYYIFRGKSSHHPIY"
FT   gene            complement(291656..293026)
FT                   /locus_tag="RPR_01820"
FT   CDS_pept        complement(291656..293026)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_01820"
FT                   /product="cyanide-insensitive cytochrome bd-type quinol
FT                   oxidase subunit I"
FT                   /note="COG1271 Cytochrome bd-type quinol oxidase, subunit
FT                   1"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_01820"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47232"
FT                   /db_xref="GOA:C4K0Y1"
FT                   /db_xref="InterPro:IPR002585"
FT                   /db_xref="UniProtKB/TrEMBL:C4K0Y1"
FT                   /protein_id="ACR47232.1"
FT                   /translation="MEFDQGLLSRIQFAFTISFHIIFPAFTIGLASFLAVIEGLWLKTK
FT                   KPVYQEIYKFWVKIFAVTFGMGVVSGVVMSYQFGTNWSNFSDKVGNVLGPLLGFEVFTA
FT                   FFLESSFLGIMLFGFNKVSKKVHFISTLIVAVGTVISAFWILAASSWMHTPAGFELRGE
FT                   GFFYPLNWLEIIFNPSFPYRFFHMITAAYLTTSFVIGGVASFYLLNNRYKEHAKIMLFM
FT                   AVLMALIVAPIQIVIGDLHGLNTLKYQPVKVSAMEGIWNTDKGAAFNLIGFPDGEEEKT
FT                   KYAVEIPYVSSLILTHSLDGEVKGLKEWTKEERPPVAVVFFSFRIMVGSGCLMVFTGIV
FT                   GLYLYLKKRLYTTHWLQYWYILMSPSGFIAVLAGWFVTEVGRQPYIVYNILKTVDTVSP
FT                   VLGKYVFISLIAFIVVYVIIFGAGIYYIMHLIKKGIEVIDNKEMYGESGLNNPLLEK"
FT   gene            complement(293181..293453)
FT                   /locus_tag="RPR_01825"
FT   CDS_pept        complement(293181..293453)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_01825"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_01825"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47233"
FT                   /db_xref="InterPro:IPR022715"
FT                   /db_xref="UniProtKB/TrEMBL:C4K0Y2"
FT                   /protein_id="ACR47233.1"
FT                   /translation="MQEKELSNNFLEEQEKSKEDDSPFFDVKYICQASLLITDSIRKGY
FT                   DVTQLPNGDINVTEVRIVNVHYNWNSEKGKFVKTNQIEFNNSKGG"
FT   gene            293634..295403
FT                   /locus_tag="RPR_01830"
FT   CDS_pept        293634..295403
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_01830"
FT                   /product="multidrug resistance ABC transporter ATP-binding
FT                   and permease protein"
FT                   /note="COG1132 ABC-type multidrug transport system, ATPase
FT                   and permease components"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_01830"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47234"
FT                   /db_xref="GOA:C4K0Y3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:C4K0Y3"
FT                   /protein_id="ACR47234.1"
FT                   /translation="MIKYPTLSKSTFSLSIYFLKFDKVKMTLLTVICILLGMIPAIDSI
FT                   LLQKIIDLIESFSDKNANNLLSSMIYWAVFYALWWESINIAYRSYDYLYLKTMPVIKGK
FT                   ILNELYNYTQYHSHKFFQDNLAGHISNRITETARSFEMIISIFGEKILRKLAIIVFALI
FT                   ALYSVHYVFATIFILWITVFLGLSVLFSDKINKYSLNYARSQSFVAGSIVDAISNINAV
FT                   RMFTAHKFERQHLETRVENAVADEQTMQFFMFKLRYALGTSCSIMIFIMIYYLSKLRSE
FT                   LSISIGDCVLVLTLCINVADDIWDLTQEIGDMFEQVGAFNQGLSLMAPHIITDIANATP
FT                   LDIKEGVIEFRNVTFNYHHNNNLFYNKSVLIPSKQKVGLVGFSGSGKTTFISLLTRLHD
FT                   IEEGMILIDNQNIKNVTQDSLRKAISLIPQEPVLFHRTILDNIRYGKKEATLEEVIEAA
FT                   KAAHIHDVIDNLPDGYDTMCGERGNNLSGGQRQRIIIARAILKNAPILILDEATSSLDS
FT                   ETESLIQESMDYLMQNKTVIVIAHRLSTLLNMDRILVFEKGSITDDGNHAELLKNSKLY
FT                   QKLWNSQVKGLIV"
FT   gene            296827..297924
FT                   /locus_tag="RPR_01855"
FT   CDS_pept        296827..297924
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_01855"
FT                   /product="S-adenosylmethionine:tRNA
FT                   ribosyltransferase-isomerase"
FT                   /note="COG0809
FT                   S-adenosylmethionine:tRNA-ribosyltransferase-isomerase
FT                   (queuine synthetase)"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_01855"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47235"
FT                   /db_xref="GOA:C4K0Y4"
FT                   /db_xref="InterPro:IPR003699"
FT                   /db_xref="InterPro:IPR036100"
FT                   /db_xref="InterPro:IPR042118"
FT                   /db_xref="InterPro:IPR042119"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4K0Y4"
FT                   /protein_id="ACR47235.1"
FT                   /translation="MKLSDFDFDLPSELIAQYPSSERDNSDLLIAVTPLIKTKFYNIID
FT                   YLKEGDLLVFNNSKVIKAKLNLGKNITINLNQKLSDDSWSAFAKPARKLHVNDEFYFDN
FT                   HKVIITEKLAMGEIKVKFELNDISVFEFLNKYGEMPLPVYIRRSHSLCHPVATTTGSKT
FT                   YLNNDWIPWSNHGMTNTQNDNDRYQTVYSQIEGSVAAPTAGLHFTKDILDKLKAEGIQA
FT                   TFLTLHVGAGTFLPVKTENIHEHKMHTEYCSITPDTAEIINKAKQEGKRIIAVGTTTLR
FT                   TLESSCNNGIVKAGSFKTDIFITPGFKFQTADMLLTNFHFPKSTLFMLICAFAGFKEMH
FT                   ELYKYAIKEAMRFFSYGDATLLCRK"
FT   misc_feature    298139..299185
FT                   /note="authentic internal stop codon: pfam03969 AFG1-like
FT                   ATPase"
FT   gene            complement(299386..300480)
FT                   /locus_tag="RPR_01870"
FT   CDS_pept        complement(299386..300480)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_01870"
FT                   /product="transposase ISRpe1"
FT                   /note="COG2801 Transposase and inactivated derivatives"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_01870"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47236"
FT                   /db_xref="GOA:C4K0Y5"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:C4K0Y5"
FT                   /protein_id="ACR47236.1"
FT                   /translation="MNLNQKIIKPKIGLLELAKSLGSISSAYKAMGYSRDSYYRFKALY
FT                   ETGGEEALYEISRRKPIIANRVDPAIEKAVMDMAIEYPAYGQLRVSNELKKSGILVSPG
FT                   GVRSIWLRNDLNNISKRLKALEAKMAQDGIVLTESQLQVLEERRNEREAHGETETQHPG
FT                   YLGCQDTYYVGNFKGIGKVYSQVFIDSYTRVADAKLYTDKTALTAADMLNDRVLPWYET
FT                   QGIPILRILTDRGSEYKGNIEHHAFELFLSIEGIEHTTTKAYSPQTNGMCERFNKTMKQ
FT                   EFFDTAMRKKIYTDLDDLQLDLDIWLEHFNNERPHSGKYCYGKTPMQTFKDSRKLAVEK
FT                   NNEILYLEYVSDSQNVTDNQVQNL"
FT   gene            complement(300540..301106)
FT                   /locus_tag="RPR_01875"
FT   CDS_pept        complement(300540..301106)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_01875"
FT                   /product="hypothetical protein"
FT                   /note="COG4421 Capsular polysaccharide biosynthesis
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_01875"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47237"
FT                   /db_xref="GOA:C4K0Y6"
FT                   /db_xref="InterPro:IPR007657"
FT                   /db_xref="UniProtKB/TrEMBL:C4K0Y6"
FT                   /protein_id="ACR47237.1"
FT                   /translation="MPRLIILKESALEYDRIYINNLKYSWQIKSLEIVLNYLNIPEDKL
FT                   FVVNSDCIIQATRLIVPSVPFIPVKGTPLPLWLKKDLRNIFIKDNSKAYDKIYISRKYA
FT                   STRKIVNEEELIEKIERSGLKVIYLALSFPYEQAQLFNKTKIIVGSHGSGFANFIFAVP
FT                   KCKVVEIDHGTTPSRSFYKRMANYM"
FT   gene            complement(301512..301626)
FT                   /locus_tag="RPR_r07840"
FT   rRNA            complement(301512..301626)
FT                   /locus_tag="RPR_r07840"
FT                   /product="5S ribosomal RNA"
FT   gene            complement(301929..304659)
FT                   /locus_tag="RPR_r07841"
FT   rRNA            complement(301929..304659)
FT                   /locus_tag="RPR_r07841"
FT                   /product="23S ribosomal RNA"
FT   gene            complement(304918..305334)
FT                   /locus_tag="RPR_01880"
FT   CDS_pept        complement(304918..305334)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_01880"
FT                   /product="hypothetical protein"
FT                   /note="COG0147 Anthranilate/para-aminobenzoate synthases
FT                   component I"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_01880"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47238"
FT                   /db_xref="UniProtKB/TrEMBL:C4K0Y7"
FT                   /protein_id="ACR47238.1"
FT                   /translation="MKKTPHGKTSQYEISSFINKAGEHINDPKQIKEISKLYAHAVFAD
FT                   LQKNILGKFDKNGNLSITKDFAIDENPVFRKDGKLLWVKTQSGLINREGEITAVNHILQ
FT                   KGRFLFEDLGGKVDTKLGTTNLNKKPTKPTLKRG"
FT   gene            complement(305551..306462)
FT                   /gene="fmt"
FT                   /locus_tag="RPR_01885"
FT   CDS_pept        complement(305551..306462)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fmt"
FT                   /locus_tag="RPR_01885"
FT                   /product="methionyl-tRNA formyltransferase"
FT                   /EC_number="2.1.2.9"
FT                   /note="COG0223 Methionyl-tRNA formyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_01885"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47239"
FT                   /db_xref="GOA:C4K0Y8"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR005793"
FT                   /db_xref="InterPro:IPR005794"
FT                   /db_xref="InterPro:IPR011034"
FT                   /db_xref="InterPro:IPR036477"
FT                   /db_xref="InterPro:IPR037022"
FT                   /db_xref="InterPro:IPR041711"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4K0Y8"
FT                   /protein_id="ACR47239.1"
FT                   /translation="MKVIFMGTPEFAVPALKKLITHHEVKAVFTQQPKAKGRGLNLAKS
FT                   PIHQLAFEHQIPVYTPSTLRNDEIINLINKVNADIIVVIAYGFIVPKAILEAKKYGCLN
FT                   IHPSDLPRHRGAAPLQRTIIEGDRKSSVCIMRMDTGLDTGDILMKEDFDLEERITLEEL
FT                   HNKCANLGAELLIKTLANIDNIVPITQPSDGVTYAHKLTKAEGKINWHESAYKIDCKIR
FT                   GMNPWPGVYFSYNDKIIKILEAEYLNADHHFTSGTVISDKLEIACGSGILRVKKLQQES
FT                   KKALNIEEFLRGTNILKDTVLK"
FT   gene            complement(306459..306986)
FT                   /gene="def"
FT                   /locus_tag="RPR_01890"
FT   CDS_pept        complement(306459..306986)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="def"
FT                   /locus_tag="RPR_01890"
FT                   /product="peptide deformylase"
FT                   /EC_number="3.5.1.88"
FT                   /note="COG0242 N-formylmethionyl-tRNA deformylase"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_01890"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47240"
FT                   /db_xref="GOA:C4K0Y9"
FT                   /db_xref="InterPro:IPR023635"
FT                   /db_xref="InterPro:IPR036821"
FT                   /db_xref="UniProtKB/TrEMBL:C4K0Y9"
FT                   /protein_id="ACR47240.1"
FT                   /translation="MSILPIVTAPDERLKQKSQPVLEFTDQTRKFMDDMLKTMYHEDGA
FT                   GLAAVQVGVLKRILVIDIQDHDSVARPKDFYPLFIVNPEIIEKAEELVTANEGCISLPE
FT                   QRIEVARPESIKIRYLDYHGKSQELKANDWLARVIQHEYDHLEGKLMIDYLSNLKRDVV
FT                   LRKLKKLKNNIV"
FT   gene            complement(307435..307620)
FT                   /locus_tag="RPR_01900"
FT   CDS_pept        complement(307435..307620)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_01900"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_01900"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47241"
FT                   /db_xref="GOA:C4K0Z0"
FT                   /db_xref="InterPro:IPR007667"
FT                   /db_xref="UniProtKB/TrEMBL:C4K0Z0"
FT                   /protein_id="ACR47241.1"
FT                   /translation="MMWLLIAIGLTVAVLIIGVVSMAIEGKFDKKFSSKLMTLRFFFQA
FT                   VAIFLLVIMYFYKVNL"
FT   misc_feature    complement(307982..309120)
FT                   /note="authentic frameshift: common BLAST hit:
FT                   gi|67458714|ref|YP_246338.1| transporter"
FT   gene            complement(309641..312358)
FT                   /locus_tag="RPR_01920"
FT   CDS_pept        complement(309641..312358)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_01920"
FT                   /product="DNA gyrase subunit A"
FT                   /note="COG0188 Type IIA topoisomerase (DNA gyrase/topo II,
FT                   topoisomerase IV), A subunit"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_01920"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47242"
FT                   /db_xref="GOA:C4K0Z1"
FT                   /db_xref="InterPro:IPR002205"
FT                   /db_xref="InterPro:IPR005743"
FT                   /db_xref="InterPro:IPR006691"
FT                   /db_xref="InterPro:IPR013757"
FT                   /db_xref="InterPro:IPR013758"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR035516"
FT                   /db_xref="UniProtKB/TrEMBL:C4K0Z1"
FT                   /protein_id="ACR47242.1"
FT                   /translation="MTDKSSSNLVPVNIEDEMKVSYLDYAMSVIVSRAIPDVRDGLKPV
FT                   HRRIIYSMHEAGNHASKPYRKSARIVGDVMGKYHPHGDSAIYDALVRMAQDFSLRLPLV
FT                   EGQGNFGSMDGDAAAAMRYTESRMAKVSYKLVEDIDKETVSFNPNYDGSEKEPSVLPAM
FT                   FPNLLVNGSGGIAVGMATNIPPHNLGEVIDACCLYIDNNDIEILDLLEVVKGPDFPTGS
FT                   MILGISGIRSAYLTGRGSIIMRGRAEIENIGNSRQAIIITEIPYMVNKARLVEKIAEMV
FT                   KEKRIEGISDLRDESNKNGVRIFIELKKDVVAEVVLNQIYACTQLQTSFGVIMLALKDG
FT                   LPKVMNLKEVIAAFVNFREVVITNRTIYLLNKARDRAHILLGLTIAVSNIDEIIRIIKA
FT                   SNDPNAAKQELMARQWEALNILPLVKLVDDKAMLNEQGKCNFTEVQAKAILEMRLQRLT
FT                   AMEKNKLEEDLKNLTTEITEYLNILGSRTRLLEILKEELIKVKEEFATPRLTSIEFGEF
FT                   DQDIEDLIQREEMVVTVTLGGYIKRVPLSSYRAQKRGGKGRSGLSMRDEDITTQVFVGS
FT                   THTPMLFFSNIGQVYSLKLYKLPLSNPQGKGRPMVNILPLKANEHITNIMPLPENQDER
FT                   DNLNIMFATAKGNIRRSDLLDFKKLQSNGKIAIRLDEDDKLIDVKPCKEDEHILLATKA
FT                   GKALRFPVESLRVIKSRTSDGVRGMKLAKEDSVISMTVLKGISSTKEDRDAYLSVPWEQ
FT                   RLEIAKGEAFNSEELGVSLTVPAIVEMANSEEFILTVTENGFGKRSSAYGYRITDRGGS
FT                   GIINMDINDKTGLVVGVMPVKMDDELMLITNSGKLIRCKLESVRITGRNTSGVILFKLD
FT                   DGEKVVSVSLIAETAESEEDSELEEEGLEQSEEV"
FT   gene            complement(312726..312896)
FT                   /locus_tag="RPR_01925"
FT   CDS_pept        complement(312726..312896)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_01925"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_01925"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47243"
FT                   /db_xref="UniProtKB/TrEMBL:C4K0Z2"
FT                   /protein_id="ACR47243.1"
FT                   /translation="MFNKNNKLLSKILPFSQKNKDLEKLRSKFKQRLAEQVTVDEITRI
FT                   EQRSLYLESIK"
FT   misc_feature    complement(313414..315237)
FT                   /note="authentic frameshift: common BLAST hit:
FT                   gi|157964270|ref|YP_001499094.1| multidrug resistance
FT                   protein Atm1"
FT   gene            complement(315330..315638)
FT                   /locus_tag="RPR_01945"
FT   CDS_pept        complement(315330..315638)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_01945"
FT                   /product="glutaredoxin 3"
FT                   /note="COG0695 Glutaredoxin and related proteins"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_01945"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47244"
FT                   /db_xref="GOA:C4K0Z3"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR011767"
FT                   /db_xref="InterPro:IPR011900"
FT                   /db_xref="InterPro:IPR014025"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:C4K0Z3"
FT                   /protein_id="ACR47244.1"
FT                   /translation="MNKAILHTIIVYTLASCPYCIKAKALLDEKNVAYEEIEVSNFTQE
FT                   EKEKFIKKSGGKKTVPQIFIDNMHVGGCDALFDLEKEGRLDKLLENQPKTTSPDAGA"
FT   gene            315709..317694
FT                   /locus_tag="RPR_01950"
FT   CDS_pept        315709..317694
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_01950"
FT                   /product="excinuclease ABC subunit B"
FT                   /note="COG0556 Helicase subunit of the DNA excision repair
FT                   complex"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_01950"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47245"
FT                   /db_xref="GOA:C4K0Z4"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR004807"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR024759"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036876"
FT                   /db_xref="InterPro:IPR041471"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4K0Z4"
FT                   /protein_id="ACR47245.1"
FT                   /translation="MNNFSIISEYKPAGDQPKAIDEIIAGLSSKKRSQMLLGITGSGKT
FT                   FTMANIIERTNRPTLIMAHNKTLAAQIYSEMKSLFPKNAVEYFVSYYDYYQPEAYIART
FT                   DTFIEKDSSINEQIDLMRHAATRSLLERRDVIVVSSVSCIYGLGSPDLYYQMMVNLEPG
FT                   QSYLRDQLLNDLINLQYERNDIGFERGCFRVKGDNIDIFPSHYSDKAWRLSFFGNELEY
FT                   IHEFDPLTGEKLAKLDKAMVFGNSHFVMPQETVNNAISGIEEELQKRLEFLKSQDKPLE
FT                   TQRLNQRTQYDLEMLTETGSCKGVENYSRFFTGRHAGEPPPTLFEYLPEDALLFVDESH
FT                   VSVPQIRAMYNGDRARKKVLVEHGFRLPSALDNRPLKFEEWDKFRPQTVFVSATPGPFE
FT                   LEETGGTVVELIIRPTGLLDPECIIKPATNQVEDLISEIQTTIAQGFRVLVTTLTKKMA
FT                   EDLTAYLQELKYKTSYLHSNVHTLERIEILRDLRQGTIDVLVGINLLREGLDIPECGLV
FT                   AILDADKEGFLRSEVSLIQTIGRAARNSAGRVILYADKMTKSIDKAVSETLRRRQIQQE
FT                   YNEKHGIIPKTINRAIHALAEFEKIDSKLDKKQAHTLFDNPAKLKTHIDKLKKEMLKAA
FT                   SNLEFEQAVKLRDQLKTLEAAALELS"
FT   gene            complement(317848..318414)
FT                   /gene="rnhB"
FT                   /locus_tag="RPR_01955"
FT   CDS_pept        complement(317848..318414)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rnhB"
FT                   /locus_tag="RPR_01955"
FT                   /product="ribonuclease HII"
FT                   /EC_number="3.1.26.4"
FT                   /note="COG0164 Ribonuclease HII"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_01955"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47246"
FT                   /db_xref="GOA:C4K0Z5"
FT                   /db_xref="InterPro:IPR001352"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR022898"
FT                   /db_xref="InterPro:IPR024567"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:C4K0Z5"
FT                   /protein_id="ACR47246.1"
FT                   /translation="MKFEKKYHNCIVAGIDEAGRGPLAGPVVASTVIVDNANIITGIKD
FT                   SKKLSKKKRELLYEQITSNYVWATAIISHTEIDDINILEATKKACSIAVANLSLEPEIV
FT                   LVDGNMQFKDERFVSIINGDNLSLSIAAASIVAKVTRDRLMLDLSAEFPQYLWHKNSGY
FT                   GIKEHIEAINIHGLSPYHRRSFRCC"
FT   gene            318498..318998
FT                   /gene="hscB"
FT                   /locus_tag="RPR_01960"
FT   CDS_pept        318498..318998
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hscB"
FT                   /locus_tag="RPR_01960"
FT                   /product="co-chaperone HscB"
FT                   /note="COG1076 DnaJ-domain-containing proteins 1"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_01960"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47247"
FT                   /db_xref="GOA:C4K0Z6"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR004640"
FT                   /db_xref="InterPro:IPR009073"
FT                   /db_xref="InterPro:IPR036386"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4K0Z6"
FT                   /protein_id="ACR47247.1"
FT                   /translation="MQNYFQLLGLPQKYNINLKILEKQYFAMQVKYHPDKAKTLQEKEQ
FT                   NLITAAELNNAYSTLKDALKRAEYMLLLQNINLNDEKTRSLLSPLELSIFWDEMEIIEN
FT                   TILFSDLEKIKDKYELMKKLEIDSLKQAFEEQNLSDATIKTSKLKYIGTLLHKLQEKIK
FT                   SCK"
FT   gene            318989..320776
FT                   /gene="hscA"
FT                   /locus_tag="RPR_01965"
FT   CDS_pept        318989..320776
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hscA"
FT                   /locus_tag="RPR_01965"
FT                   /product="chaperone protein HscA"
FT                   /note="COG0443 Molecular chaperone"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_01965"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47248"
FT                   /db_xref="GOA:C4K0Z7"
FT                   /db_xref="InterPro:IPR010236"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="InterPro:IPR029047"
FT                   /db_xref="InterPro:IPR029048"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4K0Z7"
FT                   /protein_id="ACR47248.1"
FT                   /translation="MQIIEIREPEQADFKQEQQIAVGIDFGTTNSLIAIAANRKVKVIK
FT                   SIDDKELIPTTIDFTSNNFTIGNNKGLRSIKRLFGKTLKEILNTPALFSLVKDYLDVNS
FT                   SELKLNFANKQLRVPEIAAEIFIYLKNQAEEQLKTNLTKAVITVPAHFNDAARGEVMLA
FT                   AKIAGFEVLRLIAEPTAAAYAYGLNNNQKGCYLVYDLGGGTFDVSILNIQEGIFQVIAT
FT                   NGDNMLGGNDIDVVITQYLCNKFDLPNSIDTLQLAKKAKETLTYKDSFNNDNVSINKQT
FT                   LEQLILPLVERTINIAQECLEQAGNPNIDGVILVGGATRTPLIKDELYKAFKIDILSDI
FT                   DPDKAVVWGAALQAENLIAPHTNSLLIDVAPLSLGMELYGGIVEKIIMHNTPIPISVVK
FT                   EFTTYVDNQTGIQFHILQGEREMAADCRSLARFELKGLPPMKAGYIRAEVTFSIDADGI
FT                   LSVSAYEKISNTSHAIEVKPNHGIDKTEIDIMLENAYKNAKIDYTTRLLQEAVIEAEAL
FT                   IFSIERAIAELTTLLSESEISIINSLLDNIKEAVHARDWILINNSIKEFKSKIKKSMDT
FT                   KFNIIINDLLKGKNINQIK"
FT   gene            320840..321178
FT                   /locus_tag="RPR_01970"
FT   CDS_pept        320840..321178
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_01970"
FT                   /product="ferredoxin"
FT                   /note="COG0633 Ferredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_01970"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47249"
FT                   /db_xref="GOA:C4K0Z8"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR001055"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR018298"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:C4K0Z8"
FT                   /protein_id="ACR47249.1"
FT                   /translation="MSGKIKVTFIINDGEEKTVEAPIGLSILEIAHSNDLDLEGACEGS
FT                   LACATCHVILEEEFYNKLKKPTEAEEDMLDLAFGLTNTSRLGCQIILTEELDGIKVRLP
FT                   AATRNIKL"
FT   gene            321191..322261
FT                   /locus_tag="RPR_01975"
FT   CDS_pept        321191..322261
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_01975"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_01975"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47250"
FT                   /db_xref="UniProtKB/TrEMBL:C4K0Z9"
FT                   /protein_id="ACR47250.1"
FT                   /translation="MIRKILLFVFLAFTIIWFATAYTIKNNVVSLMKNSESDNLKISYN
FT                   VVKFSGYPFNWKITVTDPKVKLIDHVNSKEFTCENIVLNIAFSTKRAALNFGPFIREVD
FT                   NYGDKTFTYDVRSDDDIKGIGKFNKPLYKISKDDNLKEILKSIQLNNKALLIFKDNQEI
FT                   FKINDLAFLIRKQNLASEENISLFLNMNYYSEKDILNFKNANLDIAASLKFAEDGEDSA
FT                   ILQNFNIERFIFTCDNDSKINLNGDLQLFANKLPKGKLYFELENYNSIVDKLLPNNIIL
FT                   SKKIIKTIIAKAINKASDVQLNTEQNDSNSAYNNIEKAKFDIEFSDKGINIGAINLLEL
FT                   KLGEHKEDQNTTNNSN"
FT   gene            322266..323207
FT                   /locus_tag="RPR_01980"
FT   CDS_pept        322266..323207
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_01980"
FT                   /product="immunogenic protein"
FT                   /note="COG2358 TRAP-type uncharacterized transport system,
FT                   periplasmic component"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_01980"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47251"
FT                   /db_xref="InterPro:IPR011852"
FT                   /db_xref="UniProtKB/TrEMBL:C4K100"
FT                   /protein_id="ACR47251.1"
FT                   /translation="MNNFKLATIISIFLICSNIYAAPKVIKIGTGSILKGYYAIGLDLC
FT                   KTITNDDKNNEHIKCEVVATNGSIENLKLLQQGKIDLALVQANIAVEAYEGIGYYHDQE
FT                   KMQNLRQVLNLHDEFFTVIVKDEDKIKGFADIDGKKITNGPAFSSSHITYDVVRSLYKF
FT                   AKEPEELHINYEDSSDQFCNKEIDAIIMMVGHSNPLVNLIANKCEIDFISIDNDKITEL
FT                   IKQNRAFHKAILHKGLYPGITDNHTTVKVSAILVTRDEANRDILDKFIGAFHRNVANFK
FT                   LSNYLLNNLDINYFADTKNFVLPKHDSVRNKN"
FT   gene            323217..323663
FT                   /locus_tag="RPR_01985"
FT   CDS_pept        323217..323663
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_01985"
FT                   /product="hypothetical protein"
FT                   /note="COG0589 Universal stress protein UspA and related
FT                   nucleotide-binding proteins"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_01985"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47252"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:C4K101"
FT                   /protein_id="ACR47252.1"
FT                   /translation="MSENTIFKNILIPIDLNDKKSIKGILSKALMLATNFQAKLHFMYV
FT                   IPEFGTKMFEDYLPKHWRTEKKEKYKAQIKELIKQYIPDEIETDYYIGSGAVYDEIIKH
FT                   SNEIKADLIIISAVRLQLKDYMLGPNASKIVRHSDISVLVVRDE"
FT   misc_feature    324399..325493
FT                   /note="authentic internal stop codon: common BLAST hit:
FT                   gi|157964614|ref|YP_001499438.1| transposase ISRpe1"
FT   gene            complement(326018..326842)
FT                   /gene="dapD"
FT                   /locus_tag="RPR_02005"
FT   CDS_pept        complement(326018..326842)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dapD"
FT                   /locus_tag="RPR_02005"
FT                   /product="2,3,4,5-tetrahydropyridine-2-carboxylate
FT                   N-succinyltransferase"
FT                   /EC_number="2.3.1.117"
FT                   /note="COG2171 Tetrahydrodipicolinate
FT                   N-succinyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_02005"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47253"
FT                   /db_xref="GOA:C4K102"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005664"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR023180"
FT                   /db_xref="InterPro:IPR037133"
FT                   /db_xref="UniProtKB/TrEMBL:C4K102"
FT                   /protein_id="ACR47253.1"
FT                   /translation="MSSLIKEVEEAWQIKDKLLQDSSKLITLKQTLNDSIESLNQGTIR
FT                   VCEKKENSWHVNEWVKKAILLYFITTESQLYNNNYNSWYDKVAPKFSADTDKNTFKEAA
FT                   IRKVPGAVVRTGTYIAKNVVIMPSFINIGAYIDEGTMIDTWATIGSCAQIGKNCHISGG
FT                   TGIGGVLEPLQAKPVIIEDNCFIGARSEIAEGVIVEEGAVISMGVFIGSSTKIVYRDTG
FT                   EIIYGRIPAYSVVVPGVLPAKEAGKPGLYCVVIVKQVDKTTRAKVRINDLLR"
FT   gene            326918..327550
FT                   /locus_tag="RPR_02010"
FT   CDS_pept        326918..327550
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_02010"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_02010"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47254"
FT                   /db_xref="GOA:C4K103"
FT                   /db_xref="InterPro:IPR011723"
FT                   /db_xref="UniProtKB/TrEMBL:C4K103"
FT                   /protein_id="ACR47254.1"
FT                   /translation="MHITCPNCQTRFIVTSNQIGINGRRVKCSKCSHLWYQKLDYNTST
FT                   LNDFKDKVNTGTIKTPIKNHYNANVPVILPYIPPKKKYNIFPILWTSFIIFCLVILLID
FT                   SFKFLDKYDQLKIEEINLGKSRHIGGMKIFYKLSNESEYLISDPIIKVRVMDTNNQALD
FT                   EYVSITKLQTKIPAKQAIYLEMNIEGIPITAKYIDIVIGNRLGLLFK"
FT   gene            complement(327894..328253)
FT                   /locus_tag="RPR_02015"
FT   CDS_pept        complement(327894..328253)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_02015"
FT                   /product="virB2 protein"
FT                   /note="COG3838 Type IV secretory pathway, VirB2 components
FT                   (pilins)"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_02015"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47255"
FT                   /db_xref="GOA:C4K104"
FT                   /db_xref="InterPro:IPR007039"
FT                   /db_xref="UniProtKB/TrEMBL:C4K104"
FT                   /protein_id="ACR47255.1"
FT                   /translation="MNFPIRKLNEELIDYNLSLRILFTILSVAIIMVAFDSLGGNVGDP
FT                   VGEALCKLIKVFRGNTAKGIAVVGIIVLGIQTLRGKLQWEVALVVVTAIIILFKAPDIV
FT                   NMVSSDTNSSSCGVS"
FT   gene            complement(328409..329260)
FT                   /locus_tag="RPR_02020"
FT   CDS_pept        complement(328409..329260)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_02020"
FT                   /product="cytochrome c oxidase subunit III"
FT                   /note="COG1845 Heme/copper-type cytochrome/quinol oxidase,
FT                   subunit 3"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_02020"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47256"
FT                   /db_xref="GOA:C4K105"
FT                   /db_xref="InterPro:IPR000298"
FT                   /db_xref="InterPro:IPR013833"
FT                   /db_xref="InterPro:IPR024791"
FT                   /db_xref="InterPro:IPR033945"
FT                   /db_xref="InterPro:IPR035973"
FT                   /db_xref="UniProtKB/TrEMBL:C4K105"
FT                   /protein_id="ACR47256.1"
FT                   /translation="MSQKIILNNSYSITKSHLFHIVDPSPWPVLTSFALLLLVIGGVSF
FT                   MHGYKFNIYILSAGIISVGYCLYSWWRDIVKEGIVEHQHTSPVRKGLQIGMALFILTEI
FT                   VFFGVFFASFFKSSLSPVGLLDGVWVVKQGIWPPPTIKTFEPFDIPFINTLILLLSGTT
FT                   VTWAHYALEEKNQKDCVTALALTILLGIFFTTMQAYEYYHAAFKFTDGIYASNFYLATG
FT                   FHGAHVIIGTIFLIICYFRAKRGDFTTEGNGHLGFECAAWYWHFVDVVWLFLFTFVYIF
FT                   GS"
FT   gene            complement(329801..330340)
FT                   /locus_tag="RPR_02025"
FT   CDS_pept        complement(329801..330340)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_02025"
FT                   /product="2-polyprenyl-3-methyl-6-methoxy-1,4-benzoquinol
FT                   hydroxylase"
FT                   /note="COG2941 Ubiquinone biosynthesis protein COQ7"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_02025"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47257"
FT                   /db_xref="GOA:C4K106"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR011566"
FT                   /db_xref="UniProtKB/TrEMBL:C4K106"
FT                   /protein_id="ACR47257.1"
FT                   /translation="MPRPDFSDPDKQIHEIIRVNHAGEYGAKRIYQGQLKYIKSQNDHI
FT                   LIKEMLDHEEVHLNYFEKKLLEKEVRPTFLLFFWHHYGFLLGALSSLMGIKTAMLITES
FT                   VEEVIEKHYEQQINYLENKNVEPELLNNIIKFRLDEIEHKNIAIMNDSTEAIFAEITSK
FT                   IVKIICRISIILSKKI"
FT   gene            complement(330476..331450)
FT                   /gene="holA"
FT                   /locus_tag="RPR_02030"
FT   CDS_pept        complement(330476..331450)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="holA"
FT                   /locus_tag="RPR_02030"
FT                   /product="DNA polymerase III subunit delta"
FT                   /note="COG1466 DNA polymerase III, delta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_02030"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47258"
FT                   /db_xref="GOA:C4K107"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C4K107"
FT                   /protein_id="ACR47258.1"
FT                   /translation="MKFYFSQIGRLFELITSGKIRALLLYGPDKGYIEKICKHLVKSLN
FT                   MLQTSIEYADLNISSLEILLNSSNFFGQKELIKIRSVGNSIDQNLKTILNSDYINFPVF
FT                   IGEEMTSSGSIRKFFETEEYLAAVACYHDDEAKIERIILGKVEKTNKVISKEAITYLKA
FT                   HLKGDHDLICSEINKLIYFVHDAREITLNDVLEVISSEITANGSDLAMYFSKKDYSNFL
FT                   QELDILKKQNINEVLIIRALIRHYLNLYIVLSKVKNGERLELAIKSLSPPIFYQYINDF
FT                   TKIANGLSLTECLKTLKVLQQAEVDYKLNPASFDLFQSILQSK"
FT   gene            complement(331458..331931)
FT                   /locus_tag="RPR_02035"
FT   CDS_pept        complement(331458..331931)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_02035"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_02035"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47259"
FT                   /db_xref="UniProtKB/TrEMBL:C4K108"
FT                   /protein_id="ACR47259.1"
FT                   /translation="MRSLFVIIIFFLMSSCNLKPVYSEKYSRNNDLEAIEVEPIRTIEG
FT                   AEFYHRLTSILPQKAQAKYLLKVKLIATTMPATIEKNSNVLREYINQLVRYKLIDIESQ
FT                   KVLIEEKFYQNTSYNAIFTPYATNVERDKTGIDLAYQAAEEIRSRLILYFTRK"
FT   gene            complement(333629..335101)
FT                   /locus_tag="RPR_02050"
FT   CDS_pept        complement(333629..335101)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_02050"
FT                   /product="heat shock protease"
FT                   /note="COG0265 Trypsin-like serine proteases, typically
FT                   periplasmic, contain C-terminal PDZ domain"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_02050"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47260"
FT                   /db_xref="GOA:C4K109"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR001940"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:C4K109"
FT                   /protein_id="ACR47260.1"
FT                   /translation="MKKLPILLKLLFIINLVFLNNIVLASSETSTIIFEKAKKAIVTID
FT                   TRIAVSAYDDTSSWTGTGFINDKNNGYIITNTHVVGGASIGTYFVTFYNGEQAEAKLIY
FT                   YDIWQDYAVLKVESKDIPASATQISFASEFPKLNQKVFVVGNTEAKGFSFHTGYLSDLY
FT                   NIEGLMPQCTYVINLNTTGGASGSPVLNDKIEAIGVLYGGGKTHSLALHGDYVARTLES
FT                   LKNNKQPGRKHIGIISELYSLNKAVRHHNFPKEEMDKYIKKFPDSRNRVISIKAVLAGS
FT                   PAAKSLKAGDIIWAVNDKELGGNLALFDREMDNFKGIAIKLTIFRDGKKLEQAVDLYDV
FT                   NNNKIAKMINFGGAVFFEADDYFSNKSGIPLKALSIASVQSGSSFSSIPTFFTKDYKNV
FT                   YRLQIFEMKDLALSNLDDLVKCLPAITKEKFITVRFRNYQPYYANFGYNELISSHDDMI
FT                   ADVTLDSIDTKPYILKYNTISHDWDMENIKLQ"
FT   gene            335186..337069
FT                   /gene="dnaK"
FT                   /locus_tag="RPR_02055"
FT   CDS_pept        335186..337069
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaK"
FT                   /locus_tag="RPR_02055"
FT                   /product="molecular chaperone DnaK"
FT                   /note="COG0443 Molecular chaperone"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_02055"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47261"
FT                   /db_xref="GOA:C4K110"
FT                   /db_xref="InterPro:IPR012725"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="InterPro:IPR029047"
FT                   /db_xref="InterPro:IPR029048"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4K110"
FT                   /protein_id="ACR47261.1"
FT                   /translation="MGKVIGIDLGTTNSCVAVMEGKEPKVIENAEGERTTPSIIAFANG
FT                   EKLVGQSAKRQAVTNHRNTIYAVKRLIGRNFIDPMVKKDQGIVPYNIVKADNGDAWVEA
FT                   DNNKYSPSQISAFILQKMKETAENYLGDKVTQAVITVPAYFNDAQRQATKDAGKIAGLE
FT                   VLRIINEPTAAALAYGFEKSASKTIAVYDLGGGTFDVSILEIADGVFEVKSTNGDTFLG
FT                   GEDFDTRILNHLIDVFKKENGIDLSNDPLALQRLKEAAEKAKKELSSAVTTNINLPYIT
FT                   ADSSGPKHLNIKFTRAELEKLVDDLIEKTIEPCRKALQDAGFKASDIQEVVLVGGMTRM
FT                   PKVQEAVKKFFGREPHKGVNPDEVVALGAAIQGGVLNKEVTDILLLDVTPLSLGIETLG
FT                   GVFTRLIDRNTTIPTKKSQVFSTADDNQHAVTIRVFQGEREMAKDNKLLGQFNLEGIPL
FT                   APRGLPQIEVTFDIDANGIVHVSAKDKASGKEQKVTIQASGGLSDAEIEQMVKDAEQNA
FT                   DEDKKRKELIEAKNAADSLVYSTEKTLTEYGDKLSSDDKGAVEEALAALKAVLESEDTA
FT                   LIKEKTESLTAASMKIGEAMYKAQSESQPAAESAANDEKIVDADFQDVEKK"
FT   gene            337198..338319
FT                   /locus_tag="RPR_02060"
FT   CDS_pept        337198..338319
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_02060"
FT                   /product="dnaJ protein"
FT                   /note="COG0484 DnaJ-class molecular chaperone with
FT                   C-terminal Zn finger domain"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_02060"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47262"
FT                   /db_xref="GOA:C4K111"
FT                   /db_xref="InterPro:IPR001305"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR002939"
FT                   /db_xref="InterPro:IPR008971"
FT                   /db_xref="InterPro:IPR012724"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="InterPro:IPR036410"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4K111"
FT                   /protein_id="ACR47262.1"
FT                   /translation="MSQNYYQILGVSKTASQADLKKAYLKLAKQYHPDTTDAKDAEKKF
FT                   KEINAAYDVLKDEQTRAAYDRLGHDAFQNQQSRGGGGNHGGFHPDINDIFGDFFSDFMG
FT                   GSRRSSRPTSAKVRGSDLKYNLTINLEEAFHGIEKNISFSSTVKCDTCHGSGSEKGETV
FT                   TTCDACSGVGATRMQQGFFTIEQACHKCQGNGHIIKNPCKKCHGMGRYHKQRNLSVNIP
FT                   AGVENGTRIRHTGEGEAGIRGGNSGDLYVDITIKPHDIYKVDGANLHCKLPISFVNAAL
FT                   GGEIEVPVIEGGKVNLTIPAGTQNGDQLRLRSKGMSKMRSTIRGDMLTHIHVEVPKNLS
FT                   KRQRELLEEFKKESINEKENDGSFFNKMKSLWS"
FT   misc_feature    338628..338861
FT                   /note="authentic internal stop codon in COG4572 Putative
FT                   cation transport regulator, cation transport regulator
FT                   ChaB"
FT   gene            338861..339616
FT                   /locus_tag="RPR_02070"
FT   CDS_pept        338861..339616
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_02070"
FT                   /product="ComL family lipoprotein"
FT                   /note="COG4105 DNA uptake lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_02070"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47263"
FT                   /db_xref="GOA:C4K112"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR017689"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR039565"
FT                   /db_xref="UniProtKB/TrEMBL:C4K112"
FT                   /protein_id="ACR47263.1"
FT                   /translation="MKLTKLLSTLLVIGLVLGGCKNKKTSDDIVVPIATLYNEGITLLE
FT                   KKKYKNAAEEFGRVLYQHPGNEMTPQAELMQAYSLFLAAQYEEAVDVLDMFIKLHPANV
FT                   DIAYAYYLKALSYYMLISDVNHDQSRTFLAKDSFEDVIAKFPNTKYAIDSSLKIDLVND
FT                   HLAGKEMMVGRFYLKKKNPMAAINRFEEVIDNYQTTSHSVEALYRLAESYMILGLPDEA
FT                   KKYASVLGYNYPDSQWYSYAYRLVQNHQN"
FT   gene            339624..341261
FT                   /locus_tag="RPR_02075"
FT   CDS_pept        339624..341261
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_02075"
FT                   /product="DNA repair protein RecN"
FT                   /note="COG0497 ATPase involved in DNA repair"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_02075"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47264"
FT                   /db_xref="GOA:C4K113"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR004604"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C4K113"
FT                   /protein_id="ACR47264.1"
FT                   /translation="MFYSLSVKNFILIDELEIEFNKGLCVITGETGAGKSILLDAILFC
FT                   LGYKTSNKIIKRGKEYAVVNIIFSLNEEIKNFLIQNFIEPEELLFVKCLQKAEGRKNFF
FT                   INNQVVTKALMQQLATYLFELHGQNNNISLLEANTQRDILDSYGNLLDFRAELSKCYQA
FT                   WQNTRKEMAEITLKQNSIEQEIDYLSFATEELTKLNIQTGEEEKLANLRKDLQNKDKDL
FT                   QLIKDILEQINNPEINTSINRAEKLLARQGNNERFEAIVTSLEEAYNNLEEARQELSNL
FT                   LDSFNYEEYNLEETEERLFLIKAISRKYNVPADALGVFLDKSLEQLSILKHKIANSNEL
FT                   KAQEVLLQKKYYELASNLSAKRLIVAKHLEESLHQELKQLKMAKAIFEIEINAKEPTAD
FT                   GNDDIVFKASTNPGTAAATINKIASGGELSRFMLALKTSLFDKMVKPSIIFDEIDVGIG
FT                   GEVADKVGERLKKLSSVTQVIVITHQPQVAGKADLHIKIEKTQLEKETKVTVKALNLAE
FT                   RQEELARMISGKTITKASLKAAKELLHL"
FT   gene            341438..342928
FT                   /locus_tag="RPR_02080"
FT   CDS_pept        341438..342928
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_02080"
FT                   /product="thermostable carboxypeptidase"
FT                   /note="COG2317 Zn-dependent carboxypeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_02080"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47265"
FT                   /db_xref="GOA:C4K114"
FT                   /db_xref="InterPro:IPR001333"
FT                   /db_xref="UniProtKB/TrEMBL:C4K114"
FT                   /protein_id="ACR47265.1"
FT                   /translation="MNNNYTKLENEFATISHFNNILSILYWDVAVNMPMGSGESRTNEI
FT                   VTLTSLVHSMLKSPILKELLSKAKEESKNLDEWQNGNIREIERKVTDANCIDEQLQKKL
FT                   VVATTKAALVWREARKHNDYNLFKSHLQKVLDYTKEVAKVRADAFNCGLYDSLIDMFDP
FT                   SRKSSEIKQVFSVLKKELPQLINKVLEKQKTEKELVKHSKLAPEMQKRIGKRIMGIMQF
FT                   DLTKGRLDESTHPFCGGTPNDIRLTTRYDKDNFISGLMGIIHETGHALYEQNLPEMYKG
FT                   QPVGLAKGMAFHESQSLFMEMQVGRSREFTEFLAKLLRDEFAFKSEEYSAASLYRKITR
FT                   VMPDFIRVDADEVTYPMHVILRFEIEEMLINGDLNLDELPSCWDSKMQEYLGVKPVSSS
FT                   NGCLQDIHWSHGNFGYFPAYTNGAIIASMVMKKVKEMHSNIKDDILKGDFSNLNNYLNK
FT                   NFRNLGSLKNSADLLKSASGEEKISPEVYIRYLEGKYL"
FT   gene            343065..345851
FT                   /gene="kgd"
FT                   /locus_tag="RPR_02085"
FT   CDS_pept        343065..345851
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kgd"
FT                   /locus_tag="RPR_02085"
FT                   /product="alpha-ketoglutarate decarboxylase"
FT                   /EC_number="1.2.4.2"
FT                   /note="COG0567 2-oxoglutarate dehydrogenase complex,
FT                   dehydrogenase (E1) component, and related enzymes"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_02085"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47266"
FT                   /db_xref="GOA:C4K115"
FT                   /db_xref="InterPro:IPR001017"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR011603"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR031717"
FT                   /db_xref="InterPro:IPR032106"
FT                   /db_xref="InterPro:IPR042179"
FT                   /db_xref="UniProtKB/TrEMBL:C4K115"
FT                   /protein_id="ACR47266.1"
FT                   /translation="MEEDFKKTGYLFGGNAVFIEELYKQYLANPASVDQTWQEFFAGIK
FT                   DNNTLLNKSTAKIIIPDEIKKESLNNNLSSEDLNSLKAKEMINAYRKHAHYLANLDPLG
FT                   LELRKTKNDLKLNIETFGLDSSQLEENINITDEFVGTWNCKLSELVTKFDKVYTGSIGV
FT                   EFEQIENVAGKNWLYNKLESEVTFSSEDKKTILNDLVEVEGFEQYLHTKFPGAKRFSIE
FT                   GGDASIVAMSKAIDLSMHQGVSEIVIGMAHRGRLNTLTKVVGKPYKAVIAGFISGSVFP
FT                   DELNVSGDVKYHLGYSSDRTLEDKKIHLSLADNPSHLEAVNPIVAGKVRAKQDILGDTK
FT                   RSKVKAILVHGDAAFCGQGVVAESLSMSPLAAYDIGGILHFVINNQLGFTANAANTRAS
FT                   RYSTEFAKIIAAPILHVNGDDIEAVLKATNIAVEYRQKFGKDVVVEIICYRKYGHNEGD
FT                   EPMYTQGKMYNIIKNKLTPGNIYANELVKSGVIDNNYFAKLKEEFKAKLDKEYEQAKSY
FT                   KQEAHFLGGLWQGISRTRTQATITGISKKTLHDLGTKLCEIPKDFAVNPKLVKLFEARK
FT                   ATLTADQPIDWATAEQLAFASLLASGTNIRLTGQDSGRGTFSHRHSVLHNQIDGTTYIP
FT                   LNNLSKEQAKYEVADSNLSEYAVLGFEYGYSLANPKNLVLWEAQFGDFANGAQIIFDQF
FT                   ISSSETKWLRMSGLVVLLPHAFEGQGPEHSSARLERFLQLAAENNMYVTYPTTPASIFH
FT                   LLRRQILDDTRKPLIVMSPKSLLRHKYAVSKLDELGENTTFLPVLDEVTKVDTNNITKV
FT                   ILCSGKVYYDLFEMRGNNSNIAIIRLEQLYPFEKKLVASLLKKYNRTQELIWCQEEPKN
FT                   MGTWCYIVSHLNDALKEAGIKNEFKYVGREESASPAVGSLQAHNKQQEKLLRTALGI"
FT   gene            346016..347203
FT                   /locus_tag="RPR_02090"
FT   CDS_pept        346016..347203
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_02090"
FT                   /product="dihydrolipoamide acetyltransferase"
FT                   /EC_number="2.3.1.61"
FT                   /note="COG0508 Pyruvate/2-oxoglutarate dehydrogenase
FT                   complex, dihydrolipoamide acyltransferase (E2) component,
FT                   and related enzymes"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_02090"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47267"
FT                   /db_xref="GOA:C4K116"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001078"
FT                   /db_xref="InterPro:IPR003016"
FT                   /db_xref="InterPro:IPR004167"
FT                   /db_xref="InterPro:IPR006255"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR036625"
FT                   /db_xref="UniProtKB/TrEMBL:C4K116"
FT                   /protein_id="ACR47267.1"
FT                   /translation="MRVKIIVPSLGESITEATIAKWYKKEGDSVKTDELLLEIETEKVT
FT                   LEVNAPCNGTIGKISKTDGANIAVGEEIGEINEGASVNTAGTNNESARAQAVTQPTSEK
FT                   PAVANNTLAPSVQKLVTENKLDPNNIKGTGRDGRITKGDVLATINTTTTSAPAISKSNE
FT                   ERVQRVRMSRLRKTIAQRLKDSQNTAAILTTFNEIDMSKVIALRNQYKEEFEKKHAVKL
FT                   GFMSFFVKATIEALKLIPSVNAEIDGDDLVYKNYYDIGVAVGTEQGLVVPVVRDADKMG
FT                   FAEVEKTIGILAKQAREGKLSMADLSGGTFSISNGGVYGSLLSTPIINPPQSGILGLHK
FT                   TEERAVVIDGKIEIHPMMYIALSYDHRIIDGKEGVSFLVKIKQLIENPEKLLLNL"
FT   gene            347373..347789
FT                   /locus_tag="RPR_02095"
FT   CDS_pept        347373..347789
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_02095"
FT                   /product="hypothetical protein"
FT                   /note="COG0720 6-pyruvoyl-tetrahydropterin synthase"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_02095"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47268"
FT                   /db_xref="InterPro:IPR007115"
FT                   /db_xref="InterPro:IPR038418"
FT                   /db_xref="UniProtKB/TrEMBL:C4K117"
FT                   /protein_id="ACR47268.1"
FT                   /translation="MIKCTRRIEFDAGHRIIEHQNKCQFLHGHRYVLEIAIAANKTDKL
FT                   GMVIDFGLIKDLAKKWIDENFDHSLILHQDDKEMGQQIENCTGQKIYYMQNNPTAENIA
FT                   THLKNEIFPKLFVSQNFFVTSLKLYETPHCFVEV"
FT   gene            347792..348106
FT                   /locus_tag="RPR_02100"
FT   CDS_pept        347792..348106
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_02100"
FT                   /product="periplasmic divalent cation tolerance protein"
FT                   /note="COG1324 Uncharacterized protein involved in
FT                   tolerance to divalent cations"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_02100"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47269"
FT                   /db_xref="GOA:C4K118"
FT                   /db_xref="InterPro:IPR004323"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="UniProtKB/TrEMBL:C4K118"
FT                   /protein_id="ACR47269.1"
FT                   /translation="MQDCCLILTTTNDLQIAEKIAFVLLELNLTACIQIDDVKSYFRWN
FT                   GRVTLETEYRLVIKTKSSNYNEIENKLLEIHNYELPQIIKINIDYGFQKYLEWINQNNK
FT                   "
FT   gene            348147..349346
FT                   /locus_tag="RPR_02105"
FT   CDS_pept        348147..349346
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_02105"
FT                   /product="Na+/H+-dicarboxylate symporter"
FT                   /note="COG1301 Na+/H+-dicarboxylate symporters"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_02105"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47270"
FT                   /db_xref="GOA:C4K119"
FT                   /db_xref="InterPro:IPR001991"
FT                   /db_xref="InterPro:IPR018107"
FT                   /db_xref="InterPro:IPR033380"
FT                   /db_xref="InterPro:IPR036458"
FT                   /db_xref="UniProtKB/TrEMBL:C4K119"
FT                   /protein_id="ACR47270.1"
FT                   /translation="MKLWQKVTLGLILGIIFGIYLPQYVNYIKPIGDIFLRLIKMIITP
FT                   LIFFSLVSGITSMNNNSALGRVGMKAVAAFLGTTFFATVFGLTVALVLKPGVGVHIDFT
FT                   SSGTTSRTSFNIIDFFVNIVPDNAVGAFANGDVLQVVFFAIFVGITLNKMKSIGEPITD
FT                   LIHIMSKLILKMISFVIQLSPYGAFALTGWIVGMRGVEVMISLSKLVVAVVVAMTFQYL
FT                   VFGLLICVFCRVSPIPFYKKSFEYQILAFSTSSSKATLATTMQVCREKLGISESSTSFV
FT                   LPIGASINMDGFAINLSLTTIFFAQMMGVTLAPHDYLVIILTSTLGSIGGAGIPGASLI
FT                   MLPMVLSSVHLPIEGVAIIAGIDRILDMLRTTINITGDATITMIIDNSEDTLDKEVYLS
FT                   "
FT   gene            complement(350282..351376)
FT                   /locus_tag="RPR_02120"
FT   CDS_pept        complement(350282..351376)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_02120"
FT                   /product="transposase ISRpe1"
FT                   /note="COG2801 Transposase and inactivated derivatives"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_02120"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47271"
FT                   /db_xref="GOA:C4K120"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:C4K120"
FT                   /protein_id="ACR47271.1"
FT                   /translation="MNLNQKIIKPKIGLLELAKSLGSISSACKAMGYSRDSYYRFKALY
FT                   ETGGEEALYEISRRKPIIANRVDPAIEKAVMDMAIEYPAYGQLRVSNELKKSGILVSPG
FT                   GVRSIWLRNDLNNISKRLKALEAKMAQDGIVLTESQLQVLEERRNEREAHGETETQHPG
FT                   YLGCQDTYYVGNFKGIGKVYSQVFIDSYTRVADAKLYTDKTALTAADMLNDRVLPWYET
FT                   QGIPILRILTDRGSEYKGNIEHHAFELFLSIEGIEHTTTKTYSPQTNGMCERFNKTMKQ
FT                   EFFYTAMRKKIYTDLDDLQLDLDIWLEHFNNERPHSGKYCYGKTPMQTFKDSRKLAVEK
FT                   NNEILYLEYVSDSQNVTDNQVQNL"
FT   gene            complement(351451..351654)
FT                   /locus_tag="RPR_02125"
FT   CDS_pept        complement(351451..351654)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_02125"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_02125"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47272"
FT                   /db_xref="UniProtKB/TrEMBL:C4K121"
FT                   /protein_id="ACR47272.1"
FT                   /translation="MKTNNILKVAVGASSVAQKALNSITDKSCGIIEDKILKGNYVTRE
FT                   EFEKLQTLVIKLKKELAELKSK"
FT   gene            complement(351651..351893)
FT                   /locus_tag="RPR_02130"
FT   CDS_pept        complement(351651..351893)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_02130"
FT                   /product="hypothetical protein"
FT                   /note="COG0271 Stress-induced morphogen (activity unknown)"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_02130"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47273"
FT                   /db_xref="InterPro:IPR002634"
FT                   /db_xref="InterPro:IPR036065"
FT                   /db_xref="UniProtKB/TrEMBL:C4K122"
FT                   /protein_id="ACR47273.1"
FT                   /translation="MNRIERIQEKLSVLKPHFQEIIDESYKHASHYNGIHSHIKIRISA
FT                   ETLQGKSLIANHRTINNLLADEFNSGLHALSIEVL"
FT   gene            351957..353174
FT                   /locus_tag="RPR_02135"
FT   CDS_pept        351957..353174
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_02135"
FT                   /product="hypothetical protein"
FT                   /note="COG2200 FOG: EAL domain"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_02135"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47274"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:C4K123"
FT                   /protein_id="ACR47274.1"
FT                   /translation="MAMSELRTNYKDLQDAIDKLEKGVCFACRLVNYDEIEFIEQGKHF
FT                   IIEDLDQIIEDVSKELNIFSKFKKIKKDRILFILNTIDSDLIKNFARKLYLFLQLYINE
FT                   QKPAIYMNCYIASIKFPKKVSNNAKEIEKTLNMLLSQNNNYYYREYSSTEHDLENIRKS
FT                   NLQLNLLRQALAKKTMRFAYQPIIDRNTMKIHYYECLLRIPDENGVYISVGPIIPIAEN
FT                   KGLIFIIDQIVLEMTVNELARNPNLMLAVNISNIGTGDEALWEIAENLLKAHNVRDRLI
FT                   IEITETSFNQHYDKITLFINKLRKYGCKFALDDFGAGFTSFKQLQSLPIDIIKIDGKYV
FT                   RSITSDVQSRYFVERLIKISEDLGIETVAEFVENGEIAKFLIDLKVGGLQGNFYSEAKF
FT                   DRVDEV"
FT   gene            353395..354852
FT                   /gene="murC"
FT                   /locus_tag="RPR_02140"
FT   CDS_pept        353395..354852
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murC"
FT                   /locus_tag="RPR_02140"
FT                   /product="UDP-N-acetylmuramate--L-alanine ligase"
FT                   /EC_number="6.3.2.8"
FT                   /note="COG0773 UDP-N-acetylmuramate-alanine ligase"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_02140"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47275"
FT                   /db_xref="GOA:C4K124"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005758"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4K124"
FT                   /protein_id="ACR47275.1"
FT                   /translation="MLLLELKKTNQTLETIHFIGIGGVGMSGIAEILYNLGYKVQGSDL
FT                   VENYNTKRLESYGIKIFLGHAEQNITNVSYVVISSAINPKNPEIKEALERKIPIIRRAD
FT                   MLAELMRLKCSVAVSGSHGKTTTTSLVACLFEAAGLCPTVINGGIINNKLTNAYLGSSN
FT                   YLIAEADESDATFIHIPSTIAIITNIDPEHLDYYRDFETLIGAFRSFITNLPFYGFAVC
FT                   CIDHKIVRKLVDEITERKIVTYGIDSEDAHIIAFNINTDIASSTFDVKISLPNVLGTTI
FT                   IEKITIPTPGRHNILNSLAAIAVGIELDFGIKAIKNGFNNFKGVKRRFTKVAEYNNASI
FT                   IDDYAHHPEEIKATLATAKNIANKQNGKVIAIFQPHRYSRMQYLFDDFMLCFADADILY
FT                   ITDIYAAGENPIEGITGRSLVDKITKRKHHDKANFLAELDDAVGVIIDNAASGDMIIMM
FT                   GAGNISSFANELDGRLSSSGFSCHTVV"
FT   gene            355075..355962
FT                   /gene="murB"
FT                   /locus_tag="RPR_02145"
FT   CDS_pept        355075..355962
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murB"
FT                   /locus_tag="RPR_02145"
FT                   /product="UDP-N-acetylenolpyruvoylglucosamine reductase"
FT                   /EC_number="1.3.1.98"
FT                   /note="COG0812 UDP-N-acetylmuramate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_02145"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47276"
FT                   /db_xref="GOA:C4K125"
FT                   /db_xref="InterPro:IPR003170"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR011601"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="InterPro:IPR036635"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4K125"
FT                   /protein_id="ACR47276.1"
FT                   /translation="MLILPIVKGEYKKDYNLKHLTWFKVGGNAEIFFKPLDSEDLKSFL
FT                   IQNKQKLPIKTFGAGSNIIIRDGGIEGVVIKLGQNFSNIEFIDNHLIVGSSCLNYNLAK
FT                   FCQANAISGFEFLVGIPGTIGGGVAMNAGAYGSEFKDIVVQIEAIDFAGNFLTFTNEAI
FT                   GFKYRSNNLPKNLIILKVVFKINKGDSENILLRMNEINNARSSTQPIKERTGGSTFANP
FT                   EGHKSWELIDKAGLRGYRIGGASMSELHCNFMINNGDATAKDLEDLGDFVRQKVCEDSG
FT                   VKLEWEIKRIGRHP"
FT   gene            356206..357177
FT                   /gene="ddl"
FT                   /locus_tag="RPR_02150"
FT   CDS_pept        356206..357177
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ddl"
FT                   /locus_tag="RPR_02150"
FT                   /product="D-alanine--D-alanine ligase"
FT                   /EC_number="6.3.2.4"
FT                   /note="COG1181 D-alanine-D-alanine ligase and related
FT                   ATP-grasp enzymes"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_02150"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47277"
FT                   /db_xref="GOA:C4K126"
FT                   /db_xref="InterPro:IPR000291"
FT                   /db_xref="InterPro:IPR005905"
FT                   /db_xref="InterPro:IPR011095"
FT                   /db_xref="InterPro:IPR011127"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4K126"
FT                   /protein_id="ACR47277.1"
FT                   /translation="MHKYQTHWVEHSIVKILSSTGKKHIALMAGGMSAEREVSLVSSEG
FT                   VSKALIELGYRVTFIDMGADIAVRLQEIKPDIVFNCLHGTYGEDGCLPGLLNIMRIPYT
FT                   HSGVLSSALAFNKIHSRIWFLTNNINMAESIVVNKSDNIKNDPMKRPYVIKPLAQGSSI
FT                   GVEVIFAEDDFNFADYDFPYGDQVIIEQYIKGQGRELQVAVLNGKALGALEIKLLKNRF
FT                   YDYETKYTEGFADHLCPAPLPANLYEKLLIESEKIYKTMNCKGPARAEFILEEQTNKLY
FT                   ALEINTHPGMMPLSIVPEIAAYAGINFTNLIEEIIKTASFES"
FT   gene            357174..357977
FT                   /locus_tag="RPR_02155"
FT   CDS_pept        357174..357977
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_02155"
FT                   /product="cell division protein"
FT                   /note="COG1589 Cell division septal protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_02155"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47278"
FT                   /db_xref="GOA:C4K127"
FT                   /db_xref="InterPro:IPR005548"
FT                   /db_xref="InterPro:IPR013685"
FT                   /db_xref="InterPro:IPR026579"
FT                   /db_xref="InterPro:IPR034746"
FT                   /db_xref="UniProtKB/TrEMBL:C4K127"
FT                   /protein_id="ACR47278.1"
FT                   /translation="MRKKTSSNKKKQTKKTNNISLRRKLGLIYKKAILGLKIALIIFVC
FT                   LFVFTKYFAGIKTYLTTNIYQTTTKLGFKLENVIIEGQQNVDEPTILKVLNANKDSPIF
FT                   ALKLDEIRNNLKKNKWIKEVYVSRRLPNTVYIKLFEREPIAIWQINNQLFLVDEEGYEI
FT                   SKNIQPFPHLLHVVGEGANIYAGTLVLELQKYPALMNKTSAAVRLGDRRWDLNLKGNIS
FT                   IKLPEKEFEEALKYVDALNKANKLFNQNYKVLDLRDKNKYYIEKY"
FT   gene            358105..359340
FT                   /locus_tag="RPR_02160"
FT   CDS_pept        358105..359340
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_02160"
FT                   /product="cell division protein ftsA"
FT                   /note="COG0849 Actin-like ATPase involved in cell division"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_02160"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47279"
FT                   /db_xref="GOA:C4K128"
FT                   /db_xref="InterPro:IPR003494"
FT                   /db_xref="InterPro:IPR020823"
FT                   /db_xref="UniProtKB/TrEMBL:C4K128"
FT                   /protein_id="ACR47279.1"
FT                   /translation="MKEKISNFVTLDLGSSKIAVIAAYISKKGEIKVASQNLHHSKGIK
FT                   SGVISDLKNAETSIVSAIYALEKDCGKNIKKVILSLSGADTKSYYINYTIKVNGQTVTQ
FT                   QDIKKLLQKALLEFKVKNQEIIHYFPLEFTLDNNSVENPIGMYGRELSCELHIIAASSN
FT                   MLSNIVQCFAKCHVEVTNITLAIYASAISCLTNDEKNLGSLIIDMGDKTTSFGIFFAGK
FT                   LIYTGHVNIGSFHISSDIAKVFGIDLVTAEKLKILYGNAMIPLFEKDSIINTEDFQVDT
FT                   HHTLNTSVTIYKLAEVIRARAEEILSMVKAEYDKATKGQVEVFRVVITGGGSQLRGLKE
FT                   FSNKIFEKQSRIGKPEIIAGFIEDYNPAMYSATIGMLKIHALKQQQEFAHIRLDANSSF
FT                   FKKAFDWFKENI"
FT   gene            complement(359483..359953)
FT                   /locus_tag="RPR_02165"
FT   CDS_pept        complement(359483..359953)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_02165"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_02165"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47280"
FT                   /db_xref="GOA:C4K129"
FT                   /db_xref="InterPro:IPR002810"
FT                   /db_xref="UniProtKB/TrEMBL:C4K129"
FT                   /protein_id="ACR47280.1"
FT                   /translation="MINNYLTEIWLIIGIICIVVEFFTVPSIGFLFFGLGALSNTLVVY
FT                   NYPLVSLTNQITFFGILSLIWFCILYYPLKKYVYNKTDKTKNYSDMIGKTVEVYSATVS
FT                   SDIIGQVRWSGAIMNAYLVPNEIDAKTGNRLFIIEVKGNVLICSREKPNNNS"
FT   gene            complement(359943..360470)
FT                   /locus_tag="RPR_02170"
FT   CDS_pept        complement(359943..360470)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_02170"
FT                   /product="cytochrome c"
FT                   /note="COG3474 Cytochrome c2"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_02170"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47281"
FT                   /db_xref="GOA:C4K130"
FT                   /db_xref="InterPro:IPR002327"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:C4K130"
FT                   /protein_id="ACR47281.1"
FT                   /translation="MSGKELNKIVAAILFASLIAMMVGFVANILYKPTLELQHRGYSVA
FT                   VQESSENQNTTALEQAPVNIPELMKTANADNGREIAKKCLMCHSLDKDGPNKLGPHLWD
FT                   VAGRPKASIADYKYSPALSKLGGVWDDDSLFAFLHKPSSYAPGTKMSFAGISKPQDIAD
FT                   VILFLKTYVHDK"
FT   gene            360584..361615
FT                   /locus_tag="RPR_02175"
FT   CDS_pept        360584..361615
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_02175"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_02175"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47282"
FT                   /db_xref="GOA:C4K131"
FT                   /db_xref="UniProtKB/TrEMBL:C4K131"
FT                   /protein_id="ACR47282.1"
FT                   /translation="MSKKSRVRKIFNKLKSYWTSFRQSKIGKILFSNSLSYAVSIASIA
FT                   ITVSGLFTPISPIIIAVAVVSGVSVGIQAVNETLKVHDLRKLHKENNLLVHNRNAKIQQ
FT                   DYILSLEPSLKDILKNELYTPQTAGKDATQDKYELNVNKLKSTGRIFGNNLGGAANLAA
FT                   SIIKGASGNVLDILKATGYGVVTTASLIIDGLTEKEKIEIKAIFKLNINEEYKKQDTPI
FT                   YKNLEQLENYTKNQVLQTLALKKLITDKNYWSMNKDQKIQKFREIIGSFNFEIKRNGLE
FT                   EFFRENKITMDNSKESYVKDIKNVMNPFYENPSKAEGYNPLTKAMDQDKVNNAAIKRTK
FT                   SEN"
FT   gene            complement(361662..362537)
FT                   /gene="lpxC"
FT                   /locus_tag="RPR_02180"
FT   CDS_pept        complement(361662..362537)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lpxC"
FT                   /locus_tag="RPR_02180"
FT                   /product="UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine
FT                   deacetylase"
FT                   /note="COG0774 UDP-3-O-acyl-N-acetylglucosamine
FT                   deacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_02180"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47283"
FT                   /db_xref="GOA:C4K132"
FT                   /db_xref="InterPro:IPR004463"
FT                   /db_xref="InterPro:IPR011334"
FT                   /db_xref="InterPro:IPR015870"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/TrEMBL:C4K132"
FT                   /protein_id="ACR47283.1"
FT                   /translation="MPKMQQSTLLKPVSCYGIGVHSGKRTQLTIEPAKENTGIIFIRTD
FT                   ISSENNYIEASYFNVSDTLLSTTISNDHKVQISTIEHLMAALWGCSIDNAIIKIDGPEV
FT                   PIMDGSSKPFVFMIECAGKKLQNAPKKYLKILKDIKVVHKDCELYCTPSDHMTVDLTID
FT                   FSSKAIGRQNLSFRDQESFTKNIADARTFGFIRDVDYLKSKGLAQGASFENAIGIDEQD
FT                   KILNPNGLRYEDEFVRHKLLDLFGDLYTNGTSIVSAIKGYKTSHALNNELLHRIFSDTT
FT                   SYKFVTSSEL"
FT   gene            complement(362895..364043)
FT                   /locus_tag="RPR_02185"
FT   CDS_pept        complement(362895..364043)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_02185"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_02185"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47284"
FT                   /db_xref="GOA:C4K133"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C4K133"
FT                   /protein_id="ACR47284.1"
FT                   /translation="MTLKNDYKTIFFSLLGIFIFSCINAINFYNFKIFLLLNKNLGGEQ
FT                   INHINQTKFIGSIIAGFALTQLINKLSNQKIILISLSLLIICTINLILLNNYTLIKINF
FT                   IVINFGTFAYFTSITLDIIESSKEKKYFFLACIMLLWAGGNLMVDLLNPFITPTNNTIV
FT                   ICALLYCINILTEFLHYNPTSHKLNLNSKFSSLIKNVELQLLTGFVVAYVTLDILWYYE
FT                   AFALKKELALINLRLILKYIFLAICFSIIPICYILSKVNKYLANLSLTIILLVCFILLP
FT                   LHGTNKNLNILYIILIGSCLGSIYICNILILIDKFRDYELRTALFSYFSMCSIGTYAGA
FT                   LSSHVPYGTINGSDFLFSVFAVVGSFVAYHFWYFIKYTLYRF"
FT   gene            364470..366542
FT                   /locus_tag="RPR_02190"
FT   CDS_pept        364470..366542
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_02190"
FT                   /product="ribonuclease E"
FT                   /note="COG1530 Ribonucleases G and E"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_02190"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47285"
FT                   /db_xref="GOA:C4K134"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004659"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019307"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/TrEMBL:C4K134"
FT                   /protein_id="ACR47285.1"
FT                   /translation="MNKKIIIDANFPSETRVVLLGQSNNIEDIEFQTTVRQQNKGNIYL
FT                   AKVTRIEPSLQAVFIEYGMDKSGFLPFSEIHPNYYNLPTSERNFPVNAFPEIALSNITV
FT                   EDDKEKPAAIYDSLVDSEEIDLKTIEDLVESRFQSELNLEAADDIEMIQSGTPESNIPQ
FT                   YKQYKVQEVIRKNQILLVQVTKEERGNKCAAFTTYISLAGKYCVLMPNKGSQNGISRKI
FT                   SNGEERKRLKDILNKIVSGDKNAYSVIVRTAGRGSSTLDLKKDYNYLARLWNKIRKSTI
FT                   KFPAPCFIHEEDSIIRKTIRDMCDHNVKEVVIQGQEGYEDASKFMQDLLPSELVKLKEH
FT                   KSKTPIFTKFQVEEQLVKLYQPVVTLPSGGYMVINPTEALIAIDVNSGKSTSEQNIEET
FT                   ALKTNLEAAKEVAKQVKLRDLSGLIVVDFIDMSEAKNRKIIERSFKEFLSRDRARIQTG
FT                   NISQFGLLEFSRQRLRSSFLETNSAICSHCNGKGVIRASDANAMLILRTIENEIFEERI
FT                   DVINVFTNIVSVIYLLNNKRAEIKFIEEKYNIKLNFYSDPNATSDSYSIEKVKLFKKNN
FT                   NNFNSVKPVIQNHNADYTEEELKKEQLRKNKHKWKTANNSNNVANEVKDKSLEAEESVE
FT                   QTVSVVEEVKVVESNAGLEEAQAAPKKTKRRYRNKTSNKKCPSNTVEDTEKNAES"
FT   gene            366835..367803
FT                   /locus_tag="RPR_02195"
FT   CDS_pept        366835..367803
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_02195"
FT                   /product="cytochrome c oxidase assembly protein"
FT                   /note="COG1612 Uncharacterized protein required for
FT                   cytochrome oxidase assembly"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_02195"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47286"
FT                   /db_xref="GOA:C4K135"
FT                   /db_xref="InterPro:IPR003780"
FT                   /db_xref="InterPro:IPR023754"
FT                   /db_xref="UniProtKB/TrEMBL:C4K135"
FT                   /protein_id="ACR47286.1"
FT                   /translation="MVIATIVIGGITRLTGSGLSIVEWRPVTGILPPFSFESWQSEFAK
FT                   YKAFPEYNSVNYGITLSQFKFIYLLEFIHRLLGRITALIYIVPLIYFYFKDVIKNRDML
FT                   PYIIALLLFCVQGFIGWYMVKSGLLNSPYVSHFRLAFHLIIAVIIYHILFYQLIKNRCD
FT                   ILLIPSQTDFKLPLIFSGIAITVVYVQIFLGALVAGLDAGLIYNSFPLMDDRFIPMEIK
FT                   DNFFDLKNWYDPVFIQFIHRLVGYSVFLVVVVLIICLLKIEHPKLNKIAYFLMIALFMQ
FT                   VSTGIITLLYSVPIIIASIHQLFAIILLSIIIWCYFLIKSS"
FT   gene            367816..368727
FT                   /locus_tag="RPR_02200"
FT   CDS_pept        367816..368727
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_02200"
FT                   /product="hypothetical protein"
FT                   /note="COG0564 Pseudouridylate synthases, 23S RNA-specific"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_02200"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47287"
FT                   /db_xref="GOA:C4K136"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR006224"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:C4K136"
FT                   /protein_id="ACR47287.1"
FT                   /translation="MIIDVNTPISSRLDKYLKRLYPLLTQGVIEKALRQKQITVNSQKA
FT                   EASLRVKGGDKIFINDKFNLPVKQPEKLVFTDAEIKLATKITTDYLIYADDNLIAINKP
FT                   AGLATQGGTKINLSIDSALKYLNYKGTDFKLVHRLDKKTSGLLLIAKNYLSSVKLHDAF
FT                   KEKLVVKTYFAVTYGKPIKNVGEVRSNIEKSKGSTPKITDIDSENGKLAITYYKVLKSL
FT                   DNNLFLIEFTPVTGRMHQLRLHAKLLGCPILGDDKYGNKEIMPYSKYMFLHANNICLSE
FT                   KIFGQEIKLDAKLPFYFTRRLT"
FT   gene            368882..370063
FT                   /locus_tag="RPR_02205"
FT   CDS_pept        368882..370063
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_02205"
FT                   /product="penicillin-binding protein 4*"
FT                   /note="COG1680 Beta-lactamase class C and other penicillin
FT                   binding proteins"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_02205"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47288"
FT                   /db_xref="InterPro:IPR001466"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:C4K137"
FT                   /protein_id="ACR47288.1"
FT                   /translation="MMRRYFLLLLFFITNCIDCFADIQQRINEAEKEYISNRFLNAVFM
FT                   FADDYKPLLTGAKGIFALNGEQLKANEMMPIVSATKPFTAAGILKLQEQALLNINDKIY
FT                   KYLDPEMWGGKVPDWAYKISIHNLLTHSSGIAEYFSFVKLDLNMPKKEIHKKILQFVSS
FT                   KPLEISIGKKFKYSNTNFVILGMIIEKVAKKDLANFFYDEFFKPLNMKSTSFASYSEAA
FT                   RIQKNVISSNYPVRYFLTPNNSNKPIFTPVTADFLAVPCADGGIISTPVDLIRWYRALN
FT                   EEKILAKKSYKLMTTKYFLAQEIEGRKSYMGYGIFLTDLDSKRLMIHYTGKALGIQSEA
FT                   GYVVPDNLYFAILSNTMIKIPEEEKDKIDMKHPLNQLGIIYFRNTIIGAAIKN"
FT   gene            370210..371025
FT                   /locus_tag="RPR_02210"
FT   CDS_pept        370210..371025
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_02210"
FT                   /product="exodeoxyribonuclease III"
FT                   /note="COG0708 Exonuclease III"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_02210"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47289"
FT                   /db_xref="GOA:C4K138"
FT                   /db_xref="InterPro:IPR004808"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR020847"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="InterPro:IPR037493"
FT                   /db_xref="UniProtKB/TrEMBL:C4K138"
FT                   /protein_id="ACR47289.1"
FT                   /translation="MKIVTWNINSLRLRIDLLRKLAYEHQPDIILLQETKVADSLFPLE
FT                   VIKNIGYEHVIYSGQKSYNGVAIISKFPLNNVFSLELYNSDKRHIAAIVNDIEIHNFYV
FT                   PAGGDIPDIEVNTKFKHKLEYVRLMQEWLTTNRTKNDKMIIVGDLNIAPHEHDVWSSKQ
FT                   LRNVISHTDIERSLLVELQNALGFIDSSRHFVSLDEKFYTWWSYRNIDWKKSNRGRRLD
FT                   HIWVSDNLKGALFSMHLLSEARDWFSPSDHVPYFVTFNLQMSSRDQATG"
FT   gene            371048..372028
FT                   /locus_tag="RPR_02215"
FT   CDS_pept        371048..372028
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_02215"
FT                   /product="pyruvate dehydrogenase e1 component, alpha
FT                   subunit precursor"
FT                   /note="COG1071 Pyruvate/2-oxoglutarate dehydrogenase
FT                   complex, dehydrogenase (E1) component, eukaryotic type,
FT                   alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_02215"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47290"
FT                   /db_xref="GOA:C4K139"
FT                   /db_xref="InterPro:IPR001017"
FT                   /db_xref="InterPro:IPR017597"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:C4K139"
FT                   /protein_id="ACR47290.1"
FT                   /translation="MDIKLGKYKPTKEEYIKSFKDMLLLRRFEEKCGQLYGMGEIGGFC
FT                   HLYIGQEAVISAVDMVKQKGDSTITSYRDHAHIILAGTEPKYVLAELMGRATGCSKGKG
FT                   GSMHLFNVPNKFYGGHGIVGAQVPIGTGLAFAEKYNDTHNICFTFLGDGAVNQGQVYEA
FT                   FNMAALWGLPVVYIIENNEYSMGTSVARSTFMRDLYKKGASFGIKGFQLDGMDFEEMYD
FT                   GSKQAAEYVRENSFPLILEVKTYRYRGHSMSDPAKYRSKEEVEQYKERDPLVIIRKTIL
FT                   DNKYVTEADLKAIEQSVKEIVKEAVEFSENSPLPDEGELYTQVYC"
FT   gene            372189..373169
FT                   /locus_tag="RPR_02220"
FT   CDS_pept        372189..373169
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_02220"
FT                   /product="pyruvate dehydrogenase subunit beta"
FT                   /EC_number="1.2.4.1"
FT                   /note="COG0022 Pyruvate/2-oxoglutarate dehydrogenase
FT                   complex, dehydrogenase (E1) component, eukaryotic type,
FT                   beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_02220"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47291"
FT                   /db_xref="GOA:C4K140"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR027110"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/TrEMBL:C4K140"
FT                   /protein_id="ACR47291.1"
FT                   /translation="MQITVREALRDAMQEEMIRDDKVFVIGEEVAEYQGAYKVTQGLLE
FT                   RFGPKRVIDTPITEYGFAGLAVGAAFAGLRPIVEFMTFNFAMQAFDHIVNSAAKTHYMS
FT                   GGQVKCPIVLRGPNGAASRVAAQHSQNYTACYSHIPGLKVVAPYSAEDHKGLMLTAIRD
FT                   DNPVVFLENEILYGHSFDVPKTIEPIPFGQAKILREGSSVTIVTFSIQVKLALDAANVV
FT                   QNDNIDCEVIDLRTIKPLNTETIIESVKKTNRLVVVEEGWFFAGVGASIASIVMKEAFD
FT                   YLDAPIEIVSGKDLPLPYAVNLETLALPSESDVIEAVKKVCYYSI"
FT   gene            complement(373307..375136)
FT                   /locus_tag="RPR_02225"
FT   CDS_pept        complement(373307..375136)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_02225"
FT                   /product="GTP-binding protein"
FT                   /note="COG1217 Predicted membrane GTPase involved in stress
FT                   response"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_02225"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47292"
FT                   /db_xref="GOA:C4K141"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006298"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035651"
FT                   /db_xref="InterPro:IPR042116"
FT                   /db_xref="UniProtKB/TrEMBL:C4K141"
FT                   /protein_id="ACR47292.1"
FT                   /translation="MPSIRNIAIIAHVDHGKTTLVDNMLKQSGTFRANQAVAERAMDSN
FT                   DLERERGITILAKCTALMWNDIRINIVDTPGHADFGGEVERILSMVDGVVLLVDASEGP
FT                   MPQTKFVLSKALNLGLKPIVVINKIDRDDQRIKEVIAEVFELFVALEANNDQLDFPIVY
FT                   ASGRAGRASLTFDDKINPLDNLADDLAPLFDLIVQHVPKPLADDKAPFSMLVTTREYNS
FT                   FFGRVLTGRVQSGTVKINQNVKVLNRENKVLETGRITKILAFRGLERIAINDATAGDII
FT                   AVAGVENANVADTICSPEVTEAVPSLPIDPPTLSMTFSINDSPLAGSEGTKVTSSLIGA
FT                   RLMRELESNVALKVTEAAEKNAFQVAGRGELQLGILIETMRREGFELSISRPEVLFQTD
FT                   EKGNKQEPMEEIQVDVDDDYVGVVVKSLALRKAEMTDMRPSGGGKSRVTFIGPSRGLIG
FT                   YHSQFLTETRGTGIMNRIFHGYADYKGNIEGRRNGVLISNGDGAAVAYALWNLEERGKM
FT                   FINPSDKVYRGMIIGEHNRDNDLEVNPLKAKQLSNVRATGKDEAIRLTPPMLLTLEQAI
FT                   SYIQDDERVEVTPKSIRLRKALLDPNDRKRAAK"
FT   gene            376330..376815
FT                   /locus_tag="RPR_02245"
FT   CDS_pept        376330..376815
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_02245"
FT                   /product="Outer membrane protein H precursor"
FT                   /note="COG2825 Outer membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_02245"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47293"
FT                   /db_xref="GOA:C4K142"
FT                   /db_xref="InterPro:IPR005632"
FT                   /db_xref="InterPro:IPR024930"
FT                   /db_xref="UniProtKB/TrEMBL:C4K142"
FT                   /protein_id="ACR47293.1"
FT                   /translation="MPIKEDNFKVRVAVADVQSILEGSIAIKDLRNKIEKLNHKIQENI
FT                   AAKEAEFKPLEEKLLNERSHLSETEFEHKVNEFNAKVSHVRKEIQIKKTKLEQAHAEAM
FT                   SRVHETTITIISELAEKYNLNLVIPSAQVLYAKNNLNITSEVTFMLNERLKEVTINY"
FT   gene            376993..378444
FT                   /locus_tag="RPR_02250"
FT   CDS_pept        376993..378444
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_02250"
FT                   /product="isocitrate dehydrogenase"
FT                   /EC_number="1.1.1.41"
FT                   /note="COG0473 Isocitrate/isopropylmalate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_02250"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47294"
FT                   /db_xref="GOA:C4K143"
FT                   /db_xref="InterPro:IPR014273"
FT                   /db_xref="InterPro:IPR019818"
FT                   /db_xref="InterPro:IPR024084"
FT                   /db_xref="InterPro:IPR040978"
FT                   /db_xref="UniProtKB/TrEMBL:C4K143"
FT                   /protein_id="ACR47294.1"
FT                   /translation="MAEFTPITIAYGDGIGPEIMEAVLYILRKAEARIRLETIEVGEKL
FT                   YKKHYTSGISEESWESIQRTGIILKAPITTPQGGGYKSLNVTIRKTLQLFANIRPAVSF
FT                   HPFTRTLHPNLNLTIIRENEEDLYAGIEYRQTHNMYESMKLISHTGCEKIIRYAFEYAV
FT                   KNNRKKVMCLSKDNIMKFSDGVLHKVFNEIAKEYPQINNAHYIIDIGTARLATKPEIFD
FT                   VIVTSNLYGDIISDVAAEISGSVGLAGSANIGQHYAMFEAVHGSAPDIAGKDIANPSGL
FT                   LNAAIMMLVHIGQGDIATLIENAWKKTIEDGVHTADIYNEQSSSKKVGTKEFAEEVTKR
FT                   LGQLPTKLPKADYPLIAEKQESNIDYKIDTKEVKKLVGTDIFVNMNVSSAHDIADKIDK
FT                   LDLGNFELKTISSKGLKLWPRDTRFETVSDHWCCRFMNKDGTEIKHLDITRLLEALSTA
FT                   NIDFIKVENLFEFDGVAGYSLAQGE"
FT   gene            378559..378879
FT                   /locus_tag="RPR_02255"
FT   CDS_pept        378559..378879
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_02255"
FT                   /product="putative monovalent cation/H+ antiporter subunit
FT                   G"
FT                   /note="COG1320 Multisubunit Na+/H+ antiporter, MnhG
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_02255"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47295"
FT                   /db_xref="GOA:C4K144"
FT                   /db_xref="InterPro:IPR005133"
FT                   /db_xref="UniProtKB/TrEMBL:C4K144"
FT                   /protein_id="ACR47295.1"
FT                   /translation="MTLYYIGILLVIIGLFAIFSGIIGFFRFPDFYTKLHAASVIESFG
FT                   VPICLIGFACIEADIVNSVKLILAALLIFILNPVATHALGKASLFMKIRADSTVIARKI
FT                   TK"
FT   gene            378943..380016
FT                   /locus_tag="RPR_02260"
FT   CDS_pept        378943..380016
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_02260"
FT                   /product="putative monovalent cation/H+ antiporter subunit
FT                   B"
FT                   /note="COG1563 Predicted subunit of the Multisubunit Na+/H+
FT                   antiporter"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_02260"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47296"
FT                   /db_xref="GOA:C4K145"
FT                   /db_xref="InterPro:IPR007182"
FT                   /db_xref="InterPro:IPR025383"
FT                   /db_xref="UniProtKB/TrEMBL:C4K145"
FT                   /protein_id="ACR47296.1"
FT                   /translation="MTLNFNNHMTVKTALNFDLGNYLLNLIAFLLILISIKIIFAKDLL
FT                   NAVIAASVFSLLIGVSYLIMDAPDVAMTEAALGACLSTCVYLNLLRKLPSDLKNIERTN
FT                   IIPASLICLLFVVTLAYMGLELPNYGDDNAPIHMHSSKYYIENTSRDIGIPSFVAAILA
FT                   SYRGYDTLGETSVILIAGIAVLLIFSRKSDDAIPRLDLGISGHSRRYKIPWSSHGMTNP
FT                   IIKYITSFIIPYIILYSIYIQLNGESSPGGGFQAGVIFASSLIAYDLVYGNRKLSRYFP
FT                   PNVLVCIAVLGVAIYAIVGTISLFFNDNYLNYYSLTNFINDKLLAQHIAIVIVEIGIGL
FT                   TVAAIMYLIYNVFNNYE"
FT   gene            380009..380656
FT                   /locus_tag="RPR_02265"
FT   CDS_pept        380009..380656
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_02265"
FT                   /product="heme exporter protein B"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_02265"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47297"
FT                   /db_xref="GOA:C4K146"
FT                   /db_xref="InterPro:IPR003544"
FT                   /db_xref="UniProtKB/TrEMBL:C4K146"
FT                   /protein_id="ACR47297.1"
FT                   /translation="MNSLFVLIKRELIVQNRINNIIKYLVIFFLFCIISTVLINSERDI
FT                   NKFGLIFSVICLLISLIGFSSVIFKSDLEDGSLELLLSIVSHEKIILAKFFAIFISSTI
FT                   GLVFVLPIIYVLFDKTLLEIIFFFISVWMILVLSSSLVVLSGSVQCYFKKNANFVGTFI
FT                   MPLLIPNIIMTGLILQDNNLQLIFIMIGINLVFLPISFFLSSCLIKNIYNIT"
FT   gene            380731..381189
FT                   /locus_tag="RPR_02270"
FT   CDS_pept        380731..381189
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_02270"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_02270"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47298"
FT                   /db_xref="GOA:C4K147"
FT                   /db_xref="InterPro:IPR022714"
FT                   /db_xref="UniProtKB/TrEMBL:C4K147"
FT                   /protein_id="ACR47298.1"
FT                   /translation="MWQALRRLMAANPMGFFLWSIITKWYLIIAVASLITLYYTVLGLK
FT                   KIGFIDYFTETTVEILDTTKAVAQNCTTKLGPNWNRLVSFWNCLSDPGEYKHEEGTGAQ
FT                   VLEDEINKLTPKQADSVADAERPIINPYEARENPNNLNNTPSGSNNNH"
FT   gene            381211..381744
FT                   /locus_tag="RPR_02275"
FT   CDS_pept        381211..381744
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_02275"
FT                   /product="ubiquinol-cytochrome c reductase iron-sulfur
FT                   subunit"
FT                   /note="COG0723 Rieske Fe-S protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_02275"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47299"
FT                   /db_xref="GOA:C4K148"
FT                   /db_xref="InterPro:IPR005805"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR006317"
FT                   /db_xref="InterPro:IPR014349"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR019470"
FT                   /db_xref="InterPro:IPR019546"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:C4K148"
FT                   /protein_id="ACR47299.1"
FT                   /translation="MSDTEDNKNKQTTRRDFMVLTASSVAAIGAACTLWPLVDSLNPSA
FT                   DVLALSSIEVDLSNIAVGQTVTVKWQGKPVFITNRTPDKIAEARAVKMSELIDPEADEA
FT                   RVKAGHDNWLVTIGICTHLGCVPLANQGEYDGWFCPCHGSQYDSSGRVRRGPAPLNLAV
FT                   PPYTFISDKKIRIG"
FT   gene            381751..382947
FT                   /locus_tag="RPR_02280"
FT   CDS_pept        381751..382947
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_02280"
FT                   /product="cytochrome b"
FT                   /note="COG1290 Cytochrome b subunit of the bc complex"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_02280"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47300"
FT                   /db_xref="GOA:C4K149"
FT                   /db_xref="InterPro:IPR005797"
FT                   /db_xref="InterPro:IPR005798"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="InterPro:IPR027387"
FT                   /db_xref="InterPro:IPR030689"
FT                   /db_xref="InterPro:IPR036150"
FT                   /db_xref="UniProtKB/TrEMBL:C4K149"
FT                   /protein_id="ACR47300.1"
FT                   /translation="MNEDITPKKPNAIIEWIDYRLPIFAFLKHFSHYQTPKNLSYLWNL
FT                   GSIAGIALVIQIITGVILAMHYTPHVDYAFDSVERIMRNVNYGWLLRYTHAVGASMFFA
FT                   AVYLHIARGLYYGSYKAPRELLWHIGIIIFLTMMATAFMGYVLPWGQMSYWGATVITNL
FT                   FSAIPLIGEFIVTWLWGGFSVDNPTLNRFFSLHYLLPFIIVALVMLHLVALHQHGSNNP
FT                   KGIDVKSPKDTIPFHPYYTVKDFVGFGVYFIIFAYFIFYEPNYLGHPDNYIPANPLVTP
FT                   AHIVPEWYFLPFYAILRAVPSKLGGVLLMFGSIFVLFLLPWLDTSKVRSSNYRPIHRMA
FT                   FWIFMADCLLLGYLGGQPAEEPYITISRFAACYYFFHVLVALPLIGKYEKPLPLPEEL"
FT   gene            383450..384205
FT                   /locus_tag="RPR_02285"
FT   CDS_pept        383450..384205
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_02285"
FT                   /product="cytochrome c1, heme protein precursor"
FT                   /note="COG2857 Cytochrome c1"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_02285"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47301"
FT                   /db_xref="GOA:C4K150"
FT                   /db_xref="InterPro:IPR002326"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR021157"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:C4K150"
FT                   /protein_id="ACR47301.1"
FT                   /translation="MKTKLLISIIILLTSCLSLANEEVLHPKKMKWSFDGVFGTVNREA
FT                   AQRGFQVYKEVCSVCHGLNNLYYRNLKDIGFSDDEIKEIAKGYIIQDGPNDDGEMFDCP
FT                   ALLSDRFVPPYPNEQAARAANNGAHPPDLSLIIKARHDGANYIYSLLTGYTEPPADFKL
FT                   MQGTHYNPYFPGEQIAMPPPLTDGQVTYMDGTNASVEQMSQDIVVFLQWAAEPEMEHRK
FT                   SMGLKVMMFLAVFTIFFYIAKNRIWSNLK"
FT   gene            384994..385497
FT                   /locus_tag="RPR_02300"
FT   CDS_pept        384994..385497
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_02300"
FT                   /product="small heat shock protein"
FT                   /note="COG0071 Molecular chaperone (small heat shock
FT                   protein)"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_02300"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47302"
FT                   /db_xref="InterPro:IPR002068"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="InterPro:IPR031107"
FT                   /db_xref="UniProtKB/TrEMBL:C4K151"
FT                   /protein_id="ACR47302.1"
FT                   /translation="MLKSVRLYIPSIAAMILSSNIAIANKNYDSGNATPLRQVADLIDN
FT                   QITNIDNLFKNRLPLYESNSIKSNFITKDKQYIIVMEVPGFDKSQIKVKVNGNKLFITG
FT                   NIEEKNKADDSDNYMNKNFNYVISLYEDVDQANISSSLKNGILTIILPRIEIKEQEARE
FT                   IVID"
FT   misc_feature    complement(385508..386339)
FT                   /note="authentic frameshifts in hypothetical rickettsial
FT                   gene"
FT   misc_feature    complement(386368..387388)
FT                   /note="authentic frameshift in gene for COG4804
FT                   Uncharacterized conserved protein, Predicted nuclease of
FT                   restriction endonuclease-like fold [General function
FT                   prediction only] and DUF 1016 superfamily member"
FT   gene            complement(387398..388255)
FT                   /gene="prfB"
FT                   /locus_tag="RPR_02325"
FT   CDS_pept        complement(387398..388255)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prfB"
FT                   /locus_tag="RPR_02325"
FT                   /product="peptide chain release factor 2"
FT                   /note="COG1186 Protein chain release factor B"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_02325"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47303"
FT                   /db_xref="GOA:C4K152"
FT                   /db_xref="InterPro:IPR000352"
FT                   /db_xref="InterPro:IPR004374"
FT                   /db_xref="InterPro:IPR005139"
FT                   /db_xref="UniProtKB/TrEMBL:C4K152"
FT                   /protein_id="ACR47303.1"
FT                   /translation="MAEAENDLETLSQIEQDLKNLSIIAAKFETECLFSGEADGNNCFL
FT                   EINAGAGGTESHDWASIMMRMYLRFAERLGFKTEIINMINGEEAGIKSCTIRIIGKRAY
FT                   GWFKTEAGVHRLVRISPFNAAGKRMTSFASSWVYPEIDDNIAIIIEDKDLRIDTFRASG
FT                   AGGQHVNTTDSAVRITHIPTGMVTQCQSDRSQHKNKAQAMKMLQAKLYELEMQKRTDSV
FT                   NEQNAAKTDNSWGHQIRSYVLQPYQMVKDLRTDYETSDTKGVLDGDLEEFVSANLAMNA
FT                   GGKK"
FT   gene            388623..390425
FT                   /locus_tag="RPR_02330"
FT   CDS_pept        388623..390425
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_02330"
FT                   /product="GTP-binding protein LepA"
FT                   /note="COG0481 Membrane GTPase LepA"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_02330"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47304"
FT                   /db_xref="GOA:C4K153"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006297"
FT                   /db_xref="InterPro:IPR013842"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035654"
FT                   /db_xref="InterPro:IPR038363"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4K153"
FT                   /protein_id="ACR47304.1"
FT                   /translation="MNHQKYIRNFSIIAHIDHGKSTLADRLIEHCGGLQAREMSQQVLD
FT                   SMDIEKERGITIKAQTVRLVYKAKDGNTYYLNLMDTPGHVDFAYEVSRSLAACEGSLLV
FT                   VDSTQGVEAQTLTNVYQAIENDHEIVLVLNKLDLPASEPEQVKQQIEDIIGIDTSEAVL
FT                   ISAKSGIGIDLVLEAIVNKLPPPKESSSDILKALLVDSWYDPYLGVVILVRVIDGYLRK
FT                   NMRIKMMATNSVYNVENVGYFTPKKHISDVLHAGAIGFFTAAIKQVADCKVGDTITDEK
FT                   KPCEQALPGFKPNLPVVFCGLYPTDSSEFEHLKDSLAKLRLNDASFEYEMESSSALGVG
FT                   FRCGFLGLLHLEIIQERLSREFDLDLITTAPSVVYKIHMRDGENLEIHNPADLPDLQKI
FT                   ESMEEPWIKATIMVPDEFLGAVLSLCTEKRGMQLDHSYIANRAKIIYKLPLNEIVYDFY
FT                   DRLKSCSKGYASFEWQMDVYEPSELVKLGILVNAEVVDALSTIVHRSRAEQRGRALCVR
FT                   LKDLIPRQQIDIAIQASIGSRIIARETIKALRKDVLSKCYGGDISRKRKLLEKQKAGKK
FT                   RMRQYGNIEIPQSAFIAALKIGDE"
FT   gene            390517..390591
FT                   /locus_tag="RPR_t07788"
FT   tRNA            390517..390591
FT                   /locus_tag="RPR_t07788"
FT                   /product="tRNA-Asn"
FT   gene            390727..391821
FT                   /locus_tag="RPR_02340"
FT   CDS_pept        390727..391821
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_02340"
FT                   /product="transposase ISRpe1"
FT                   /note="COG2801 Transposase and inactivated derivatives"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_02340"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47305"
FT                   /db_xref="GOA:C4K120"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:C4K120"
FT                   /protein_id="ACR47305.1"
FT                   /translation="MNLNQKIIKPKIGLLELAKSLGSISSACKAMGYSRDSYYRFKALY
FT                   ETGGEEALYEISRRKPIIANRVDPAIEKAVMDMAIEYPAYGQLRVSNELKKSGILVSPG
FT                   GVRSIWLRNDLNNISKRLKALEAKMAQDGIVLTESQLQVLEERRNEREAHGETETQHPG
FT                   YLGCQDTYYVGNFKGIGKVYSQVFIDSYTRVADAKLYTDKTALTAADMLNDRVLPWYET
FT                   QGIPILRILTDRGSEYKGNIEHHAFELFLSIEGIEHTTTKTYSPQTNGMCERFNKTMKQ
FT                   EFFYTAMRKKIYTDLDDLQLDLDIWLEHFNNERPHSGKYCYGKTPMQTFKDSRKLAVEK
FT                   NNEILYLEYVSDSQNVTDNQVQNL"
FT   gene            392166..394739
FT                   /locus_tag="RPR_02350"
FT   CDS_pept        392166..394739
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_02350"
FT                   /product="clpB protein"
FT                   /note="COG0542 ATPases with chaperone activity, ATP-binding
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_02350"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47306"
FT                   /db_xref="GOA:C4K155"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004176"
FT                   /db_xref="InterPro:IPR017730"
FT                   /db_xref="InterPro:IPR018368"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028299"
FT                   /db_xref="InterPro:IPR036628"
FT                   /db_xref="InterPro:IPR041546"
FT                   /db_xref="UniProtKB/TrEMBL:C4K155"
FT                   /protein_id="ACR47306.1"
FT                   /translation="MNIDKFTAHAKSVIASSQSLAAKNDHQQILPLHLLSSLLSEETGI
FT                   IQTLINNTGGNINLLKDQVQLELNKIPKVQVEGGGQVYSSAEALKVLEKASSIAKNSGD
FT                   SFVTIERIFEALTYDNTIAGKILTNNGINNKKIATAILQFRKGKKADTESAENSYDALK
FT                   KYGRDVTELAESGKLDPIIGRDEEIRRTVQVLSRRMKNNPVLIGEPGVGKTAIIEGLAQ
FT                   RIFSKDVPESLINCRIIELDMGALIAGAKYRGEFEERLKAVLSEIKESSGEIILFIDEL
FT                   HLLVGTGKTDGAMDASNLLKPMLARGELHCIGATTLDEYRKYIEKDAALARRFQPVYVS
FT                   EPTVEDTISILRGIKEKYELHHAVRISDSAIVAAATLSNRYITDRYLPDKAIDLIDEAC
FT                   SRMKIELSSKPEELDELDRRIIQIKIELAALKNENDEHSKKKIEHLTTALEKLESKSYD
FT                   MGAKWQAEKSKLQQTQKLKEELDRSRNELERAERDANLAKASELKYGIIPEIMKKIQEA
FT                   ESMDNKGLLKEIVSESDIASIISRITGIPIDTMLSSERERLLVMEQKLRESVIGQDKAI
FT                   KGVSDAVRRSRAGIQDINRPLGSFLFLGPTGVGKTELTKALAGFLFDDRNAILRIDMSE
FT                   YMEKHAISRLIGAPPGYIGYDQGGVLTEAVRRRPYQVILFDEVEKAHPDIFNIMLQILD
FT                   EGRLTDSQGITVDFKNTIIVLTSNLGAEILVNQKEDEDTYKVKDEVMEYVKAVFKPEFL
FT                   NRLDEIILFHRLNCNNIHDIVKIQLESLKKILLAQNIILEFDESALNYLAEKGYDPSFG
FT                   ARPLKRLIQREIQNNLAKMILAGEISSGKTIKINAKDKELKVTMS"
FT   gene            complement(394980..395471)
FT                   /locus_tag="RPR_02355"
FT   CDS_pept        complement(394980..395471)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_02355"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_02355"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47307"
FT                   /db_xref="InterPro:IPR035354"
FT                   /db_xref="UniProtKB/TrEMBL:C4K156"
FT                   /protein_id="ACR47307.1"
FT                   /translation="MSNSNYENIYKAFNCFSEATNSAYSAVNTFLELPNVFNKYPTVIS
FT                   LIFSKTATLDSNITNIIKNGVIIYEISTALIGAVNTFYKDKKLVDKILKDGQNAIDKLI
FT                   ETTTYLSPIVTDITNSYLVDPYKEEKALLFDLQIPNSTSSDYYKLSGTESITLAEIEYY
FT                   "
FT   gene            complement(395598..396632)
FT                   /locus_tag="RPR_02360"
FT   CDS_pept        complement(395598..396632)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_02360"
FT                   /product="O-sialoglycoprotein endopeptidase"
FT                   /note="COG0533 Metal-dependent proteases with possible
FT                   chaperone activity"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_02360"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47308"
FT                   /db_xref="GOA:C4K157"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR017860"
FT                   /db_xref="InterPro:IPR017861"
FT                   /db_xref="InterPro:IPR022450"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4K157"
FT                   /protein_id="ACR47308.1"
FT                   /translation="MIKILGIESSCDDTAVSIITENREILSNIIISQNTEHAVFGGVVP
FT                   EIAARSHLSHLDKALKNVLKESNTKLTDISTIAATSGPGLIGGVIVGSMFARSLSSALK
FT                   KPFIAINHLEGHALTARLTDNIPYPYLLLLASGGHCQFVAVLGLGKYKILGSTIDDAVG
FT                   EAFDKVAKMLNLAFPGGPEIEKRAKLGDPHKYKFPKPIINSGNCNMSFSGLKTAVRTLI
FT                   INLKEINDTVINDIAASFQFTIGEILSSKVQDAIRAYEQITNNFDKKNIVIAGGVAANK
FT                   YLQKILSSCAKTYGYRLIYPPIHLCTDNAAMIAYAGLERYNNKLFTPLNFCPKARWSLE
FT                   DISN"
FT   gene            complement(396815..398008)
FT                   /locus_tag="RPR_02365"
FT   CDS_pept        complement(396815..398008)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_02365"
FT                   /product="acyl-CoA desaturase"
FT                   /note="COG1398 Fatty-acid desaturase"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_02365"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47309"
FT                   /db_xref="GOA:C4K158"
FT                   /db_xref="InterPro:IPR005804"
FT                   /db_xref="InterPro:IPR015876"
FT                   /db_xref="UniProtKB/TrEMBL:C4K158"
FT                   /protein_id="ACR47309.1"
FT                   /translation="MLSKLNKSALFALIFYPIFIISLVVKYSFDYGIGLTEVIFIIASY
FT                   YINNITVGIGLHRLWSHNAYKINKYAEFVLIMLSAGTLQGPALSWASNHYKHHRYTDQD
FT                   QDPHTPLKFDNKFLGFMWSHIGWMLVGSGSYKSIDRITWAKHGKNNLLKWQLKYYWQIA
FT                   AFMNIVVPLFIGYLVGGTMQSAYAGFLFMGLGRFLQQQATFCVNSLCHFAGSKKYYKGT
FT                   AGDIWWMALFLLGENWHNYHHAFPSDYRNGAKWYHLDIHKWIIFLMSKIGLASELERTT
FT                   KVRIQAKMQETLSYLSEKQKQKLTLMQTKIDHLLENLCLKIKELEESSITIKEQFKKSF
FT                   VEIQESLKNLAEQVSAATQITEKSSEKLLKIVNKKIIDAEQSIYKLYNQLNTLKVSN"
FT   gene            398963..399328
FT                   /gene="rpsF"
FT                   /locus_tag="RPR_02375"
FT   CDS_pept        398963..399328
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsF"
FT                   /locus_tag="RPR_02375"
FT                   /product="30S ribosomal protein S6"
FT                   /note="COG0360 Ribosomal protein S6"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_02375"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47310"
FT                   /db_xref="GOA:C4K159"
FT                   /db_xref="InterPro:IPR000529"
FT                   /db_xref="InterPro:IPR014717"
FT                   /db_xref="InterPro:IPR020814"
FT                   /db_xref="InterPro:IPR035980"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4K159"
FT                   /protein_id="ACR47310.1"
FT                   /translation="MSFYESVFIIRQDVSLNDIDKIVDDFAKIIKDNNGTIIKKEYWGL
FT                   RTLAYKIGNNKKGHYYFLGLDITGNVKEELERKMKLNENIIRFLTIQADSISSEPSPIL
FT                   KNQSTENAPVIDVTINN"
FT   gene            399353..399640
FT                   /gene="rpsR"
FT                   /locus_tag="RPR_02380"
FT   CDS_pept        399353..399640
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsR"
FT                   /locus_tag="RPR_02380"
FT                   /product="30S ribosomal protein S18"
FT                   /note="COG0238 Ribosomal protein S18"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_02380"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47311"
FT                   /db_xref="GOA:C4K160"
FT                   /db_xref="InterPro:IPR001648"
FT                   /db_xref="InterPro:IPR018275"
FT                   /db_xref="InterPro:IPR036870"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4K160"
FT                   /protein_id="ACR47311.1"
FT                   /translation="MLKSNNASETAAHKVGDKTAKKVFFRRRKGCPLSVSNAPVIDYKN
FT                   PELLIKFVSEGGRMLPSRITNVCAKKQRKLNNAIKIARILALLPFVFQAK"
FT   gene            399652..400167
FT                   /gene="rplI"
FT                   /locus_tag="RPR_02385"
FT   CDS_pept        399652..400167
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplI"
FT                   /locus_tag="RPR_02385"
FT                   /product="50S ribosomal protein L9"
FT                   /note="COG0359 Ribosomal protein L9"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_02385"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47312"
FT                   /db_xref="GOA:C4K161"
FT                   /db_xref="InterPro:IPR000244"
FT                   /db_xref="InterPro:IPR009027"
FT                   /db_xref="InterPro:IPR020069"
FT                   /db_xref="InterPro:IPR020070"
FT                   /db_xref="InterPro:IPR020594"
FT                   /db_xref="InterPro:IPR036791"
FT                   /db_xref="InterPro:IPR036935"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4K161"
FT                   /protein_id="ACR47312.1"
FT                   /translation="MEIILIKPVRKLGKIGDILKVADGFGRNYLLPQKLAIRATEPNKE
FT                   LIVKQKHEFEAKDKQIREEVEKINALIKDQQLVFIRQTSNDGKLFGSVTNKEIADKLSE
FT                   NISYNISHSNIILDKQIKSTGIYTVEIRLHAELNAIVTVIVARSESEAQDYLREQKTET
FT                   SEDLAESA"
FT   gene            400470..402071
FT                   /locus_tag="RPR_02390"
FT   CDS_pept        400470..402071
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_02390"
FT                   /product="tRNA(Ile)-lysidine synthetase"
FT                   /note="COG0037 Predicted ATPase of the PP-loop superfamily
FT                   implicated in cell cycle control"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_02390"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47313"
FT                   /db_xref="GOA:C4K162"
FT                   /db_xref="InterPro:IPR005728"
FT                   /db_xref="InterPro:IPR011063"
FT                   /db_xref="InterPro:IPR012094"
FT                   /db_xref="InterPro:IPR012795"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4K162"
FT                   /protein_id="ACR47313.1"
FT                   /translation="MLYEKFEYNINNLIGNFGLSKMSIAVSGGSDSVALLYLANIWAEK
FT                   NNIELFVISVDHNLREQSKQETHYIQNISNSLNRKHYSLSFDHQNNFSNLQERAREGRY
FT                   DLMTNLCLELDILVLLTAHHEDDYVENFCLRLERNSGIFGLSSSNINWYNNIHIIRPLY
FT                   NIPKSELVEYLVSHNIKWFEDESNSSDKYRRNVIRQKLAKGADYIRHFSKPVYREEFKG
FT                   DTERSTAAYTSVGEEALLRGPVKLTVSSRGLTTVKTIKSTNNFSIFNWIPWSSHGMTEV
FT                   KLIHATMPREDASTGTASKLSLEAKCGKMSKAAIISQQLKTNKRIENEFKPELISAIAE
FT                   AVKIFEYGFAFLDLVKFDKFSNEVKVQIINFLLIIISGQSRAARFYSVEPILKLITQDV
FT                   NFKNTLHGCIIKRIQNELLIYREFGKKLPESKILLDKSVIWDNRFCITKNQETPNCFVT
FT                   HLSLKDYKIIKKQLDLEPLKNLSCKNHNAVLLTLPIIKILEKVIAIPHISYYDNDMWNF
FT                   EVSFSPNFVSRFTHFC"
FT   gene            402172..404085
FT                   /locus_tag="RPR_02395"
FT   CDS_pept        402172..404085
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_02395"
FT                   /product="cell division protein ftsH"
FT                   /note="COG0465 ATP-dependent Zn proteases"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_02395"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47314"
FT                   /db_xref="GOA:C4K163"
FT                   /db_xref="InterPro:IPR000642"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR005936"
FT                   /db_xref="InterPro:IPR011546"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037219"
FT                   /db_xref="InterPro:IPR041569"
FT                   /db_xref="UniProtKB/TrEMBL:C4K163"
FT                   /protein_id="ACR47314.1"
FT                   /translation="MNNQGRSILAWAALFIFVILLFNVFQSDGLLGGRNNITFSDFLTR
FT                   VDEKTVNSVKIQGRVIEGTSNDGSTFNTYAPDYPDLVNRLTSNDVNIEVVPLETRMNTF
FT                   LGFLISWFPMLLLIGVWFFFMRQMHGGGKAMGFGKSKARLLSDKGPKITFKDVAGIDEA
FT                   KEELTEIVDFLRDPSKFQKLGGKIPKGCLLIGPPGTGKTLLAKAIAGEANVPFFSISGS
FT                   DFVEMFVGVGASRVRDMFEQGKRNAPCIIFIDEIDAVGRHRGIGMGGGNDEREQTLNQM
FT                   LVEMDGFETNEGVVIIAATNRPDVLDRALLRPGRFDRQIAVANPDINGREQILKVHLKK
FT                   IKYNSTVLARIIARGTPGFSGAELANLVNEAALIAARLGKKEVDMHDMEEAKDKVLMGV
FT                   ARRSIAMSEKEKRLTAYHEGGHALVGLYCPAASPIHKATIIPRGNALGMVQRLPETDEY
FT                   SQNREQMESSIAVYMAGRVAEEIIFGRNKVTSGASSDIKGATNIARAMVTKAGLSDLIG
FT                   PIFHGSSGDDMYGRQPNNETSEATAELIDAEVKRIITQGYEFAKDILTKHIDQLHTLAN
FT                   ALIEYETLSGQQIKNLLSGRVLDSEEENKFPFNDSSTIKIDKEKSPEKTKITKAKKENY
FT                   AS"
FT   gene            404903..405688
FT                   /gene="sdhB"
FT                   /locus_tag="RPR_02410"
FT   CDS_pept        404903..405688
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sdhB"
FT                   /locus_tag="RPR_02410"
FT                   /product="succinate dehydrogenase iron-sulfur subunit"
FT                   /EC_number="1.3.99.1"
FT                   /note="COG0479 Succinate dehydrogenase/fumarate reductase,
FT                   Fe-S protein subunit"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_02410"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47315"
FT                   /db_xref="GOA:C4K164"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR004489"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR025192"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:C4K164"
FT                   /protein_id="ACR47315.1"
FT                   /translation="MAELRLPPNSVVKKGREHKEQGEMLKPRKIKIYRYDPNLDKNPTI
FT                   DSFEIDLSKTGPMVLDALIKIKNEIDSTLTFRRSCREGICGSCAMNIDGTNTLACIKPI
FT                   EDISGDIKIYPLPHMKVVKDLVPDMSHFYAQYESIEPWLKTDSPTPSNSERLQSIKDRE
FT                   KLDGLYECILCACCSTSCPSYWWNGDKYLGPAILLQAYRWIADSRDDNTGERLEALEDP
FT                   FKLYRCHTIMNCTKTCPKGLNPAKAIGKIKSLIAERHGV"
FT   gene            complement(406262..407482)
FT                   /locus_tag="RPR_02415"
FT   CDS_pept        complement(406262..407482)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_02415"
FT                   /product="hypothetical protein"
FT                   /note="COG1565 Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_02415"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47316"
FT                   /db_xref="InterPro:IPR003788"
FT                   /db_xref="InterPro:IPR005728"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR038375"
FT                   /db_xref="UniProtKB/TrEMBL:C4K165"
FT                   /protein_id="ACR47316.1"
FT                   /translation="MSIESKIRQLIDQNGYITCDVLMQEVLNLNPTSYYKQVKSLANEG
FT                   DFVTAPEISQLFGEIIGLWCIREWQRIGCPKSLSLVELGPGRGLLMRDLLRTAKLVPEF
FT                   YKALSIELIEINKNFIAYQKANLQDINLPISHQSFVEDIPKKPTIIIANEFFDAIPIKQ
FT                   YIKVKELWYERIFVVQPVDERIKYDKISVNKQLQEYLLCTHIEAKDGAVLEESYKSIEI
FT                   IKFIAQHLKRLSGSGLIIDYGYDIAPNGRTRYQYNQTLQAVKNHKYCPTLENLGEADLS
FT                   AHVDFYALKTVAKNSKINVIDTISQRDFLIENGILLRKQTLQDKLNDRHLAKFAYREEF
FT                   KGDTKRSTAAYTLVREDASIGSTYKLPLEVEFGKMYEQAQIIERQVERLISPKQMGELF
FT                   KVLQIMN"
FT   gene            complement(407461..408240)
FT                   /locus_tag="RPR_02420"
FT   CDS_pept        complement(407461..408240)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_02420"
FT                   /product="prolipoprotein diacylglyceryl transferase"
FT                   /note="COG0682 Prolipoprotein diacylglyceryltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_02420"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47317"
FT                   /db_xref="GOA:C4K166"
FT                   /db_xref="InterPro:IPR001640"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4K166"
FT                   /protein_id="ACR47317.1"
FT                   /translation="MTFPNINPIIFSIGPLAISWYSLSYVIGILLGWFYANKIIEKFKP
FT                   QITKKNLEDFITYAVIGIIVGGRLGFVLLYNPSRYFSNPIDILKTYEGGMSFHGGALGG
FT                   IIAAYLFCRKYKINFLSFTDIIAPVVPIGLFLGRIANFINGELYGRITNASFGMIFPNS
FT                   DLMPRHPSQLYEAFFEGLVLFSILAHATFKHKTLKKCGLNSGIFFTFYGLFRITIEIFR
FT                   EPDIQIGFILDSLTMGQILSVPMLLLGSYLICQSNPK"
FT   gene            408485..409648
FT                   /locus_tag="RPR_02430"
FT   CDS_pept        408485..409648
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_02430"
FT                   /product="hypothetical protein"
FT                   /note="COG0668 Small-conductance mechanosensitive channel"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_02430"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47318"
FT                   /db_xref="GOA:C4K167"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR023408"
FT                   /db_xref="InterPro:IPR030192"
FT                   /db_xref="UniProtKB/TrEMBL:C4K167"
FT                   /protein_id="ACR47318.1"
FT                   /translation="MQYLMDLYHTSSTELVLLFVMLVSLIPVIFLIKRLIFIPVKNYLT
FT                   RHHYDDYERIKKYPIFRYLLHTLLALYFVCWGKIFHPTSFKAHVLLGIKDTIVILYTGI
FT                   SVTMLLLTLIDAFADLYHNRIKAVTKNAPLSLYFQILKIIVIVIAAMVTISYILNISLS
FT                   TFLTSLGAAAALLTFVFKDTVLGLLASLQLTTQEIINIGDWVRIGAIEGTVEKITISVV
FT                   TIRNFDQSISTVPTYSILNSNVTNYRGISESRARRVKRVFNINMATINFCDATILKALK
FT                   KSPYISKDVIDKITLDKEEKDLTNIKLFKLYIQEYLKNNPAVYTEGFTFLVRQLEPTIN
FT                   GLPIEIYIFVKEVNLVGYENIQDNISEHFISILPEFKLKIFQNVGVV"
FT   gene            409840..411522
FT                   /locus_tag="RPR_02435"
FT   CDS_pept        409840..411522
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_02435"
FT                   /product="putative inner membrane protein translocase
FT                   component YidC"
FT                   /note="COG0706 Preprotein translocase subunit YidC"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_02435"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47319"
FT                   /db_xref="GOA:C4K168"
FT                   /db_xref="InterPro:IPR001708"
FT                   /db_xref="InterPro:IPR019998"
FT                   /db_xref="InterPro:IPR028053"
FT                   /db_xref="InterPro:IPR028055"
FT                   /db_xref="InterPro:IPR038210"
FT                   /db_xref="InterPro:IPR038221"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4K168"
FT                   /protein_id="ACR47319.1"
FT                   /translation="MNNNIINLIAAIILSLSIIFGWQYFVVKPEQKKQQQQIAVQKAEN
FT                   LKKQQLKALVEPATGIVVQEESQVQRIKIESESLTGSVSLKGLRFDDLILKKYKQDLSK
FT                   NSPEVRLFSPANTENAYFAEVGLVSNLSSVKLPNNDTIWNSDSEILSPEKPVHLFWVNE
FT                   DGVKFLVTITVDENYLFTIEQTIVNNSDKELPVQSYGLINRKYIAVEKAVNILHQGPIG
FT                   CIDENLKEYSYDDIKDKKSEKFAASKVDWIGITDKYWLSSLIPDKSSNYSSNFNYALKQ
FT                   GTERYQVDFISPVQIIKPGENFSIKSRIFAGAKKVDLLDKYEKQYDIKLFDRAIDFGWF
FT                   YIITKPVFYAMNFFYGYVGNFGVSILIVTVIIKLLMFTLANKSYRSMKKMKNLQPEIDR
FT                   IKNLYSDDKARLNQEIMALYKKEKVNPVAGCLPILVQIPVFFSIYKVLYVTIEMRQAPF
FT                   YGWIKDLSAPDPTTIFNLFGLLPFSPPSFLMIGAWPILMAITMFLQQKMSPEPADPMQA
FT                   QVMKFMPLIFLFMFSSFPVGLLIYWSWNNILSIIQQYYINKFN"
FT   gene            411526..412071
FT                   /locus_tag="RPR_02440"
FT   CDS_pept        411526..412071
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_02440"
FT                   /product="CDP-diacylglycerol--glycerol-3-phosphate
FT                   3-phosphatidyltransferase"
FT                   /note="COG0558 Phosphatidylglycerophosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_02440"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47320"
FT                   /db_xref="GOA:C4K169"
FT                   /db_xref="InterPro:IPR000462"
FT                   /db_xref="InterPro:IPR004570"
FT                   /db_xref="UniProtKB/TrEMBL:C4K169"
FT                   /protein_id="ACR47320.1"
FT                   /translation="MRIDKNLPNYLTIARIMVIPVIILVFYINNSLARTLGALLFVLAS
FT                   ITDFFDGYIARKYNLVTSFGKMFDPIADKLLVGCVIIMLLKKDNVDEIPCLLILAREFL
FT                   VSGLREFLALVKVSVPVSRLAKVKTFLQMFALSILILGSKGSGIIYLDIVGEIILWIAA
FT                   FLTIITGYSYFKACKKYF"
FT   gene            412085..412639
FT                   /locus_tag="RPR_02445"
FT   CDS_pept        412085..412639
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_02445"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_02445"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47321"
FT                   /db_xref="GOA:C4K170"
FT                   /db_xref="InterPro:IPR036874"
FT                   /db_xref="UniProtKB/TrEMBL:C4K170"
FT                   /protein_id="ACR47321.1"
FT                   /translation="MIHVKYIILGFIMVSSLNLYAANNDIIANKKVVKVEVSNEYLKTL
FT                   NEASTLLISCVDFRLIDETDKLMKQLGLEDNFDKVSLPGASLALINDKYTYWGKTIEDT
FT                   IEILQELHNIKQIVFLDHRECGAYKILIGQEQLNTKEKETAAHAAILNKARDIIKEKFP
FT                   QLKVYTFLMGLDGVVEQIYEI"
FT   gene            complement(412814..413197)
FT                   /locus_tag="RPR_02450"
FT   CDS_pept        complement(412814..413197)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_02450"
FT                   /product="hypothetical protein"
FT                   /note="putative prokaryotic lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_02450"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47322"
FT                   /db_xref="UniProtKB/TrEMBL:C4K171"
FT                   /protein_id="ACR47322.1"
FT                   /translation="MIKKIIFGIAIFLSTSCFANSTTSDGSKKDAAKTNDVTTQKIIDD
FT                   FSAYAGTIKPEVREEIQKYRVAIVKINKKKRELYNRLSKEAQNFLAEQQKYKQKLSISK
FT                   LPVENDQKNNTADSNDNKSKDTK"
FT   misc_feature    413417..414056
FT                   /note="authentic internal stop codon and frameshift in
FT                   tellurite resistance protein-related gene"
FT   misc_feature    414158..415245
FT                   /note="authentic internal frame shifts and internal stop
FT                   codon in hypothetical rickettsial gene"
FT   gene            complement(415312..415986)
FT                   /locus_tag="RPR_02485"
FT   CDS_pept        complement(415312..415986)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_02485"
FT                   /product="peptide deformylase"
FT                   /note="COG0242 N-formylmethionyl-tRNA deformylase"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_02485"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47323"
FT                   /db_xref="GOA:C4K172"
FT                   /db_xref="InterPro:IPR023635"
FT                   /db_xref="InterPro:IPR036821"
FT                   /db_xref="UniProtKB/TrEMBL:C4K172"
FT                   /protein_id="ACR47323.1"
FT                   /translation="MSKLKTALLLTAIIFITGCKSNMKNENNISLPQYVTLNIQTLNSS
FT                   EDKTIRIKAKTLNFPLSSEDLRDISILEKKYDQEENCAGLAAPQIGISKCIIIFAVHED
FT                   AELKKWHPDLKDTMPKTIWINPSYKPIGIDKHEDYEGCFSVENATGPVARFKKIHYHAY
FT                   DINGNQIQGIAEGFLARVIQHEIDHLNGKVFLDYVAPKKIMTKEEYLEMRKKAMEQENI
FT                   KS"
FT   gene            416185..417690
FT                   /locus_tag="RPR_02490"
FT   CDS_pept        416185..417690
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_02490"
FT                   /product="ADP,ATP carrier protein"
FT                   /note="COG3202 ATP/ADP translocase"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_02490"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47324"
FT                   /db_xref="GOA:C4K173"
FT                   /db_xref="InterPro:IPR004667"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C4K173"
FT                   /protein_id="ACR47324.1"
FT                   /translation="MNTPKNDNYLSELSKVIWPIERYENKKFLPMAFMMFCILLNYSTL
FT                   RSIKDGFVVTDIGAEAISFLKTYIVLPSAVIAMVIYVKLCDILKQENVFYVITSFFLGY
FT                   FALFAFVLYPYPDLVHPDPETIESWSVVYPNFKWFIRIVGKWSFASFYTMAELWGTMML
FT                   SLLFWQFANQITKTDEAKRFYSMFGLLANLALPVTSVIIGYCLHEKTQIVAEHLKFVPL
FT                   FVIMITSSFLVILTYRWMNKNVLTDPRLYDPALVKEKKAKAKMSLIDSFKMIFTSKYVG
FT                   YIALLLIAYGVSVNLVEGVWKSKVKELYPTKEAYTIYMGKFQFYQGWVAIAFMLIGSNI
FT                   LRKVSWLTAAMITPLMMLITGAAFFAFIFFDSVIAMHLTGILASGPLALAVMIGMIQNV
FT                   LSKGVKYSLFDATKNMAYIPLDKDLRVKGQAAVEVIGGRFGKSGGAIIQSTFFILFPAF
FT                   GFVEATPYFASIFFVIVILWIYAVKGLNKEYKVLVNKTESRIC"
FT   gene            417910..419211
FT                   /locus_tag="RPR_02495"
FT   CDS_pept        417910..419211
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_02495"
FT                   /product="glycerol-3-phosphate transporter"
FT                   /note="COG2271 Sugar phosphate permease"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_02495"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47325"
FT                   /db_xref="GOA:C4K174"
FT                   /db_xref="InterPro:IPR000849"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C4K174"
FT                   /protein_id="ACR47325.1"
FT                   /translation="MTNTRSKIKTPRSPYVKKYNSWRVRILYSIIIGYATFYFCRQNFN
FT                   IATPAIREYFGVTKTQIGWILTASSIMYGVSKACNGFISDKVNARIFMVLGLLFVGIIT
FT                   MLIGFSDSLWLIGILWIASNWFQSMGWPPATKMLTHWFASKELGTKWAMGATSNQIGGA
FT                   LAMISCGYLIDKFDWRAAFFVPGVVACVVSLFLYNRLRNSPKEVGLSTVEEYKEYPLEA
FT                   IGDYEKLLTPQLLKMVFCNKLIWYVCLANMFVYIIRSGVIYWAPTFLKDLRNISLANAG
FT                   LQIGLYEMIGIPGALIAGVLSDKLFQGRRGPVASICMVLLSLLLVLFWKLPIPIHSELL
FT                   SIVILSLIGFFVSGPQLLVGIAAADFSTRQAVGTANGLSGLFGYLGAAIAGVGVGWISD
FT                   NYGWNGVFIFFSISALLGGGLFALIWNRSAKKYI"
FT   gene            419236..419658
FT                   /gene="ndk"
FT                   /locus_tag="RPR_02500"
FT   CDS_pept        419236..419658
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ndk"
FT                   /locus_tag="RPR_02500"
FT                   /product="nucleoside diphosphate kinase"
FT                   /EC_number="2.7.4.6"
FT                   /note="COG0105 Nucleoside diphosphate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_02500"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47326"
FT                   /db_xref="GOA:C4K175"
FT                   /db_xref="InterPro:IPR001564"
FT                   /db_xref="InterPro:IPR023005"
FT                   /db_xref="InterPro:IPR034907"
FT                   /db_xref="InterPro:IPR036850"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4K175"
FT                   /protein_id="ACR47326.1"
FT                   /translation="MTIQYTFSMIKPDAIKRNKIGQVNTYLENAGLKIVAQKMKFLTKY
FT                   EAACFYDEHRARPFFNSLVEYITSGAVVLQVLKGEDAITLNRTVMGATNPAEAEAGTIR
FT                   KDLGESIEANSIHGSDSENSAKREIAFFFNKSEIIE"
FT   gene            419662..421530
FT                   /locus_tag="RPR_02505"
FT   CDS_pept        419662..421530
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_02505"
FT                   /product="tRNA uridine 5-carboxymethylaminomethyl
FT                   modification enzyme GidA"
FT                   /note="COG0445 NAD/FAD-utilizing enzyme apparently involved
FT                   in cell division"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_02505"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47327"
FT                   /db_xref="GOA:C4K176"
FT                   /db_xref="InterPro:IPR002218"
FT                   /db_xref="InterPro:IPR004416"
FT                   /db_xref="InterPro:IPR020595"
FT                   /db_xref="InterPro:IPR026904"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4K176"
FT                   /protein_id="ACR47327.1"
FT                   /translation="MLKYDVIVIGGGHAGVEAAAASARLGVPTLLITLKPENLGEMSCN
FT                   PAIGGIAKGTLVKEIDALDGLMGYVIDQAGIHYKMLNETRGPAVWGPRAQADRKLYKKA
FT                   MYQILTNYPNLDILYGKVEDIEIKSSKIEAVILNNGSKILCQKIILTTGTFLSGLIHIG
FT                   QKKIPAGRVDEEPSYGLSNTLKQIGFKLARLKTGTPPRIDGRTIDYSKTILQPGDKIPR
FT                   PFSELTNIVNVSQINCFITTTTSETHDIIRENLDKSAMYSGQIEGIGPRYCPSIEDKIV
FT                   RFSTKSEHRIFLEPEGLDDYTIYPNGISTSLPEDVQHKLIKTIPGLENVKVLRPGYAIE
FT                   YDYVDPREISVTLETKKIAGLYLAGQINGTTGYEEAAGQGIIAGINAALAVKDQAPFML
FT                   TRANSYIGVMIDDLTTFGTIEPYRMFTSRSEYRLSLRADNSDLRLTELGMNIGVVSEKR
FT                   KKIFTKKCEDIEKIKSLLNTLSLTTSKLAKMGIQVAQDGTYKTVLDLFKIPNFNVEQAI
FT                   KIFPMLKETQNNNILQLLYIEAKYASYLTRQHADINLFQSEEAQFIPKNLDYFKIPSIS
FT                   LEIQEKLSSHKPTTIGVARRIPGITPAAITAIIIYLKTKYSDGSST"
FT   gene            421514..422089
FT                   /gene="gidB"
FT                   /locus_tag="RPR_02510"
FT   CDS_pept        421514..422089
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gidB"
FT                   /locus_tag="RPR_02510"
FT                   /product="glucose-inhibited division protein B"
FT                   /note="COG0357 Predicted S-adenosylmethionine-dependent
FT                   methyltransferase involved in bacterial cell division"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_02510"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47328"
FT                   /db_xref="GOA:C4K177"
FT                   /db_xref="InterPro:IPR003682"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C4K177"
FT                   /protein_id="ACR47328.1"
FT                   /translation="MEVPREIIKKLEIFQKLVKKWNKSINLVSDNTIHNFWQRHILDSL
FT                   QLIQYIDNKEIHLVDIGSGSGLPGIVLSIAGVAQVSLIEADLRKCIFLEKASKISNNNI
FT                   QIINQRIEKVEIDCSILTFRAFSNLNTIFNCIKNISVREKFLLLKGKNYLTEIVEAKER
FT                   WLFGYLIHQSITCEEGKILEVSNLTKMI"
FT   gene            422086..422853
FT                   /locus_tag="RPR_02515"
FT   CDS_pept        422086..422853
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_02515"
FT                   /product="chromosome partitioning protein"
FT                   /note="COG1192 ATPases involved in chromosome partitioning"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_02515"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47329"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C4K178"
FT                   /protein_id="ACR47329.1"
FT                   /translation="MKVIAIVNQKGGVAKTTTTVNLATAFAAVNKKILVIDLDPQGNSS
FT                   TGFGISQQQRKNTIYQVLTNLIELQDAIISTDIPNLEIITSNTNLSAAELDLTKLKDRE
FT                   YILMKLLAEIKILYDYIIIDCPPSLNLLTVNALVASDEVLIPMQCDFYSLEGLSHLLKT
FT                   IEIVEKKLNPKIKIAGILFTMYDKRNRLTEQVEDDVRKCLGELVFKTVIPRNIKLSEAP
FT                   SYGKPAIIYDYKCSGAVAYIELTKEILERYGEK"
FT   gene            422840..423700
FT                   /locus_tag="RPR_02520"
FT   CDS_pept        422840..423700
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_02520"
FT                   /product="stage 0 sporulation protein J"
FT                   /note="COG1475 Predicted transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_02520"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47330"
FT                   /db_xref="GOA:C4K179"
FT                   /db_xref="InterPro:IPR003115"
FT                   /db_xref="InterPro:IPR004437"
FT                   /db_xref="InterPro:IPR036086"
FT                   /db_xref="InterPro:IPR041468"
FT                   /db_xref="UniProtKB/TrEMBL:C4K179"
FT                   /protein_id="ACR47330.1"
FT                   /translation="MAKNKGLGRGLSSLLGEEVISIESEIVQIINIDKIRPNENQPRKN
FT                   FEYDKIKELADSILNNGLLQPIIIDNNFQIIAGERRWRACKLAKVLEIPVIIKNLDARE
FT                   SMEIALIENIQRTDLTVMEEARGFKYLIENFNYTVEKLAERLGKSRSHIANLLRLNNLP
FT                   QSIQDKVNENILSMGQARCLINHEHAEVIADYIINNDLNVRQTEELVRRWYKNEYTKSP
FT                   NNNNKIGKRFLKDNATDNDLELLVKALSEKFGIKITIENYPLGGKLIFHYKDLEELDLI
FT                   LLKLN"
FT   gene            423938..425605
FT                   /locus_tag="RPR_02525"
FT   CDS_pept        423938..425605
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_02525"
FT                   /product="putative ABC transporter ATP-binding protein"
FT                   /note="COG0488 ATPase components of ABC transporters with
FT                   duplicated ATPase domains"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_02525"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47331"
FT                   /db_xref="GOA:C4K180"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR022374"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032781"
FT                   /db_xref="UniProtKB/TrEMBL:C4K180"
FT                   /protein_id="ACR47331.1"
FT                   /translation="MSYQYVYEMVGLSKIINGKRILKETNLSFLPKAKIGIIGPNGAGK
FT                   STLLKIMAGIDKEFEGKATAKIGIKVGYLPQEPYLDASKNVFDNIIEGLHEKKKLIDEF
FT                   NYISNKFAAEIADEEMQKLFDKQAELQEKIDNCDGWNLEREIEIAMLALRCPPKEADIT
FT                   KISGGEKRRVALCKLLLEKPDMLLLDEPTNHLDAESVSWLEDYLKHYEGTVIVITHDRY
FT                   FLDNVTEWILQIDRGNCIPWELNYSSWLEQKQKKLALESKEDDDRKNQLNRELEWIRQT
FT                   PKARQSKNKARITAYQELLNKQQEQKTDPTQIIIPNGPRLGDLVIEAEHIAKKFNNKIL
FT                   LSDFSFKVPRGAIVGIIGPNGAGKSTLFNIITGKIMPDSGSIKIGQTVKLGYVDQSRDH
FT                   LDDNKTIWEEISEGLDELQLGNRIIKSRAYCAAFNFRGGDQQKKVGQLSGGERNRVHLA
FT                   KLLKEGANVILLDEPSNDLDIDTLRALEDAILDFAGCVLVISHDRWFLDRITTHIISYD
FT                   KENNATWFEGNYQDYHEYMLSTNGESILNPKYKHKKLI"
FT   gene            425960..426784
FT                   /locus_tag="RPR_02535"
FT   CDS_pept        425960..426784
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_02535"
FT                   /product="2-dehydro-3-deoxyphosphooctonate aldolase"
FT                   /EC_number="2.5.1.55"
FT                   /note="COG2877 3-deoxy-D-manno-octulosonic acid (KDO)
FT                   8-phosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_02535"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47332"
FT                   /db_xref="GOA:C4K181"
FT                   /db_xref="InterPro:IPR006218"
FT                   /db_xref="InterPro:IPR006269"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4K181"
FT                   /protein_id="ACR47332.1"
FT                   /translation="MQKVVKLNNIKIGNDLPFVLITGPCQIEGKDHALFMAEKLVKLTS
FT                   KLEIPFIYKSSFDKANRTSVHGIRGVGIEKGLDILSKVKSEFDCPIVTDVHSESQCIET
FT                   AEVADILQIPAFLCRQTDLLQAAAKTGKIVKVKKGQFLAPWDMKNVQTKLETFGVKDIL
FT                   FTERGACFGYNNLVSDMRSLAIMAELNVPVVFDATHSVQQPGGLGGSTGGERKYVELLA
FT                   KAATSVGIAGMYMEVHQDPDNAPSDGPCMMKLDNLESILIKLKKYDKITKEK"
FT   misc_feature    427202..428516
FT                   /note="authentic frameshifts in gene fragment homologous to
FT                   RF_0112"
FT   gene            complement(428607..428939)
FT                   /locus_tag="RPR_02555"
FT   CDS_pept        complement(428607..428939)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_02555"
FT                   /product="HesB protein family protein"
FT                   /note="COG0316 Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_02555"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47333"
FT                   /db_xref="GOA:C4K182"
FT                   /db_xref="InterPro:IPR000361"
FT                   /db_xref="InterPro:IPR016092"
FT                   /db_xref="InterPro:IPR017870"
FT                   /db_xref="InterPro:IPR035903"
FT                   /db_xref="UniProtKB/TrEMBL:C4K182"
FT                   /protein_id="ACR47333.1"
FT                   /translation="MTITITDRAFERVCELVKLEKDKNLVLRVSVDSGGCSGLMYNYEL
FT                   VSKDNIEQDDYVITKHNATIIIDPISQKFMLDCTLDFIEELGSSYFNVSNPQAKAKCGC
FT                   GNSFSV"
FT   gene            429169..430323
FT                   /locus_tag="RPR_02560"
FT   CDS_pept        429169..430323
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_02560"
FT                   /product="deoxyguanosinetriphosphate
FT                   triphosphohydrolase-like protein"
FT                   /note="COG0232 dGTP triphosphohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_02560"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47334"
FT                   /db_xref="GOA:C4K183"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006261"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR023023"
FT                   /db_xref="InterPro:IPR026875"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4K183"
FT                   /protein_id="ACR47334.1"
FT                   /translation="MLASYASDPLKSRGRLYKEIPTSYRNEFERDRDRIIHTNAFRRLQ
FT                   YKTQVFINHEGDHYRNRLTHSLEVSTVARSVASTLNLSNDLAETIALAHDLGHTPFGHA
FT                   GERALNECMREYNGFSHNAQSLKILTLLEKRYAAYNGVNLTWEVLEGIVKHNGPILGEI
FT                   NEYIAEYNKQNDLELSTYASAEAQIAALADDISYISHDLEDSIGAKIIDFNSLAELKYI
FT                   DQHVVELKSKFKNISSSCLIYEVVRKLIHELITDLLWQTKENLNKEKITNIDEIRNLNY
FT                   QIVDFTEKTNKNIKETKKFLHERVYKSNKITAISLKCTKIVQGLFKIYMDDINLLPVNW
FT                   KMLIDSNETYSKARVVADYIAGMTDRFAIQEYNQLCSTSYITCF"
FT   gene            430473..432203
FT                   /gene="argS"
FT                   /locus_tag="RPR_02565"
FT   CDS_pept        430473..432203
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argS"
FT                   /locus_tag="RPR_02565"
FT                   /product="arginyl-tRNA synthetase"
FT                   /EC_number="6.1.1.19"
FT                   /note="COG0018 Arginyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_02565"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47335"
FT                   /db_xref="GOA:C4K184"
FT                   /db_xref="InterPro:IPR001278"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR005148"
FT                   /db_xref="InterPro:IPR008909"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR035684"
FT                   /db_xref="InterPro:IPR036695"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4K184"
FT                   /protein_id="ACR47335.1"
FT                   /translation="MNIFNQLKQDIIVASRQLYNNQEIANTATIEIPKDSFNGDLSSNV
FT                   AMIIAAKESIAPREVALKFKEVLITLPYIASIEIAGPGFINFTIKADSWQASIKDILQH
FT                   EEKFFEIDIDKSRNINIEYVSANPTGPMHIGHARGAVYGDVLARILQKVSYSVTKEYYV
FT                   NDAGSQINDLVSTVLLRYKEALGEQITIPAGLYPGEYLIPLGQILAKEYGNKLLTMNYA
FT                   ERFKIVKSFAVEKMLDLNRKDLADLGIKHDIFFSEQSLHDKGEIEETVKLLERMGLIYE
FT                   GTLPAPKGKIHEEWDNRVQKLFKSTKYGDSQDRPIEKADGSWSYFASDLAYAKDKIERG
FT                   ANHLIYVLGADHSGYVKRIEAIVKALGKEQVKVDVKICQLVNFVENGVPVKMSKRLGNF
FT                   ASVQDVNHEVGKDIIRFMMLTRQNDKPLDFDLVKVKEQSRENPIFYVQYAHVRTISILS
FT                   KARELIPESYNNFESGKYDLSLLSSEEEIEIIKLLASWTKTLEASAKYFEPHRIAFYLI
FT                   NLASKFHSMWNFGKENSDYRFVIESNKELTLARLALASAIQKVIASGLEVIGVEPMNKM
FT                   "
FT   gene            432376..433050
FT                   /locus_tag="RPR_02570"
FT   CDS_pept        432376..433050
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_02570"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_02570"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47336"
FT                   /db_xref="GOA:C4K185"
FT                   /db_xref="InterPro:IPR007730"
FT                   /db_xref="InterPro:IPR036680"
FT                   /db_xref="UniProtKB/TrEMBL:C4K185"
FT                   /protein_id="ACR47336.1"
FT                   /translation="MINNIFIKIFLVFLVCMSAIYFGYQYYQNSKPVITIYPDELPTKI
FT                   KPSIIENNQIAAVHSTIYENLIAKDTNIKTVKLLPDPEKPMSIDSRNQSQSDESFDEIS
FT                   NLIALIEPNNNSKNETDLNIIKLEKGSKDKVSNAKNCKNNESYKVQLGSVKSETEAMKE
FT                   GERIKKQFPKILKNVVITTKKVKYDDGKFFYLILAGDYGSLSQAKAVCKKLAYNKQSCV
FT                   LK"
FT   gene            433228..435444
FT                   /locus_tag="RPR_02575"
FT   CDS_pept        433228..435444
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_02575"
FT                   /product="DNA topoisomerase IV subunit A"
FT                   /note="COG0188 Type IIA topoisomerase (DNA gyrase/topo II,
FT                   topoisomerase IV), A subunit"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_02575"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47337"
FT                   /db_xref="GOA:C4K186"
FT                   /db_xref="InterPro:IPR002205"
FT                   /db_xref="InterPro:IPR005742"
FT                   /db_xref="InterPro:IPR006691"
FT                   /db_xref="InterPro:IPR013757"
FT                   /db_xref="InterPro:IPR013758"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR035516"
FT                   /db_xref="UniProtKB/TrEMBL:C4K186"
FT                   /protein_id="ACR47337.1"
FT                   /translation="MKEDKIENIDFGNALSERYLAYALSTIMSRSLPDVRDGLKPVHRR
FT                   LLYAMLQLRLEPNSGYKKCARVVGDVIGKYHPHGDVAVYDTLVRLAQHFSLRYPLIDGQ
FT                   GNFGSIDGDNAAAMRYTESRMTDICTLLMEDIDKDTVDFRPTYDGSDLEPVIMPASFPN
FT                   LLANGSEGIAVGMATNILPHNLHELCDALIHLINHPKAEINDIMNFVKGPDFPTGGIII
FT                   DKAEVINAAYTTGRGSLRVRSRWEKEELSYGTYQIVVTEIPYQVQKSKLIEQIAILLKD
FT                   KKIPLVSNIRDESTDIIRLVIEPTDRGCDPQIVMESLFKLTNLESRIQLNMNVIGSNNV
FT                   PRVMNILEILQEFLYHRQNIVTRRSTYLLNKIKHRLEILKGLRIAYLNLDEIIKIIREE
FT                   DEPKAIMMERFKLTEIQVEAILNTRLRSLRKLEEQEIINEHSNLQKQQAILEEILNNPK
FT                   ELWKIVKKEIKTVQTKFGLNTVIGARRTSFEEVTFTNQVVDITAFITKEPITIICSKMG
FT                   WVRSLKGHNTDLSTIKYKEGDAEKFILEAYTTDKILIVSSEGRFFTLLADNISKGKGTG
FT                   ESIKLLVDIGNNDITNILVYKPDQLLLLASSVGKGFLVNSNEVMAQTKTGKQIMNVPDG
FT                   HVCIACLPVNGDSIACIGESRKLLVFNIDEIPEMKKGQGVTLQKFKNAKLLDIKIFNKE
FT                   DGLGWNNNGKVKLEKNIVAFLGKRGSTGKLPPMGFPKNNRFSSY"
FT   gene            complement(436144..437460)
FT                   /locus_tag="RPR_02585"
FT   CDS_pept        complement(436144..437460)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_02585"
FT                   /product="hypothetical protein"
FT                   /note="COG0154 Asp-tRNAAsn/Glu-tRNAGln amidotransferase A
FT                   subunit and related amidases"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_02585"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47338"
FT                   /db_xref="GOA:C4K187"
FT                   /db_xref="InterPro:IPR033900"
FT                   /db_xref="UniProtKB/TrEMBL:C4K187"
FT                   /protein_id="ACR47338.1"
FT                   /translation="MKKLLLAASIICLASAGLAEENPTPVISNSDTEIKLEGFYLFENG
FT                   YIKQDHLILFDKNVTDNRKKLGFYTEAAFAATIAKTINDVIAGAKIVLQPTTRAKTSTS
FT                   YNGSHIFIETSYGKVELGSPADASAKLRITGSQVTAGTGGWSRYALLDGQYMRYNGLKS
FT                   DFDTNASFYLESYSNSFDQINDKAERARRLNFFTPKMKGFQAGVSYTPDTANTGGNRDI
FT                   NNLTLESSGRNGVSVSKTGIKTVKLENNETMTINQNIRDAFSAGLTYEHEISEDADLKL
FT                   SVTGEYGKPARRLIHAKMDGTTIQVLNTYKLSNLKAYNLGAVFTYGNFSCGASYGNLGK
FT                   SLTAKEYYKVGRDTYYYNGAVAYGQGPIKTSLEYLKTSRYKNTVDAVSLATEYKIMPGL
FT                   LPYAEISHFQAKGKPVYYPEAPSKTTRGTVGLIGTKLKF"
FT   gene            437742..438308
FT                   /gene="dcd"
FT                   /locus_tag="RPR_02590"
FT   CDS_pept        437742..438308
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dcd"
FT                   /locus_tag="RPR_02590"
FT                   /product="deoxycytidine triphosphate deaminase"
FT                   /EC_number="3.5.4.13"
FT                   /note="COG0717 Deoxycytidine deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_02590"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47339"
FT                   /db_xref="GOA:C4K188"
FT                   /db_xref="InterPro:IPR011962"
FT                   /db_xref="InterPro:IPR029054"
FT                   /db_xref="InterPro:IPR033704"
FT                   /db_xref="InterPro:IPR036157"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4K188"
FT                   /protein_id="ACR47339.1"
FT                   /translation="MAIMSDKWIKEAVINHSMIRPFAEKQVRVHNKEKIISYGLSSYGY
FT                   DARVSNEFKIFTNINSTTVDPKNFSEYNLVDREVDVCIIPPNSFALGRTIEYFKIPRDV
FT                   LVICVGKSTYARCGIIVNVTPLEPEWEGHVTLEFSNTTPLPAKIYANEGACQFLFLKSD
FT                   QICDTSYADRQGKYMKQVGVTLPLT"
FT   gene            438354..438812
FT                   /locus_tag="RPR_02595"
FT   CDS_pept        438354..438812
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_02595"
FT                   /product="preprotein translocase subunit SecB"
FT                   /note="COG1952 Preprotein translocase subunit SecB"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_02595"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47340"
FT                   /db_xref="GOA:C4K189"
FT                   /db_xref="InterPro:IPR003708"
FT                   /db_xref="InterPro:IPR035958"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4K189"
FT                   /protein_id="ACR47340.1"
FT                   /translation="MSTINTDTNKTMPHISVNAQYIKDLSLENPSAPSSLAALDQRPQI
FT                   DLSLDINITNLSEENFYEVELNIEAIARNEKYKLFQIELKYAGVFNLINIDSEQHPVLL
FT                   SVHCPAMIFPFARKIIASCTQDAGFQPLMIDPIDFGALYHKKMSEHQN"
FT   gene            439037..439750
FT                   /locus_tag="RPR_02600"
FT   CDS_pept        439037..439750
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_02600"
FT                   /product="transcriptional activator protein czcR"
FT                   /note="COG0745 Response regulators consisting of a
FT                   CheY-like receiver domain and a winged-helix DNA-binding
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_02600"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47341"
FT                   /db_xref="GOA:C4K190"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:C4K190"
FT                   /protein_id="ACR47341.1"
FT                   /translation="MRVLLIEGEPEMANLIELTLASEGIVCDKASVGVEGLRLGKVGGY
FT                   DLVILDLMLPDINGFKILLRLRAAKIKTPILILSSLTDTYQKITGFSSGADDYLTKPFV
FT                   REELIARIKAIVRRSKGHAASVFRFDKVSINLDTRSVEVDGKKVHLTNKEYAILELLVL
FT                   RRGTILTKEMFLNHLYSSVDEPEMKIIDVFICKLRKKLSDAAGGRDYIDTVWGRGYMLK
FT                   EYDELQQKEILAQGA"
FT   gene            439754..440575
FT                   /gene="queF"
FT                   /locus_tag="RPR_02605"
FT   CDS_pept        439754..440575
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="queF"
FT                   /locus_tag="RPR_02605"
FT                   /product="7-cyano-7-deazaguanine reductase"
FT                   /note="COG2904 Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_02605"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47342"
FT                   /db_xref="GOA:C4K191"
FT                   /db_xref="InterPro:IPR016428"
FT                   /db_xref="InterPro:IPR029139"
FT                   /db_xref="InterPro:IPR029500"
FT                   /db_xref="UniProtKB/TrEMBL:C4K191"
FT                   /protein_id="ACR47342.1"
FT                   /translation="MPLSTSLLGKKSTYKDSYDVTLLFKIPRINNRNELGINSNNLPFY
FT                   GVDVWNTYELSCLNKNGKPWVGVGTFYIPTDSENIVESKSFKLYLNSFNNFVVESVKEL
FT                   ERIILQDLSNVTHAKVTGRIFPINTKVEFGVPSGKNIDDLDIVCNNYGAPDNSLIEYED
FT                   VLVEEEINSNLLKSNCLVTSQPDWGTIVIKYKGKKLKYDSFLKYLISFRNCNEFAEQCA
FT                   ERIFTDIKNAISPDFLSIYIVYARRGGIDICPYRSTDKSYTLPSDKRFIRQ"
FT   gene            complement(440893..441453)
FT                   /locus_tag="RPR_02610"
FT   CDS_pept        complement(440893..441453)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_02610"
FT                   /product="putative cytoplasmic protein"
FT                   /note="COG3820 Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_02610"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47343"
FT                   /db_xref="InterPro:IPR010421"
FT                   /db_xref="UniProtKB/TrEMBL:C4K192"
FT                   /protein_id="ACR47343.1"
FT                   /translation="MNSQKTLPLLPKATAIWLIENTSLTFKQIADFCGIHEFEIKGMAD
FT                   GEVAHSIKGLNPIANGQLTLEEIERCSKDPNANLQISYSPADELMKNQKKKRAKYTPIA
FT                   RRQDKPDAIYWLLSNYPNIQDHQIIKLIGTTKITIDAIRTRSHWNMNSIRPRDPVLLGI
FT                   CSQIDLNKIVESLKPPQNPTKES"
FT   gene            complement(441508..442659)
FT                   /locus_tag="RPR_02615"
FT   CDS_pept        complement(441508..442659)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_02615"
FT                   /product="truncated NAD(P) transhydrogenase subunit beta"
FT                   /note="COG1282 NAD/NADP transhydrogenase beta subunit.
FT                   N-terminal truncation of 82 AA's due to frameshift. Rusults
FT                   in change from nine putative transmembrane domains to six."
FT                   /db_xref="EnsemblGenomes-Gn:RPR_02615"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47344"
FT                   /db_xref="GOA:C4K193"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR034300"
FT                   /db_xref="UniProtKB/TrEMBL:C4K193"
FT                   /protein_id="ACR47344.1"
FT                   /translation="MPQLVAGFHSFVGLAAVFVAYATVLAPENFSIGIAGSLPINALIE
FT                   ILVGVSIGALTFSGSIIAFLKLQGLMKSSALKFYGQQYICLLTAIILVILVISFIRSEN
FT                   IFLFNLIVFLSLLIGVLLIIPVGGADMPVIVSMLNSYSGFAAAGIGFTLGNSLLIITGA
FT                   LVGSSGAILSYIMCKAMNRSLIKVIFGAFLPAPTGINKDIDDNKIAKTSCPEDAAHLLL
FT                   NTSSVIIVPGYGMAVAQSQHIIKEMVDILERSDINVRFAVHPVAGRMPGHMNVLLAEAN
FT                   IDYEKVLELEEINRDFATTDVVLVIGANDVTNPAAKNDPNSPIYGMPVLDVEKARTILF
FT                   IKRSMASGYAGIKNALFYHDNTFMLFGDAKKVVEEIVKFLNED"
FT   gene            complement(443043..443777)
FT                   /locus_tag="RPR_02625"
FT   CDS_pept        complement(443043..443777)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_02625"
FT                   /product="hypothetical protein"
FT                   /note="COG3047 Outer membrane protein W"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_02625"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47345"
FT                   /db_xref="GOA:C4K194"
FT                   /db_xref="InterPro:IPR005618"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="UniProtKB/TrEMBL:C4K194"
FT                   /protein_id="ACR47345.1"
FT                   /translation="MLRIVKKLGIILFVSTISINSFAKSMYDYVDSASDYDSTPYYENE
FT                   GSLVFKMRLGGVVSSAKQKGLPTPTSPQPVSVGEVAKNGYGGDASTTIFFNNYLATELS
FT                   LGFNVLRTKYTSLAAVAHNYGVDNVKLGKNKPIYMIPATVTGQFHIAPYGGIRPYIGIG
FT                   YHSSYMLTQATGLKIRNGHGAVGQIGVDFYATDDTLINIDVRQFFLNPKLEYKPNLVGN
FT                   KTMTSKVKLNPLIVSIGIGFTF"
FT   gene            443932..444816
FT                   /locus_tag="RPR_02630"
FT   CDS_pept        443932..444816
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_02630"
FT                   /product="hypothetical protein"
FT                   /note="COG0697 Permeases of the drug/metabolite transporter
FT                   (DMT) superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_02630"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47346"
FT                   /db_xref="GOA:C4K195"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:C4K195"
FT                   /protein_id="ACR47346.1"
FT                   /translation="MNDALKTYLTGIGWFLLSLVSSSANDVISKYLGTRLHSFEVAFFR
FT                   FFFSSIVLLPFVVYYGKNTLKTSRPFVHILRGLLLFFGMTSWTYGLTIAPVTTATVVSF
FT                   SIPLFTLILAVFFLNENIIWPRWVVTVVGFIGLVITLKPHAEDFNPEILYFVLAAISFA
FT                   MLDIINKKFVIKESMISMLFYSAIVTAIVSLPVASQYWLTPSSFELALLFVLGSSGSLI
FT                   LFFLLKAFSMVDATATAPYRYLELVISVIAAYFIFNEFPDKSTLHGAVIIIPTTLFIIY
FT                   SEKKAMNRKHELQ"
FT   gene            444803..446059
FT                   /locus_tag="RPR_02635"
FT   CDS_pept        444803..446059
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_02635"
FT                   /product="major facilitator transporter"
FT                   /note="COG0477 Permeases of the major facilitator
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_02635"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47347"
FT                   /db_xref="GOA:C4K196"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C4K196"
FT                   /protein_id="ACR47347.1"
FT                   /translation="MNCSKLVFSSGIANIFEWYDYVLFGYFAPIIGTKFFPNDDANTSL
FT                   LQVFLVFAIGYLARPLGGIFFGVIGDRFGRKVALTSALFCMSAPTVLIGILPTYHTIGI
FT                   TATILMICVRILQGLSMGGVLTGSISFVIEHTSHKHQGFIGSISMSSICAGLLLGSFVS
FT                   YIVKNILTASQFDSFGWRIPFLLGFFILFAAFYIKKNTHETPNFKNLREQKKILQSPLK
FT                   KVITNYWFDILISIFINAPGSIIFYLTTIYLVSFLKISRNFTENEVNSLASVCYVIMIA
FT                   VTLLSGYLSDIIGRRKIFVINLIIIIVTTPFLLNNFENGVFTSVIISQLILAILAASYI
FT                   GPEPALQAELYPTNIRNTALSISYNTATSIFGGTTPLVFEYLVHKTGHVTSAVYYVILS
FT                   CIFALIALSFYKNRSLDKI"
FT   gene            446639..446713
FT                   /locus_tag="RPR_t07790"
FT   tRNA            446639..446713
FT                   /locus_tag="RPR_t07790"
FT                   /product="tRNA-Thr"
FT   gene            446895..447197
FT                   /gene="secG"
FT                   /locus_tag="RPR_02645"
FT   CDS_pept        446895..447197
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secG"
FT                   /locus_tag="RPR_02645"
FT                   /product="preprotein translocase subunit SecG"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_02645"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47348"
FT                   /db_xref="GOA:C4K197"
FT                   /db_xref="InterPro:IPR004692"
FT                   /db_xref="UniProtKB/TrEMBL:C4K197"
FT                   /protein_id="ACR47348.1"
FT                   /translation="MIDILLFVHITIAILLIIVILMQRSGSDGISSISGGNNMGVVSAK
FT                   TVGNFLTKSTIILTTLFLINAIVLANLSSKKKSDLVSKINEIEENQAENSLPIAK"
FT   gene            complement(448103..453301)
FT                   /locus_tag="RPR_02655"
FT   CDS_pept        complement(448103..453301)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_02655"
FT                   /product="190 kDa antigen precursor"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_02655"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47349"
FT                   /db_xref="InterPro:IPR005546"
FT                   /db_xref="InterPro:IPR036709"
FT                   /db_xref="UniProtKB/TrEMBL:C4K198"
FT                   /protein_id="ACR47349.1"
FT                   /translation="MTSSFLSTSARAASFKDLVSKTPAWEKHNATQQQNIWNDLTQNEK
FT                   IKKWQEAALVPSFTQAHNDLGIKYKETDLSSFLDNTRHKARQARAKILLYIERVKQQDF
FT                   DTKKQEYINQGVVPTDIEAATNLGISYDPSKIDNNVEHDQKVRRAEKDKKAVIELYISS
FT                   INRDIKYKHYVDNDIIPELQEVRTALNMNKDDAQSFVASIRTEIMENAKGQYIADSHIP
FT                   TEKELKKKFGISRDDNRDGYIKSIRLKVMDKEKPQYIADNHIPTEKELEQKFGADKGEA
FT                   TNYIASINQIRAGIEANQFLNNNDTTKPSTGRSQKKSGSKNDHWYMSNQSINDTRTSSR
FT                   IFTGRAKKQRYFFDPISTFKTHFNTKANKGNLTQSQHNINRIIQQEENIEEFKNLIKTD
FT                   PIAALTLQVDSSYKQEAVTTILSDFNDDTIQRVLFSNDKGQLDFKTNIDVKNRPILQEL
FT                   LENSSSEEKTKFVERIQDYATRNISNSQFEEKARLDLIKLAASKDKSSVENFLTLQLEL
FT                   KNRIQPHIANSVYVLTLEMVKEINIELKNKGLIKDSLTKDYMIKLAKEINNHTLNSVIK
FT                   VILSDSNILSNETNKILGLAVGNNANNLEQTQSGIPNPPPLPLNGDIPNPPPLPLNGSI
FT                   PSPPLHSQGFSSNSKHFDLNQLQAEYPHIHSLYIQFTHNTTVQSKAPLQPTASSATSTG
FT                   RSTPKTAYAKLYAEYRTETGGTKANDLQDQLIKRQADLTNVIRQILTESYANQGADEKT
FT                   LVNLFSISTPEIAEKAKEAFNILAQDQYIKDITVNGKKTITSEEIIKNLFNEDTDDAVK
FT                   RILLSSCKISEELKRPIKLEFNKSELIRELQGKQNPFKQLEFAYINAKNFDQDIFSNRV
FT                   DELINNPNILTIVQQATFLITEDTNLRKTINSDQAQAKLDDLRTAILSTIKFEELITAK
FT                   LPQHDFIAIVKEKDPELLKEFLKATTLKLTGNNNLDQLRLALPSFTDMSNEQIRILANK
FT                   LKMPIILKALKECSQEKAKQHIHTGNMPPPPPLPDSQDLELAYLTSLGITKFNANTSTF
FT                   KTTPKTYRFSSDIALRYKEFTLSGQKSAGYKAKYSDADLLQKAIVESVAFEHSKNLSKA
FT                   HQNNKYFEQIQEAVDTMHPRFIGPRTEIGQKIHNIYTSKLLALTKDKEFIKYVEDNIIL
FT                   SKKLTEAFTSADSDFIDSRTEIGQKIHNIYIQQLTKYPEEAVKEAFNTAHPDFIGPRTE
FT                   IGQEVHNIYKSQLLELAKDKELFLLVQQVLVESAELEQKYGSDIQSENSNDEKKVGRLD
FT                   QTKLRLFQQNEATNDESSTKDDTQPEDSNKKSEQSDSNTALSPRLLSSNDSKNDKSSDY
FT                   KKSLLALRSSDEDDKGYATDEEELEESNSTTGEELKKDIVLESEDEAIDVSFKTEAITE
FT                   QDEVTQRQQVSDDTSGKVAILVQATSTLHKPVHYNINDRLKVAAIGAGDEETSINRGVW
FT                   ISGLYGISKQRIWKNIPKYQNRTTGITIGTDAEFINSHDVIGIAYSRLASQIKYNKKLG
FT                   KTAVNGHLLSIYSLKELIKGFSLQTITSYGLNYIKNRSKNINNIIGKYQNNNLSFQTLL
FT                   TYKYRTKYDLQFIPNIGFQYDYSRASNYKEYNVDIENLMIQKKSNQLFESSLGGKIVFK
FT                   PIVTTNNIVLTPSLYGNIEHHFNNKNTKVNAKATFKGQTLQETIITLKQPKLGYNIGSN
FT                   ILMSRKNINVLLEYNYYTHRKYQSHQGLIKLKVNL"
FT   gene            453598..454977
FT                   /gene="cysS"
FT                   /locus_tag="RPR_02660"
FT   CDS_pept        453598..454977
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysS"
FT                   /locus_tag="RPR_02660"
FT                   /product="cysteinyl-tRNA synthetase"
FT                   /EC_number="6.1.1.16"
FT                   /note="COG0215 Cysteinyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_02660"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47350"
FT                   /db_xref="GOA:C4K199"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015273"
FT                   /db_xref="InterPro:IPR015803"
FT                   /db_xref="InterPro:IPR024909"
FT                   /db_xref="InterPro:IPR032678"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4K199"
FT                   /protein_id="ACR47350.1"
FT                   /translation="MQIQFHLYNTLSRTKEVFNPQDQANVKMYVCGPTVYYNPHIGNSR
FT                   SGVVYDLLYRIVIKIFGEKAVKYVRNITDVDDKIIDRAALLGVTIDELTDKVTKEFHKN
FT                   MAYLGCMLPSIEPKATKHIDVMIAIIERLIAKDHAYIADNHVYFDVLSAPNYTELSNRN
FT                   LEEMFEGVHVENSKTKKNPQDFVLWKPAKQNESANMNFESPWGLGRPGWHIECSAMSYK
FT                   YLGENFDIHGGGADLIFPHHTNEIAQSRCAFPSSTYAKYWVHNGFLTVNGEKMSKSLGN
FT                   FITVRDLMDKQIQGEVVRLFLLSSHYRRPLDYNDKAIEDAKKTLDYWYRAIENINVQKI
FT                   DLPHDFMQSLLDDMNTPLAVKIINDYAKGVFISKTEEERQLNASAIITCANFIGLMNKT
FT                   PHEWFNSGVDELYINELVNKRLEAKKQKNWLLADQIRNQLLEEKIILEDQPDGTTIWRK
FT                   E"
FT   gene            455224..456111
FT                   /gene="rpsB"
FT                   /locus_tag="RPR_02665"
FT   CDS_pept        455224..456111
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsB"
FT                   /locus_tag="RPR_02665"
FT                   /product="30S ribosomal protein S2"
FT                   /note="COG0052 Ribosomal protein S2"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_02665"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47351"
FT                   /db_xref="GOA:C4K1A0"
FT                   /db_xref="InterPro:IPR001865"
FT                   /db_xref="InterPro:IPR005706"
FT                   /db_xref="InterPro:IPR018130"
FT                   /db_xref="InterPro:IPR023591"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4K1A0"
FT                   /protein_id="ACR47351.1"
FT                   /translation="MSKIPSVNIKALLDAGVHFGHKTSRWNPKMASYIYGERDDVHIID
FT                   LRQSVALMSVALNAIYETVKKDGKILFVSTKIQASDIIAEYAEKCGQYYVNHRWLGGML
FT                   TNWKTIAGSIEKLNKLDKTLENEEALMGYTKKEILYMSRKKDKLLLSLAGIRNLNSKPD
FT                   LLVVIDTNKEHIAINEAVKLNVPIVAVVDTNSNPDNVDYPIPGNDDSIRSIRLYCSLFA
FT                   DAALQGLEESMKASGVDMGAMQEHTDKGLTSKNVSKLKQAKKFSKTKNIDEETNTEFEK
FT                   ALNDADENKNSDNA"
FT   gene            456308..457237
FT                   /gene="tsf"
FT                   /locus_tag="RPR_02670"
FT   CDS_pept        456308..457237
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tsf"
FT                   /locus_tag="RPR_02670"
FT                   /product="elongation factor Ts"
FT                   /note="COG0264 Translation elongation factor Ts"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_02670"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47352"
FT                   /db_xref="GOA:C4K1A1"
FT                   /db_xref="InterPro:IPR001816"
FT                   /db_xref="InterPro:IPR009060"
FT                   /db_xref="InterPro:IPR014039"
FT                   /db_xref="InterPro:IPR018101"
FT                   /db_xref="InterPro:IPR036402"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4K1A1"
FT                   /protein_id="ACR47352.1"
FT                   /translation="MSEINISAAAVKELREKTGAGMMDCKKALIETSGNFEKASDFLRK
FT                   KGLAAAAKKAGRIASEGLTAAKVDGLTGVVIEVNSETDFVARNEQFQDLVKDIANFAVI
FT                   AKTIDTLKTFKMQSGKSVEEEIIENIATIGENLTLRRMDILEISEGAIGSYVHNEVVPN
FT                   LGKISVLVGLASNAKDKAKLEALAKQIAVHVAGNNPQSIDDSSLDQALIERERKVFFEK
FT                   SKEEGKPDNIIAKMVEGRIRKFFSEVVLLQQNFLFEPKLTVAEVIKNAEKELGAEIKIA
FT                   KFIRYELGEGIEHEEKNFADEVAAITQG"
FT   misc_feature    457712..458731
FT                   /note="authentic frame shifts in hypothetical rickettsial
FT                   gene"
FT   gene            complement(458752..460146)
FT                   /locus_tag="RPR_02690"
FT   CDS_pept        complement(458752..460146)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_02690"
FT                   /product="3-deoxy-D-manno-octulosonic-acid transferase"
FT                   /note="COG1519 3-deoxy-D-manno-octulosonic-acid
FT                   transferase"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_02690"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47353"
FT                   /db_xref="GOA:C4K1A2"
FT                   /db_xref="InterPro:IPR005728"
FT                   /db_xref="InterPro:IPR007507"
FT                   /db_xref="InterPro:IPR038107"
FT                   /db_xref="InterPro:IPR039901"
FT                   /db_xref="UniProtKB/TrEMBL:C4K1A2"
FT                   /protein_id="ACR47353.1"
FT                   /translation="MMLLYYALSFILLPVYFIIILIRLLIGKEDIRRIQERFAIGKHRQ
FT                   DYSLDFVQTSANKEEFKGDTSLRTTAYTLIREDEGLGSTYKLSLEASYARRLIWINAAS
FT                   IGESMVALTLIHNISKRYPDVRFLVTSWTNSSAKILTAKLPKIAVHQFLPIDNIIFTRK
FT                   FLRNWQPDLGIFIESELWPCTINEGAKQCKLLLVNARISDKSFKAWLQRKSFFQLILKN
FT                   CSKIIVQSERDLQKFNELGVSDAVNLGNIKFANEKLPVNQEELSKLNLHLDNKRVVLFA
FT                   STHPEDEEVILPIIKNLKEQFLDCYIILIPRHPERVKSIIDNCKSHNLSATAKSQNDLP
FT                   VLSDDLYIVDRFGEMGLFFSVATISFIGGSFKQGGHNILEAAYFSNCIIFGPDMSKNTD
FT                   IAKGVLQNEAAIQIKNSEDLLTKLTYLLRSNNALELTAYRENALKFIKDNQKVLDEYLK
FT                   VITKFL"
FT   gene            complement(460143..460799)
FT                   /locus_tag="RPR_02695"
FT   CDS_pept        complement(460143..460799)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_02695"
FT                   /product="lipoprotein"
FT                   /note="COG2121 Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_02695"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47354"
FT                   /db_xref="GOA:C4K1A3"
FT                   /db_xref="InterPro:IPR007172"
FT                   /db_xref="UniProtKB/TrEMBL:C4K1A3"
FT                   /protein_id="ACR47354.1"
FT                   /translation="MRKVFKKFLKNNKYVLSIITILLYWYLRFVYFTSKQKFIFYDNGN
FT                   KEKFLNEQGVIFAFWHNMLALSPSMFIGHRNIYALISPHLDGKILNDLVGKFGCRVIVG
FT                   STNKNPIGALRNIIGKLSQGANIIVTPDGPKGPVYKVNSGITEIAYRYNTKLITIVSST
FT                   SRCFRLKSWDKLIIPLPFGTIKIIVGSPLELTNDKIQNHISLEKQLASLTESLKK"
FT   gene            complement(460950..462155)
FT                   /locus_tag="RPR_02700"
FT   CDS_pept        complement(460950..462155)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_02700"
FT                   /product="aspartate aminotransferase"
FT                   /EC_number="2.6.1.1"
FT                   /note="COG0436 Aspartate/tyrosine/aromatic
FT                   aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_02700"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47355"
FT                   /db_xref="GOA:C4K1A4"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:C4K1A4"
FT                   /protein_id="ACR47355.1"
FT                   /translation="MSIISTRLSSIKPSPTLAVVKKTLELKKAGVDIITLGAGEPDFDT
FT                   PDNIKEAAIKAIKDGFTKYTNVEGMPLLKQAIKDKFKRENNIDYELDEIIVSTGGKQVI
FT                   YNLFMASLDQGDEVIIPAPYWVSYPDMVALSTGTPVFVNCGIENNFKLSAEALERSITD
FT                   KTKWLIINSPSNPTGASYNFEELENIAKVLRKYSHVNVMSDDIYEHITFDDFKFYTLAQ
FT                   IAPDLKKRIFTVNGVSKAYSMTGWRIGYGAGSKALIKAMTIIQSQSTSNPCSISQMAAI
FT                   EALNGPQDYIKPNALNCQKKRDLALSILKRVKYFECYKPEGAFYLFVKCDKIFGHKTKS
FT                   GTIIANSNDFAEYLLEEAKVAVVPGIAFGLEGYFRISYATSMEELEKACIRIERTIDVI
FT                   PA"
FT   gene            complement(462277..462471)
FT                   /locus_tag="RPR_02705"
FT   CDS_pept        complement(462277..462471)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_02705"
FT                   /product="hypothetical protein"
FT                   /note="COG4115 Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_02705"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47356"
FT                   /db_xref="GOA:C4K1A5"
FT                   /db_xref="InterPro:IPR009614"
FT                   /db_xref="InterPro:IPR035093"
FT                   /db_xref="UniProtKB/TrEMBL:C4K1A5"
FT                   /protein_id="ACR47356.1"
FT                   /translation="MIEIEWTLEAAEDLAYWKKYDIKKYERIKLLIKNIQEVPVTGIGK
FT                   PEPLKHILSGLWSRRMNID"
FT   gene            complement(462464..462715)
FT                   /locus_tag="RPR_02710"
FT   CDS_pept        complement(462464..462715)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_02710"
FT                   /product="antitoxin of toxin-antitoxin"
FT                   /note="COG2161 Antitoxin of toxin-antitoxin stability
FT                   system"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_02710"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47357"
FT                   /db_xref="InterPro:IPR006442"
FT                   /db_xref="InterPro:IPR036165"
FT                   /db_xref="UniProtKB/TrEMBL:C4K1A6"
FT                   /protein_id="ACR47357.1"
FT                   /translation="MNSISGTSFRKNLSSVLNTVENDHVPYLIKRKNHKNIILLTEEEY
FT                   ESTKETLYLLSNLANANRIKKSIEQTKRGEFAKVNLDD"
FT   misc_feature    462858..463848
FT                   /note="authentic frameshifts result in RPR_02715 lacking
FT                   the TPR domain of it's homologs like AIG_00720"
FT   gene            463195..463848
FT                   /locus_tag="RPR_02715"
FT   CDS_pept        463195..463848
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_02715"
FT                   /product="SAM-dependent methyltransferase"
FT                   /note="COG0500 SAM-dependent methyltransferases"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_02715"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47358"
FT                   /db_xref="GOA:C4K1A7"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C4K1A7"
FT                   /protein_id="ACR47358.1"
FT                   /translation="MKNYKDITEIPQEICGKYRDLTAQYYPTIFNNDKNIHLPYRFVNE
FT                   ALKQISDLPDNYSILALGSNIGLVGYEIQKRFPERFTLTGVEVSALMNKLQETYYPNTK
FT                   IYDQIYNIAINEFLKQNSNKFDIIFSFCGLSFTNNLIEYFNLIYSSLNKQGYFALCLPN
FT                   ATKTQFSVKRKEFIFNLNEINNFLQKNNFTILTLEEIILAENNKYSIIVCKKTA"
FT   gene            463826..464608
FT                   /locus_tag="RPR_02720"
FT   CDS_pept        463826..464608
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_02720"
FT                   /product="vacJ lipoprotein precursor"
FT                   /note="COG2853 Surface lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_02720"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47359"
FT                   /db_xref="GOA:C4K1A8"
FT                   /db_xref="InterPro:IPR007428"
FT                   /db_xref="UniProtKB/TrEMBL:C4K1A8"
FT                   /protein_id="ACR47359.1"
FT                   /translation="MFVRKQHKSMRILIILSIILCSLSIRADLEYVDNEIYNYNGGSNE
FT                   NGCVEVYDPYEKFNRKVFVFNSVLDHIILRPLAIGYKNITNDYVKARVNSFVSNVDTPL
FT                   TAVNYGLQLNYDKTMKSVWRFLINTTLGIGGLFDVAGKVGLPSDRQTFGSTLAHYGVAP
FT                   GPYLVLPIIGSTNARDMTDSVITNYALNPLMYYTHNDFDLGVLAVSKINDRYVVLPFSD
FT                   YVMKNSTDPYVAIRSALHRVREASVQYPENFKCPKPKN"
FT   gene            464628..465227
FT                   /locus_tag="RPR_02725"
FT   CDS_pept        464628..465227
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_02725"
FT                   /product="hypothetical protein"
FT                   /note="COG2854 ABC-type transport system involved in
FT                   resistance to organic solvents, auxiliary component"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_02725"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47360"
FT                   /db_xref="InterPro:IPR008869"
FT                   /db_xref="UniProtKB/TrEMBL:C4K1A9"
FT                   /protein_id="ACR47360.1"
FT                   /translation="MQKIITGLFLLVMTFYAYSNEKVPAGLNSYVTNLVNEASSILNDS
FT                   KLSERVKIAKARELMSQNLDFDWMAKYTLGRNGIKTLSGGQVQEFIKVYSKYVTKSYTD
FT                   LIKDYKGKQPKIVGVRPLSSTDFMVAMNIISNKEQDPIKVEYLVREMKGNGKDVFKVSD
FT                   IITEGVSLIGAQQDEFTDTLKNQGFKALIQKLESRS"
FT   misc_feature    465454..466405
FT                   /note="authentic frameshifts: common BLAST hit:
FT                   gi|157964158|ref|YP_001498982.1| ribose-phosphate
FT                   pyrophosphokinase"
FT   gene            466467..467534
FT                   /gene="alr"
FT                   /locus_tag="RPR_02750"
FT   CDS_pept        466467..467534
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="alr"
FT                   /locus_tag="RPR_02750"
FT                   /product="alanine racemase"
FT                   /EC_number="5.1.1.1"
FT                   /note="COG0787 Alanine racemase"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_02750"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47361"
FT                   /db_xref="GOA:C4K1B0"
FT                   /db_xref="InterPro:IPR000821"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR011079"
FT                   /db_xref="InterPro:IPR020622"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4K1B0"
FT                   /protein_id="ACR47361.1"
FT                   /translation="MSLCTVEINLSTIKNNYLLLQDVCKTSLVGAAVKANGYGLGAVQI
FT                   SKALIEENCRHFFVASSEEGVNLRNALGLDVNILVLNGVFEHDALELIEYNLTPVLNNL
FT                   KQIEIWQKFSNLKNRLLPCYLHFNTGINRLGLSSDEIEQLINDRDLLKGLDLQYIISHL
FT                   AISEEIDNPYNLEQLNRFKAYLQYFPNVKASLANSGGIFLGQDYHFDLARPGAALYGLN
FT                   PLTKNPVTLKAPIIHLQNLTLDSHIGYNMTFTTKRDSVIATLPLGYADGFSRNFSNQGE
FT                   VFINSRSVPIVGRVSMDLINIDVTDLPPSEIFLGQEAEIIGNYCTPDKIASIIGTIGYE
FT                   VLTNLGSRYKRKYIG"
FT   gene            467691..468470
FT                   /locus_tag="RPR_02755"
FT   CDS_pept        467691..468470
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_02755"
FT                   /product="ABC transporter permease protein"
FT                   /note="COG0767 ABC-type transport system involved in
FT                   resistance to organic solvents, permease component"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_02755"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47362"
FT                   /db_xref="GOA:C4K1B1"
FT                   /db_xref="InterPro:IPR003453"
FT                   /db_xref="InterPro:IPR030802"
FT                   /db_xref="UniProtKB/TrEMBL:C4K1B1"
FT                   /protein_id="ACR47362.1"
FT                   /translation="MLFNIANSVGKRTVKFAQSVGSFSLFSFAAVSSIIRPPLYLSLII
FT                   RQLLFIGFHSLPVVAMTTFFSGAVLALQSYIGFSRFSAESSIATVVVLSLTRELGPVLA
FT                   GLMVAGRVGASIAAEIATMRVTEQVDALYTLSTDPIKYLVFPRVITAIITMPCLVLIGD
FT                   IIGVMGGYLVGVYKLDFNSAAYLTSTFQYLEPIDVISGLVKAGVFGFIISIISCYSGYY
FT                   SGKGAKGVGRATTSAVVNASILILISNYLITELFFKV"
FT   gene            468619..469374
FT                   /locus_tag="RPR_02760"
FT   CDS_pept        468619..469374
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_02760"
FT                   /product="ribonucleotide ABC transporter ATP-binding
FT                   protein"
FT                   /note="COG1127 ABC-type transport system involved in
FT                   resistance to organic solvents, ATPase component"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_02760"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47363"
FT                   /db_xref="GOA:C4K1B2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C4K1B2"
FT                   /protein_id="ACR47363.1"
FT                   /translation="MSVEEFKIKIRSLYKSFANHKVLDGIDLDVKKGSSLVILGGSGSG
FT                   KSVLIKNIVGLIKPDKGKIFIDNVEIQDISSKQKFEIMDGIGFLFQGGALFDSLNIRDN
FT                   ITFETKKLSKKEKNDLAGAKLNAVGLSPRILELYPAELSGGMQKRVALARAICSTPSIL
FT                   FLDEPTTGLDPIMANVINELIIKIQEELEATTITITHDMISAAKIAKEVAMIYQGKIKW
FT                   YGSKDEMRNSDNPYLKQFINGLTTGPIEV"
FT   gene            469376..469624
FT                   /locus_tag="RPR_02765"
FT   CDS_pept        469376..469624
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_02765"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_02765"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47364"
FT                   /db_xref="GOA:C4K1B3"
FT                   /db_xref="InterPro:IPR035116"
FT                   /db_xref="UniProtKB/TrEMBL:C4K1B3"
FT                   /protein_id="ACR47364.1"
FT                   /translation="MFKNLLCIIIFLGINLNVYAINSSSYTTDDIIKIVIILGIVILIF
FT                   SPAKFRIIVIGTMLGLSCAYFTYKYIVPIFISLLNGP"
FT   gene            complement(469702..470106)
FT                   /locus_tag="RPR_02770"
FT   CDS_pept        complement(469702..470106)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_02770"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_02770"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47365"
FT                   /db_xref="UniProtKB/TrEMBL:C4K1B4"
FT                   /protein_id="ACR47365.1"
FT                   /translation="MQIEINSQEYKIFDINDDLVIYTKDLNEEIACSFFSVKLNKIALA
FT                   RNINSQQLEQLITDFNQNELIEQALIKVRIIGGNDSPESSKYLEDIRTTLNGIDNNTNM
FT                   INIIGLDACKNIHPNSFELDGYHGGVRALD"
FT   gene            complement(470189..470473)
FT                   /locus_tag="RPR_02775"
FT   CDS_pept        complement(470189..470473)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_02775"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_02775"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47366"
FT                   /db_xref="UniProtKB/TrEMBL:C4K1B5"
FT                   /protein_id="ACR47366.1"
FT                   /translation="MNLKDQEQTKIVNNLIAKTDYLLSNNLNPLESVRSEINKTLALTH
FT                   STYQQDSNIKKSWIQKIKDLFINIFSSNKTKNEPKLNLTSDKILKKYKY"
FT   gene            complement(470781..471278)
FT                   /locus_tag="RPR_02780"
FT   CDS_pept        complement(470781..471278)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_02780"
FT                   /product="hypothetical protein"
FT                   /note="COG1871 Chemotaxis protein; stimulates methylation
FT                   of MCP proteins, CheD superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_02780"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47367"
FT                   /db_xref="InterPro:IPR011324"
FT                   /db_xref="UniProtKB/TrEMBL:C4K1B6"
FT                   /protein_id="ACR47367.1"
FT                   /translation="MARLALGAAYKTQNRKENSIAQYAYAYSLQQGIVDYEAVRVEQHK
FT                   VGFSDKEKIGTNHIQQCVAVILHDPLTKKTALAHVDRFTDAGALTHDVISNFPPNTQLK
FT                   AYLVGGRDRSAVSISVSDGNIRKVTQELTNHFNVNIKSADIEDKGAPLGIIFDPITGNC
FT                   SG"
FT   gene            472074..472367
FT                   /gene="rpmB"
FT                   /locus_tag="RPR_02800"
FT   CDS_pept        472074..472367
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmB"
FT                   /locus_tag="RPR_02800"
FT                   /product="50S ribosomal protein L28"
FT                   /note="COG0227 Ribosomal protein L28"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_02800"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47368"
FT                   /db_xref="GOA:C4K1B7"
FT                   /db_xref="InterPro:IPR001383"
FT                   /db_xref="InterPro:IPR026569"
FT                   /db_xref="InterPro:IPR034704"
FT                   /db_xref="InterPro:IPR037147"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4K1B7"
FT                   /protein_id="ACR47368.1"
FT                   /translation="MSRKCELTGVGVLYGNNVSHSQRKTRRRFKPNLRSVKFTSDITAG
FT                   EYRLSVNARCISSVEKAGGFDAYILKADDNVLSSNARAIKKKIIQTKTAKSL"
FT   gene            472364..472600
FT                   /locus_tag="RPR_02805"
FT   CDS_pept        472364..472600
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_02805"
FT                   /product="50S ribosomal protein L31"
FT                   /note="COG0254 Ribosomal protein L31"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_02805"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47369"
FT                   /db_xref="GOA:C4K1B8"
FT                   /db_xref="InterPro:IPR002150"
FT                   /db_xref="InterPro:IPR034704"
FT                   /db_xref="InterPro:IPR042105"
FT                   /db_xref="UniProtKB/TrEMBL:C4K1B8"
FT                   /protein_id="ACR47369.1"
FT                   /translation="MKSGIHPEYKKFLIKVGSDVFETMSTHPTGEILMDVDFRKHPAWN
FT                   KDSGNVVNQSNKSVSDFNKRFSGLSFGSKKEAS"
FT   gene            472801..472877
FT                   /locus_tag="RPR_t07792"
FT   tRNA            472801..472877
FT                   /locus_tag="RPR_t07792"
FT                   /product="tRNA-Met"
FT   gene            472958..473596
FT                   /gene="engB"
FT                   /locus_tag="RPR_02810"
FT   CDS_pept        472958..473596
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="engB"
FT                   /locus_tag="RPR_02810"
FT                   /product="GTPase EngB"
FT                   /note="COG0218 Predicted GTPase"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_02810"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47370"
FT                   /db_xref="GOA:C4K1B9"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR019987"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030393"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4K1B9"
FT                   /protein_id="ACR47370.1"
FT                   /translation="MTTQKIVPTKSTDGSKLFRHQAKFVAGAMNINQIPNFSLPEIAFV
FT                   GKSNVGKSSLINTICNNKNLAKVSNTAGRTRQINFFNLADKLIIVDLPGYGFANVPISV
FT                   KEQWGVLISYYLRNSYNLRLVNLLIDSRRGIKENDKKVADLLLANKREFQIIFTKSDKV
FT                   TDHKNLHDEAHNFLATLNYSCNVMYVSNRSKEGARELKASLAKCIKPQK"
FT   gene            473544..474467
FT                   /locus_tag="RPR_02815"
FT   CDS_pept        473544..474467
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_02815"
FT                   /product="acetylglutamate kinase"
FT                   /note="COG0548 Acetylglutamate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_02815"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47371"
FT                   /db_xref="GOA:C4K1C0"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR004662"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="UniProtKB/TrEMBL:C4K1C0"
FT                   /protein_id="ACR47371.1"
FT                   /translation="MQENLKLVWQNASNLKNKEVDSISSLNNIAIIKNIIKCSSELKNQ
FT                   AIVLKLPATIIIDDKLFTAFIESVRLLEMCGAKIYIVHDHIDLRSSSLISQIDENFSQK
FT                   ISKISDYSSLNNPIIMEILSSYVNKLIVTKLSSIGCYAVGISGKDANLLQAKKSKLSYR
FT                   KIVNHDVINIGFLSEPIMINPEILLNFADNNIIPVIAPFASDDQEKTHLLNVNLTLATI
FT                   ASALSAEHLILPYEILQVSETFPYNIKIRDINLLKSMLDDSNNFIEEALIKIAVNALEN
FT                   NNGYVHFVNSEAPNSILSTMFDININ"
FT   gene            474480..474767
FT                   /locus_tag="RPR_02820"
FT   CDS_pept        474480..474767
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_02820"
FT                   /product="type IV secretion system protein VirB3"
FT                   /note="COG3702 Type IV secretory pathway, VirB3 components"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_02820"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47372"
FT                   /db_xref="GOA:C4K1C1"
FT                   /db_xref="InterPro:IPR007792"
FT                   /db_xref="UniProtKB/TrEMBL:C4K1C1"
FT                   /protein_id="ACR47372.1"
FT                   /translation="MAGALASDLLFVGLTRPPMIFGVSIKFAALNMIMTMIVFIWNNGI
FT                   MILFIAAALHLVAYIICFKEPRFIELYLNKMSRTSQCPNKFYYGANSYNI"
FT   gene            474983..477400
FT                   /locus_tag="RPR_02825"
FT   CDS_pept        474983..477400
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_02825"
FT                   /product="type IV secretion system ATPase VirB4a"
FT                   /note="COG3451 Type IV secretory pathway, VirB4 components"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_02825"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47373"
FT                   /db_xref="GOA:C4K1C2"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004346"
FT                   /db_xref="InterPro:IPR018145"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C4K1C2"
FT                   /protein_id="ACR47373.1"
FT                   /translation="MKLFRTRAAKELRSKQERPTSHFIPYKCHWDSNTILTKDNSLLQV
FT                   IKINGFSFETADDEDLDIKKNIRNALLKNMASGNIVMYFHTIRRRKAVIFDDTEFTYDP
FT                   TVKVPNDFITYLGAEWRKKHAGARSFFNELYVSILYKPDTGGVAIVEYFLKKLRQKSNK
FT                   TAWENDMKEMKENLQEMSTRVINTFRSYGARLLGFRQTQSGSYCEILEFLSSLINCGDS
FT                   PGPIALPRGTIDEYLPTHRLFFDSRTIEARSPLGKKYAGMISILEYGPNTSAGIFDGFL
FT                   QMPFEFVMTQSFVFVNRTVAIGKMQLQQNRMIQSGDKATSQIAEINTALDMATSGDIAF
FT                   GEHHLSLLCSANNIKALEDILSMAVVELSNSGIQPVREKVNMEPSYWGQLPGNMDYIVR
FT                   KSTINTLNMASFASQHNYPLGKIRDNHWGEYVTVLDTTSGTPFYFNFHVRDVGHTLIIG
FT                   PTGAGKTVLMNFLCAEAQKFKPRMFFFDKDRGAEIFIRALNGVYTVIDPGLKCNFNPLQ
FT                   LEDTSENRTFILEWLRVLVTSNGESLTAQDNKILSQAVSGNFRLAKQDRRLSNVIAFLG
FT                   IDTPNSLASRIAMWVGKGSHAKIFDNEIDDIDLQKARVFGFDMTELLKDPVSLAPVLLY
FT                   IFHRINISLDGQKTMIVLDEAWALIDNPVFAPKIKDWLKVLRKLNTFVIFATQSVEDAA
FT                   KSRISDTLIQQTATQIFLPNLKATDIYRSAFMLSQREYILIKTTDPATRYFLIKQGIDA
FT                   VVAKVSLDGMDNIISVLSGRVETVILLDQIREKHGNDPDKWLPIFYAAVKTL"
FT   gene            477518..480484
FT                   /locus_tag="RPR_02830"
FT   CDS_pept        477518..480484
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_02830"
FT                   /product="virB6a protein"
FT                   /note="COG3704 Type IV secretory pathway, VirB6 components"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_02830"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47374"
FT                   /db_xref="GOA:C4K1C3"
FT                   /db_xref="InterPro:IPR007688"
FT                   /db_xref="UniProtKB/TrEMBL:C4K1C3"
FT                   /protein_id="ACR47374.1"
FT                   /translation="MKLFPRSILITLVLSFALNLGIVTKTHAKDTLDSIVDILSGLTCE
FT                   TQGVGDLLRTEFSHTCIVAPFFTFAVMNLVSPVLYMNTFLKLKINDSDLFNDSNFGNFP
FT                   GGQCTRENRIDPKNPELRFALCNNAKLIVSRAKSVAESALAIAKAVLTGSDPWDDIKTA
FT                   WANKKKEYHVPYSGKPGDDGFAFDLGFPVIYWKVIQDKDRICVSTKGFTGDVPVGCKYM
FT                   KEPFPKSMYNSFMDVADKDFIENPNKTPTDPLALVSCSAAGDGCYQKAYNASKTAVVMT
FT                   SPLIECMRQMIARLLISKDVCSFDNVSQVVNLVSRQDSAFFQFQVGMYKIVTAFLTLYV
FT                   MFFGFKLLLAGEVPPKSEYINFILKMIFVTYFSIGINITPGNGSPYDRLDGMIQWAFPF
FT                   LLDGINGLASWVMNAAPSGLCKFNNLSYDGTVSYIALWDALDCRVAHYLGLDILSTLLV
FT                   ENAYRSHDFLNFDFFSFSAPPYIYLLIPAIISGNMMLVSLALSYPLLVISVAAFMVNAT
FT                   IICMISIVILGILAPLFVPMFLFAYTRNYFESWVKLMISFLLQPMVVVTFMITMFSVYD
FT                   YGFYGKCQYKSKLIHNSIEDKIQGGITSKRDVLIFYINNDWDDTSQYPDKDAVESCQNS
FT                   LGYMLNNPITTVFNFTKDSVSEIVDSKPGNTPTDKFLAKFQFLSGVVLGPGMFFMSPKV
FT                   LFEKIKNILLALVMACFTLYLMYNFSSQLAEFAADMTEGVALNNFAIKPQAIFKAAMAV
FT                   LATAGAATKGGDQIASRGGVGDLKAGQGGGASDLEVGQGGLPNDNIATSGGTSTPTASS
FT                   SVATSSPKTVSSEARSDVVTPPAPTEAISPPPASIRTSISTPAPRVGQIIRDNNQESKK
FT                   EIDNTPPSQEKVDNAAPQEKVDSTSKGTGVIDYSFNLKEHDNPTGVKQIRENAEIRDKR
FT                   VKVEKAWNELVASGGGRVREQEGGEISERRANAEKAWDELVRSGVVTEKKDNSSNENS"
FT   gene            480471..482456
FT                   /locus_tag="RPR_02835"
FT   CDS_pept        480471..482456
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_02835"
FT                   /product="virB6b protein"
FT                   /note="COG3704 Type IV secretory pathway, VirB6 components"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_02835"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47375"
FT                   /db_xref="GOA:C4K1C4"
FT                   /db_xref="InterPro:IPR007688"
FT                   /db_xref="UniProtKB/TrEMBL:C4K1C4"
FT                   /protein_id="ACR47375.1"
FT                   /translation="MKTLKTLKIFIIVCIASVSLASFAGFGESCSSLPTTSDGYLETDT
FT                   AYGYIIRNIDMKDPRGNCNSVASSITFCFKNVEGSSSPCTMYTLNEGDSKKISDLSTDN
FT                   NPDLGANPVLKNIVLTVKKWDNDLCLVMPTSRGPMPVACKSLSATPTPPPPEDENCNIG
FT                   KSCYTGANYSQSLINFSGLAVQCLSATLNKIFFAGKSCSAQDQNSRITNLTAFSTFQGY
FT                   LKRIIGAALILYTMFFAFNMALNTEYASTEKIALFVIKFLFVAYFSIGLGPLDFSGGHP
FT                   TKENGMLKYGLPLLTGAAPDFAQMIFNAAGSRGLCQFDNSKYKDGYKFYGLWDAIDCRI
FT                   GYYLGLDLLYNIDKNGVLGNVVGNGPRGNNTPIPNFDPEGKNDRPKDLSKAGALRFFTV
FT                   MFGFFMAGNVIILAAGLVFSVIFLSILLYFITHYLVCMITIYVMTYISPIFIPMALFTR
FT                   TKAYFDGWLKVCISCALQPAVVAGFIALLITMYDSAIFKNCEFLRYDYEKGDIRFSTFE
FT                   LRLPVGGADQCQESFGYKMLEYYAGKGWEEHLLILFPIKSIVRDVVSILAELLCVLVFS
FT                   VIFYYFSKSIGRFASDLTNGPNMDAVTASPTKIVGLVKKGAAFLKDAAMASQGKPLVGD
FT                   KPGVGGKRKEGQQQGGDLASGSGGGK"
FT   gene            482463..485363
FT                   /locus_tag="RPR_02840"
FT   CDS_pept        482463..485363
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_02840"
FT                   /product="virB6c protein"
FT                   /note="COG3704 Type IV secretory pathway, VirB6 components"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_02840"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47376"
FT                   /db_xref="GOA:C4K1C5"
FT                   /db_xref="InterPro:IPR007688"
FT                   /db_xref="UniProtKB/TrEMBL:C4K1C5"
FT                   /protein_id="ACR47376.1"
FT                   /translation="MQGNLLKVLEVLAIVATLVCFIFAALGMIGAVKVGDSCYMRYASD
FT                   GQGGADSITGTITLNANANYVNTAKMLSDGTTLLIPDPTRYGEWLNTQVLVENSQSVNL
FT                   QVVGQVSLCLAYIPKDNLQRTGAGSNLDDNGQMIPIPRINDRNNPPVSLIMDAKNNEWR
FT                   NIAELYANDRVLVSVSPNFANTDATVKDAFKGVEVTKDCSENKTTYNPICGKYSVYSGE
FT                   YVNACELKEKYWNCQVTWRCPTWYEQPFCNWGALGCVRSCDKIPECTTKCMAWVNITRP
FT                   APENYLDDESFTFSWSDNTGKLFIDYSALQCSYNANIPPVDQCPDSVRDRSTKDKDYIG
FT                   GVHCTSGICSDGDFQKNRRFWYTADGKGGKGPTGLIYQMNDAGSVSQALPSKLEFAKFV
FT                   ADTDQPPDYKDKDGKYLYKVIYNIPFNSNIAKSYLQYRLWSPTSQDSSKNTGGYVLNIK
FT                   QTKCYRENGNSFNDTFDDRGRVQYIIVKPSENPNTSGKTYSPQGISVDSEGKYSFNANE
FT                   AGYIWMKILNDPGNNLRDYKDSEGSYKVHFSTSLKVGSFTIKVMNPLLQLFKTKVQGAA
FT                   TSIFKNMVCYKANDSSSCTNFFTYIKAILILYVMTYGAMFLLGFAKINQKELVIRIAKI
FT                   GVVSGLMNGNTFEFFNNYLFDAITNFSDSIIANMSGYSLFTSTNTISNPFMFLDAVMSK
FT                   IFFSQTFIAQLLALLSLGLSGIIYFIITFIAVGIVIITALRAVAVYIMAFMATCILIGI
FT                   APLFISFLLFDFTRYLFDNWVRFTIRYMIEPVVMMAGIIVLTQLFTIYLDFVLGYSVCW
FT                   KCALPIKIPFIGTILPIALLNVPIFCINWFAPWGMDYMSGMMGVNMQNIVALVIIAYGM
FT                   YGYVEFSGRMVVKLTSAVGPSATEIGGKMSHDAGQKALSSIGMDDKTRQGITGRAEARL
FT                   KQRNKTLDQAEKNRKNTPKEGGEKTNEEPPKPEIPK"
FT   gene            485537..488212
FT                   /locus_tag="RPR_02845"
FT   CDS_pept        485537..488212
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_02845"
FT                   /product="virB6d protein"
FT                   /note="COG3704 Type IV secretory pathway, VirB6 components"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_02845"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47377"
FT                   /db_xref="GOA:C4K1C6"
FT                   /db_xref="InterPro:IPR007688"
FT                   /db_xref="UniProtKB/TrEMBL:C4K1C6"
FT                   /protein_id="ACR47377.1"
FT                   /translation="MKILKSLVLLVLFMAMPAKADDVFSWMSTSFGGLKSLFGCLEVPE
FT                   FTSFQEGNIGISLSTAGIWQSTGNTVQKGKLLKINWSTSGITPEPRKYLVLYRIDPRFG
FT                   MPQVFIKTYNYSKLQFEALGFPRFVTDNNSETPGTIPPDKDLDALSFTKMSDFVKYFNY
FT                   SNGNSRIEVKAGDVVNISLVGKDNFFSPNTLKLPNTVDNILTQELDSSIFAASALYTQS
FT                   NLGDLDNRIIYSSAEQVCNMIDEERKSVCSGTGTATKYKNTDNGVIVGKPMITGAVQYF
FT                   MGLIKACPANAGINTSPACYYDQGRGMIIKVGGQVIKGRDQSFVNSGSTQSSFIYYQAT
FT                   SGGTMDFTSDWQVSNMFSNSVLMSDWSRNFSNYASFVDYINKNDWSANFLYFGCYSMIV
FT                   EIGNGANSINPDDQQNIKLEYLITSDGTLPDPSVRGTPVDYNFATDAPQDGYLWLRVVN
FT                   PNSNIQGVVSVNYANYTGTTWFSDIIYNGAIKPITDQFRTFSQNFYIKLVKNSAVQNLA
FT                   KTALTLYVTIFGLMFVTGALKLTAVEVITRICKIAIVAFLIREESWSFFNTYFFSVFTD
FT                   GIDFFVTNVLGATSSRSNIFGFIDPIFDKYTNGRIWGLLFIELLQIHNGLAFIAIITIY
FT                   SLITYFRAILEVIIGYVIAFIGVTVMISLAPFFIILMLFEKTKSLFDNWISTLLSYVVQ
FT                   PTILLIFFLLIDQVLSEQLLKVVVRACWDTLIPIKIGLDLTNLGIPIHFSFTLPFLPGI
FT                   PFYVPDVPEISSSNILTNNANTFLVLFTTALLFYSYCLMSYSLVTFVNIVVGMLTNVTP
FT                   ARISGNYQERSDPVGAVMQDIDSVTKPIKKAAMAPARVFKDKIIDQNYKARKLEVGGEF
FT                   TNKFLAERNDVKKEEGEKKE"
FT   gene            488365..491826
FT                   /locus_tag="RPR_02850"
FT   CDS_pept        488365..491826
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_02850"
FT                   /product="virB6e protein"
FT                   /note="COG3704 Type IV secretory pathway, VirB6 components"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_02850"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47378"
FT                   /db_xref="GOA:C4K1C7"
FT                   /db_xref="InterPro:IPR007688"
FT                   /db_xref="UniProtKB/TrEMBL:C4K1C7"
FT                   /protein_id="ACR47378.1"
FT                   /translation="MNKNIFITLLISLLLLSGCTGDTCIDPDDFGFIKFNVSARYDPEE
FT                   ITSRQEGNQVAPWRDSAYKVNGYPLTIMVRPWSYILGDKNTSGQLSAWCPWYGQKNNTT
FT                   TLAAFCVKLQPCTFWDNTRLDMCTPNPANQNDAMISNAPCIMTNGVGLYFLIAAKNTDP
FT                   NISPDSQSKPQGITQHLGEELTSGYELYSTSSTGQFLKAGGINYQYKGEDKSKYAQSPL
FT                   YFKIIDKFYNDNSGQYRLVIKSGVTDTRPDPLQFLTDLIKGVLFGKDGIIKKTYQQIID
FT                   TSGYRMSVSAILTLYIMFTGFSFFIGNINLTHVELIVRILKVSIVSILLSTDKAWTFFH
FT                   DYLFVFFIDGVQQILQIINEASATGPGSQSLLGLLISPQTLSKLFSLLFVDWLGFIYII
FT                   LYLIALYFIFFLIFKATIIYLTALITIGMIIIMGPIFICFMLFNITRSLFENWLRQLIS
FT                   YALQPIILFTGIVFISMIIRTEIYSTLGFAVCKHDFPNLGPINEIFGSFLEDIDPSLGH
FT                   SIFYWWFPVPMKGGINNFHKANILVPKDHIIVDDSCKNDPDKCKHCAAYECIDERYIEL
FT                   PFLDLVKDAKRISNFINGKFVQLDGILLIFVSIYLLSKFNDTAISTAQFIAGTSGNLTE
FT                   IQKVNQQSYESAAKQMNRPLNYVAKTVSAPVTSSVSAGKEQVRMFFAEKFENMMMGRLE
FT                   KQALGSSANKTVQNEVKRKYGIDSKDVKMNAITDYENGIAGLLKNLPKGNELKAKELSQ
FT                   MKFTQLRDKIAANKYGVKDYAALSKEQKAELDKSLKDANLRELASDANFTRDYQDAYKN
FT                   AHQEMSGRGVGLFGKNIGVLRSWQEIEHRVDTKRKLKEEKRVGIGEKIYAGYTGIKRGV
FT                   LTAIVGKDLRDAYEGNLTSAEWHDFEYNDPRLRTYSEKLKDDEKAREHEELQMHINKEA
FT                   LAAQADILSPEYLAILEKAGRHSDVEYYQELAQRKLIHEVHGRLFEEGEPVMMGDRFMR
FT                   EKATDSQMRDMIDNAHRKHAEFIDGDRYIRRQEHYDIMHEKAQENLEQTYKELKDHFKR
FT                   DDIKIEEMPALIAQKVKDTAEGAEIDQKITEELNNFNADVKNYEYSTEVLNKIEDRKQA
FT                   ITDEVNAQIDKINKYRENAKMQTYVKPIVNEGRKLRKLEDHLRNMK"
FT   misc_feature    492394..493447
FT                   /note="authentic frameshift: common BLAST hit:
FT                   gi|67458488|ref|YP_246112.1| phosphate acetyltransferase"
FT   misc_feature    493447..494480
FT                   /note="authentic frameshifts: common BLAST hit:
FT                   gi|67458489|ref|YP_246113.1| acetate kinase"
FT   gene            495051..495755
FT                   /gene="trmD"
FT                   /locus_tag="RPR_02885"
FT   CDS_pept        495051..495755
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trmD"
FT                   /locus_tag="RPR_02885"
FT                   /product="tRNA (guanine-N(1)-)-methyltransferase"
FT                   /note="COG0336 tRNA-(guanine-N1)-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_02885"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47379"
FT                   /db_xref="GOA:C4K1C8"
FT                   /db_xref="InterPro:IPR002649"
FT                   /db_xref="InterPro:IPR016009"
FT                   /db_xref="InterPro:IPR023148"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4K1C8"
FT                   /protein_id="ACR47379.1"
FT                   /translation="MSILHATILTVFPEMFPGTLGHSLAGQALNKNIWSYDVINIRDFG
FT                   LTKHKNIDDEAYGGGNGLIMRPDVLGSSIDHALALNPNAEMYYPSPRGRVFTQSFAKEM
FT                   LKNKNLIFLCGRYEGIDERVIEEYNVKEISVGDYILSGGEMPTLTILDCLIRLLPGVLM
FT                   NQNTLSSESFEEDGEFKGGLECSLYTRPEIWRDRAVPSVLLSGNHRLINEWKKEQSHMI
FT                   TKLRRPELLKDL"
FT   gene            495773..496189
FT                   /gene="rplS"
FT                   /locus_tag="RPR_02890"
FT   CDS_pept        495773..496189
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplS"
FT                   /locus_tag="RPR_02890"
FT                   /product="50S ribosomal protein L19"
FT                   /note="COG0335 Ribosomal protein L19"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_02890"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47380"
FT                   /db_xref="GOA:C4K1C9"
FT                   /db_xref="InterPro:IPR001857"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR018257"
FT                   /db_xref="InterPro:IPR038657"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4K1C9"
FT                   /protein_id="ACR47380.1"
FT                   /translation="MNIIDRFEQENISKRTANKKIPDFEAGDTVKVTVKIVDRSIEKDG
FT                   KEKLTERFQAYEGVVIAKRNRSITSSFLVRKISHGEGVERRFMTYSPIVHSIDVVKYGV
FT                   VRRAKLYYLRNRSGKSARIKERHIPIAKTKAAKA"
FT   gene            496395..497489
FT                   /locus_tag="RPR_02895"
FT   CDS_pept        496395..497489
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_02895"
FT                   /product="transposase ISRpe1"
FT                   /note="COG2801 Transposase and inactivated derivatives"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_02895"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47381"
FT                   /db_xref="GOA:C4K1D0"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:C4K1D0"
FT                   /protein_id="ACR47381.1"
FT                   /translation="MNLNQKIIKPKIGLLELAKSLGSISSACKAMGYSRDSYYRFKALY
FT                   ETGGEEALYEISRRKPIIANRVDPAIEKAVMDMAIEYPAYGQLRVSNELKKSGILVSPG
FT                   GVRSIWLRNDLNNISKRLKALEAKMAQDGIVLTESQLQVLEERRNEREAHGETETQHPG
FT                   YLGCQDTYYVGNFKGIGKVYSQVFIDSYTRVADAKLYTDKTALTAADMLNDRVLPWYET
FT                   QGIPILRILTDRGSEYKGNIEHHAFELFLSIEGIEHTTTKTYSPQTNGMCERFNKTMKQ
FT                   EFFYTAMRKKIYTDLDDLQLDLDIWLEHFNNERPHSGKYCYGKTPMQTFKDSRKLAVEK
FT                   NNEILYLEYVSDSQNLTDNQVQNL"
FT   misc_feature    497525..497869
FT                   /note="COG0338 Site-specific DNA methylase C-terminal
FT                   fragment, truncated by transposon"
FT   misc_feature    complement(497903..499606)
FT                   /note="authentic frameshifts in hypothetical rickettsial
FT                   gene"
FT   gene            complement(499745..499821)
FT                   /locus_tag="RPR_t07794"
FT   tRNA            complement(499745..499821)
FT                   /locus_tag="RPR_t07794"
FT                   /product="tRNA-Val"
FT   gene            500043..500321
FT                   /locus_tag="RPR_02925"
FT   CDS_pept        500043..500321
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_02925"
FT                   /product="transcriptional regulator"
FT                   /note="COG1396 Predicted transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_02925"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47382"
FT                   /db_xref="GOA:C4K1D1"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:C4K1D1"
FT                   /protein_id="ACR47382.1"
FT                   /translation="MKNFDEFKKELLSNPEVKKAYEERKMEFEIASTLIKVRLASNMTQ
FT                   ADVAKKLSNSQAQIARMDSGHHIPNFLSLQKYAKAVNQKINLLITPS"
FT   gene            500444..501103
FT                   /gene="cmk"
FT                   /locus_tag="RPR_02930"
FT   CDS_pept        500444..501103
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cmk"
FT                   /locus_tag="RPR_02930"
FT                   /product="cytidylate kinase"
FT                   /EC_number="2.7.4.14"
FT                   /note="COG0283 Cytidylate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_02930"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47383"
FT                   /db_xref="GOA:C4K1D2"
FT                   /db_xref="InterPro:IPR003136"
FT                   /db_xref="InterPro:IPR011994"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4K1D2"
FT                   /protein_id="ACR47383.1"
FT                   /translation="MVDLKTKAFDISQNFTISLDGPAASGKGTIGLILAKKFSLKYFQS
FT                   SIVYRQLAFDCISQKIDVTDIDAVIALSKELKLDNNFDLENENIGNIASQIAVISEIRN
FT                   NLNKYLINLVKTTPRMIMEGRDIGTVVAPDADLKIFITANPQIRAERRYKQLQAKGKTC
FT                   ILDEILRQIILRDKRDKERKAAPLLPASDALIIDTSKLSAMEVVEEVTNYIKNKIT"
FT   gene            501358..503064
FT                   /gene="rpsA"
FT                   /locus_tag="RPR_02935"
FT   CDS_pept        501358..503064
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsA"
FT                   /locus_tag="RPR_02935"
FT                   /product="30S ribosomal protein S1"
FT                   /note="COG0539 Ribosomal protein S1"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_02935"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47384"
FT                   /db_xref="GOA:C4K1D3"
FT                   /db_xref="InterPro:IPR000110"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/TrEMBL:C4K1D3"
FT                   /protein_id="ACR47384.1"
FT                   /translation="MSIKLKQRFVPQLAAMNHEFAEDFSKMLETVDTSHIKEKTVVKGQ
FT                   VIEIKNDIIIVDVGLKNEGRIPKSEFLALPEVGDVVEVFIEKIEGRNGRTILSREKAVK
FT                   EELWGQLEIMCSKGEFVDGTIFGRVKGGFTVDLSGVVAFLPGSQVDVRPIKDPTSIMNI
FT                   KQPFKILSMDKKLGNIVVSRRAILEESRSEARDEMLSKIKEGMVLEGTVKNITDYGAFI
FT                   DLGSVDGLLHLTDISWGRVNHPSEVLDFNQKVKVMVIKFDEKTNRISLGIKQLDSNPWE
FT                   AVKEEFPVGKQMTGKVTNFADYGIFIELKDGLEGLVHSSEISWLKSNQNPRKTLTIGQE
FT                   VEFVVLEVDTEKHRVSLSIKQCQENPLTKFAENNPVGTIIKAPIRNITDFGIFVALGNN
FT                   MDGMIHEGDISWEDKGTDLLKSYKKGDEIECKVLAINIEKEQVSLGIKQLSPNPYQEIS
FT                   DEYKKGTIVKALITEVKDEGLEVLLNDKVAGFIKRTELSDEKDEQKSEMFQIDTEIEAK
FT                   VVSIEKSTGRILLSVKAHKIAERQKALKAYGSSDNTTNMGDILANALEDKK"
FT   gene            503224..503829
FT                   /gene="clpP"
FT                   /locus_tag="RPR_02940"
FT   CDS_pept        503224..503829
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="clpP"
FT                   /locus_tag="RPR_02940"
FT                   /product="ATP-dependent Clp protease proteolytic subunit"
FT                   /EC_number="3.4.21.92"
FT                   /note="COG0740 Protease subunit of ATP-dependent Clp
FT                   proteases"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_02940"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47385"
FT                   /db_xref="GOA:C4K1D4"
FT                   /db_xref="InterPro:IPR001907"
FT                   /db_xref="InterPro:IPR018215"
FT                   /db_xref="InterPro:IPR023562"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR033135"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4K1D4"
FT                   /protein_id="ACR47385.1"
FT                   /translation="MSYVPIVVEPTSRGERAYDIYSRLLKERIIFVCSTVEDHMANLIV
FT                   AQLLFLEAENPKKDIYMYINSPGGVVTAGLAIYDTMQYIKPKVATLCIGQACSMGSLLL
FT                   CGGEKGMRYSLPHSRIMIHQPSGGYKGQATDIEIHAQETLKIKRLLNELYSKHTEQELK
FT                   HIEKSMERDNFMSPEEAKKFGLVDNIMSSRDAMTLLAK"
FT   gene            503992..504067
FT                   /locus_tag="RPR_t07796"
FT   tRNA            503992..504067
FT                   /locus_tag="RPR_t07796"
FT                   /product="tRNA-Ala"
FT   gene            504401..504568
FT                   /locus_tag="RPR_02945"
FT   CDS_pept        504401..504568
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_02945"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_02945"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47386"
FT                   /db_xref="UniProtKB/TrEMBL:C4K1D5"
FT                   /protein_id="ACR47386.1"
FT                   /translation="MPHIKLWWDKDIEWSLELIEQKYSSYVIGYKLENNEPKNIHAYII
FT                   EADCTPLQCL"
FT   gene            504847..505875
FT                   /locus_tag="RPR_02950"
FT   CDS_pept        504847..505875
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_02950"
FT                   /product="isopentenyl pyrophosphate isomerase"
FT                   /EC_number="5.3.3.2"
FT                   /note="COG1304 L-lactate dehydrogenase (FMN-dependent) and
FT                   related alpha-hydroxy acid dehydrogenases"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_02950"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47387"
FT                   /db_xref="GOA:C4K1D6"
FT                   /db_xref="InterPro:IPR000262"
FT                   /db_xref="InterPro:IPR011179"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4K1D6"
FT                   /protein_id="ACR47387.1"
FT                   /translation="MLKDQNLDIERKQDHIEINLTKNVESTLKSGFESIHFIHNALPEI
FT                   NYDSVNTTTTFLGKSLQAPILISSMTGGTTRARDINYRLAQVAQKAGIAMGLGSMRVLL
FT                   TEPDTIKTFAVRHIAPDIPLLANIGAVQLNYGVTPKECQYLVDAIKADALILHLNVLQE
FT                   LTQPEGNRNWEKLLPKIREVVHYLSIPVIVKEVGYGLSKKVAESLIEAGVKVLDIAGSG
FT                   GTSWSQVEAYRATNSLQNRIASSFINWGIPTLDSLKMVREVSKDIPIITSGGLKSGIDG
FT                   AKAIRIGANIFGLAGQFLKAADTSESLLFEEIQLIIEQLKITMLCTGSRTLKDLAKAEI
FT                   RL"
FT   gene            complement(505906..507000)
FT                   /locus_tag="RPR_02955"
FT   CDS_pept        complement(505906..507000)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_02955"
FT                   /product="transposase ISRpe1"
FT                   /note="COG2801 Transposase and inactivated derivatives"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_02955"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47388"
FT                   /db_xref="GOA:C4K0U7"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:C4K0U7"
FT                   /protein_id="ACR47388.1"
FT                   /translation="MNLNQKIIKPKIGLLELAKSLGSISSACKAMGYSRDSYYRFKALY
FT                   ETGGEEALYEISRRKPIIANRVDPAIEKAVMDMAIEYPAYGQLRVSNELKKSGILVSPG
FT                   GVRSIWLRNDLNNISKRLKALEAKMAQDGIVLTESQLQVLEERRNEREAHGETETQHPG
FT                   YLGCQDTYYVGNFKGIGKVYSQVFIDSYTRVADAKLYTDKTALTAADMLNDRVLPWYET
FT                   QGIPILRILTDRGSEYKGNIEHHAFELFLSIEGIEHTTTKAYSPQTNGMCERFNKTMKQ
FT                   EFFDTAMRKKIYTDLDDLQLDLDIWLEHFNNERPHSGKYCYGKTPMQTFKDSRKLAVEK
FT                   NNEILYLEYVSDSQNLTDNQVQNL"
FT   misc_feature    complement(508153..508990)
FT                   /note="authentic frameshifts: common BLAST hit:
FT                   gi|157826229|ref|YP_001493949.1| S-adenosylmethionine
FT                   synthetase"
FT   gene            complement(509354..511981)
FT                   /locus_tag="RPR_02990"
FT   CDS_pept        complement(509354..511981)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_02990"
FT                   /product="DNA polymerase I"
FT                   /note="COG0258 5'-3' exonuclease (including N-terminal
FT                   domain of PolI)"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_02990"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47389"
FT                   /db_xref="GOA:C4K1D8"
FT                   /db_xref="InterPro:IPR001098"
FT                   /db_xref="InterPro:IPR002298"
FT                   /db_xref="InterPro:IPR002421"
FT                   /db_xref="InterPro:IPR008918"
FT                   /db_xref="InterPro:IPR018320"
FT                   /db_xref="InterPro:IPR019760"
FT                   /db_xref="InterPro:IPR020045"
FT                   /db_xref="InterPro:IPR020046"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="InterPro:IPR036279"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:C4K1D8"
FT                   /protein_id="ACR47389.1"
FT                   /translation="MTQKNTLLLIDGYGFVFRAYYAQQPLTSPKGEPVGALYGFTSMLL
FT                   KLLSDFKPKHVAVVFDSGGKNFRHQIYPDYKANRPPPPEDLIVQLPLVRDVASNLNFPI
FT                   LEKNGYEADDIIATFATKTAALGEHVVIISSDKDLLQLMTENIKIYDPLKGKYITEDDV
FT                   VKKFGTTSDKLREVMALIGDRSDNIPGVPSIGPKTASSLITQFGSVENIFNSLDQVSSV
FT                   KQRETLQNSRETALISWQLIGLNSNVDLDFQLNNLEWSPPNSDKLTGFLQEYGFRSLYK
FT                   RVENLLDIKINDYKEIADNKVTEIKEINNANELADFAKEATKIGIFGIYLLQHKGANLA
FT                   FILSLQNQSYIIKISNTSHDLFSYNTKTNNNWFSNIIFNLLTDKSIKKITYSLKPLLKF
FT                   YANQSHDITAIEDLELMQYALSAGLSQKNLFKEVLKETWIENIIIESAKIVINFITLYK
FT                   QTIWELKDNKTFRLYSNIDLPICFILDKMEKVGITVDANYLKQLSAEFGTEILKLEEEI
FT                   FALSGTKFNIGSPKQLGEILFEKMQLPFGKASAKASSYSTGAEILEKLSEHGYNIADLL
FT                   LRWRQLTKLKNTYTDSLPKQIDNITHRVHTKFLQTSTTTGRLSSQEPNLQNVPIRSSEG
FT                   NQIRQAFIAKEGYKLISADYSQIELRILSHIANIDALKQAFINKDDIHTQTACQIFNLQ
FT                   KHELTSEHRRKAKAINFGIIYGISAFGLAKQLNVTNGEASEYIKKYFAEYKGVQEYMEQ
FT                   TKAFASSNGYVTNCFGRKCFVPLIHDKKLKQFAERAAINAPIQGTNADIIKIAMINLDQ
FT                   EIEKRKLKTRLVLQIHDELLFEAPIDEVEIITPIIKKIMENSTNMDVPIITEIRAGNNW
FT                   MEIH"
FT   gene            complement(512145..513056)
FT                   /locus_tag="RPR_02995"
FT   CDS_pept        complement(512145..513056)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_02995"
FT                   /product="cell division protein"
FT                   /note="COG0552 Signal recognition particle GTPase"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_02995"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47390"
FT                   /db_xref="GOA:C4K1D9"
FT                   /db_xref="InterPro:IPR000897"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004390"
FT                   /db_xref="InterPro:IPR013822"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036225"
FT                   /db_xref="InterPro:IPR042101"
FT                   /db_xref="UniProtKB/TrEMBL:C4K1D9"
FT                   /protein_id="ACR47390.1"
FT                   /translation="MISIFSKLKQSLSKTSNKISEGIDKIFYKKKLDAETLEELEELLI
FT                   SSDMSVLVVTNIIEEFKKVKFDKEIDSDTVKEALAKLIEQQLSKSEIPFTLSENKLNVI
FT                   LVCGVNGAGKTTTIGKLAAMYSAQGKKVAVAACDTFRAAAVNQLSTWADRANVLLITGE
FT                   ESADPASVAYRGMEESIKQNIDILFIDTAGRLHNKKNLMDELSKIVKVIKKLDENAPTH
FT                   SVLVIDAITGQNTYNQVEHFNDATNLTGLIVTKLDGSAKAGVIVGVVQKFNLPLYFIGI
FT                   GEKIEDLKIFNQHDFARNIVGL"
FT   gene            complement(513260..513733)
FT                   /locus_tag="RPR_03000"
FT   CDS_pept        complement(513260..513733)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_03000"
FT                   /product="SmpA/OmlA family lipoprotein"
FT                   /note="COG2913 Small protein A (tmRNA-binding)"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_03000"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47391"
FT                   /db_xref="GOA:C4K1E0"
FT                   /db_xref="InterPro:IPR007450"
FT                   /db_xref="InterPro:IPR037873"
FT                   /db_xref="UniProtKB/TrEMBL:C4K1E0"
FT                   /protein_id="ACR47391.1"
FT                   /translation="MKIFITYIFSILAFFSLSGCKTIENRGQSIDDSALVKLESKKLNK
FT                   TEVVELIGTPTIVPEYSQNTWYYVERVMSQRAWLNPKIEKQKIVKITFDANNFMQEVVV
FT                   IDDSHRQDIERVHEYTRTYGTELNGLQKFVKNLGRFNKTTDRNKNKSKNKKKR"
FT   gene            513829..514029
FT                   /gene="rpmF"
FT                   /locus_tag="RPR_03005"
FT   CDS_pept        513829..514029
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmF"
FT                   /locus_tag="RPR_03005"
FT                   /product="50S ribosomal protein L32"
FT                   /note="COG0333 Ribosomal protein L32"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_03005"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47392"
FT                   /db_xref="GOA:C4K1E1"
FT                   /db_xref="InterPro:IPR002677"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4K1E1"
FT                   /protein_id="ACR47392.1"
FT                   /translation="MAVPKKKTSKSRRNMRRSHLALGKVNVIVDSQTGEYKLPHHVSLV
FT                   DGTYNNRLVVTKKIKTEEEVA"
FT   gene            514037..514993
FT                   /locus_tag="RPR_03010"
FT   CDS_pept        514037..514993
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_03010"
FT                   /product="3-oxoacyl-(acyl carrier protein) synthase III"
FT                   /EC_number="2.3.1.41"
FT                   /note="COG0332 3-oxoacyl-[acyl-carrier-protein] synthase
FT                   III"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_03010"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47393"
FT                   /db_xref="GOA:C4K1E2"
FT                   /db_xref="InterPro:IPR004655"
FT                   /db_xref="InterPro:IPR013747"
FT                   /db_xref="InterPro:IPR013751"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="UniProtKB/TrEMBL:C4K1E2"
FT                   /protein_id="ACR47393.1"
FT                   /translation="MTCKIIGCGGYLPSKIVSNDELAKFVDTNDEWIRTRTGITQRHIA
FT                   GDTEYTSHLALKSAEKAIADAGISVNDIDLIIICTTTPDNSFPSVASKLQGYLGLTNIP
FT                   SFDLQAVCAGFVYGLQVANSLISSDKYKTILLIGAEKMTSLLDWNDRTTCVLFGDGAGS
FT                   VILQRSSDDSGLIDSNIFSSGADYDEILYTNGGVSMNGISGKIVMQGQKLFRHAIEKMQ
FT                   QSIKDLLHANQFSVSDIDYFIPHQANIRIINKLAELLNIEEHKVVKTVDKHANCSAASI
FT                   PLALSTLKASGKIKKGDILLFSAIGAGLTWGSAFIRW"
FT   gene            515481..515948
FT                   /locus_tag="RPR_03020"
FT   CDS_pept        515481..515948
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_03020"
FT                   /product="peptidoglycan-associated lipoprotein precursor"
FT                   /note="COG2885 Outer membrane protein and related
FT                   peptidoglycan-associated (lipo)proteins"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_03020"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47394"
FT                   /db_xref="GOA:C4K1E3"
FT                   /db_xref="InterPro:IPR006664"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR014169"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="InterPro:IPR039001"
FT                   /db_xref="UniProtKB/TrEMBL:C4K1E3"
FT                   /protein_id="ACR47394.1"
FT                   /translation="MKTKITLAFLALCVLAGCNTTKRAPQFDGNMNQSEETSLMKDFEK
FT                   HAGNAVWFAFDSSALSPKAKEELERQACWLSKHPEVKVTVEGHCDERGTKNYNLGLGER
FT                   RAAAAKKFLAHKGIDHNRLNTISYGKDRPAMMGNTEEAFAYNRRAVTVVHH"
FT   gene            516258..516334
FT                   /locus_tag="RPR_t07798"
FT   tRNA            516258..516334
FT                   /locus_tag="RPR_t07798"
FT                   /product="tRNA-Met"
FT   gene            516376..517464
FT                   /locus_tag="RPR_03025"
FT   CDS_pept        516376..517464
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_03025"
FT                   /product="hypothetical protein"
FT                   /note="COG0795 Predicted permeases"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_03025"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47395"
FT                   /db_xref="GOA:C4K1E4"
FT                   /db_xref="InterPro:IPR005495"
FT                   /db_xref="UniProtKB/TrEMBL:C4K1E4"
FT                   /protein_id="ACR47395.1"
FT                   /translation="MINLKTLSWYLTKLYSKCFFIILFLLIGLLIISNVFDLLQKFKNI
FT                   YVPFSFFWRLILYKIPYLLGQVSSLISFTAMLFFLRNLTKNNELTAMLSSGIHIWQVLV
FT                   IPCIVTLMLGIVFTTILNPIGTIGLQKYELLEAKLTKKALSEGIISKSGLLFFESLNDE
FT                   TQIIQTQFINVAEKKLNNITILFVDHNNSFLKRIDALYGIIENKMLHLNRVKVFTKEET
FT                   KAYNNLTMQTNLSINSLVNKFIRPEMVSIWALPKLINELLNSGLPAINYQIYYYKQLFK
FT                   PIMMMATVILASCFISLKQRDNSQEKILLLGLFSGFIAYSLSEILLKILTYNNLSLIAA
FT                   ILLPSMLIFFISNFIMLHYKEI"
FT   gene            517675..518715
FT                   /locus_tag="RPR_03030"
FT   CDS_pept        517675..518715
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_03030"
FT                   /product="rod shape-determining protein MreB"
FT                   /note="COG1077 Actin-like ATPase involved in cell
FT                   morphogenesis"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_03030"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47396"
FT                   /db_xref="GOA:C4K1E5"
FT                   /db_xref="InterPro:IPR004753"
FT                   /db_xref="UniProtKB/TrEMBL:C4K1E5"
FT                   /protein_id="ACR47396.1"
FT                   /translation="MIMKFLEGFSSGMAIDLGTANTIVYQKNCGIVLREPSVIALIKKD
FT                   GAFVPYAYGHEAKMMLGRTPTDIEAKRPLKDGVIADFKGAEEMIKYFIRMVHNRRSFFG
FT                   PTIVICVPSGSTPVERRAIQEAAESAGGRDVYLIEEPMAAAIGAGLPVTEATGSMIVDI
FT                   GGGTTEVAVLSLGGIVYARSVRVGGDKMDAAIISYIRRHYNLLIGEATAEKIKQEIGTA
FT                   YVDENAEPRKMEIKGRDLIYGIPKEMILNERQIADSLIEPVSQIVEAVKVALEATPPEL
FT                   SSDIVDKGIVLTGGGSLLRNLDFVLSEATKLPVIVADDALSCVALGTGKVLEDFTKLKH
FT                   VLFKQD"
FT   gene            518727..519566
FT                   /locus_tag="RPR_03035"
FT   CDS_pept        518727..519566
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_03035"
FT                   /product="rod shape-determining protein MreC"
FT                   /note="COG1792 Cell shape-determining protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_03035"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47397"
FT                   /db_xref="GOA:C4K1E6"
FT                   /db_xref="InterPro:IPR007221"
FT                   /db_xref="InterPro:IPR042175"
FT                   /db_xref="InterPro:IPR042177"
FT                   /db_xref="UniProtKB/TrEMBL:C4K1E6"
FT                   /protein_id="ACR47397.1"
FT                   /translation="MAILANRVKNSSNSLELIRIISNTLKRFFVIFGLGLSVYLFFATP
FT                   KKISSISLEVTGSIVSIGLAVYEDIFEYINSITQKFVYFQDLERKNIELKLEIARLQHL
FT                   QSEVELVRAENIALKDLLTIAEEEEFEYITTKLLSVSFNPFSRTALISAGKKQGIEPDQ
FT                   IVVNTGKLVGKVIEVSNNYAKVMLISDVNSRIPIKANSSREQGILAGNNNNSKILYLPN
FT                   NHLVQKDEEIVTSGHGNIYPAGILVGYVSKVTEHDVMVNVAADLSKTEFVQVLLPKE"
FT   gene            519920..520156
FT                   /locus_tag="RPR_03040"
FT   CDS_pept        519920..520156
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_03040"
FT                   /product="hypothetical protein"
FT                   /note="COG1396 Predicted transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_03040"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47398"
FT                   /db_xref="GOA:C4K1E7"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:C4K1E7"
FT                   /protein_id="ACR47398.1"
FT                   /translation="MALATKVKEFLEEKLKQEKIDRKYLAEVTNIPYTTVSRIMRAEAN
FT                   REFNPEIDTILKIAKYFNCTMDEVIKRKVRNNS"
FT   gene            520297..520986
FT                   /gene="gmk"
FT                   /locus_tag="RPR_03045"
FT   CDS_pept        520297..520986
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gmk"
FT                   /locus_tag="RPR_03045"
FT                   /product="guanylate kinase"
FT                   /EC_number="2.7.4.8"
FT                   /note="COG0194 Guanylate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_03045"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47399"
FT                   /db_xref="GOA:C4K1E8"
FT                   /db_xref="InterPro:IPR005728"
FT                   /db_xref="InterPro:IPR008144"
FT                   /db_xref="InterPro:IPR008145"
FT                   /db_xref="InterPro:IPR017665"
FT                   /db_xref="InterPro:IPR020590"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C4K1E8"
FT                   /protein_id="ACR47399.1"
FT                   /translation="MTTKNKRVLQKCAYREEFKGDMERSTAATSKLPLEVELSRNSKGL
FT                   IIILSSPSGTGKSSLAKALLKIDNNLRLSISATTRKPRLGEVEGINYYFKTGLEFEELV
FT                   KQNKFLEYAKIYDNYYGTPKEYVEMLLNQGLDVLFDIDWQGARSIKKNATNVVAIFVLP
FT                   PNIEVLEQRLRNRATDNEEAIKLRMQSAQNEISHANEYDYVVTNDDFDRTLKKIHAIIV
FT                   AARDKAF"
FT   gene            521056..522210
FT                   /locus_tag="RPR_03050"
FT   CDS_pept        521056..522210
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_03050"
FT                   /product="ATPase"
FT                   /note="COG1373 Predicted ATPase (AAA+ superfamily)"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_03050"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47400"
FT                   /db_xref="InterPro:IPR025420"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041682"
FT                   /db_xref="UniProtKB/TrEMBL:C4K1E9"
FT                   /protein_id="ACR47400.1"
FT                   /translation="MLRKQFLSSIIKHFKTHKVCALLGPRQCGKTTLSKQFVEAYNIPK
FT                   INIFDLENPLDLARLNEPMLALSDLKGFVIIDEIQYKPNLFPILRVLVDTTDIKFLVLG
FT                   SASRDLIKQGSETLAGRIGYIEMTPFTLSEVSGTQQLWIRGGFPLSYLADDEELSALWR
FT                   QNYIKTFLERDIPNLGFTIPSMQLRRFWLMLCHYHANILNASELGNSLSISYHTAKHYL
FT                   DILEGTFMIRILQPWYENLKKRQVKTPKIFFRDSGIYHALLGLNNYEALSTHPKIGASW
FT                   EGFALEQIVRYYKAEPEECYFWSSHNGAEIDLLIFKNGKRLGFEIKYTNTPSITKSMQI
FT                   SLEDLKLDQINVIFPGEISFKLSEKIQAIGLSSLIQNDTKAATI"
FT   gene            complement(522476..523543)
FT                   /locus_tag="RPR_03060"
FT   CDS_pept        complement(522476..523543)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_03060"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_03060"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47401"
FT                   /db_xref="UniProtKB/TrEMBL:C4K1F0"
FT                   /protein_id="ACR47401.1"
FT                   /translation="MSDITATLKYKFDNLKEHLNNSYSRSQIEIILGELSSLQSEAASY
FT                   GLNFDISNLKETAETKLKNYEVEQSIEKARVQEEFLKSQRVIKLAEEEKEIAQRIAALN
FT                   NLYNEFIKNITKDTKRIEESNKRLDKIINKLEKENIIDHEELNREILTHEEIFKLNQAY
FT                   KVLHKNHKKITEEHKQAHTELNELNKTITNLSQQLQEKGLAPKKVKALKGELEFHQEML
FT                   KIRKAHVEKIENSKKILDQEIIKHEKEHNINKDKIKKLGSDIKERYKKEPEKYLDAYEK
FT                   YLVLKHQHKAIKTDGVVKDIEHHNKVLNKINVDKTKSLANKIRAQTQVKDTNTGSLSPA
FT                   RTPNIKVTNNKTRGI"
FT   gene            complement(523620..525401)
FT                   /locus_tag="RPR_03065"
FT   CDS_pept        complement(523620..525401)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_03065"
FT                   /product="ABC transporter ATP-binding protein Uup"
FT                   /note="COG0488 ATPase components of ABC transporters with
FT                   duplicated ATPase domains"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_03065"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47402"
FT                   /db_xref="GOA:C4K1F1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032524"
FT                   /db_xref="InterPro:IPR037118"
FT                   /db_xref="UniProtKB/TrEMBL:C4K1F1"
FT                   /protein_id="ACR47402.1"
FT                   /translation="MTPIYYIKDGNLSFADKVILSDLELYLYTGDKICLIGRNGCGKSS
FT                   LMKVISGDYELDNGALFQDPLVTTGYLRQDISIKTHLTVYDFVLQQTDSTKEIDKYQID
FT                   IILEKLQINGTDNLSTYSGGQLRRASLAKTLILEPEMLLLDEPTNHLDIATIEWLEEFV
FT                   KSYNGAIICVSHDRTFLSNVTNKIWWLDRGILRKSDKGFKFFDEWQTIIIDQEEAALRK
FT                   LNKKLSQENEWLNAGVTARRKRNQKRLADLKALRAITQEQTAKLASSTQRVRAELAENI
FT                   AKSKFIIEADNITFSYKNTKIIDNFSFRVKNGEKIGIIGANGSGKSTFIKLLTKQLTPE
FT                   SGKIIYGGNLDISYFDQHREKLEPNHTLQQTLCPTGGDQVFLPHGKTMHVAGYLKQFMF
FT                   NPKLLNAKTAILSGGEANRLLLAKILINPGNLLILDEPTNDLDMDSLEILLDILTDYSG
FT                   TLIVVSHDRDFLDRLVTRTLVFAQGKIHDSTGGYEDYKQYFTTSPIAKKASKPLPLTAQ
FT                   KEPLNKKLSYKYQRLLETLPNYIEKLEISIKHLEKELEDVNLYLDNPQKYNRITSQLIN
FT                   DKKKLDELLNQWLEIQD"
FT   gene            complement(525683..526969)
FT                   /locus_tag="RPR_03070"
FT   CDS_pept        complement(525683..526969)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_03070"
FT                   /product="3-oxoacyl-(acyl carrier protein) synthase II"
FT                   /EC_number="2.3.1.41"
FT                   /note="COG0304 3-oxoacyl-(acyl-carrier-protein) synthase"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_03070"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47403"
FT                   /db_xref="GOA:C4K1F2"
FT                   /db_xref="InterPro:IPR000794"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR017568"
FT                   /db_xref="InterPro:IPR018201"
FT                   /db_xref="InterPro:IPR020841"
FT                   /db_xref="UniProtKB/TrEMBL:C4K1F2"
FT                   /protein_id="ACR47403.1"
FT                   /translation="MSNQRVNKRVVITGLGLVTPVGLNVNSSWKNIVDGVSGIKTITEF
FT                   DTSKLACKIAGLIDNSEKDGFKLENFTQADDINRLSKMDKFIHYGVAAATEAVEDSGWL
FT                   PDDEKSRDRTGLILGSGIGGLKMIEDTSIKLYQENNGKVSPFFIPASLINLLSGLVSIK
FT                   YGFSGPNQTAVTACSTGAHAIGDAMRMIKHGYADVMIAGGAEAPVTPVGVAGFVAARAL
FT                   CTKYNDNPKKASRPWDKDRSGFVMGEGAGVVVLEEYEHALNRGAKVYGEVIGYGSTGDA
FT                   YHMTAPHPEGRGAYRAMRDAMLDATITPDMIDYINAHGTSTTLGDGIELAAVQKLFLEA
FT                   NPKVLMSSTKSSIGHLLGAAGSVEFIFSALAIRDQIAPPTLNLDTPMDEVNIDLVALKA
FT                   KKTKIDYVLSNSFGFGGTNASLVIKSILV"
FT   gene            complement(527006..527251)
FT                   /gene="acpP"
FT                   /locus_tag="RPR_03075"
FT   CDS_pept        complement(527006..527251)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acpP"
FT                   /locus_tag="RPR_03075"
FT                   /product="acyl carrier protein"
FT                   /note="COG0236 Acyl carrier protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_03075"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47404"
FT                   /db_xref="GOA:C4K1F3"
FT                   /db_xref="InterPro:IPR003231"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/TrEMBL:C4K1F3"
FT                   /protein_id="ACR47404.1"
FT                   /translation="MSTTDKIEQKVIEMVAEKLNKDKSIITTDSRFIEDLKADSLDTVE
FT                   LMMAIEVEYGIDIPDDEATKIKTVSDVIQYIKERHS"
FT   gene            complement(527430..528155)
FT                   /gene="fabG"
FT                   /locus_tag="RPR_03080"
FT   CDS_pept        complement(527430..528155)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fabG"
FT                   /locus_tag="RPR_03080"
FT                   /product="3-ketoacyl-(acyl-carrier-protein) reductase"
FT                   /EC_number="1.1.1.100"
FT                   /note="COG1028 Dehydrogenases with different specificities
FT                   (related to short-chain alcohol dehydrogenases)"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_03080"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47405"
FT                   /db_xref="GOA:C4K1F4"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR011284"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C4K1F4"
FT                   /protein_id="ACR47405.1"
FT                   /translation="MIDLTGKTSLITGASGGIGGAIARLLHKLGSHVIISGSNEEKLKS
FT                   LGKVVKDNYTIEVCNLADKEECSNLISKASKLDILVCNAGITSDTLAIRMKDEDFDKVI
FT                   DINLKANFILNREAIKKMIQNRYGRIINISSIVGISGNPGQANYCASKAGLIGMTKSLS
FT                   YEVATRGITVNTVAPGFIKSDMTDKLNEKQREAIIQKIPLGTYGMPEDVANAVAFLASD
FT                   QASYITGQTIHVNGGMLMV"
FT   gene            complement(528148..529179)
FT                   /gene="recA"
FT                   /locus_tag="RPR_03085"
FT   CDS_pept        complement(528148..529179)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recA"
FT                   /locus_tag="RPR_03085"
FT                   /product="recombinase A"
FT                   /note="COG0468 RecA/RadA recombinase"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_03085"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47406"
FT                   /db_xref="GOA:C4K1F5"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013765"
FT                   /db_xref="InterPro:IPR020584"
FT                   /db_xref="InterPro:IPR020587"
FT                   /db_xref="InterPro:IPR020588"
FT                   /db_xref="InterPro:IPR023400"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4K1F5"
FT                   /protein_id="ACR47406.1"
FT                   /translation="MSNTDKERAIAAALAQIEKSYGKGSVMKLGQRPHVDIEAVSTGSL
FT                   GLDIALGIGGVPKGRIIEIFGPESSGKTTLTLHLIAEAQKKGGTCAFIDAEHALDPAYA
FT                   KKLGVNIAELIISQPDTGEQALEIADTLIRSSGIDMIIIDSVAALVPKSEIEGEMGDAQ
FT                   MASQARLMSQALRKLTASINRTNCITVFINQIRMKIGVMFGSPETTTGGNALKFYASVR
FT                   IDIRRIGSIKDKEEVIGSQTKVKVVKNKVSPPFKTADFDIMYGSGISKEGEIIDLGVKL
FT                   DIVEKSGSWFSYKNVRIGQGRENVKQYLKEHPQISNEIEKIIREKSSKITNINLDQTEE
FT                   END"
FT   gene            complement(531654..532955)
FT                   /locus_tag="RPR_03120"
FT   CDS_pept        complement(531654..532955)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_03120"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_03120"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47407"
FT                   /db_xref="InterPro:IPR020182"
FT                   /db_xref="UniProtKB/TrEMBL:C4K1F6"
FT                   /protein_id="ACR47407.1"
FT                   /translation="MASILNINFKCVMPIFSNEIVSRLPGNVNHIIHKLSSTIFSSVYS
FT                   TIEGAFKKGYIVDNTQCNWKNIEQSFNESPNDFSILHQECNNGLNIPIHNIFIDAENNP
FT                   HILLQQAVTPHQNGTASILSQLYKVMNDYIFSQGNITETSGADFLGLNECTKEEAMSAL
FT                   QNYNAYKETLIPRESFINTLENTLNHLGLSLDNVSPTEIGKNILDQLGKAYTDPTTTER
FT                   PNDDTNDGGYSSGAYIAGIALGTLAVGTILGYCIKYGWDWYKGRNIKNENLDLVMKNKE
FT                   LAFVELLYENFKKNAVIFDEVIKINNLHDIIKLAKSIKEYEFSILLLTNLNNEIVKLNS
FT                   PSSIAINLDSSSGILHEICKSLGGDDSFQTISNFAHLITIIRTANPKSEEYKESSIEIF
FT                   EIFNPCYTDINYQNCEMPLLADVSSPYNSLGIEA"
FT   gene            complement(533348..534685)
FT                   /gene="trmE"
FT                   /locus_tag="RPR_03125"
FT   CDS_pept        complement(533348..534685)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trmE"
FT                   /locus_tag="RPR_03125"
FT                   /product="tRNA modification GTPase TrmE"
FT                   /note="COG0486 Predicted GTPase"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_03125"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47408"
FT                   /db_xref="GOA:C4K1F7"
FT                   /db_xref="InterPro:IPR004520"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR018948"
FT                   /db_xref="InterPro:IPR025867"
FT                   /db_xref="InterPro:IPR027266"
FT                   /db_xref="InterPro:IPR027368"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031168"
FT                   /db_xref="UniProtKB/TrEMBL:C4K1F7"
FT                   /protein_id="ACR47408.1"
FT                   /translation="METIFAQSSAFGKAGVAVFRISGPKSLEVLQLLTGRKDFKSRLMY
FT                   YQQITVPETKELIDNVMVVYFKSPGSFTGEDVVEIHTHGSKAISIMLTNALLNIAGIRL
FT                   AEAGEFTKRAFLNNKFDLTAAEGIADLINAETIMQHKQAIRQASGKLEALYNNWRSQLL
FT                   KIISLLEAYIDFPDEDIPDTVLNEVTNTHTILVNTISEYLNDNRKGELLRSGLKLAIIG
FT                   PPNVGKSSLLNFLMQRDIAIVSNIAGTTRDIIEGHLDIGGYPIILQDTAGIREESSDII
FT                   EQEGIKRAINSAKTADIKIIMFDAEKLDSSINEDIINLIDENTIIIINKIDLIEASKIF
FT                   SIENKYKCLRVSVKNNIALSSILKNIENIAENMAGFTEIPYITNQRHRNYLQQALSHLT
FT                   AFSLDNDLVLATEDIRMTVRCIGAITGVINVEEILGEIFKNFCIGK"
FT   gene            534770..539518
FT                   /locus_tag="RPR_03130"
FT   CDS_pept        534770..539518
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_03130"
FT                   /product="hypothetical protein"
FT                   /note="COG2902 NAD-specific glutamate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_03130"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47409"
FT                   /db_xref="GOA:C4K1F8"
FT                   /db_xref="InterPro:IPR007780"
FT                   /db_xref="InterPro:IPR028971"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C4K1F8"
FT                   /protein_id="ACR47409.1"
FT                   /translation="MTPKTTSLNFSRLNCQIPNYKTKILELSKERESSSIYIDFVQKFL
FT                   NYIPIDYDFENRAKLFQNFADEAFKFFKQRIARARKIAITKAVIENDPAINVLILLDNK
FT                   PHIVDFIICLLKNMNLQTKFLLHPVINCVRNSKGELEKILENSVSDEKSESILHLTILG
FT                   NFDDKTTTFLTEAINERLEKLEQSYSHLPQLRTKLQDLSKNIIDNYKLNFKEAKEFLNW
FT                   LQNDNLVLLGTLDFEVKSLKLSNEIGAAKIWQEVKDEIDDIIKCSANPLYQNQLIILGK
FT                   INSASFIHSDNLIDYILVKNFDSSGEYISGSIIFGIYNSNMYYHSISNIPILRQKFNFV
FT                   IEKAGFALSGYNADKLRILMESLPREALIQIDQGDLYCMCLHMLSSMMSKKLKLFIQYD
FT                   WSSSFLNIIIFLPRERLTAEIHNMIDCYLAEKFGSKILSNYITKVAGNFSYLFVTLEAQ
FT                   GEHKINFEAEIIQQDLDRISTCWSEDFYFKFSKKFGEYQAGINLKLFDNVFSADYRQKF
FT                   SPEIALVDIEYLTEASKSQKCMFNLVSVNETEFYLKIYSPKVKLALSNILPPIENLGFK
FT                   AIDEQTFAIKEALEIKESWIYNFILTSIVPVKDNITELKINVEEALDKMALGMLANDSL
FT                   SKLIVLAGFNWKQVKLVKALTRYLHQTGFSYGKGYVQLTLLKHPEYTKMLVNLFDIKFN
FT                   PKHSDNNCDVIKDKLNNYLVTVEMSSEDKVLSNMLGIVNAITRTNYYQPHKHIFSFKFD
FT                   SSKVPDLPKPVPFAEAFVYSRNFEAVHLRGGPVSRGGLRWSDRAEDYRLEVLGLMKAQM
FT                   TKNSVIVPVGSKGGFYVHFTDEGLTRDEYMEKVVECYKNFLRGLLDITDNIIDGKVVHP
FT                   KDVIIYDKEDPYLVVAADKGTASFSDYANSVAREYNYWLDDAFASGGSAGYDHKKMAIT
FT                   SKGAWISVTNHFKTLGLDVQKDPITVVGIGDMSGDVFGNGMLRSETIKLVAAFNHKHIF
FT                   IDPTPDPLSSFNERLRLFNLKGSNWSDYDSKLISKGGKVFERSSKLIKLSPEIKKLLDI
FT                   NDNELSPEELIKAILKADVDLLWNGGIGTYIKAKTENNLEIGDKANDNLRCNGEEIRAK
FT                   VIAEGGNVGVSQRGRVEYAKKGGRINADFIDNSAGVDCSDHEVNIKIALSSAITSGKIT
FT                   LEERNKLLNDMTKQVEELVLLDNYKQTEAITIMQLSPTLTVNILSQFIDILEEEKVLER
FT                   ENEFLPSAEELNSRAISGEVLTRPELCILLSYSKRSAYHELINSTFSHDKYFDAYLIDY
FT                   FPEMMQKKFRNEILSHPLKHEIIKTVTINKIMNQLGGPLISIVKREIGAPLCDIIRSYT
FT                   IICEIFDLDDIWETISKLPTNIDYNVKIDMFTEITKLMRRGISWFIKNLKHPINISETI
FT                   EEFRVPAQNLRKTVDTLLVGETKIRFEEKLNYYTTSGVEESLAATIATFDNLISVFDII
FT                   YVTKQTSGNNKEIAKAYFVISDMFSLDWLRKACDRQLNDSFWRRLGIQSLKDDLYDKQR
FT                   RLLIKIINKSKTTIDLDLWIDNNNLVRNLLDFIKEIKAQETIDLNIIILANKKFEIFLQ
FT                   KLE"
FT   gene            539531..539875
FT                   /locus_tag="RPR_03135"
FT   CDS_pept        539531..539875
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_03135"
FT                   /product="hypothetical protein"
FT                   /note="COG1426 Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_03135"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47410"
FT                   /db_xref="GOA:C4K1F9"
FT                   /db_xref="UniProtKB/TrEMBL:C4K1F9"
FT                   /protein_id="ACR47410.1"
FT                   /translation="MLKQIRLDSGKTLNQVSSDLKIRKKYLVALEEGDFDVLPGEVYVR
FT                   GYLKLYLDYLNVKDRNAEQIEATKQNETEKLLNNKRATVINYKRKKQLVLISIIMLSII
FT                   IVSHPFIINA"
FT   gene            539882..540229
FT                   /locus_tag="RPR_03140"
FT   CDS_pept        539882..540229
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_03140"
FT                   /product="hypothetical protein"
FT                   /note="COG0419 ATPase involved in DNA repair"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_03140"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47411"
FT                   /db_xref="InterPro:IPR005728"
FT                   /db_xref="UniProtKB/TrEMBL:C4K1G0"
FT                   /protein_id="ACR47411.1"
FT                   /translation="MDNEILDCLQNEANKEAFEGDTERGTAAYTDVREDASTGSTYKLP
FT                   LEASYVSSLKKLMEEVEHKLDDLLSMLVNNQNEVQKLQNENKALKDNYIIMLDQINIYI
FT                   NELEEIKKQQK"
FT   gene            540232..540549
FT                   /locus_tag="RPR_03145"
FT   CDS_pept        540232..540549
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_03145"
FT                   /product="hypothetical protein"
FT                   /note="COG3027 Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_03145"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47412"
FT                   /db_xref="GOA:C4K1G1"
FT                   /db_xref="InterPro:IPR007838"
FT                   /db_xref="InterPro:IPR036192"
FT                   /db_xref="UniProtKB/TrEMBL:C4K1G1"
FT                   /protein_id="ACR47412.1"
FT                   /translation="MSIVTVTLNNKSFQLYCNNGDEEELLSLANKLNDKIAEIKLGSPT
FT                   ASFELLLVMASLNAQAEIASLTEKLNKNGLQKNHPDEEKFAETLTTIAGYLENLARKMG
FT                   K"
FT   gene            540877..542118
FT                   /locus_tag="RPR_03150"
FT   CDS_pept        540877..542118
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_03150"
FT                   /product="proline/betaine transporter"
FT                   /note="COG0477 Permeases of the major facilitator
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_03150"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47413"
FT                   /db_xref="GOA:C4K1G2"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C4K1G2"
FT                   /protein_id="ACR47413.1"
FT                   /translation="MKQTKSRNKVLGAFLGTIIEYYDYSLYGFSAAIIADKFFSASTDL
FT                   LTKLVNVFAVYAAAYLSKPMGAYIFGRIGDIYGRKKALSFTIIGIVIPTLIIGLLPDYS
FT                   SIGVWSTIILVLCRFMQGIFIGGEYDGAAIYVIEHLGAKYRFTASAITRCTGVMGLLCG
FT                   IGATNFFNSHIFPEWSWRIPFLLSLPLALITLYYRRKFDETPEFKKAHYSQDSIEKLSS
FT                   IIKKQWKNIARLIFLAGGFGATYQIAIIFMKQYLPIVLPSVGIIMSAFSVLIVICFAVC
FT                   MPIAGFIADRLGVNSVLKIAFICTITASVFFVIAVKYQMTNLGFAASLMLAASVAPFNS
FT                   LAHSIVIKSFVVKERYRVISLGHNIGSMLMSGTANYICAKVIKSFDFNLFPILYLCMFA
FT                   VLAYSMTILFNRNR"
FT   gene            542220..542807
FT                   /locus_tag="RPR_03155"
FT   CDS_pept        542220..542807
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_03155"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_03155"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47414"
FT                   /db_xref="UniProtKB/TrEMBL:C4K1G3"
FT                   /protein_id="ACR47414.1"
FT                   /translation="MQTEVYTLDIGNCKERKYNYEDHLEKLLKQEISLAMQKNGLRVKL
FT                   LYNKDIRTQKLDDLVSRFRSSYNNTYTALYTPLLWPEGKAFSMTQNIGELVIMLGEKTG
FT                   ADIFVLLHYVQMIKTNGACTCDFLMSALGCSVSNADNIFMSIGIVEAKSGRILWTNATP
FT                   QAQPFSSSIFSSRDKSEIGNFYSVINMLLSPL"
FT   gene            complement(544040..544534)
FT                   /locus_tag="RPR_03170"
FT   CDS_pept        complement(544040..544534)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_03170"
FT                   /product="hypothetical protein"
FT                   /note="COG1396 Predicted transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_03170"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47415"
FT                   /db_xref="GOA:C4K1G4"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:C4K1G4"
FT                   /protein_id="ACR47415.1"
FT                   /translation="MSEDIRSKERFNRINDISETNKDDPEEIRNNFKKFVLNILETDNI
FT                   TPYKLSEKTGTHETAWKNFLDGRTKMPDMGAIVALADYKNVPLDEVIGRDINKEKKITV
FT                   EIKQTPEISASIAKLPKDILQEAMLIGEKTRGVIHKPTNKKTKSFAEQIKSSNKPKGRS
FT                   I"
FT   gene            complement(544818..546023)
FT                   /locus_tag="RPR_03175"
FT   CDS_pept        complement(544818..546023)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_03175"
FT                   /product="aspartate kinase"
FT                   /EC_number="2.7.2.4"
FT                   /note="COG0527 Aspartokinases"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_03175"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47416"
FT                   /db_xref="GOA:C4K1G5"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001057"
FT                   /db_xref="InterPro:IPR001341"
FT                   /db_xref="InterPro:IPR005260"
FT                   /db_xref="InterPro:IPR018042"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR041740"
FT                   /db_xref="UniProtKB/TrEMBL:C4K1G5"
FT                   /protein_id="ACR47416.1"
FT                   /translation="MALIIQKFGGTSVANIDRIKKIVPIIKTEIAKNNQVIVVVSAMAG
FT                   VTNQLVTLCNEVSSLNNISQFAEYDVALSSGEIVTASLLALALQEEDIKARSFLAWQLP
FT                   MLTDNNHSKALVESITTDLLEKYLQLNTIPIIAGFQGINKSNRLTTLGRGGSDTTAALI
FT                   AAAMKADRCDIYTDVEGIFTADPRIIPNAKKIKEIDFLEMLELASSGAKVLHPRAGELV
FT                   MRYKIDMRVLSTFSPDTEGTLITSKDKNMENGIINSITSNKNLLKISVKSMSLSFLQVA
FT                   HMITQNNNHIEFMQEIKNNEEYSFITNLTDKNNLQALLTNLKDDKQIQDFTFDTEIATI
FT                   SLIGYGIKNDCKLLETILSKLTNDNINVHMIQLSEVKITLFINDQDAEKTIFNLYNLFK
FT                   IS"
FT   gene            complement(546307..546567)
FT                   /gene="rpmA"
FT                   /locus_tag="RPR_03180"
FT   CDS_pept        complement(546307..546567)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmA"
FT                   /locus_tag="RPR_03180"
FT                   /product="50S ribosomal protein L27"
FT                   /note="COG0211 Ribosomal protein L27"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_03180"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47417"
FT                   /db_xref="GOA:C4K1G6"
FT                   /db_xref="InterPro:IPR001684"
FT                   /db_xref="InterPro:IPR018261"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4K1G6"
FT                   /protein_id="ACR47417.1"
FT                   /translation="MATKKAGGSSRNGRDSAGRRLGVKKADGQYVIPGNIIVRQRGTKI
FT                   HPGMNVGLGKDHTIFALIEGRVEFLTKRNHKIVNVNEIAST"
FT   gene            complement(546592..546909)
FT                   /gene="rplU"
FT                   /locus_tag="RPR_03185"
FT   CDS_pept        complement(546592..546909)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplU"
FT                   /locus_tag="RPR_03185"
FT                   /product="50S ribosomal protein L21"
FT                   /note="COG0261 Ribosomal protein L21"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_03185"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47418"
FT                   /db_xref="GOA:C4K1G7"
FT                   /db_xref="InterPro:IPR001787"
FT                   /db_xref="InterPro:IPR018258"
FT                   /db_xref="InterPro:IPR028909"
FT                   /db_xref="InterPro:IPR036164"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4K1G7"
FT                   /protein_id="ACR47418.1"
FT                   /translation="MFAVIKAGGKQYKVDRNSIIKVEKIDGELGSKIQFDQVLMIGEYS
FT                   KPSFIGTPIVKGAVVTAEITNQLKDNKIIVFKKKRRKNYRRKAGHRQELTELKILDITK
FT                   Q"
FT   gene            complement(546998..547597)
FT                   /locus_tag="RPR_03190"
FT   CDS_pept        complement(546998..547597)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_03190"
FT                   /product="phosphatidylglycerophosphatase A"
FT                   /note="COG1267 Phosphatidylglycerophosphatase A and related
FT                   proteins"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_03190"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47419"
FT                   /db_xref="GOA:C4K1G8"
FT                   /db_xref="InterPro:IPR007686"
FT                   /db_xref="InterPro:IPR026037"
FT                   /db_xref="InterPro:IPR036681"
FT                   /db_xref="UniProtKB/TrEMBL:C4K1G8"
FT                   /protein_id="ACR47419.1"
FT                   /translation="MFTKKQFSEFFATFFYIGKIKYCPGTFGSIAAFPLTYFLIYFIVN
FT                   NKIIIPFLSLTLGEAQLVSIFIISFSLCLILLILGTYFTKIYLNYTNSEDPKEVVIDEV
FT                   VGQILTIVLVFFSALFANESYLIKYFSPLTINIILLFILPFCLFRFFDIVKPWPINWLD
FT                   KNIKGSIGVMLDDLLAAIFAAVTQYAIIFVLIDIRQ"
FT   gene            547678..547845
FT                   /locus_tag="RPR_03195"
FT   CDS_pept        547678..547845
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_03195"
FT                   /product="twin-arginine translocation protein TatA"
FT                   /note="putative Twin-arginine translocation protein TatA/E"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_03195"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47420"
FT                   /db_xref="GOA:C4K1G9"
FT                   /db_xref="InterPro:IPR003369"
FT                   /db_xref="InterPro:IPR006312"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4K1G9"
FT                   /protein_id="ACR47420.1"
FT                   /translation="MGMSFSHLLIVLLIIFVLFGAGKLPQVMSDLAKGLKAFKDGMKDD
FT                   GSDNDNDKNK"
FT   gene            complement(548077..549195)
FT                   /locus_tag="RPR_03200"
FT   CDS_pept        complement(548077..549195)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_03200"
FT                   /product="hypothetical protein"
FT                   /note="COG0683 ABC-type branched-chain amino acid transport
FT                   systems, periplasmic component"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_03200"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47421"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:C4K1H0"
FT                   /protein_id="ACR47421.1"
FT                   /translation="MASIKHKLRIVLSFFCLIYLTSCQTPKEEPISFPKKEQTEIEIAI
FT                   LMPNQGPDSIVGKQYKDLIKMGLNDGIKSYIHVTSYDGSDEKNVLAAMDKIVARKTKII
FT                   LGPLYSNFTSLIAEKAKANDIIIITMSNNPALAEDKLFVFGHAPLKQLIRIINYYASNN
FT                   HKDFMALLPKGKHSQTISQVMQNILIQNNASLSRTEFYEDNPESIAKAARNISDNTDII
FT                   NERSDTTKPVIYLSDDPKNLNLLADSIRKYNLDKKAILIGDHRIDIDYPENIDISFTGS
FT                   LNLLNSNVPDRAKDLGINHIGFMHLLSYDLGRMTANYIGNEFASERFLNRMNSRQPYIG
FT                   LSGNIYFIDGVAQRRYDIIRKKNGIYSTVSEN"
FT   gene            549220..550065
FT                   /locus_tag="RPR_03205"
FT   CDS_pept        549220..550065
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_03205"
FT                   /product="tetrapyrrole (corrin/porphyrin) methylase family
FT                   protein"
FT                   /note="COG0313 Predicted methyltransferases"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_03205"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47422"
FT                   /db_xref="GOA:C4K1H1"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR008189"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR018063"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:C4K1H1"
FT                   /protein_id="ACR47422.1"
FT                   /translation="MIRYLSKPGLYIVSTPIGNFEDITLRAISTLKNSDIILCEDTRIS
FT                   QKLLAKHDIHTKLQIYNDHSDEKDRENIISLIKSGNIISLISDAGTPLISDPGYKLVRG
FT                   ICNLNCHIDVVPGVSAPVTALTLSALPTDRFLFHGFLPKTIESKKKIFSELVNLKATLI
FT                   FFETAPRLINTLSVAKEILGNREICVARELTKLYQEIKTGDIDEIIEFYQNNILKGEIV
FT                   LLISGNIQEQNQHKNLEKFIELCLSKNLSSKTTTELVYDKFKDVYSKKEIYRLVNKQKI
FT                   "
FT   misc_feature    550141..551028
FT                   /note="authentic frameshifts in hypothetical rickettsial
FT                   gene"
FT   gene            complement(551100..551276)
FT                   /locus_tag="RPR_03225"
FT   CDS_pept        complement(551100..551276)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_03225"
FT                   /product="entericidin B-like protein"
FT                   /note="COG5510 Predicted small secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_03225"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47423"
FT                   /db_xref="GOA:C4K1H2"
FT                   /db_xref="InterPro:IPR012556"
FT                   /db_xref="UniProtKB/TrEMBL:C4K1H2"
FT                   /protein_id="ACR47423.1"
FT                   /translation="MRSALITSILVAVAFLTSACNTMQGAGQDMQAAGKKLKDSAESNK
FT                   PQKGCGCPHSSAN"
FT   gene            551514..551954
FT                   /locus_tag="RPR_03230"
FT   CDS_pept        551514..551954
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_03230"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_03230"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47424"
FT                   /db_xref="UniProtKB/TrEMBL:C4K1H3"
FT                   /protein_id="ACR47424.1"
FT                   /translation="MKDGVLDCTNLEGISLQEIFNFLQNPYIVKDKIIALDISTYEHWK
FT                   EVNDFILQLNDNSSFKPQTIEIYTFYRYMEDILNLRLKTGINITNHIDVNMTDRRKEAL
FT                   LKKFLKRFKENNFTKDEEQLSQFIKAVCKEDKTPDGIEMQYG"
FT   gene            552106..552297
FT                   /locus_tag="RPR_03235"
FT   CDS_pept        552106..552297
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_03235"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_03235"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47425"
FT                   /db_xref="UniProtKB/TrEMBL:C4K1H4"
FT                   /protein_id="ACR47425.1"
FT                   /translation="MVKVNGANMSAWQNFLGKQSSFQSSYQGNDLVIKIFKGKYAFSAS
FT                   LDYHDQGLTDVLCSLCFQ"
FT   gene            552342..552824
FT                   /locus_tag="RPR_03240"
FT   CDS_pept        552342..552824
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_03240"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_03240"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47426"
FT                   /db_xref="UniProtKB/TrEMBL:C4K1H5"
FT                   /protein_id="ACR47426.1"
FT                   /translation="MLTSQNASFISHSGIARLPIYQEKPFIIKHKNLAVKLHSFIAACA
FT                   KDIYSNKKEYMITVPVKEMTQIILKEYEKKGVLDKIYIGHQQENLDNKQTPIKLIEDND
FT                   KTLFSLYDKNGNILHELTSAQMEGEFAWFCKHPYLCRGQGKRCTVRYLSFRNISNT"
FT   gene            complement(552898..553530)
FT                   /locus_tag="RPR_03245"
FT   CDS_pept        complement(552898..553530)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_03245"
FT                   /product="endonuclease III"
FT                   /note="COG0177 Predicted EndoIII-related endonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_03245"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47427"
FT                   /db_xref="GOA:C4K1H6"
FT                   /db_xref="InterPro:IPR000445"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR003651"
FT                   /db_xref="InterPro:IPR004036"
FT                   /db_xref="InterPro:IPR005759"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="InterPro:IPR023170"
FT                   /db_xref="UniProtKB/TrEMBL:C4K1H6"
FT                   /protein_id="ACR47427.1"
FT                   /translation="MQAQIVNKIFEIFSKNNPNPKTELIYKNDFTLLVAVILSAQATDI
FT                   SVNLATKSLFKTYDTPEKILALGEEGLKKYIKSIGLFNSKAKNIIALCKILISNYQASV
FT                   PNDFKALIKLPGVGRKTANVVLNCLFGMPTMAVDTHVFRVANRIGLAKGGTPEIVEKEL
FT                   LQIIDKKWLTHAHHWLILHGRYICKARKPDCDICPIKEYCDYYFNLK"
FT   gene            553568..553903
FT                   /locus_tag="RPR_03250"
FT   CDS_pept        553568..553903
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_03250"
FT                   /product="glutaredoxin"
FT                   /note="COG0278 Glutaredoxin-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_03250"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47428"
FT                   /db_xref="GOA:C4K1H7"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR004480"
FT                   /db_xref="InterPro:IPR014434"
FT                   /db_xref="InterPro:IPR033658"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:C4K1H7"
FT                   /protein_id="ACR47428.1"
FT                   /translation="MSLKMLENKNFKFIENEIKNNKVVLFMKGIKKSPACGFSGTVVAI
FT                   LNKLGVEFRDINVLFDAELREDLKKFSDWPTFPQLYINGELVGGCDIARELYQSGELEK
FT                   MLKAYTR"
FT   gene            554059..554709
FT                   /locus_tag="RPR_03255"
FT   CDS_pept        554059..554709
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_03255"
FT                   /product="carboxylesterase"
FT                   /note="COG0400 Predicted esterase"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_03255"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47429"
FT                   /db_xref="GOA:C4K1H8"
FT                   /db_xref="InterPro:IPR003140"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C4K1H8"
FT                   /protein_id="ACR47429.1"
FT                   /translation="MSKYLEYPEVESKEQPPKKLVVLLHGVGSDGHDLIGLVPYIKNYL
FT                   PNCHFISPHGIEAYDMMPYGRQWFSLQDRSPHIMAKLIANNISKVEDIIKQKQDELNLT
FT                   NKDTIIIGFSQGTMIGLYLTLVQKEPFFCTIGFSGALIPPMEVNNKLTPICLIHGELDE
FT                   VVGVSEMYNASNYLSKLHIEHSGHKLTSLAHSIDGRGLEIAINFINNRHCEQP"
FT   gene            554824..556086
FT                   /gene="glyA"
FT                   /locus_tag="RPR_03260"
FT   CDS_pept        554824..556086
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glyA"
FT                   /locus_tag="RPR_03260"
FT                   /product="serine hydroxymethyltransferase"
FT                   /EC_number="2.1.2.1"
FT                   /note="COG0112 Glycine/serine hydroxymethyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_03260"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47430"
FT                   /db_xref="GOA:C4K1H9"
FT                   /db_xref="InterPro:IPR001085"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR019798"
FT                   /db_xref="InterPro:IPR039429"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4K1H9"
FT                   /protein_id="ACR47430.1"
FT                   /translation="MNIFNNNLHETDKEINEIIKHEKLRQSNVIELIASENFVSPAVLE
FT                   AQGALLTNKYAEGYPSKRFYNGCEEVDKAENLAIERVKKLFNCKYANVQPHSGSQANQA
FT                   VYLALLQPGDTVLGMSLDSGGHLTHGAAPNMSGKWFNAVSYSVNKETYLIDYDEIERLA
FT                   DLHKPKLLIAGFSAYPRNIDFAKFREIVDKVGAYFMADIAHIAGLVATGEHQSPIPYAH
FT                   AVTSTTHKTLRGPRGGLILSKDEEIGHKINSALFPGLQGGPLMHIIAAKAVAFLENLQP
FT                   EYKSYIQQVISNAKALASSLQERGYDILTGGTDNHIVLVDLRKDGITGKLAANSLDRAG
FT                   ITCNKNAIPFDETSPFITSGIRLGTPACTTRGFKEKDFVLVGHMVADILDGLKNNEDNS
FT                   ALEQKVLNEVTKLIELFPFYG"
FT   gene            556079..556969
FT                   /locus_tag="RPR_03265"
FT   CDS_pept        556079..556969
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_03265"
FT                   /product="lipoyl synthase"
FT                   /note="COG0320 Lipoate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_03265"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47431"
FT                   /db_xref="GOA:C4K1I0"
FT                   /db_xref="InterPro:IPR003698"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR031691"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4K1I0"
FT                   /protein_id="ACR47431.1"
FT                   /translation="MANLNKRPDWIKVKAPNSTEYYNTKDLIKNLRLNTVCEEAACPNI
FT                   GECWSKKHTTVMILGSVCTRACRFCNVKTGRPDLLDPYEPQRLAEAVQKLNLKHVVITS
FT                   VDRDDLEDGGASHFAECISEIRKSSPNTTIEILTPDFLRKEGAAEIIANAKPDVFNHNV
FT                   ETVPSLYKTIRPGARYYNSLSLLHNIKKLSPEIFTKSGMMVGLGEEINEVVQVIDDLRE
FT                   AKVDFLTIGQYLQPTKNHAEVAKYVTPEEFKYLERVAKTKGFLMVSANPLTRSSYHADE
FT                   DFQKLKENYQQKLVS"
FT   gene            557651..558154
FT                   /locus_tag="RPR_03280"
FT   CDS_pept        557651..558154
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_03280"
FT                   /product="putative metalloprotease"
FT                   /note="COG0319 Predicted metal-dependent hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_03280"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47432"
FT                   /db_xref="GOA:C4K1I1"
FT                   /db_xref="InterPro:IPR002036"
FT                   /db_xref="InterPro:IPR020549"
FT                   /db_xref="InterPro:IPR023091"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4K1I1"
FT                   /protein_id="ACR47432.1"
FT                   /translation="MINVEIVRNYNKWREHKQINKSLIKKITQNILLRFDNFSKIKQFE
FT                   LSILLTNAAEILTLNKQFRNIEKATNVLSFPSNELNWQDLYSKLEFLGDSDYMHLGDIA
FT                   FCYEVIYNESCEQHKTFENHFIHLLIHSILHLIGFDHQNDTEANIMENLEIEILSYFGI
FT                   FPPY"
FT   gene            558171..559070
FT                   /locus_tag="RPR_03285"
FT   CDS_pept        558171..559070
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_03285"
FT                   /product="hemolysin"
FT                   /note="COG1253 Hemolysins and related proteins containing
FT                   CBS domains"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_03285"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47433"
FT                   /db_xref="GOA:C4K1I2"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR005170"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:C4K1I2"
FT                   /protein_id="ACR47433.1"
FT                   /translation="MLKSSKKEDSSKKNQNNKLIFTVRKLFSPIKNFFRKTKTPDNFFG
FT                   VIKRLKINSQKMTLDERNILANLLELEDKTIEDIMVPRSDIAAIKLTTNLEELSESIKL
FT                   EVPHTRTLIYDGTLDNVVGFIHIKDLFKALATKQNGRLKKLIRKHIIAAPSMKLLDLLA
FT                   KMRRERTHIAIVVDEYGGTDGLVTIEDLIEEIVGRIDDEHDQQLDSDNFKVINNSTIIS
FT                   NARVEVEVLEEIIGEKLQNDYDEFDTIGGLVLTRVSSVPAIGTRIDISENIEIEVTDAT
FT                   PRSLKQVKIRLKNGLNGQ"
FT   misc_feature    559562..560115
FT                   /note="authentic frameshift and internal stop codon: common
FT                   BLAST hit: gi|67459575|ref|YP_247199.1| (di)nucleoside
FT                   polyphosphate hydrolase"
FT   gene            complement(560638..562047)
FT                   /locus_tag="RPR_03305"
FT   CDS_pept        complement(560638..562047)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_03305"
FT                   /product="ADP,ATP carrier protein"
FT                   /note="COG3202 ATP/ADP translocase"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_03305"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47434"
FT                   /db_xref="GOA:C4K1I3"
FT                   /db_xref="InterPro:IPR004667"
FT                   /db_xref="UniProtKB/TrEMBL:C4K1I3"
FT                   /protein_id="ACR47434.1"
FT                   /translation="MSTLMFCILFNQNVLRILKDSILISEISAEIAGFAKVYCVTPAAA
FT                   LFVIIYAKMINYLTFEKIFYYLSAFFISFFVLFTFVIYPNIHIFHVHPDNLADWMERYP
FT                   HFKWYISLVGNWGYIVYYSLAELWPNIFYILLFWQFANELTTTEEAKRFYTLFSLFGNS
FT                   SLILVGFLMMNLSSEDTIIKKFMSISDSKITLVQVSTTIVAIVAIICCLLVRFISKNVF
FT                   TNPLFYAKAKSGRSTSERMGLIKSFKYIAKSKYLWLLLICSAAFGFAINLVEAVWKAKI
FT                   KELYPTVNTYAEFNSLYILWTGVAIMVMTIIGNNIMRMHNWFVAAVISPVIIMVTGILF
FT                   FVLIVFDQQILSLFDGAILMSPLALAVSIGGIQNILAKGTKYSIWDTSREMLYIPLDEE
FT                   LKTKGKAAVDVISAKVGKSSSGLVQSIIFTLVPTATFTLISPILMVVFTFVCLAWIYAV
FT                   RKIYFEYQKIA"
FT   gene            562486..563169
FT                   /locus_tag="RPR_03310"
FT   CDS_pept        562486..563169
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_03310"
FT                   /product="Poly-beta-hydroxybutyrate polymerase"
FT                   /note="COG3243 Poly(3-hydroxyalkanoate) synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_03310"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47435"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C4K1I4"
FT                   /protein_id="ACR47435.1"
FT                   /translation="MDSRFRENDKGEVGNDIERSQDDIKTFLIILSIFNSLEIFFLARD
FT                   KSFIENLRSYGEVYLIDWLEIKEPKYLLDDYVHKIIEVIDNLKIKDINLIGHCIGGNLA
FT                   IATNVLMPKFIKTLTLLNCPWDFSHFFYIRMLHRYLKLDSGIDNLPIIPKIHIQILFFL
FT                   LFPDYFNAKLKKFFSITSDKEQELALRIENWLMSGNSISKEVYNQIIQNILDENMFINL
FT                   KWKIE"
FT   misc_feature    563363..564443
FT                   /note="authentic frameshift: common BLAST hit:
FT                   gi|67458555|ref|YP_246179.1| acetyl-CoA acetyltransferase"
FT   misc_feature    complement(564612..565269)
FT                   /note="authentic frameshifts etc. in hypothetical
FT                   rickettsial protein"
FT   misc_feature    565466..567569
FT                   /note="authentic frameshifts: common BLAST hit:
FT                   gi|67458557|ref|YP_246181.1| superfamily I DNA/RNA
FT                   helicase"
FT   gene            complement(567581..568675)
FT                   /locus_tag="RPR_03370"
FT   CDS_pept        complement(567581..568675)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_03370"
FT                   /product="transposase ISRpe1"
FT                   /note="COG2801 Transposase and inactivated derivatives"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_03370"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47436"
FT                   /db_xref="GOA:C4K0U6"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:C4K0U6"
FT                   /protein_id="ACR47436.1"
FT                   /translation="MNLNQKIIKPKIGLLELAKSLGSISSACKAMGYSRDSYYRFKALY
FT                   ETGGEEALYEISRRKPIIANRVDPAIEKAVMDMAIEYPAYGQLRVSNELKKSGILVSPG
FT                   GVRSIWLRNDLNNISKRLKALEAKMAQDGIVLTESQLQVLEERRNEREAHGETETQHPG
FT                   YLGCQDTYYVGNFKGIGKVYSQVFIDSYTRVADAKLYTDKTALTAADMLNDRVLPWYET
FT                   QGIPILRILTDRGSEYKGNIEHHAFELFLSIEGIEHTTTKAYSPQTNGMCERFNKTMKQ
FT                   EFFDTAMRKKIYTDLDDLQLDLDIWLEHFNNERPHSGKYCYGKTPMQTFKDSRKLAVEK
FT                   NNEILYLEYVSDSQNVTDNQVQNL"
FT   misc_feature    568740..569519
FT                   /note="authentic frameshifts in homolog of RF_1099, COG0666
FT                   FOG: Ankyrin repeat"
FT   gene            568956..569297
FT                   /locus_tag="RPR_03380"
FT   CDS_pept        568956..569297
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_03380"
FT                   /product="ankyrin repeat-containing protein"
FT                   /note="COG0666 FOG: Ankyrin repeat"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_03380"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47437"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="InterPro:IPR036770"
FT                   /db_xref="UniProtKB/TrEMBL:C4K1I6"
FT                   /protein_id="ACR47437.1"
FT                   /translation="MGWTPLDYAISNNNIKIADFLLKCGAPMNLIHINIGFMKPEIAEL
FT                   LINQGMSPNLRYEDGITGMMLAAERNNLDLIKLLLKLGVNPNVQNSKTGMTSLIMHHHI
FT                   LMLNLLVFY"
FT   gene            569817..570911
FT                   /locus_tag="RPR_03390"
FT   CDS_pept        569817..570911
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_03390"
FT                   /product="transposase ISRpe1"
FT                   /note="COG2801 Transposase and inactivated derivatives"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_03390"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47438"
FT                   /db_xref="GOA:C4K0U6"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:C4K0U6"
FT                   /protein_id="ACR47438.1"
FT                   /translation="MNLNQKIIKPKIGLLELAKSLGSISSACKAMGYSRDSYYRFKALY
FT                   ETGGEEALYEISRRKPIIANRVDPAIEKAVMDMAIEYPAYGQLRVSNELKKSGILVSPG
FT                   GVRSIWLRNDLNNISKRLKALEAKMAQDGIVLTESQLQVLEERRNEREAHGETETQHPG
FT                   YLGCQDTYYVGNFKGIGKVYSQVFIDSYTRVADAKLYTDKTALTAADMLNDRVLPWYET
FT                   QGIPILRILTDRGSEYKGNIEHHAFELFLSIEGIEHTTTKAYSPQTNGMCERFNKTMKQ
FT                   EFFDTAMRKKIYTDLDDLQLDLDIWLEHFNNERPHSGKYCYGKTPMQTFKDSRKLAVEK
FT                   NNEILYLEYVSDSQNVTDNQVQNL"
FT   gene            complement(571215..573134)
FT                   /gene="uvrC"
FT                   /locus_tag="RPR_03395"
FT   CDS_pept        complement(571215..573134)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="uvrC"
FT                   /locus_tag="RPR_03395"
FT                   /product="excinuclease ABC subunit C"
FT                   /note="COG0322 Nuclease subunit of the excinuclease
FT                   complex"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_03395"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47439"
FT                   /db_xref="GOA:C4K1I8"
FT                   /db_xref="InterPro:IPR000305"
FT                   /db_xref="InterPro:IPR001162"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR004791"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR035901"
FT                   /db_xref="InterPro:IPR036876"
FT                   /db_xref="InterPro:IPR038476"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4K1I8"
FT                   /protein_id="ACR47439.1"
FT                   /translation="MTLEITGSELIKSKLIDAPERSGVYRMFDVNKQVLYVGKAKNLKK
FT                   RLTNYIKSNLDNKTLRMIANTCFLEYSITNSEVEALLLEAQLIKKFQPKFNILLKDCKS
FT                   FPFIKLRLDHDFPQLLKYRGKTLSDGKFFGPFASSAEVNTTLTELQKIFKLRSCTDNYF
FT                   NSRTRPCLQYEIKRCYAPCVGKINKEDYRDLVTQVKDFLQGRTKELQENLSRKMEELSS
FT                   QMRFEEAAEIRDRIKALSYVQLKAGVSDVVKDADIIAIVEKNGHYCVEVFLYRAGQACG
FT                   NIPYFPTSTENSTKEEVLEYFLLQFYQKQHVPAAIIINHEINDKENVIEAIKKINNILQ
FT                   LNITVPNKGGKAKLVQNAETNALFSLEQYLKKFAKNQEIMFEIKELFGLSEIPERIEIY
FT                   DNSHIQGKFAVGVMVVAGKVGFDKKEYRVFNVHAPSLVCHSRESGDPKRLMDSCFRGNG
FT                   IKNCGGDIKGDDYEMLRQVLTRRLTRLRQEPHKLPSLMIIDGGKGHLGVVKEVMDKFEM
FT                   NIPFVCMSKGVDRNTGFEQFHVIGKEVFTLDKNLPVMKYLQILRDEAHNFAIKNHRLGR
FT                   SRAIKISRLDDIEGVGETRKKALLHYFGSYKAVCDATIYELAKVNGINKLLAEMIFNVL
FT                   HRKN"
FT   gene            complement(573309..573836)
FT                   /locus_tag="RPR_03400"
FT   CDS_pept        complement(573309..573836)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_03400"
FT                   /product="hypothetical protein"
FT                   /note="COG2847 Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_03400"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47440"
FT                   /db_xref="InterPro:IPR007410"
FT                   /db_xref="InterPro:IPR036182"
FT                   /db_xref="UniProtKB/TrEMBL:C4K1I9"
FT                   /protein_id="ACR47440.1"
FT                   /translation="MLKTLLISFITLIGAVNYADNQTAQNPNSTNSSSDQPDDLPAEAA
FT                   VHFAQPWARPTTNVQGKVSNSAMYFTLINSRSKSYNLVNISSDKISGIEIHQTINDQGV
FT                   SKMVKVDYPFLIAGNINVDFKPGDMHIMLYDPKVDLNVGDEFKITFFFDDNTRKIVNVK
FT                   VANDNPYNKTGN"
FT   misc_feature    complement(573905..574686)
FT                   /note="authentic frameshift: common BLAST hit:
FT                   gi|91205507|ref|YP_537862.1| putative DNA alkylation repair
FT                   protein"
FT   misc_feature    complement(574668..575631)
FT                   /note="authentic frameshifts in COG0350 Methylated
FT                   DNA-protein cysteine methyltransferase"
FT   misc_feature    complement(575721..576227)
FT                   /note="COG0350 Methylated DNA-protein cysteine
FT                   methyltransferase gene fragment"
FT   misc_feature    complement(576707..578241)
FT                   /note="authentic frameshifts: common BLAST hit:
FT                   gi|91205217|ref|YP_537572.1| Type I site-specific
FT                   restriction-modification system, R"
FT   gene            complement(579562..579636)
FT                   /locus_tag="RPR_t07800"
FT   tRNA            complement(579562..579636)
FT                   /locus_tag="RPR_t07800"
FT                   /product="tRNA-Ala"
FT   gene            complement(581497..584217)
FT                   /locus_tag="RPR_03495"
FT   CDS_pept        complement(581497..584217)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_03495"
FT                   /product="preprotein translocase subunit SecA"
FT                   /note="COG0653 Preprotein translocase subunit SecA (ATPase,
FT                   RNA helicase)"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_03495"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47441"
FT                   /db_xref="GOA:C4K1J0"
FT                   /db_xref="InterPro:IPR000185"
FT                   /db_xref="InterPro:IPR004027"
FT                   /db_xref="InterPro:IPR011115"
FT                   /db_xref="InterPro:IPR011116"
FT                   /db_xref="InterPro:IPR011130"
FT                   /db_xref="InterPro:IPR014018"
FT                   /db_xref="InterPro:IPR020937"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036266"
FT                   /db_xref="InterPro:IPR036670"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4K1J0"
FT                   /protein_id="ACR47441.1"
FT                   /translation="MLSILKKLFGTANDRTVKKLFSEITKINSLEPAIQKLSDEELKNK
FT                   TVEFKEKLKNGATLDDIVYEAFAVVREAAKRVCGMRHFDVQLIGGLILHRGMITEMRTG
FT                   EGKTLVATLPAYLNALTGKGVHVVTVNDYLARRDSASMGKIYNFLGLSVGCIVGGMPDE
FT                   VKRAAYNADITHATNNELGFDYLRDNMKYSLQERVLRPFNFAIIDEVDSILIDEARTPL
FT                   VISGPVNDNAELYGKIDKIVRLLNASDFEKDEKLKTINLTETGITHIESLLSKENIIKP
FT                   DTSLYDFENLTLVHYVNQALRAHNMFTVNVDYLVREGKVMIIDEFTGRVMEGRRYSEGL
FT                   HQALEAKENVKIQNENQTLASITFQNYFRNYPKLSGMTGTAMTEAPELKDIYNLDVVAV
FT                   PTHNKVTRLDLDDEIYGSKKEKYDAILKLIRDCYDRGQPMLVGTISIEKSEELSSVLNK
FT                   EKIPHKVLNAKFHEQEAFIIAQAGRFKAVTIATNMAGRGTDIMLGGNPEMLIEQLDKEH
FT                   NYEAKIAEIKAQIAEEKKQVIEAGGLFVIGTERHESRRIDNQLRGRSGRQGDPGKTKFF
FT                   LSLDDDLMRIFASDRISGVLRTLGLKDGEAIHHPMISRSLEKAQQKVEGHNYEMRKNLL
FT                   RFDDVMNDQRKIIYEQRTEIIKSKDSHGFLNSTTEELAKKIVLTFMPVGSYREDWDIEN
FT                   LSVELHRVFSIKFDHNVVSKNDVTEEEITKTVIQMAHYIYKSKEEAYSSELMHNAMKYI
FT                   LLTTLDQVWKDHLYSLDHLRQGISLRAYGQKDPLSEYKREAFNLFEQMLNNLKELFIQT
FT                   VYHFHIDLKNVQKEDVSLEYKKLQKNMRESREDPAFSKYNAGSSLETDLKPVVSRIDPK
FT                   DRNPDDPTSWGRVSRNELCPCGSGKKYKYCHGANE"
FT   gene            584433..585281
FT                   /locus_tag="RPR_03500"
FT   CDS_pept        584433..585281
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_03500"
FT                   /product="protein export protein prsA precursor"
FT                   /note="COG0760 Parvulin-like peptidyl-prolyl isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_03500"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47442"
FT                   /db_xref="GOA:C4K1J1"
FT                   /db_xref="InterPro:IPR000297"
FT                   /db_xref="UniProtKB/TrEMBL:C4K1J1"
FT                   /protein_id="ACR47442.1"
FT                   /translation="MKKLSVIFLSVSMLSGIAFADKDKVVATYKGGEVKESQIMKEFKP
FT                   QLNLQSGETIKNFDDFPPQDQEKLIKIYVNNLLLKEEVAKSNITSSKEFQEKLENAKNQ
FT                   LAQQELLANYIKSNITDNMFDDEYNKYVGNLKGKEQIKVAHILVKSQKEANYIKTKLSK
FT                   GGNFTKLAEELSLDKASASNGGVIGYILLNQPGQLVPEFEKKAFALKVNEVSTPVKTDF
FT                   GWHIIKVLEKKPVPIPTKEEAKVTIDNILAAEVLKKYIADLEAKANLKIMLPKADSKAG
FT                   S"
FT   gene            complement(585492..585887)
FT                   /gene="acpS"
FT                   /locus_tag="RPR_03505"
FT   CDS_pept        complement(585492..585887)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acpS"
FT                   /locus_tag="RPR_03505"
FT                   /product="4'-phosphopantetheinyl transferase"
FT                   /EC_number="2.7.8.7"
FT                   /note="COG0736 Phosphopantetheinyl transferase (holo-ACP
FT                   synthase)"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_03505"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47443"
FT                   /db_xref="GOA:C4K1J2"
FT                   /db_xref="InterPro:IPR002582"
FT                   /db_xref="InterPro:IPR004568"
FT                   /db_xref="InterPro:IPR008278"
FT                   /db_xref="InterPro:IPR037143"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4K1J2"
FT                   /protein_id="ACR47443.1"
FT                   /translation="MLIGVGTDIVQIPRIEKILHLYPELFAKKILTSKELKQFALLGKI
FT                   NHAAFLAKRFAAKEAVSKAFGVGIGQGINFKDITILNNDLGKPIVEVSSNYTNKLSPFN
FT                   IHLSLADDYPVCVAFAVIESSYNVIRG"
FT   gene            complement(585888..586271)
FT                   /gene="rpoZ"
FT                   /locus_tag="RPR_03510"
FT   CDS_pept        complement(585888..586271)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoZ"
FT                   /locus_tag="RPR_03510"
FT                   /product="DNA-directed RNA polymerase subunit omega"
FT                   /EC_number="2.7.7.6"
FT                   /note="COG1758 DNA-directed RNA polymerase, subunit
FT                   K/omega"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_03510"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47444"
FT                   /db_xref="GOA:C4K1J3"
FT                   /db_xref="InterPro:IPR003716"
FT                   /db_xref="InterPro:IPR006110"
FT                   /db_xref="InterPro:IPR012293"
FT                   /db_xref="InterPro:IPR036161"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4K1J3"
FT                   /protein_id="ACR47444.1"
FT                   /translation="MARITAEDCNKIIPDRFRLVVLATRYAKLLNYKVETNQIKKEKRD
FT                   KPPVIALRRIAAGKVSVAQLEQDLINSLRTRTMIEPLVNQDESEAVEEKFEYLSEVYIG
FT                   EDYSDLDDQIFIDENGEDYETDK"
FT   gene            complement(586450..587709)
FT                   /locus_tag="RPR_03515"
FT   CDS_pept        complement(586450..587709)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_03515"
FT                   /product="UDP-N-acetylglucosamine
FT                   1-carboxyvinyltransferase"
FT                   /EC_number="2.5.1.7"
FT                   /note="COG0766 UDP-N-acetylglucosamine enolpyruvyl
FT                   transferase"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_03515"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47445"
FT                   /db_xref="GOA:C4K1J4"
FT                   /db_xref="InterPro:IPR001986"
FT                   /db_xref="InterPro:IPR005750"
FT                   /db_xref="InterPro:IPR013792"
FT                   /db_xref="InterPro:IPR036968"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4K1J4"
FT                   /protein_id="ACR47445.1"
FT                   /translation="MHKLIIHGGTPLKGSINISGAKNAVLPIMAASILTDKLHITNVPK
FT                   LTDVSTMKDLLRSHGADIEIIEHQDEFELIIDTKNINNFTADYEIVRKMRASIWVLGPL
FT                   LTKYGKAKVSLPGGCAIGARQVDLHIAVLKAMGAEIEIEDGYINASSKGRLKGPHFVFD
FT                   KVSVGATINAILAAVLAEGETVLFNCGREPEIVDLCNCLITMGADIAGIGTSEITIKGK
FT                   DSLNKASYKVLSDRIEAGTYMFAAAITKGDVKICGIDYHIVENIALKLIETGIKVVPIN
FT                   NGVQVTYEGKLNSVDLETNPYPGFATDLQAQFMSLMTLSSGVSMITENIFENRFMHVPE
FT                   LCRMGADIVVRGNKAVVRGVEMLKGAEVMASDLRASVSLILAGLSTNSKTVLHRIYHLD
FT                   RGFQDLEKKLSNCGADIKRV"
FT   gene            complement(587801..590224)
FT                   /gene="gyrB"
FT                   /locus_tag="RPR_03520"
FT   CDS_pept        complement(587801..590224)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gyrB"
FT                   /locus_tag="RPR_03520"
FT                   /product="DNA gyrase subunit B"
FT                   /note="COG0187 Type IIA topoisomerase (DNA gyrase/topo II,
FT                   topoisomerase IV), B subunit"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_03520"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47446"
FT                   /db_xref="GOA:C4K1J5"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C4K1J5"
FT                   /protein_id="ACR47446.1"
FT                   /translation="MSEIEEKFNESSYGADSIKVLKGLEAVRKRPGMYIGDVGDGSGLH
FT                   HMIYEVVDNAIDESLAGYCDLVRVTLNKNGSVTVSDNGRGIPVEIHEEEGISAAEVIMT
FT                   QLHAGGKFDQNAYKVAGGLHGVGVSVVNALSEWLELRIWRNNKEYLMRFNNGITEAPLA
FT                   VVKENIDKKGTEVTFFPSVETFTNIEFDFGTIEHRLRELAFLNSGVKLLLVDNRFEEVK
FT                   EVEFYYTGGIEAYVKYIDRAKHAIHPCIVVNTENAESGISLELAMHWNDSYHENILCFT
FT                   NNIRQRDGGTHLSAFKSAITRVITSYLDTTGLNKKAKNYFSGEDTREGLCCVLSVKVPD
FT                   PKFSSQTKDKLVSSEVRPVVENAVYTKVLEWFEEHPAEAKAIITKIMEAANAREAARKA
FT                   RELTRRKSALEVSNLPGKLADCHAKDPAISELFIVEGDSAGGTAKQGRDSKIQAILPLR
FT                   GKILNVERARFDKMLGSDQIGTLITALGISVEREFSLEKLRYHKVIIMTDADVDGSHIR
FT                   TLLLTFFYRHMPELIKKGYLYIAQPPLYKVKKGAAEFYLKNEQALQDYLIKSTINDATL
FT                   ILDDKEQLVGDNLEELINKVVKFNGLLDHASKKFNRSITEILAINDLLNNKIFDPESDL
FT                   RLKKALDVLNSLEDSPDKTNWEVLKHENKIEFFRFSRGLKESKILLKEQLESFEFVQIS
FT                   KLALTIFDIFSKQLKLIVKSQEFDILTPSQLLNTIIKCGKRGINIQRFKGLGEMNSDQL
FT                   WETTLDPTKRTLLQVRVAEIDEAEGIFSTLMGDVVEPRRLFIQANALNVVNLDV"
FT   gene            590330..591190
FT                   /locus_tag="RPR_03525"
FT   CDS_pept        590330..591190
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_03525"
FT                   /product="HAD family hydrolase"
FT                   /note="COG0647 Predicted sugar phosphatases of the HAD
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_03525"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47447"
FT                   /db_xref="GOA:C4K1J6"
FT                   /db_xref="InterPro:IPR006356"
FT                   /db_xref="InterPro:IPR006357"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:C4K1J6"
FT                   /protein_id="ACR47447.1"
FT                   /translation="MNILKLKHIFDVINDYDVFLFDLWGVIIEGGRTYPGVVQNINKII
FT                   ERKKVYFVTNAPRNIVSLHQTIKSWGLNAEPEMIISSGEIAVEMILESKERFGIEKPAI
FT                   YHLGHLENDIINRIQCPITDDINKANIFLMTIYRDENENLDLNEFNELFKIVVQRKMVN
FT                   ICANPDLGINQHGVYRYCSGYYAEKIKQLGGKVIYSGKPYEEIYSKILKECHNTPKNRM
FT                   LMIGDTVYTDILAANRLGIDSALVLTGNSRAYHIDFDNIDEKLDSLMKAAVKQSITPSF
FT                   VVDLS"
FT   gene            591345..591431
FT                   /locus_tag="RPR_t07802"
FT   tRNA            591345..591431
FT                   /locus_tag="RPR_t07802"
FT                   /product="tRNA-Leu"
FT   gene            591696..593066
FT                   /locus_tag="RPR_03530"
FT   CDS_pept        591696..593066
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_03530"
FT                   /product="Mg2+ transporter"
FT                   /note="COG2239 Mg/Co/Ni transporter MgtE (contains CBS
FT                   domain)"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_03530"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47448"
FT                   /db_xref="GOA:C4K1J7"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR006667"
FT                   /db_xref="InterPro:IPR006668"
FT                   /db_xref="InterPro:IPR006669"
FT                   /db_xref="InterPro:IPR036739"
FT                   /db_xref="InterPro:IPR038048"
FT                   /db_xref="InterPro:IPR038076"
FT                   /db_xref="UniProtKB/TrEMBL:C4K1J7"
FT                   /protein_id="ACR47448.1"
FT                   /translation="MPNFNIFKSILPDHHDQFAEIFDQINDLIEDHNYDAAASRLAKLH
FT                   YADLADFLDNLNNKTYKIIIPLLQDEIKPETLVSLNAYSKPLIIETLGIKKSAELINKL
FT                   VIEDAIEVVIDLDDDIKDLILSNLTKEKKHQITVGCTYPENTVGRVIERDFINLQEGWT
FT                   VEESLNFIKNVKNDFYAAIVTDNKLRPIGIISLSTLIKGKQNELIKDLMNKDFKLADAF
FT                   TDLNELSFIFRQYALTIVPVVNKSGKLVGSVSIDNIIYIIEEQAGKDILSLSGVHTQDT
FT                   FFNVFYTVRHRFPWLFVNLITACMTSLIINHFNDTIAKLVTLAAIMPIVASMGGNAGTQ
FT                   AMTVTVRALANKDIHYNNVNKVILKEIAVSAFNGFVLAIIGAGLSFVMLLDLNLSVIFA
FT                   IAVILNFLVAGLFGSAIPIILHYFDIDPATGSGVFLTTITDALGFLTFLSLAHIFLV"
FT   gene            596143..596217
FT                   /locus_tag="RPR_t07804"
FT   tRNA            596143..596217
FT                   /locus_tag="RPR_t07804"
FT                   /product="tRNA-Gly"
FT   gene            complement(596332..596562)
FT                   /locus_tag="RPR_03550"
FT   CDS_pept        complement(596332..596562)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_03550"
FT                   /product="putative antitoxin of toxin-antitoxin"
FT                   /note="COG4710 Predicted DNA-binding protein with an HTH
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_03550"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47449"
FT                   /db_xref="GOA:C4K1J8"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="UniProtKB/TrEMBL:C4K1J8"
FT                   /protein_id="ACR47449.1"
FT                   /translation="MAIFMTVITTRTSNELDIILSNVVKEIDRPKGYIIRKAIESYIEE
FT                   KADLLIALSCVEKREEVISLEDIKKKYGLED"
FT   gene            596954..597379
FT                   /gene="yajC"
FT                   /locus_tag="RPR_03555"
FT   CDS_pept        596954..597379
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yajC"
FT                   /locus_tag="RPR_03555"
FT                   /product="preprotein translocase subunit YajC"
FT                   /note="COG1862 Preprotein translocase subunit YajC"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_03555"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47450"
FT                   /db_xref="GOA:C4K1J9"
FT                   /db_xref="InterPro:IPR003849"
FT                   /db_xref="UniProtKB/TrEMBL:C4K1J9"
FT                   /protein_id="ACR47450.1"
FT                   /translation="MSANTQDNQANNNDTIEIQETEVVPAETNSLQSGLTSLIPMVLIF
FT                   AVFYFLLLRPQETRRKEREKLVSEVKKGEEVLTNSGIYGIVTKVSENDNNIEIEIAKDV
FT                   RIKVLKSAIIDITSRTKAVAVKKENKKNKKVSGAKSS"
FT   gene            597363..598919
FT                   /gene="secD"
FT                   /locus_tag="RPR_03560"
FT   CDS_pept        597363..598919
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secD"
FT                   /locus_tag="RPR_03560"
FT                   /product="preprotein translocase subunit SecD"
FT                   /note="COG0342 Preprotein translocase subunit SecD"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_03560"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47451"
FT                   /db_xref="GOA:C4K1K0"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR005791"
FT                   /db_xref="InterPro:IPR022645"
FT                   /db_xref="InterPro:IPR022813"
FT                   /db_xref="UniProtKB/TrEMBL:C4K1K0"
FT                   /protein_id="ACR47451.1"
FT                   /translation="MQNLPKWKIFLSIICTVFAVICALPNFMQVNSKFLPHDSVNLGLD
FT                   LRGGAHLLLDVDFDTYLNDSMENLADTLRKNFREDKIGYKNLLVRQNSIQLEVRSPEKL
FT                   KPLKKIINKIDPEIIAEVNENKIKLSYSESRLNDLLNKVVDQSIEIVRMRVDSTGTKEP
FT                   TLQKQGDKHILLQVPGEENPSYLKNILGKTAKLTFHLVDENANIEEAVKGHVPVGSMLV
FT                   KGDNESHGEYYVVIKKKVVLGGDQLTTASASFDQNSQAVVAFSFNNLGSKIFGEITKNN
FT                   TGKRLAIVLDNKLLSAPTINGAIMGGRGIITGNFTVESANELALLLQAGSLPAPLKIIE
FT                   ERSIGPNLGADSIESGKKAELIGFIAVCIFMVWSYGVLGLFANIALSLALLYILALLSL
FT                   FQATLTLPGIAGIILTMGMAVDANVLIYERIKEELHKGVSNLYAIRTGFESAFATILDA
FT                   NLTTLIVAFLLYIFGVGAIKGFAVALTIGIISSMFSAIIITKLLIDIWVQYFKPKKLGL
FT                   V"
FT   gene            599164..599781
FT                   /locus_tag="RPR_03565"
FT   CDS_pept        599164..599781
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_03565"
FT                   /product="sco2 protein precursor"
FT                   /note="COG1999 Uncharacterized protein SCO1/SenC/PrrC,
FT                   involved in biogenesis of respiratory and photosynthetic
FT                   systems"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_03565"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47452"
FT                   /db_xref="GOA:C4K1K1"
FT                   /db_xref="InterPro:IPR003782"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:C4K1K1"
FT                   /protein_id="ACR47452.1"
FT                   /translation="MKIQSNVIKIIIVISLLIGVGALYLLLSLRTPEKPLAGQVNIYED
FT                   NVKIGGDFELIDQNGEIFNSDKLKGNLSLIYFGFTSCPDICPTSLNKMTEIVEILNKHK
FT                   IDILPVFITIDPKRDTPIALKEYLKHFHPKFIGLTGNEQQIKDVTDKFKVFYARVHGDD
FT                   DDPNYMLDHSSFTYLIDANGKYLKHFYLDSSPKEIMEFLRNE"
FT   gene            599883..600269
FT                   /locus_tag="RPR_03570"
FT   CDS_pept        599883..600269
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_03570"
FT                   /product="cytochrome c-type biogenesis protein CcmE"
FT                   /note="COG2332 Cytochrome c-type biogenesis protein CcmE"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_03570"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47453"
FT                   /db_xref="GOA:C4K1K2"
FT                   /db_xref="InterPro:IPR004329"
FT                   /db_xref="InterPro:IPR036127"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4K1K2"
FT                   /protein_id="ACR47453.1"
FT                   /translation="MQKRVRNRLITIIICFCSACLGISIILYNLEKNIVFFLPPSKINA
FT                   IEQGKELRVGGLVKTDSINKIADDKISFVITDNIKDFEILYQGALPALFRKGQGIIAIG
FT                   QLSNGKFIARQLLAKHDENYRPPQ"
FT   gene            600397..600918
FT                   /locus_tag="RPR_03575"
FT   CDS_pept        600397..600918
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_03575"
FT                   /product="inorganic pyrophosphatase"
FT                   /EC_number="3.6.1.1"
FT                   /note="COG0221 Inorganic pyrophosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_03575"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47454"
FT                   /db_xref="GOA:C4K1K3"
FT                   /db_xref="InterPro:IPR008162"
FT                   /db_xref="InterPro:IPR036649"
FT                   /db_xref="UniProtKB/TrEMBL:C4K1K3"
FT                   /protein_id="ACR47454.1"
FT                   /translation="MFIDKIKAKANNYEINVIIEIPMNSGPIKYEFDKESGAIFVDRFM
FT                   QTTMSYPCNYGFIPHTLSNDGDPVDVLVVAHHPVVPGSVIKCRAVGVLMMEDESGLDEK
FT                   IIAVPTSKLDITFDHIKELDDLCDMLKKRIVHFFEHYKDLEKGKWVKVTGWENKSKADA
FT                   LINEGIDRVS"
FT   gene            601129..602796
FT                   /locus_tag="RPR_03580"
FT   CDS_pept        601129..602796
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_03580"
FT                   /product="integral membrane protein MviN"
FT                   /note="COG0728 Uncharacterized membrane protein, putative
FT                   virulence factor"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_03580"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47455"
FT                   /db_xref="GOA:C4K1K4"
FT                   /db_xref="InterPro:IPR004268"
FT                   /db_xref="InterPro:IPR005728"
FT                   /db_xref="UniProtKB/TrEMBL:C4K1K4"
FT                   /protein_id="ACR47455.1"
FT                   /translation="MTDFLHNVANKEEFVGDTERSTAAYTLVREDASTGATHKLSLEAS
FT                   YVGSRLFRSGVVVAFFTLISRIFGLVREQFIASLFGSTSMGDSINVAFKLPNLFRRIFA
FT                   EGALSSVFIPIYNEKMLISKKAANNFSGEIFTLLLLTLIVIIALMQIFMPQLMLFIVPG
FT                   FHGKKEKFELTVFLCRITIPYLIFVSLTALLGGILNSIKKFAAFAFSPVILSICVIIFT
FT                   LTFDHYIESTISISLSLIMAGILQVSFMFVCVKRADLNFPIIFNPSDPDVKKLLINMGP
FT                   ATISSGIQQLNLFISQSIASFIEGAISILSYADRIYQFPLSIIGTSFSTILLPELSKIY
FT                   KSNDIVAAKKIQNNAIRMGLLLSLPATFGIIILSHPIINIIYERGVFTSQDTTNTAEAI
FT                   SAFALGLPAFILAKILTPIFYANGDTKTPLKITLFSIIINTGMNLLLMDSLKHIGIAVG
FT                   TSIAAWYNLGLLYSYTTKQNKLHIEAGIKLFCGKILLCCILMSIIIALIKHYYLEYFYS
FT                   EYLLIKVCMLGSTIAVGMGAFFGTAYLLKAVNYDNNKK"
FT   gene            602777..603529
FT                   /locus_tag="RPR_03585"
FT   CDS_pept        602777..603529
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_03585"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_03585"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47456"
FT                   /db_xref="GOA:C4K1K5"
FT                   /db_xref="InterPro:IPR008875"
FT                   /db_xref="UniProtKB/TrEMBL:C4K1K5"
FT                   /protein_id="ACR47456.1"
FT                   /translation="MIITKNKHQSNYQDWLKALAIITMIIDHVGLYLYPELTIMRIIGR
FT                   TTMPVFCFFAGYNFHDKPKTHIIIFGVLLQIYTTVLFKQFLTTNILISIYLGQWYIYYF
FT                   RNSLTRFFYSGYCHAIIMVLLWYISWALIDYGTLVIATMILGFISKHEQTNLKLCCFIA
FT                   IFASFVHSTLFTLAISFNEFNFSNTDLILNLTFLTITYILMILSDYSQKIAINLKWISR
FT                   NVLYIYCIHIMILQFIFIYKYTYGFKNW"
FT   misc_feature    603616..604050
FT                   /note="gene fragment homologous to AIG_04970 truncated by
FT                   transposon"
FT   misc_feature    604110..605204
FT                   /note="authentic internal stop codon: common BLAST hit:
FT                   gi|157964614|ref|YP_001499438.1| transposase ISRpe1"
FT   gene            complement(605425..607566)
FT                   /locus_tag="RPR_03605"
FT   CDS_pept        complement(605425..607566)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_03605"
FT                   /product="ATP-dependent DNA helicase"
FT                   /note="COG1200 RecG-like helicase"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_03605"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47457"
FT                   /db_xref="GOA:C4K1K6"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033454"
FT                   /db_xref="UniProtKB/TrEMBL:C4K1K6"
FT                   /protein_id="ACR47457.1"
FT                   /translation="MLTILEKFLFSSVKTFINIREDTVSALKRLGINNIRDLLFYLPVS
FT                   YQNKILSPNLTEVRDDDIIQTEIVVESINLPKKSSQPLTITASNDTGSLLLVFFHKPPP
FT                   FIFNKLQVGTSHIISGKVQFFDHYLQIAHPEFIVNPKLAKEIEPIYSLTYLLSNKQLYS
FT                   YIIKAIEIFEEKCKSIEDKEVKDYLDIILQNLQMLHVFHHCEEACMPTKQSSNVKLINS
FT                   RLPQPLKGLRNDDLYTNAKKQLAAKELIANQISLLNVRTQISRRQGNIYPKAVSIQANI
FT                   LNELGFELTSYQKQVIEEIECDQSDKIEMMRLLQGDVGSGKTLVALLTMVNVVATGFQA
FT                   TLMAPTDLLANQHYEFFVKALKNTNIRVGLLTGKILGAARKNIMIQLDNDEIDILVGTH
FT                   ALFQEKVSFKKLGYIVIDEQHRFGVQQRLNLINKGVNPDVLVMTATPIPRSLALTMFGD
FT                   MTISKLMGKPKSRLPIATNTMSVNKIEHIIVAINKKLIAGERVYWICPLIEQGGKETPE
FT                   EDSLLMDVMNRFNSIDNIYQGYTGIIHGKMKNEQKDQIMKQFKEGEIKILVATTVIEVG
FT                   IDIPEATLIIIENAEQFGLAQLHQLRGRVGRGSLQSYCILLYNPKRLRKVARGRFEIMK
FT                   QTNDGFYIAEQDLKLRGSGEILGVKQSGEIAFFFADLADDYDLLLKAHKFAAIGSKGNV
FT                   NFVNFQIKLFAKSQVSELV"
FT   gene            607752..608846
FT                   /locus_tag="RPR_03610"
FT   CDS_pept        607752..608846
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_03610"
FT                   /product="transposase ISRpe1"
FT                   /note="COG2801 Transposase and inactivated derivatives"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_03610"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47458"
FT                   /db_xref="GOA:C4K0H1"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:C4K0H1"
FT                   /protein_id="ACR47458.1"
FT                   /translation="MNLNQKIIKPKIGLLELAKSLGSISSACKAMGYSRDSYYRFKALY
FT                   ETGGEEALYEISRRKPIIANRVDPAIEKAVMDMAIEYPAYGQLRVSNELKKSGILVSPG
FT                   GVRSIWLRNDLNNISKRLKALEAKMAQDGIVLTESQLQVLEERRNEREAHGETETQHPG
FT                   YLGCQDTYYVGNFKGIGKVYSQVFIDSYTRVADAKLYTDKTALTAADMLNDRVLPWYET
FT                   QGIPILRILTDRGSEYKGNIEHHAFELFLSIEGIEHTTTKAYSPQTNGMCERFNKTMKQ
FT                   EFFDTAMRKKIYTDLDDLQLDLDIWLEHFNNERPHSGKYCYGKTPMQTFKDSKKLAVEK
FT                   NNEILYLEYVSDSQNVTDNQVQNL"
FT   gene            complement(608872..609228)
FT                   /gene="rnpA"
FT                   /locus_tag="RPR_03615"
FT   CDS_pept        complement(608872..609228)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rnpA"
FT                   /locus_tag="RPR_03615"
FT                   /product="ribonuclease P"
FT                   /EC_number="3.1.26.5"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_03615"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47459"
FT                   /db_xref="GOA:C4K1K8"
FT                   /db_xref="InterPro:IPR000100"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020539"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4K1K8"
FT                   /protein_id="ACR47459.1"
FT                   /translation="MSITSLKNQKEFELINKLGKKLHERYFILVIATKLPKIFLESKYN
FT                   TFLGIKVSRKLSKKAVVRNKIKRRIRHLIRIIVSDSSFKAIKFAMIIIPRKGFEEINFS
FT                   HLNYELSKVILRNM"
FT   gene            complement(609248..609382)
FT                   /gene="rpmH"
FT                   /locus_tag="RPR_03620"
FT   CDS_pept        complement(609248..609382)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmH"
FT                   /locus_tag="RPR_03620"
FT                   /product="50S ribosomal protein L34"
FT                   /note="COG0230 Ribosomal protein L34"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_03620"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47460"
FT                   /db_xref="GOA:C4K1K9"
FT                   /db_xref="InterPro:IPR000271"
FT                   /db_xref="InterPro:IPR020939"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4K1K9"
FT                   /protein_id="ACR47460.1"
FT                   /translation="MKRTFQPSNLVRKRRHGFRSRMATPTGRAILRKRRAKGRHKLSA"
FT   gene            complement(609465..609818)
FT                   /gene="rplT"
FT                   /locus_tag="RPR_03625"
FT   CDS_pept        complement(609465..609818)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplT"
FT                   /locus_tag="RPR_03625"
FT                   /product="50S ribosomal protein L20"
FT                   /note="COG0292 Ribosomal protein L20"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_03625"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47461"
FT                   /db_xref="GOA:C4K1L0"
FT                   /db_xref="InterPro:IPR005813"
FT                   /db_xref="InterPro:IPR035566"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4K1L0"
FT                   /protein_id="ACR47461.1"
FT                   /translation="MTRAKSGKISKNRHKKILKFAKGYRGRANSCFRVAIEKVEKALQY
FT                   AYRDRRNRKRDFRGLWIQRINAAVREHGLVYSQFMGALKKTEIDIDRKVLAELAVNNSD
FT                   GFVSIVEKAKAHI"
FT   gene            complement(609838..610044)
FT                   /gene="rpmI"
FT                   /locus_tag="RPR_03630"
FT   CDS_pept        complement(609838..610044)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmI"
FT                   /locus_tag="RPR_03630"
FT                   /product="50S ribosomal protein L35"
FT                   /note="COG0291 Ribosomal protein L35"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_03630"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47462"
FT                   /db_xref="GOA:C4K1L1"
FT                   /db_xref="InterPro:IPR001706"
FT                   /db_xref="InterPro:IPR018265"
FT                   /db_xref="InterPro:IPR021137"
FT                   /db_xref="InterPro:IPR037229"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4K1L1"
FT                   /protein_id="ACR47462.1"
FT                   /translation="MPKLKTKSAVKKRFKLTASGKVIASQAGKKHFMRRRTKAQIRNLR
FT                   GTTILCPQDGYNIKKYFLPYGIN"
FT   gene            610210..610887
FT                   /locus_tag="RPR_03635"
FT   CDS_pept        610210..610887
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_03635"
FT                   /product="queuosine biosynthesis protein"
FT                   /note="COG0602 Organic radical activating enzymes"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_03635"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47463"
FT                   /db_xref="GOA:C4K1L2"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR024924"
FT                   /db_xref="UniProtKB/TrEMBL:C4K1L2"
FT                   /protein_id="ACR47463.1"
FT                   /translation="MFGQNPKRSILNGDGTQLEVQSIFKTIQGEGIFVGCPAIFIRLGG
FT                   CNLACNFCDTEFEAFDLVDIDKILNKVESLALNSKNEKSINLVVITGGEPMRQPIELLC
FT                   QKLLDRDVKVQIETNGTLYRSLPKEVSIICSPKVGKTSYSKIREDLLPKISAVKFIVAK
FT                   NILEYSLIPEVGQTSYNIPVFIQPMDQNNQRLNGENNELAVKLALESGTRLSLQTHKFL
FT                   NIP"
FT   gene            611642..612253
FT                   /locus_tag="RPR_03650"
FT   CDS_pept        611642..612253
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_03650"
FT                   /product="50S ribosomal protein L25/general stress protein
FT                   Ctc"
FT                   /note="COG1825 Ribosomal protein L25 (general stress
FT                   protein Ctc)"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_03650"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47464"
FT                   /db_xref="GOA:C4K1L3"
FT                   /db_xref="InterPro:IPR001021"
FT                   /db_xref="InterPro:IPR011035"
FT                   /db_xref="InterPro:IPR020055"
FT                   /db_xref="InterPro:IPR020056"
FT                   /db_xref="InterPro:IPR020057"
FT                   /db_xref="InterPro:IPR029751"
FT                   /db_xref="InterPro:IPR037121"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4K1L3"
FT                   /protein_id="ACR47464.1"
FT                   /translation="MSEILELEAESRTEFGTGAARALRRAGRVPAIIYGAGKTPVSISL
FT                   EEKEITKYYRKPAFISQLINLTIDKKKYKVLPKAVELHPVTDIVRHVDFVFLEEKTQKM
FT                   EVPVVYEGKERALGVKRGGYFNIVKRRVTLLCDVNNIPRNVTIDVTNMPMATSLKSSKI
FT                   ELPKGCSFVTKKEFVLATIIGRRGAKTEAEGEQQAAEAGK"
FT   gene            612575..613123
FT                   /locus_tag="RPR_03655"
FT   CDS_pept        612575..613123
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_03655"
FT                   /product="peptidyl-tRNA hydrolase"
FT                   /EC_number="3.1.1.29"
FT                   /note="COG0193 Peptidyl-tRNA hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_03655"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47465"
FT                   /db_xref="GOA:C4K1L4"
FT                   /db_xref="InterPro:IPR001328"
FT                   /db_xref="InterPro:IPR018171"
FT                   /db_xref="InterPro:IPR036416"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4K1L4"
FT                   /protein_id="ACR47465.1"
FT                   /translation="MLLVIGLGNPGKEYQYTRHNVGFIAIEKIANQYNSSFSTKKKFNC
FT                   EIAETISDRQKIIFIKPTTYMNLSGKSVISVKTYYNIYPAKIFVIHDDIDLETGRIKFK
FT                   TGGGNGGHNGLKSIDGVIGNNYNRIRIGVGRPQNNQDVADYVLNHFSKPEYKTVMQAID
FT                   RITSNFGLILENKLEEFKN"
FT   misc_feature    613338..613765
FT                   /note="authentic frameshift: common BLAST hit:
FT                   gi|67458746|ref|YP_246370.1| acetyltransferase"
FT   gene            613762..614859
FT                   /locus_tag="RPR_03670"
FT   CDS_pept        613762..614859
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_03670"
FT                   /product="translation-associated GTPase"
FT                   /note="COG0012 Predicted GTPase, probable translation
FT                   factor"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_03670"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47466"
FT                   /db_xref="GOA:C4K1L5"
FT                   /db_xref="InterPro:IPR004396"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="InterPro:IPR013029"
FT                   /db_xref="InterPro:IPR023192"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031167"
FT                   /db_xref="InterPro:IPR041706"
FT                   /db_xref="UniProtKB/TrEMBL:C4K1L5"
FT                   /protein_id="ACR47466.1"
FT                   /translation="MTLKLGIVGLPNVGKSTLFNALTASQAADAANYPFCTIEPNSSKV
FT                   LVPDARLHTLASLAGSGKIIPSYIEFVDIAGLVKGASKGEGLGNKFLSHIREVDAILHV
FT                   LRCFEDEDITHVHNKVDPLHDLEIIETELILADIESVEKRLATSEKRLKSGDKAMAEQI
FT                   ELLKEVYKVLGEDKPARVLNEALRVDNLKQLQLITSKPVLYICNVLEKDAAIGNEFTKL
FT                   VAERAKKENAKSVVISSKIEAEIALLESMEEKEEFLKFIGLDETGLSKVIKEGYNLLNL
FT                   KRFFTIGPKEAHSWTFKDGTLAPAAAGIIHTDFEKGFIRAEVIGYKDYINLGSEAKAKE
FT                   VGKMRLEGKEYKMQDGDIVHFRFNV"
FT   misc_feature    614901..615761
FT                   /note="authentic frameshift: common BLAST hit:
FT                   gi|91205030|ref|YP_537385.1| nucleotidyltransferase"
FT   misc_feature    615794..617007
FT                   /note="COG0477 Permeases of the major facilitator
FT                   superfamily, bicyclomycin resistance protein"
FT   misc_feature    complement(617196..618666)
FT                   /note="authentic frameshift: common BLAST hit:
FT                   gi|15892845|ref|NP_360559.1| patatin b1 precursor"
FT   gene            complement(617437..618666)
FT                   /locus_tag="RPR_03690"
FT   CDS_pept        complement(617437..618666)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_03690"
FT                   /product="truncated putative patatin b1 precursor"
FT                   /note="COG3621 Patatin [General function prediction only].
FT                   As a result of a frameshift mutation, protein is truncated
FT                   relative to most but not all rickettsial patatins, and
FT                   contains the entire patatin superfamily domain"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_03690"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47939"
FT                   /db_xref="GOA:C4K1L6"
FT                   /db_xref="InterPro:IPR002641"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="UniProtKB/TrEMBL:C4K1L6"
FT                   /protein_id="ACR47939.1"
FT                   /translation="MVDINNNKISLALFEGGGVKGNIHLEKLKIMEQITGKPTCEIFDF
FT                   TGGTSVGGLISILLNLPNPNNPGKPLFSAAQAQELFEEMAHNIFPVGLTFRKLWSFNGL
FT                   FSHKFSPEPLVKLLKEHCKDYTLKDLIGDVVVTGYDLNNKQNPLMTFSTIDARQSEEND
FT                   YYLSDIIQGITAAPGYFPSHNFRNITNTKSHKIIDGGVYANDPTLQTWQLLRENNYHIE
FT                   NALYLSLKEENNDDYQTVCCGGGMLKLVKNNMPAKILSATQQADEKTAQSIFGNKLIEI
FT                   ATYIPEKHAEMSNSSTENLQALKEFAKKSIYGSSTFRDIPYNEKFKEAIDKIITNYNAN
FT                   NPNDQIVMNDFYKELFHINTSNNALDKSFEQEEDIANNEDAVNTPIAQALDSKYRTWEK
FT                   RIISRYQGVF"
FT   misc_feature    complement(618791..619885)
FT                   /note="authentic internal stop codon: common BLAST hit:
FT                   gi|157964614|ref|YP_001499438.1| transposase ISRpe1"
FT   gene            complement(619952..621349)
FT                   /locus_tag="RPR_03720"
FT   CDS_pept        complement(619952..621349)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_03720"
FT                   /product="major facilitator superfamily permease"
FT                   /note="COG0591 Na+/proline symporter"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_03720"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47467"
FT                   /db_xref="GOA:C4K1L7"
FT                   /db_xref="InterPro:IPR001734"
FT                   /db_xref="InterPro:IPR038377"
FT                   /db_xref="UniProtKB/TrEMBL:C4K1L7"
FT                   /protein_id="ACR47467.1"
FT                   /translation="MFNLPIDNIIVFIYLISILLIGIYYRAKNSSFKNYANVESKAQNS
FT                   KLLLIATIFVSSVGGATTFGIMEKAFLGHEYYAYALILTIPIDILIAIYIVPLIAKHYG
FT                   AESIGDILSTYYGNIGRFIGGVSSVIVSVGFLAAQISVSGYIFQYILEINDVNGVILSY
FT                   SIVLIYTTIGGLQSIVFTNLLQFLAMIIAIPTITFISLNKIGFVDFINNLPTENANFDR
FT                   SNLLSYTIAAALSFSVMNLYPTFIQRALINKNPTQTTKAIYAKSAIYFFFLICITLNGL
FT                   IAYKLYPNQPSNLVLPYLINQIIPTLIQGIVMSGLLAAVMSTADSDLNVTSIAIVKDII
FT                   NPIFKVKNQQKLLLIARIINVIIGSFAIIVALKFSNVIDLVVFFTGFWGPVALVPLITT
FT                   LFGIRTSKTIMVLSSLGGAAIFLIWEYYSLSLQYFNLRGVFIGTMVSLVIFILGWWYSN
FT                   VITKKVI"
FT   gene            complement(622002..622520)
FT                   /locus_tag="RPR_03725"
FT   CDS_pept        complement(622002..622520)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_03725"
FT                   /product="hypothetical protein"
FT                   /note="COG0666 FOG: Ankyrin repeat"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_03725"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47468"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="InterPro:IPR036770"
FT                   /db_xref="UniProtKB/TrEMBL:C4K1L8"
FT                   /protein_id="ACR47468.1"
FT                   /translation="MIQVWCLDITLLEQDDTLTPIASSNFIPSISLSAIQEVPLISSSS
FT                   AQDSGYNITLDKLFEQFHITYGAYSFYQSKFFQTAQLKHLIKKILDHQGDDINIQDSFY
FT                   HTVLHKAIYRKLYDIAEFLLEKGASTELKDLDGYTPLQLVIHEGYTEMVKFNNMEQIIE
FT                   IKTNRISTR"
FT   gene            622944..623393
FT                   /locus_tag="RPR_03730"
FT   CDS_pept        622944..623393
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_03730"
FT                   /product="cell division protein MraZ"
FT                   /note="COG2001 Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_03730"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47469"
FT                   /db_xref="GOA:C4K1L9"
FT                   /db_xref="InterPro:IPR003444"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR020603"
FT                   /db_xref="InterPro:IPR035642"
FT                   /db_xref="InterPro:IPR035644"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="InterPro:IPR038619"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4K1L9"
FT                   /protein_id="ACR47469.1"
FT                   /translation="MNVFLSKYVNGVDKKSRVSVPANYRAVLGKELFNGVIAYPSIRNN
FT                   CIEVCGISHIEKLRQMTETLDPYSEERDAFETMIFGEAVQLSFDGEGRVILPQSLMKHA
FT                   GIEEQACFVGKGVIFEIWQPQNFEKYLNAAQKIAHEKRLTLRNAH"
FT   gene            623393..624316
FT                   /gene="mraW"
FT                   /locus_tag="RPR_03735"
FT   CDS_pept        623393..624316
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mraW"
FT                   /locus_tag="RPR_03735"
FT                   /product="S-adenosyl-methyltransferase MraW"
FT                   /note="COG0275 Predicted S-adenosylmethionine-dependent
FT                   methyltransferase involved in cell envelope biogenesis"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_03735"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47470"
FT                   /db_xref="GOA:C4K1M0"
FT                   /db_xref="InterPro:IPR002903"
FT                   /db_xref="InterPro:IPR023397"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4K1M0"
FT                   /protein_id="ACR47470.1"
FT                   /translation="MIQSHVSVMLNKMLEALSPKAGESYLDCTFGAGGYSKAILESCNC
FT                   YVTALDRDPNVIKRAEEIQQNYGERFDFVETNFAGSFAKLKEKKFDGIVLDLGVSSMQL
FT                   DIADRGFSFLHDGPLDMRMSGQGLSAEEFVNAAEAKELADVIYKYGDESFSRRIAKRIV
FT                   EYRKTARIDSTGKLAEIVRSSIGFRKGKIDPATKTFQAIRIYVNDELGELEQFLVNVKN
FT                   ILKKDGRLVVVSFHSLEDRIVKNFFKENSEKPVVRSKYAKDDMTIDPNKWLKIITNKAL
FT                   APSDKEVGLNIRARSAKLRAAKAIYE"
FT   gene            624323..624721
FT                   /locus_tag="RPR_03740"
FT   CDS_pept        624323..624721
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_03740"
FT                   /product="cell division protein FtsL"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_03740"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47471"
FT                   /db_xref="GOA:C4K1M1"
FT                   /db_xref="UniProtKB/TrEMBL:C4K1M1"
FT                   /protein_id="ACR47471.1"
FT                   /translation="MSIRKLHYLTLLITIIAICSLFSIKERVSTLDYQLSSVVKQINSE
FT                   NNNIHILKAEQAYLLLPARLEKLAAAYLKLETVKSYQMIKDPLGPNIDQNIKFNHNISI
FT                   SKSSKWRYKRITNNKYIQTVSSRVQDTR"
FT   gene            625065..626750
FT                   /locus_tag="RPR_03745"
FT   CDS_pept        625065..626750
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_03745"
FT                   /product="cell division protein"
FT                   /note="COG0768 Cell division protein
FT                   FtsI/penicillin-binding protein 2"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_03745"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47472"
FT                   /db_xref="GOA:C4K1M2"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR005311"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR036138"
FT                   /db_xref="UniProtKB/TrEMBL:C4K1M2"
FT                   /protein_id="ACR47472.1"
FT                   /translation="MKQIWEKWKPTIKSLTIWNVCSKNTKIRLLMVICVFSFLFCTLSY
FT                   RLIIVATNVYDKNINSFKKNHQFRKEIVDRNGNLLAVNLPSASLFANPQIVLDPETSVK
FT                   KLAEILPDINKAKLLAELKSNKSFIWVKRDVLPSQQEKITSLGLLGFEFEEEQKRIYTF
FT                   SNLLSHVVGYVGRDSVGLSGLELAYDKYLTNSDYELNEPKNRKEPLQLSIDIRLQSILS
FT                   EEIDKTLKQFKAIGAVGIIADPNNGEILALVNKPDFDPHYPSLAKPEELFNIASLGIYE
FT                   MGSVFKALTMAVGFDTGAINMNDAYDISYMKVGGFQLKDYTPRQGWHSVPEIFLYSSNI
FT                   GTSQIMLEIGKSNFKKYLKKLGLLDQLQIELPERGTPLFPSEKRWNELTSVTMSYGYGI
FT                   SISPLHFVRAMLPVVNGGTLYDLTLLKRKDEKVIGTKVFSENTSTQMKKLFRAVVKEGN
FT                   GKRAEVKGYLIGGKTGTAEKLSQGAGGKKKYLKNSRASSFLGMLPASNPQYIIFIRFDE
FT                   PKPTKESFGFATASWTAAPTAGRVFERMISLYGLEPIEQSEEES"
FT   gene            626925..627119
FT                   /locus_tag="RPR_03750"
FT   CDS_pept        626925..627119
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_03750"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_03750"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47473"
FT                   /db_xref="UniProtKB/TrEMBL:C4K1M3"
FT                   /protein_id="ACR47473.1"
FT                   /translation="MSKNKNITDKPSIPIPRLKSFDLTTTINNIISKQLFISTSSEAQE
FT                   ELELSDNDKRPNPSCCELL"
FT   gene            627369..627890
FT                   /locus_tag="RPR_03755"
FT   CDS_pept        627369..627890
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_03755"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_03755"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47474"
FT                   /db_xref="GOA:C4K1M4"
FT                   /db_xref="UniProtKB/TrEMBL:C4K1M4"
FT                   /protein_id="ACR47474.1"
FT                   /translation="MLKIKQEIYKNSLQIILKLLFALLCFFIILFPLVSYKINIQSRIF
FT                   PAMEIIFIYYFMSLYSLNIFSIFFLGLFIDQISGMPIGTNSLVFLSAYTIYKLSSQYFV
FT                   AKNYLINFIIFCVYCLFILNFKYLLITIKKLEADGYLIIFFQFLTTIFSYNIIRLILDS
FT                   PMNYFKQYAK"
FT   gene            627880..629661
FT                   /locus_tag="RPR_03760"
FT   CDS_pept        627880..629661
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_03760"
FT                   /product="penicillin-binding protein"
FT                   /note="COG0768 Cell division protein
FT                   FtsI/penicillin-binding protein 2"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_03760"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47475"
FT                   /db_xref="GOA:C4K1M5"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR005311"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR017790"
FT                   /db_xref="InterPro:IPR036138"
FT                   /db_xref="UniProtKB/TrEMBL:C4K1M5"
FT                   /protein_id="ACR47475.1"
FT                   /translation="MLNKKILHGELISRRAFIIGLGKLGFLSLLGIRMFYLQLIKSEEY
FT                   KTLSDKNRINFVVLPPTRGRIYDLDGNILATNKPCYQLVIDRSINNNYRDELEIISNIL
FT                   NLSPEKYNYIKQKIKKSSRHTPLIIFDQLDWQQVSMIEEQKHKLASIFIDIGYLRFYPF
FT                   SSVTSHLIGYLGQINEHEKQELNIHSLSDFNIGKSGIEKYYDNKLRGAFGYKKVEVNAY
FT                   GKQVREIAGTPTKSGEDMHLNIDVSLQQNIQQYLNPKGSSAIVMDTKTGNVLICASTPG
FT                   FESNHFSKLSENYWQSLTSDPYKPLINKVIQNSYPPGSVFKIITVLAALEVGINPNKTV
FT                   FCDGSSALGTNSFRCWNHSGHGTLDMMSALKHSCNIYMYELARIVGPDKILEVAREFGL
FT                   GSKTGIDLAPESSGFVPSKEWKKKKLKLPWSIGDSFNLAIGQGFLGVTPMQLARFITAI
FT                   ASNGKLYTPRILKNDPEFYNVNIKPENITIIQESLYNTVNVAGGTAYYNRILGKNRQLA
FT                   GKTGTSQVQGKLNAKDDLSRKSIAWERRNHALFLGFAPYHDPSYSVTVFIDHGGGGSKA
FT                   AAPVARKIMSDVLDKYL"
FT   misc_feature    630337..631282
FT                   /note="authentic frameshift in conserved rickettsial
FT                   hypothetical gene"
FT   gene            complement(631507..633252)
FT                   /locus_tag="RPR_03775"
FT   CDS_pept        complement(631507..633252)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_03775"
FT                   /product="hypothetical protein"
FT                   /note="COG1357 Uncharacterized low-complexity proteins"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_03775"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47476"
FT                   /db_xref="InterPro:IPR001646"
FT                   /db_xref="UniProtKB/TrEMBL:C4K1M6"
FT                   /protein_id="ACR47476.1"
FT                   /translation="MLKVISIITIYLLLSSCSESTRDANGLLTDSQSTVIRNYIISQNS
FT                   KNLKVNLKEKFGSNLKGVKLIGVQLINEDLSGIDLTSCEILRADFAGSNLEKAILTNAI
FT                   IQESNFADSVIKNISGYNSDFQGSIFHNITLQNTNFVQSNFSDTAFNKTTIINVNFESS
FT                   EFSHVLWSNNTIDGVNFQKANLQNNSFKNTNITNSIFYGTDLEKSIINNTNFTNNYFES
FT                   SNLSQTTLTAVIIKDSNFTQSIFNEVNFNNVQSNNSCFAYASFQDSTLQNISLTKCDLQ
FT                   NSTISSSVLKHFKINNAILNNMSLNDNKFNNLSIKNSNANFVRINKTKGSNITLDNISY
FT                   TNNIFSNNDFKQFIVINTNLNSSEIINSNITNGQFNNINFSKSLIQNVNFSDVKITLGN
FT                   LNQVALINSTLTNTAVINSVLSNSQINNINYQAYSGFINTNVSNNIILNSDNSSKILPN
FT                   NIVINSVKDLQKITHLANMNLTNFDLSNLIFDRVDFSNSIFKKANLTNTVIKNSILKEA
FT                   NFSTAILTKTDFSNSILTDSIFKSAKIDQAGFNNSDLTNADFTEAAIKDTSFDKAKTSG
FT                   MKGVE"
FT   gene            complement(633245..634669)
FT                   /locus_tag="RPR_03780"
FT   CDS_pept        complement(633245..634669)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_03780"
FT                   /product="nitrogen assimilation regulatory protein ntrX"
FT                   /note="COG2204 Response regulator containing CheY-like
FT                   receiver, AAA-type ATPase, and DNA-binding domains"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_03780"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47477"
FT                   /db_xref="GOA:C4K1M7"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C4K1M7"
FT                   /protein_id="ACR47477.1"
FT                   /translation="MSQLDVLIVDDEESIRNLIAANLKDEGFNPKVAANSTQALKILSE
FT                   KPVSAVILDIWLQGSEIDGLGILEIIKKRYPLMPVIIISGHGTIETAVNAIKMGAYDYI
FT                   EKPFNNDKLVILLTRACEVTKLKRENIDLKSKVIDKTELVGECSVTLKYKMAIAKAATS
FT                   SSRIMIHGKVGSGKELAARLIHKQSKRVNNPFIIFSPTCMTTEKINQELFGESEKQANN
FT                   KRPTILEFANNGTLYIDEVSNIPIPIQVKLLKFLKDQTITKPCGKNIKIDIKIITGTSK
FT                   NIQDEVNNGKFLEDLYYRLNVSSLKVPSLYERKEDIPLLVKYFVKQLSKFSGLKERSFA
FT                   DETIAALQSYEWPGNIRQLRNVVEWTLIMNPLTTGNNEIIKPYMIPSEILANSANLTKL
FT                   EDSFDMLSMPLREAREVFERQYLSAQMSRFNNNISKTSSFVGMERSALHRKLKLLSLHI
FT                   PPTNRINDEEYEEANA"
FT   gene            635176..635475
FT                   /locus_tag="RPR_03785"
FT   CDS_pept        635176..635475
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_03785"
FT                   /product="putative monovalent cation/H+ antiporter subunit
FT                   F"
FT                   /note="COG2212 Multisubunit Na+/H+ antiporter, MnhF
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_03785"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47478"
FT                   /db_xref="GOA:C4K1M8"
FT                   /db_xref="InterPro:IPR007208"
FT                   /db_xref="UniProtKB/TrEMBL:C4K1M8"
FT                   /protein_id="ACR47478.1"
FT                   /translation="MYPTVKPILKIMLNIFLIIISLFICLITYLFISKTDIFTNLLILN
FT                   SFTTLASLLICCLGLYSGNSSYLDIAIIYFLLSVIATNGYLKYFINESNENKTD"
FT   gene            635456..636742
FT                   /locus_tag="RPR_03790"
FT   CDS_pept        635456..636742
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_03790"
FT                   /product="2-octaprenyl-6-methoxyphenyl hydroxylase"
FT                   /note="COG0654 2-polyprenyl-6-methoxyphenol hydroxylase and
FT                   related FAD-dependent oxidoreductases"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_03790"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47479"
FT                   /db_xref="GOA:C4K1M9"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR005728"
FT                   /db_xref="InterPro:IPR010971"
FT                   /db_xref="InterPro:IPR011295"
FT                   /db_xref="InterPro:IPR018168"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C4K1M9"
FT                   /protein_id="ACR47479.1"
FT                   /translation="MKTKQIDRHLAKFAYREEFVGDTKRSTAAYTSVREDASIGSTHKL
FT                   PLEVEEFGKMSNTVILGCGLSGMLTALSFAQKGIKTTIFESKSVKSPEFFKDIRTTALT
FT                   PHSKNFLFSIDIWEKFEKFVAEMQDIYVVDNKASEILDLRNDADAVLGYVVKNSDFKKM
FT                   LLSKITNNPLITLIDNNQYQEVISHNDYSIIKFDDNQIKCNLLIICDGANSKVRSHYFA
FT                   NEIEKPYQTALTFNIKHEKPHENCAMEHFLPLGPFALLPLKDQYASSVIWSTSSDQAAL
FT                   IVNLPVEEVRFLTQRNAGNSLGKITIDSEISSFPLKARIANRYFHNRIVLIADTAHTVH
FT                   PLAGQGLNQGIKDIEILSMIVSNNGTLQEYQKLRQEDNFIMYKLTDELNNIFANYSKNL
FT                   RCLRQIGFKVINNFKSVKNLVTSYAMGKR"
FT   misc_feature    638512..639217
FT                   /note="authentic frameshift in COG1040 Predicted
FT                   amidophosphoribosyltransferase, competence protein F"
FT   misc_feature    639304..641465
FT                   /note="authentic frameshifts: common BLAST hit:
FT                   gi|67459282|ref|YP_246906.1| 3-hydroxyacyl-CoA
FT                   dehydrogenase FadB"
FT   misc_feature    complement(641657..646968)
FT                   /note="authentic frameshift: common BLAST hit:
FT                   gi|157964695|ref|YP_001499519.1| large extracellular
FT                   alpha-helical protein"
FT   gene            647188..647826
FT                   /locus_tag="RPR_03885"
FT   CDS_pept        647188..647826
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_03885"
FT                   /product="hypothetical protein"
FT                   /note="COG0671 Membrane-associated phospholipid
FT                   phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_03885"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47480"
FT                   /db_xref="GOA:C4K1N0"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="InterPro:IPR036938"
FT                   /db_xref="UniProtKB/TrEMBL:C4K1N0"
FT                   /protein_id="ACR47480.1"
FT                   /translation="MLKYTFEIPLNPALNIKGFAFPSGHMRSGVVFYGWFFANIIYSLL
FT                   RIIIVVTLTGMGFSLIYKGYHYPVDIIASITIGIMVIAVIYSVTKEEIIQKYPYMFGAF
FT                   LWLLTVPMVAYLKIIDVHCLAWVWTVFWGLLDFTISGGLFYKYFDFPQSKLNRFINLAI
FT                   IVASVALIAYINYLFKQYLGYKFYLTWFLIGFSFPLSVRLCHIHIRSTH"
FT   gene            648111..648848
FT                   /locus_tag="RPR_03890"
FT   CDS_pept        648111..648848
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_03890"
FT                   /product="hypothetical protein"
FT                   /note="LRR_RI, Leucine-rich repeats (LRRs), ribonuclease
FT                   inhibitor (RI)-like subfamily"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_03890"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47481"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="UniProtKB/TrEMBL:C4K1N1"
FT                   /protein_id="ACR47481.1"
FT                   /translation="MKKDESPKRQKIDLSRNDLLLQKIKNNDPEIVRVELPYEEDSSFL
FT                   SIVIKTLEKNTVVKEIDLYGSNLSNDDIKNLSKIVKLNQISHLNLNSTSLDSEKIKILI
FT                   DALADNTSLEYLSLNSIALKIEDLRILIDAIKNHPNLSSLALGSSEVGNKGAAIISELF
FT                   HSKLPLKSLDIGQMNITAEGIDVIANNISSAKLMSLNLGYNNLRNEGVIKLLNALMANQ
FT                   YIKELILNETRTSEQSAEVIEGF"
FT   gene            650799..651893
FT                   /locus_tag="RPR_03920"
FT   CDS_pept        650799..651893
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_03920"
FT                   /product="transposase ISRpe1"
FT                   /note="COG2801 Transposase and inactivated derivatives"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_03920"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47482"
FT                   /db_xref="GOA:C4K1N2"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:C4K1N2"
FT                   /protein_id="ACR47482.1"
FT                   /translation="MNLNQKIIKPKIGLLELAKSLGSISSACKAMGYSRDSYYRFKALY
FT                   ETGGEEALYEISRRKPIIANRVDPAIEKAVMDMAIEYPAYGQLRVSNELKKSGILVSPG
FT                   GVRSIWLRNDLNNISKRLKALEAKMAQDGIVLTESQLQVLEERRNEREAHGETETQHPG
FT                   YLGCQDTYYVGNFKGIGKVYSQVFIDSYTRVADAKLYTDKTALTAADMLNDRVLPWYET
FT                   QGIPILRILTDRGSEYKGNIEHHAFELFLSIEGIEHTTTKAYSPQTNGMCERFNKTMKQ
FT                   EFFDTAMRKKIYTDLDDLQLDLDIWLEHFNNERPHSGKYCYGKTPMQTFKDSKKLAVEK
FT                   NNEILYLEYVSDSQNVTDHQVQNL"
FT   gene            complement(652092..653939)
FT                   /gene="aspS"
FT                   /locus_tag="RPR_03925"
FT   CDS_pept        complement(652092..653939)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aspS"
FT                   /locus_tag="RPR_03925"
FT                   /product="aspartyl-tRNA synthetase"
FT                   /EC_number="6.1.1.12"
FT                   /note="COG0173 Aspartyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_03925"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47483"
FT                   /db_xref="GOA:C4K1N3"
FT                   /db_xref="InterPro:IPR002312"
FT                   /db_xref="InterPro:IPR004115"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR004524"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR029351"
FT                   /db_xref="UniProtKB/TrEMBL:C4K1N3"
FT                   /protein_id="ACR47483.1"
FT                   /translation="MGKSYNKKIKMHKYRTHNCNELQISDVETEVKLSGWVHRRRDHGN
FT                   LVFIDLRDHYGITQIVFTDQNPQLMEDASRLRYESVITVRGTVVARSEDTINNTLPTGH
FT                   VEVLAVEFSVESAADTLPFVINTEKDAPEESRLKHRFLDLRREKLHNNIILRSQIISHI
FT                   RHLMTASGFTEFQTPILTASSPEGARDFLVPSRMHPGKFYALPQAPQQFKQLLMVSGFD
FT                   RYFQIAPCFRDEDARADRSPGEFYQLDVEMSFVTQEDVFSTIEPVMYDLFTKFTDKKVS
FT                   ETPFVCIPYNESMLKYGSDKPDLRNPIIIADVTEIFRDSDFTIFRENIKKGSIVRAIPA
FT                   PKAAALPHSFFDKMIEFAISEGAGGLGYIQFSETGEAKGPVVKFLSPQQLESLKATASV
FT                   SNGDAVFFASDKKEKAAKLAGKVRIRLGEELDLLEKDCFKFCWITDFPFYELNEETGKI
FT                   DFSHNPFSMPQGGIDALEQAKTTEELLELTAYQYDIVCNGIELSSGAIRNHKPEIMYKA
FT                   FSIAGYSEEEVDKRFGGMIRAFKFGAPPHGGIAPGIDRIVMLLAEATNIREIIAFPLNQ
FT                   QAEDLLMNAPSYVEDKALKELSIISHRLLEKMQKKNKNL"
FT   gene            complement(654000..654434)
FT                   /locus_tag="RPR_03930"
FT   CDS_pept        complement(654000..654434)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_03930"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_03930"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47484"
FT                   /db_xref="UniProtKB/TrEMBL:C4K1N4"
FT                   /protein_id="ACR47484.1"
FT                   /translation="MPNIAENISKLPEEQAKVNKLVDQYKNLTPEEQKIVDRKLKSHFT
FT                   QEELEQDELKSRMNRIRSNLSKQDQEKLQAGNNSIGEIAKDVLSLVKGIINLVENVAEI
FT                   IKNPKKAIYEWIKGELNQVKPQQQNYQQRPSKPKAAAISR"
FT   gene            complement(654517..655317)
FT                   /locus_tag="RPR_03935"
FT   CDS_pept        complement(654517..655317)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_03935"
FT                   /product="ATPases involved in chromosome partitioning"
FT                   /note="COG1192 ATPases involved in chromosome partitioning"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_03935"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47485"
FT                   /db_xref="InterPro:IPR015223"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C4K1N5"
FT                   /protein_id="ACR47485.1"
FT                   /translation="MNTINKPYIFVIGNEKGGAGKTTCSMHLIIALLYQNYSVVSIDTD
FT                   SRQSSLTNYLKNRDLYNKHNPDKPVLVPKHFHISESKVEEPAKSFEPILKNNQDVDYIV
FT                   IDTPGSHTPLSRVVHSYADTIITPINDSFLDLDVIAKVDSKDEIISPSIYSQMIWEQKM
FT                   ERASRDRISIDWVILRNRLSNLDALNKRRVGNVLAKLAKRINFKLAEGFSERVIYRELF
FT                   LQGLTLLDLKTAKYDRAFNSSHVLARQELRNFLDFLGIKAAFKG"
FT   gene            complement(655536..657038)
FT                   /locus_tag="RPR_03940"
FT   CDS_pept        complement(655536..657038)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_03940"
FT                   /product="leucyl aminopeptidase"
FT                   /EC_number="3.4.11.1"
FT                   /note="COG0260 Leucyl aminopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_03940"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47486"
FT                   /db_xref="GOA:C4K1N6"
FT                   /db_xref="InterPro:IPR000819"
FT                   /db_xref="InterPro:IPR008283"
FT                   /db_xref="InterPro:IPR011356"
FT                   /db_xref="InterPro:IPR023042"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4K1N6"
FT                   /protein_id="ACR47486.1"
FT                   /translation="MLNVNFVNEESSTNQGLVVFIDEQLKLDSNLIGLDQQHHGLISKT
FT                   IQNKLQFTGKYGQIKVIPSVIKSGEVRYLIIAGLGNEEKLTEAKIEELGGKILQHATGC
FT                   KISTIGLKLTNRISRFTSQTFASLVASGAFLASYRFDKYRTTLKEAEKFAVESIEIFTD
FT                   NSTETAKLFEIKKLIAEAVFFTRDISNEPSNIKTPQVYAERIVDRLEPLGVDVDVIGER
FT                   EMKNLGMGALLGVGQGSQNESKLVVMEYKGGSKDAPTIALVGKGVIFDTGGISLKPSSD
FT                   MHLMRYDMGGSAAVVGTIIAVAGQKLSVNIVGVVGLVENMPSGNAQRPGDVVTTMSGQT
FT                   AEVLNTDAEGRLVLADAVWYAQEKFKPKCVIDVATLTGAITIALGNTYAGCFSNNDELA
FT                   DKLIKVGEEVNEKLWRMPLHDEYDAMINSDIADMANIGNVPRAAGSCIAAHFIKRFIKD
FT                   GVDWAHLDIAGVANSNKASALGPKGAVGYGVRLLEQFIKEYT"
FT   gene            657247..658368
FT                   /locus_tag="RPR_03945"
FT   CDS_pept        657247..658368
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_03945"
FT                   /product="hypothetical protein"
FT                   /note="COG0085 DNA-directed RNA polymerase, beta
FT                   subunit/140 kDa subunit"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_03945"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47487"
FT                   /db_xref="InterPro:IPR005728"
FT                   /db_xref="UniProtKB/TrEMBL:C4K1N7"
FT                   /protein_id="ACR47487.1"
FT                   /translation="MIKASCELNQDMGKIYSLTPHPIRYNCLNYLKLLSLPISLAFYIA
FT                   KLCFTANPSWTWIGVNILHEKMGQATAKKILHGLPDEVEPDQNIPKIVEYVFRQYEENP
FT                   TLTPIIEPTFIQKFLAKASKYIPALSRIVKFWNEGGINYSDEIQTKRALIDVIYKHIIA
FT                   KAYEVGKKGGKLEITDVTALFPKINFEEKVNAASANLETEKVEVSNEESLISELPVRHL
FT                   SKPAYREEFKRDTERSTAAYIDISEDASTGSTSKLPLEVKFGKMSIDQKHEEATITTNA
FT                   NNSINPLVNLLMLKALHDAIRQEVLKTYVEHCLAEIQISKNQETLENFQYDDSLARLQL
FT                   YGNYDNNNTYTFEQPVSYLGQAYEHLTAPIACY"
FT   gene            complement(658772..662890)
FT                   /locus_tag="RPR_03950"
FT   CDS_pept        complement(658772..662890)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_03950"
FT                   /product="DNA-directed RNA polymerase subunit beta'"
FT                   /EC_number="2.7.7.6"
FT                   /note="COG0086 DNA-directed RNA polymerase, beta'
FT                   subunit/160 kDa subunit"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_03950"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47488"
FT                   /db_xref="GOA:C4K1N8"
FT                   /db_xref="InterPro:IPR000722"
FT                   /db_xref="InterPro:IPR006592"
FT                   /db_xref="InterPro:IPR007066"
FT                   /db_xref="InterPro:IPR007080"
FT                   /db_xref="InterPro:IPR007081"
FT                   /db_xref="InterPro:IPR007083"
FT                   /db_xref="InterPro:IPR012754"
FT                   /db_xref="InterPro:IPR038120"
FT                   /db_xref="InterPro:IPR042102"
FT                   /db_xref="UniProtKB/TrEMBL:C4K1N8"
FT                   /protein_id="ACR47488.1"
FT                   /translation="MSVVNFYGQLSNTQQFDQIRINIASPDQVRSWSFGEVTKPETINY
FT                   RTFKPEKDGLFCARIFGPVKDYECLCGKYKRMKNRGITCEKCGVEVTVSRVRRERMGHI
FT                   ELAAPVAHIWFLKSLPSRISTLLDMTMRDVEKILYFENYVVVDPGLSILQKGELLTEEE
FT                   LQKAKDKYGEDAFTASIGAEVIQQMLKELDFSKLKQELYEELQTTSSEVKKKKLVKRLK
FT                   LVENFLESENKPEWMIMDVLPVIPPEIRPLVMLDGGRFATSDLNELYRRVINRNNRLKK
FT                   LIESKAPDIIVRNEKRMLQEAVDALFDNGRRGRAAKNANKRPFKSLSDMLKGKQGRFRQ
FT                   NLLGKRVDYSGRSVIVVGPELKLHQCGLPKKMALELFKPFIYSKLELYGIATTIKAAKR
FT                   MVEAEKSEVWDVLEEVIREHPVLLNRAPTLHRLGIQAFEPLLIEGKAIQLHPLVCAAFN
FT                   ADFDGDQMAVHIPLSIEAQLEARVFMMSTNNILSPANGRPIIVPDKDIVLGLYYLTLAF
FT                   DNEVGAGMMFSDLAEMEHALYNKFITIHTKIKYRRNQLNAEGKMVPVIIDTTYGRLMVG
FT                   ELLPSNPNIEFKFINKQLTKKDISLVIDLVYRHCGQKATVIFADQLMKLGFKYACSSGI
FT                   SFGMDDMVVPESKSTHINETQLEIKEFEQQYSNGLITYGEKYNKVVDAWSRCTDRVAND
FT                   MMKEIATPPVNDAPNHQKINAIYMMAISGARGSFQQIKQLGGMRGLMTKSNGQIIQTPI
FT                   ISNFKEGLTEFECFNSANGMRKGQIDTALKTASSGYLTRKLVDVAQDCIITEKDCGTDK
FT                   GIEVKSVIEGGEVIVPLAEKILGRTAAIDIFHPVTNDLILNKGELINEAKLEQIESAGL
FT                   DRIMIKSVLTCESTTGICSICYGRDLATGTLVSEGEAIGVIAAQSIGEPGTQLTMRTFH
FT                   IGGAATKGAEVSSVDASYDTKVKIISRNVVINSEERKIVMSRNCELLLLDNHGNEKARH
FT                   KIPYGARLLVDDGDMVIKTQKLAEWDPYTIPIITEKSGKVLFKDMVEGISIRDVTDEAT
FT                   GIPSKVIIESKQYSRGAELRPRIQLLDAKGEVITLLNGLEARYYLPVGAVLSVEDGVQI
FT                   SVGDIIARIPKESTTTKDITGGLPRVAELVEARRPKDHAVIAEIDGRVEFGKDYKSKRR
FT                   IIIHPIDETMSIEYMVPKGKHVVVNEGDFVKKGDLLIDGNPVLQDILKVMGVEVLANYI
FT                   VNEVQAVYRLQGVKIDDKHIEVIIRQMLQKVEVTDSGGTTLLAGEKIDRHEFDEINEKA
FT                   MKNGLKPAEAQLILQGITKASLQTRSFISAASFQETTRVLTEAAIAGKVDKLRGLKENV
FT                   IVGRLVPAGTGYFMDKMRKAAVKLDEENV"
FT   gene            complement(663148..667269)
FT                   /gene="rpoB"
FT                   /locus_tag="RPR_03955"
FT   CDS_pept        complement(663148..667269)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoB"
FT                   /locus_tag="RPR_03955"
FT                   /product="DNA-directed RNA polymerase subunit beta"
FT                   /EC_number="2.7.7.6"
FT                   /note="COG0085 DNA-directed RNA polymerase, beta
FT                   subunit/140 kDa subunit"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_03955"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47489"
FT                   /db_xref="GOA:C4K1N9"
FT                   /db_xref="InterPro:IPR007120"
FT                   /db_xref="InterPro:IPR007121"
FT                   /db_xref="InterPro:IPR007641"
FT                   /db_xref="InterPro:IPR007642"
FT                   /db_xref="InterPro:IPR007644"
FT                   /db_xref="InterPro:IPR007645"
FT                   /db_xref="InterPro:IPR010243"
FT                   /db_xref="InterPro:IPR014724"
FT                   /db_xref="InterPro:IPR015712"
FT                   /db_xref="InterPro:IPR019462"
FT                   /db_xref="InterPro:IPR037033"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4K1N9"
FT                   /protein_id="ACR47489.1"
FT                   /translation="MVSLRDNIEAQPLSHNRRIRKNFGHINLVADIPNLIEIQKNSYEK
FT                   NFLQLNIKDSERKNKGLQSILNSIFPISDSSNIANLEFVKYEFDTTKYDVEECSQRSLS
FT                   YAAPLKVTLRLSIWDIDEDTGTREIKGIKEQEVYMGDIPLMTKNGTFIINGTERVVVSQ
FT                   MHRSPGVFFYHDEGKVHSSGKLLYSARVIPYRGSWLDLEFDAKDVIYFRIDRKRKLYTT
FT                   TLLRAIGMSTEEIIKFYYNSVTYKLVKNKGWAVKFIPQHITAHRLTSDLVDADTGNILL
FT                   KAGQKITPRLAKKYFGEGLNNILVAHETLIGKYLSEDLRDPASDEVLAKIGEMITADML
FT                   NVINDLKIKNVNVLVINPQSGPYIRNTLFADKNQDREAALCDIFRVLRPGEPVNIEAAE
FT                   SLFYNLFFDTERYDLSEVGRIKMNSRLELNISEEVTVLTIDDIKNIVRVLVELKDGKGI
FT                   IDDIDHLGNRRVRSVGELIENQFRIGLVRMEKSVIERMSAGDVDTVMPHDLVNSKILVA
FT                   VVKEFFSTSQLSQFMDQTNPLSEITHKRRLSALGPGGLSRDRAGFEVRDVHPTHYGRIC
FT                   PIETPEGQNIGLINSMATYARINKHGFIESPYRRVKDGCVTDEVVYLSAIEEGKYKIGQ
FT                   ANSKINKDGKLQGEFINCRVEGGNFVMVEPYEVDFIDVTPMQVVSVAASLIPFLENDDA
FT                   NRALMGSNMQRQAVPLIKTDAPFVGTGVEGVVAKDSGASVLALHDGIVEQVDSNRIVIR
FT                   ILEQKVDGSPSVDIYNLLKFQKSNHNTCINQKPLVKVGHYVKKNDIIADGPSTDNGEIA
FT                   LGRNVLVAFLPWNGYNFEDSILISERIVKEDVFTSIHIEEFEVIARDTRLGPEEITRDI
FT                   PNVSEEALRHLDEVGIIYIGAEVQAGDILVGKVTPKSESPITPEEKLLRAIFGEKAFDV
FT                   KDSSLHVPSGVNGTVVEVRVFSRRGVEKDQRAIAIEKQQIEKFAKDRDDELEIIEHFVF
FT                   SWLEKLLVGQVIINGPKQATVGQTITTEMLKGLSKGQFWQITVEDANVMNEIEQIKTHY
FT                   DEKKEALDKRFATKVEKLQSGDDLPQGALKVVKVFIATKHKLQPGDKMAGRHGNKGVIS
FT                   RIVPEEDMPFLEDGTVVDIVLNPLGLPSRMNIGQILETHLGWASINLAKKISTLVKEYK
FT                   NKHIGIEQIKKFLIELYGENINSILERPEEEIIAFCKKVSKGVHFATPVFDGAKVQDVK
FT                   DMLKLAGQDPSGQVKLIDGRTGEYFDRLVTVGQKYLLKLHHLVDNKIHSRSIGPYSLVT
FT                   QQPLGGKSHFGGQRFGEMECWALQAYGAAYTLQEMLTVKSDDVNGRIKTYDSIVRGENN
FT                   FESGIPESFNVMIKEFRSLCLNVKLEVTSS"
FT   gene            complement(668076..668510)
FT                   /gene="rplL"
FT                   /locus_tag="RPR_03960"
FT   CDS_pept        complement(668076..668510)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplL"
FT                   /locus_tag="RPR_03960"
FT                   /product="50S ribosomal protein L7/L12"
FT                   /note="COG0222 Ribosomal protein L7/L12"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_03960"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47490"
FT                   /db_xref="GOA:C4K1P0"
FT                   /db_xref="InterPro:IPR000206"
FT                   /db_xref="InterPro:IPR008932"
FT                   /db_xref="InterPro:IPR013823"
FT                   /db_xref="InterPro:IPR014719"
FT                   /db_xref="InterPro:IPR036235"
FT                   /db_xref="UniProtKB/TrEMBL:C4K1P0"
FT                   /protein_id="ACR47490.1"
FT                   /translation="MPDVVISQYKKSKKEKIMADLAKIEEQLSSLTLMQAAELVKMLEE
FT                   KWGVSVAAPVAVAAAGAAAPAAEAVAEKTEFEVVLTAAGDKKVEVIKVVKDITGLGLIE
FT                   AKKLVDEAPKPIKSNVKKAEADEIKGKLEAAGAKVELFVF"
FT   gene            complement(668654..669163)
FT                   /gene="rplJ"
FT                   /locus_tag="RPR_03965"
FT   CDS_pept        complement(668654..669163)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplJ"
FT                   /locus_tag="RPR_03965"
FT                   /product="50S ribosomal protein L10"
FT                   /note="COG0244 Ribosomal protein L10"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_03965"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47491"
FT                   /db_xref="GOA:C4K1P1"
FT                   /db_xref="InterPro:IPR001790"
FT                   /db_xref="InterPro:IPR002363"
FT                   /db_xref="InterPro:IPR022973"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4K1P1"
FT                   /protein_id="ACR47491.1"
FT                   /translation="MLRSEKPVAVEDIVNIYKESPSIIITHYHGLTVSQVSSLRESLKS
FT                   KEAGFKVVKNTLAKIAANQTGLNSIANLFAGPTAIVYSKEPVEMAKLVVNFAKANDNLK
FT                   IIGGIVDNHVLDEHSIKDFSKLPTLNELRGNIVGLLQAPATKVVGVLQATSSSMARVIQ
FT                   AHASKN"
FT   gene            complement(669274..669993)
FT                   /gene="rplA"
FT                   /locus_tag="RPR_03970"
FT   CDS_pept        complement(669274..669993)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplA"
FT                   /locus_tag="RPR_03970"
FT                   /product="50S ribosomal protein L1"
FT                   /note="COG0081 Ribosomal protein L1"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_03970"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47492"
FT                   /db_xref="GOA:C4K1P2"
FT                   /db_xref="InterPro:IPR002143"
FT                   /db_xref="InterPro:IPR005878"
FT                   /db_xref="InterPro:IPR016095"
FT                   /db_xref="InterPro:IPR023673"
FT                   /db_xref="InterPro:IPR023674"
FT                   /db_xref="InterPro:IPR028364"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4K1P2"
FT                   /protein_id="ACR47492.1"
FT                   /translation="MSNKKDVAVKISGGKKIREAREKVKSDTLYNLTNAVERLKSASYV
FT                   KFDPTLEIVMKLGIDSRHSDQMVRGVVNLPAGTGKTVRVAVICKEEREEEAKSAGADLV
FT                   GSTNIIDEIKAGKINFDVCIATPDMMAAIGSVARILGPKGLMPNPKLGTVTLDIKNAIK
FT                   NAKSGQVEYRAEKAGIIHAGLGKLSFSDQDLLKNLNAFIEAVIKAKPAGLKGSYLKAMY
FT                   LSSTMGASVQIDLTSIA"
FT   gene            complement(669999..670436)
FT                   /gene="rplK"
FT                   /locus_tag="RPR_03975"
FT   CDS_pept        complement(669999..670436)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplK"
FT                   /locus_tag="RPR_03975"
FT                   /product="50S ribosomal protein L11"
FT                   /note="COG0080 Ribosomal protein L11"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_03975"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47493"
FT                   /db_xref="GOA:C4K1P3"
FT                   /db_xref="InterPro:IPR000911"
FT                   /db_xref="InterPro:IPR006519"
FT                   /db_xref="InterPro:IPR020783"
FT                   /db_xref="InterPro:IPR020784"
FT                   /db_xref="InterPro:IPR020785"
FT                   /db_xref="InterPro:IPR036769"
FT                   /db_xref="InterPro:IPR036796"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4K1P3"
FT                   /protein_id="ACR47493.1"
FT                   /translation="MSQKAIKGYINLIIPAAGATPAPPIGPALGQRKVNIAAFCKDFND
FT                   ATQGMEKGIPLPTVITVYEDSSFSFKIKTPPAAYFLKKYAKITKGSSSTKKEAVVGKVT
FT                   MDDCREIAKLKMPDLNTKNIEAATKIICGSAASMGLEVVGN"
FT   gene            complement(670707..671285)
FT                   /gene="nusG"
FT                   /locus_tag="RPR_03980"
FT   CDS_pept        complement(670707..671285)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nusG"
FT                   /locus_tag="RPR_03980"
FT                   /product="transcription antitermination protein NusG"
FT                   /note="COG0250 Transcription antiterminator"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_03980"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47494"
FT                   /db_xref="GOA:C4K1P4"
FT                   /db_xref="InterPro:IPR001062"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR006645"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR015869"
FT                   /db_xref="InterPro:IPR036735"
FT                   /db_xref="UniProtKB/TrEMBL:C4K1P4"
FT                   /protein_id="ACR47494.1"
FT                   /translation="MIAQSIDNILPSSEKNVKQWYVVHTASGAEKRIKEDMLRKIAKQN
FT                   MTDFFEDILIPVFGVSEVKRGKNFKVEKKLMPSYILIKMNMTDKSWHLVKNISGVTGFL
FT                   GSKTTPKALTESEIQNIFNNLEAEAKEAKNSKLYEVGEIVTVTDGPFETFMGTVEEIDQ
FT                   EKNRLKVSVAIFGKATPIELNFNQVKKND"
FT   gene            complement(671301..671555)
FT                   /gene="secE"
FT                   /locus_tag="RPR_03985"
FT   CDS_pept        complement(671301..671555)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secE"
FT                   /locus_tag="RPR_03985"
FT                   /product="preprotein translocase subunit SecE"
FT                   /note="COG0690 Preprotein translocase subunit SecE"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_03985"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47495"
FT                   /db_xref="GOA:C4K1P5"
FT                   /db_xref="InterPro:IPR001901"
FT                   /db_xref="InterPro:IPR005807"
FT                   /db_xref="InterPro:IPR038379"
FT                   /db_xref="UniProtKB/TrEMBL:C4K1P5"
FT                   /protein_id="ACR47495.1"
FT                   /translation="MPLEVAFCKKSNKLPNKNMFKEYKIYKFFEQVKQETYKVVWPTRK
FT                   ELVASTLVVVVAVFIFSLICLVLDYSIHNIMQLLLNIGK"
FT   gene            complement(671700..671775)
FT                   /locus_tag="RPR_t07806"
FT   tRNA            complement(671700..671775)
FT                   /locus_tag="RPR_t07806"
FT                   /product="tRNA-Trp"
FT   gene            complement(671923..674022)
FT                   /locus_tag="RPR_03990"
FT   CDS_pept        complement(671923..674022)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_03990"
FT                   /product="elongation factor G"
FT                   /note="COG0480 Translation elongation factors (GTPases)"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_03990"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47496"
FT                   /db_xref="GOA:C4K1P6"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004540"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005517"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009022"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035649"
FT                   /db_xref="InterPro:IPR041095"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4K1P6"
FT                   /protein_id="ACR47496.1"
FT                   /translation="MSKINKLEHIRNIGICAHIDAGKTTTTERILYYTGKSHKIGEVHE
FT                   GGATMDWMEQEQERGITITSAATTCRWQDKIINIIDTPGHVDFTIEVERSLRVLDGAVA
FT                   VFDGVAGVEPQSETVWRQADKYNVPRMCFVNKMDRMGADFYRCVEMLKDRLGAKPLVIQ
FT                   LPVGIEENFKGIIDLIKMKAVIWKDEALGAEYFEEDIPADMKDKAEEYRAKLLDMVVEL
FT                   DDHVMEKYLSGEEVTAEEIKRLIRKGTISAAFYPVLCGSAFKNKGVQPLLDAVVDFLPS
FT                   PIDIGIVKGMEVSTGEEKDFPISVTEPFAALAFKIMNDPFVGSLTFIRIYSGKITSGTT
FT                   VINTVKNKREKIGRMLLMHANNREDVKEASAGDIVALAGLKDTTTGDTLSDIDQQVILE
FT                   RMEFPEPVIELAVEPKSTADQEKMGLALSRLAAEDPSFRVSTDYETGQTVIKGMGELHL
FT                   EIIIDRMRREFKVEANIGAPQVAYRETITKVCEIDYTHKKQSGGAGQFARVKIIFEPLK
FT                   EVKDLKDEDKNKIFVFESKIIGGAVPKEYIPGVEKGLNNIRETGVIAGYPMIDFKATLV
FT                   DGAFHDVDSSVLAFEIAAKAAFREGMPKGNPKLLEPIMQVEVITPDEYMGDIIGDLNSR
FT                   RGQIQSMDPRGNAQVVTANIPLAEMFGYVNTLRSLSQGRAQFSMIFSHYDQVPSQVADI
FT                   IKAKK"
FT   gene            complement(674034..674516)
FT                   /locus_tag="RPR_03995"
FT   CDS_pept        complement(674034..674516)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_03995"
FT                   /product="30S ribosomal protein S7"
FT                   /note="COG0049 Ribosomal protein S7"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_03995"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47497"
FT                   /db_xref="GOA:C4K1P7"
FT                   /db_xref="InterPro:IPR000235"
FT                   /db_xref="InterPro:IPR005717"
FT                   /db_xref="InterPro:IPR020606"
FT                   /db_xref="InterPro:IPR023798"
FT                   /db_xref="InterPro:IPR036823"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4K1P7"
FT                   /protein_id="ACR47497.1"
FT                   /translation="MSRRHAAEKRVILPDMKYNSILLSRFINNIMKEGKKALAEKIVYS
FT                   AFNKIEKKHRVDPYQTFNNAMHNVKPHLEVTSVRVGGANYQVPTHVDERRGYALASRWI
FT                   INAASKRSEKMMIDKLAEELFEASNNRGVAIKKKEDTHKMAEANKAFSHFSPKKMK"
FT   gene            complement(674543..674932)
FT                   /gene="rpsL"
FT                   /locus_tag="RPR_04000"
FT   CDS_pept        complement(674543..674932)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsL"
FT                   /locus_tag="RPR_04000"
FT                   /product="30S ribosomal protein S12"
FT                   /note="COG0048 Ribosomal protein S12"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_04000"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47498"
FT                   /db_xref="GOA:C4K1P8"
FT                   /db_xref="InterPro:IPR005679"
FT                   /db_xref="InterPro:IPR006032"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4K1P8"
FT                   /protein_id="ACR47498.1"
FT                   /translation="MPTYNQLVRFGRKSKTRKTKSPALESNPFKSGVCLVVKTVTPKKP
FT                   NSALRKIATVRLSNKRTVNAYIPGEKHSVKEHDRVLVRGGQVPDLPGVKYHIVLGAYDI
FT                   AGVKGRKQGRSRYGTPRKQVAVTKK"
FT   gene            complement(675093..675749)
FT                   /locus_tag="RPR_04005"
FT   CDS_pept        complement(675093..675749)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_04005"
FT                   /product="amino acid ABC transporter permease protein"
FT                   /note="COG0765 ABC-type amino acid transport system,
FT                   permease component"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_04005"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47499"
FT                   /db_xref="GOA:C4K1P9"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C4K1P9"
FT                   /protein_id="ACR47499.1"
FT                   /translation="MFEYLIKFYPKIFFIVEGTLVTLKYSVIAVIFGLVIGMLLAICKV
FT                   NKNRALRLFANFYTSIFRGTPLLIQLSIIYFASPYIIGIKFSVFMAGAIAFSLNSGAYV
FT                   SEVIRAGINAVDKGQFEAAEALAIPKFLITKDIILPQAVKNIFPSLVNELVNLIKESAI
FT                   ISMLGEMDLMRRAQIVSIETYNYFFPMLIAACCYYILVMLISFIAKIIEKKMIVN"
FT   gene            complement(675896..677686)
FT                   /gene="sdhA"
FT                   /locus_tag="RPR_04010"
FT   CDS_pept        complement(675896..677686)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sdhA"
FT                   /locus_tag="RPR_04010"
FT                   /product="succinate dehydrogenase flavoprotein subunit"
FT                   /EC_number="1.3.5.1"
FT                   /note="COG1053 Succinate dehydrogenase/fumarate reductase,
FT                   flavoprotein subunit"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_04010"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47500"
FT                   /db_xref="GOA:C4K1Q0"
FT                   /db_xref="InterPro:IPR003952"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR011281"
FT                   /db_xref="InterPro:IPR014006"
FT                   /db_xref="InterPro:IPR015939"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR037099"
FT                   /db_xref="UniProtKB/TrEMBL:C4K1Q0"
FT                   /protein_id="ACR47500.1"
FT                   /translation="MTKAYNIIHHKFDVVVVGAGGAGLRSAFGMAKEGLNTACITKLFP
FT                   TRSHTVAAQGGISAALGNMGEDDWRWHMYDTVKGSDWLGDQDAIEYMCKNAPDAILELE
FT                   HYGVPFSRTEEGKIYQRPFGGMTTEYGKGKAAQRTCAAADRTGHAILHTLYQQSLKHKV
FT                   QFFVEYFAIDLLMEDGECRGVVAWNLDDGSLHCFRAHNVVLATGGYGRAYFSATSAHTC
FT                   TGDGGGMAIRAGLPLQDMEFVQFHPTGIYSAGCLITEGARGEGGYLVNANGERFMERYA
FT                   PAAKDLASRDVVSRAMTIEIREGRGVGEHKDHVFLHLNHLSPEILHSCLPGISETAKIF
FT                   AGVDVTKEPIPVLPTVHYNMGGIPTNYHGQVIIKDGKNHNSVVKGLMAIGEAACVSVHG
FT                   ANRLGSNSLLDLVVFGKSSALKAAELIKPASPHKSIKEESLEKIINRFDKVRHANGNIL
FT                   VAELRLKMQRTMQSHASVFRTQEVLDEGAGMISEIRSGYKDIKINDKSLIWNSDLVEAL
FT                   ELDNLLDQALVTVYSAAARKESRGAHAREDYPDRNDEDWMKHTLSSIDEAGKVVLDYKP
FT                   VTLTTLTDEVTAIPPVKRVY"
FT   gene            complement(677820..678197)
FT                   /locus_tag="RPR_04015"
FT   CDS_pept        complement(677820..678197)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_04015"
FT                   /product="succinate dehydrogenase membrane anchor subunit"
FT                   /note="COG2142 Succinate dehydrogenase, hydrophobic anchor
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_04015"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47501"
FT                   /db_xref="GOA:C4K1Q1"
FT                   /db_xref="InterPro:IPR000701"
FT                   /db_xref="InterPro:IPR014312"
FT                   /db_xref="InterPro:IPR034804"
FT                   /db_xref="UniProtKB/TrEMBL:C4K1Q1"
FT                   /protein_id="ACR47501.1"
FT                   /translation="MVYDFKAEIVKAKNSGSAKSGSHHWLLQRVTGIILALCSVWLIYF
FT                   TLTNKNNDINIIMWELKKPFNVVALLITVVISLYHAMLGMRVVIEDYISCHKLRNTLII
FT                   IVQLFCIVTIVAFVVALFYKG"
FT   gene            complement(678345..678719)
FT                   /locus_tag="RPR_04025"
FT   CDS_pept        complement(678345..678719)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_04025"
FT                   /product="succinate dehydrogenase cytochrome b-556 subunit"
FT                   /note="COG2009 Succinate dehydrogenase/fumarate reductase,
FT                   cytochrome b subunit"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_04025"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47502"
FT                   /db_xref="GOA:C4K1Q2"
FT                   /db_xref="InterPro:IPR000701"
FT                   /db_xref="InterPro:IPR014314"
FT                   /db_xref="InterPro:IPR018495"
FT                   /db_xref="InterPro:IPR034804"
FT                   /db_xref="UniProtKB/TrEMBL:C4K1Q2"
FT                   /protein_id="ACR47502.1"
FT                   /translation="MTKTKQEIYNKRPTSPHLTIYKPQISSTLSILYRMTGVALFFAVS
FT                   ILVWWLILSKYDNNYLQLAECCIIKICLVAVSYAWFYHLCNGIRHLFWDIGYGFSITLV
FT                   NITCWCVVVGSVLLTVLLWV"
FT   gene            complement(678886..679629)
FT                   /locus_tag="RPR_04030"
FT   CDS_pept        complement(678886..679629)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_04030"
FT                   /product="hypothetical protein"
FT                   /note="COG1054 Predicted sulfurtransferase"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_04030"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47503"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR020936"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="InterPro:IPR040503"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4K1Q3"
FT                   /protein_id="ACR47503.1"
FT                   /translation="MNEKIAILSTYSFVNIEEPANLIPKLLLIGKRKYIRGTILLANEG
FT                   FNGSFSGSYENVNLVLEELIKLTGPKDVNVKINYSDVHPFQKLKVRLKKEIVAMNVDDL
FT                   NVDLFKGEYIEPKDWDEFITKQDVIVIDTRNDYEVEVGTFKSAINPNTKTFKQFPAWVQ
FT                   QNQELLKGKKIAMVCTGGIRCEKSTSLLKSIGYDEVYHLKGGILQYLEDTQNKNNLWQG
FT                   ECFVFDDRRAVTDDLSPVERHWLQR"
FT   gene            complement(679802..681280)
FT                   /locus_tag="RPR_04035"
FT   CDS_pept        complement(679802..681280)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_04035"
FT                   /product="endopeptidase"
FT                   /note="COG0265 Trypsin-like serine proteases, typically
FT                   periplasmic, contain C-terminal PDZ domain"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_04035"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47504"
FT                   /db_xref="GOA:C4K1Q4"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR001940"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR011782"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:C4K1Q4"
FT                   /protein_id="ACR47504.1"
FT                   /translation="MVNLKIVIVIIVLISSNVVLAKENSKSLKVAAQEENEFTEINSAP
FT                   LKVSEAARYSFADIVEPLIPAVVNISTIEYVNSKSENAEKDPLQEKVNDFLEKLNIPLN
FT                   LEEVDQTPKSVPLGSGFIIEPNGLIVTNYHVIANVDKINIKLADNTELSAKLIGNDTKT
FT                   DLALLKIDSEEPLPFVEFGDSNDARVGDWVIAIGNPFGNLGGTVTSGIISSKGRDIDID
FT                   TDNIVDNFIQTDAAINNGNSGGPMFNLDQKVIGVNTAIFSPLGTNIGIGFAIPSNTAKP
FT                   IIERLKKDGKVSRGRLGITIQDLTEEISEGLGLKNTRGVLVAKVQEDGPGDKAGIKTGD
FT                   IIIEFADIPVKNTKKLRVIIADAPIDQEVKVKILRDKKELELPIKITSDNEEVTKDSTE
FT                   ETNKKEITNKEENNLSITKNNITFGNLTEELRQKYTIPQDKMGIMITNINQESIDDISK
FT                   LEELYENAKKSDKQNILLLIERGSSNMFVPLQVM"
FT   gene            complement(681318..682178)
FT                   /locus_tag="RPR_04040"
FT   CDS_pept        complement(681318..682178)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_04040"
FT                   /product="protease activity modulator"
FT                   /note="COG0330 Membrane protease subunits,
FT                   stomatin/prohibitin homologs"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_04040"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47505"
FT                   /db_xref="GOA:C4K1Q5"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR010200"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:C4K1Q5"
FT                   /protein_id="ACR47505.1"
FT                   /translation="MQQKIYYIIFTIVFGLILISSSLFSVDQRQSAVVFQFGEAVRTIE
FT                   NPGLNIKIPFIQNVEFFDKRLLDVEVEAKELTAADGKRVIVDAYAKFQINNPVMFYKTV
FT                   HDYQGVKIRLTRNLESSMRKVIGKISLSSLLSQERSNVMLNILNQVDGEAKSFGIDVVD
FT                   VRILRADLPKENSAAIYRRMQTAREKEATQIRAEGQEESVRIRSKADKESKIILAKAYR
FT                   DAQIIKGDGDEKAAKIYNSAYSVDPEFYKFYRSLLVYKNSLKKENTNFVISPDAEVLKY
FT                   LNLTK"
FT   gene            complement(682271..683311)
FT                   /locus_tag="RPR_04045"
FT   CDS_pept        complement(682271..683311)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_04045"
FT                   /product="protease activity modulator HflK"
FT                   /note="COG0330 Membrane protease subunits,
FT                   stomatin/prohibitin homologs"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_04045"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47506"
FT                   /db_xref="GOA:C4K1Q6"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR010201"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:C4K1Q6"
FT                   /protein_id="ACR47506.1"
FT                   /translation="MLNKKHISILKKSPWKDFDSDKEDNIFTRPRKSQFNFDQFQFPFN
FT                   FNAKTIILVVVAVVALWLASGIYEIKEGEEAAVIRFGRFVRKGYPGLNYHLPAPFEKII
FT                   VEKVKQSRRIEIGYRTNSSLRSGGDNTKNIAGESIMLTGDENIIALNCDVMWHINNLED
FT                   FIFNVQRPAETVKATVESAVREVIGNTPISWVLSDQKQEITYKIEKLAQKILDSYNVGV
FT                   MIEKVQLLKAEPPAEVIDAYRDVQTSKADKEKEINQAQAYNNKILPEARGAAAKIIQEA
FT                   EGYRAEVISKAEGDGQRFNAIYKQYATGRQVTRDRLYLEVVEEVLGGSNKTIINNALLP
FT                   HMAIKP"
FT   gene            683417..684376
FT                   /locus_tag="RPR_04050"
FT   CDS_pept        683417..684376
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_04050"
FT                   /product="Mrp protein"
FT                   /note="COG0489 ATPases involved in chromosome partitioning"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_04050"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47507"
FT                   /db_xref="GOA:C4K1Q7"
FT                   /db_xref="InterPro:IPR000808"
FT                   /db_xref="InterPro:IPR019591"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033756"
FT                   /db_xref="UniProtKB/TrEMBL:C4K1Q7"
FT                   /protein_id="ACR47507.1"
FT                   /translation="MANLHQRQIIDKIQHITFKDGTFLNEVISDIIIKGNNIGFSIDIS
FT                   GKNKLEAEEIRLKAINKLNEISEVNKITIVFTESKPMEKKVQKPKHFVENVKKIILVAS
FT                   GKGGVGKSTISALIAQQLSLANYRVGIVDADIYGPSIPHIFGINEVPQTKDGRIIPVLA
FT                   QSIEIISIGFFVKDHSAIIWRGPMASKTIYQLLSVTKWDNLDYLIIDMPPGTGDIHLSI
FT                   LENYNLDGVIIVTTPQKISEIDVIRSIDLYQKLNLPILGIIENMSYMLKNNSGGHLSQK
FT                   YNIPLIAQIPITPQIAEACDKSLPLTNLLTLPLEKYLQ"
FT   gene            684373..685419
FT                   /locus_tag="RPR_04055"
FT   CDS_pept        684373..685419
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_04055"
FT                   /product="hypothetical protein"
FT                   /note="COG3660 Predicted nucleoside-diphosphate-sugar
FT                   epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_04055"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47508"
FT                   /db_xref="InterPro:IPR009367"
FT                   /db_xref="UniProtKB/TrEMBL:C4K1Q8"
FT                   /protein_id="ACR47508.1"
FT                   /translation="MKIHVLEDDRTGNTHQAIALAEKLTEEYTTIKLEYNCLAKLPNFL
FT                   LKYYPIHIKSELLQYLLDKSPPDMIITAGRRTAVLAFYLKKKFKDIKLIQIMQPNLPYN
FT                   AFDAVILPYHDQRHCEATKWLKQSQGFFTRLLRQYFVFPRNDDFKNIIPINGAINNVTE
FT                   QFAAANLELQKHYPNLKQFIAVIIGGNNKKFNFHEDEAVLFASLLNKIYTNQKIPFFIS
FT                   FSRRTPHTVKSIIKNNMPSSTIIYYPNEDAGYNPYIAMLSKAKYIISTADSISMCSEAA
FT                   SSGKPLYIFCPPNFNSSKHKIFIKQLVEQKIARIFDKSAIALEEYSYKPLNEAERVAEI
FT                   IKSLIKSW"
FT   gene            685528..686097
FT                   /locus_tag="RPR_04060"
FT   CDS_pept        685528..686097
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_04060"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_04060"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47509"
FT                   /db_xref="InterPro:IPR010235"
FT                   /db_xref="UniProtKB/TrEMBL:C4K1Q9"
FT                   /protein_id="ACR47509.1"
FT                   /translation="MSVLILILQLSALIFQDQEWLEVMSIIENADTLLKIDCVRFESTK
FT                   ISSELYKNILKEKKLYISKINLKLEKFRKAFITLEDIYLKPTTEDRAYIDATIQRFEFT
FT                   FELAWKFLKEYFSQKGTFLHYPKEVIKEAFVASIINDESLWIYMLTDRNMISYTYDKKL
FT                   ADEIYNRIRNYVPELKKLLNIIDLKI"
FT   gene            complement(686078..686770)
FT                   /locus_tag="RPR_04065"
FT   CDS_pept        complement(686078..686770)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_04065"
FT                   /product="rRNA methylase"
FT                   /note="COG0565 rRNA methylase"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_04065"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47510"
FT                   /db_xref="GOA:C4K1R0"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR004384"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:C4K1R0"
FT                   /protein_id="ACR47510.1"
FT                   /translation="MNPIIILVAPQMGANIGATARAMKNFGLNELRIVAPRDGWPNEQA
FT                   RSNAVGAVNIIDHAKIFDSLEDSIKDLEYLYATTCIKRAMNKDYVFSQNLPLDYPNSEK
FT                   VGIMFGRENNGLSNEEIAFANKIITINTTEFSSLNIAQAVIIICYELLRNSTPREDVHN
FT                   IQKLATKEEIEHFLVNLFGKLDKAGFFKAPDKKTAMQQNITNIFTRINSLSSPEVPTLQ
FT                   GIIKSLNQ"
FT   gene            complement(686772..687245)
FT                   /gene="ruvC"
FT                   /locus_tag="RPR_04070"
FT   CDS_pept        complement(686772..687245)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ruvC"
FT                   /locus_tag="RPR_04070"
FT                   /product="Holliday junction resolvase"
FT                   /EC_number="3.1.22.4"
FT                   /note="COG0817 Holliday junction resolvasome, endonuclease
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_04070"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47511"
FT                   /db_xref="GOA:C4K1R1"
FT                   /db_xref="InterPro:IPR002176"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR020563"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4K1R1"
FT                   /protein_id="ACR47511.1"
FT                   /translation="MIILGIDPALGSLGWAVVAKETAQLKYLASGIIRTNSKDAIHHRL
FT                   AFINSTLEKVILEYQPNMAAIEETFVNTNSVTSLKLGYARGAIMSLIGRYNLDMREFKP
FT                   NTVKKTVTGYGHAEKDQMLHMIKLLLSGTALITNSDEADAVAIAYTCLVTKNY"
FT   gene            complement(687363..688382)
FT                   /gene="era"
FT                   /locus_tag="RPR_04075"
FT   CDS_pept        complement(687363..688382)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="era"
FT                   /locus_tag="RPR_04075"
FT                   /product="GTP-binding protein Era"
FT                   /note="COG1159 GTPase"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_04075"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47512"
FT                   /db_xref="GOA:C4K1R2"
FT                   /db_xref="InterPro:IPR004044"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005662"
FT                   /db_xref="InterPro:IPR005728"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030388"
FT                   /db_xref="UniProtKB/TrEMBL:C4K1R2"
FT                   /protein_id="ACR47512.1"
FT                   /translation="MTNRHLAKFAYREEFKGDTEALAAAVREDASTGSTSKLPLEVKFG
FT                   KMSNQKTVSVCIIGRPNNGKSTLLNRIIGEKLSIVTPKVQTTRSIITGIITLKDTQVIL
FT                   YDTPGIFEPKGSLEKAMVRCAWSSLHSADLVLLIIDSLRSFDDITHNILDKLRSLNIVP
FT                   IFLLNKIDIESKYLNDIKAFLTENHPDSLLFPISALSGKNIDGLLEYITSKAKISPWLY
FT                   AEDYITDLPMRFIAAEITREQLFLNLQKELPYKLTVQTEKWEDLKDKSVKINQVIVVSR
FT                   ESYKTIILGKNGSKIKEIGAKSRMQMERFFGFPVHLFLFVKVRELWENNQEFYQYMKI"
FT   gene            complement(688375..689058)
FT                   /gene="rnc"
FT                   /locus_tag="RPR_04080"
FT   CDS_pept        complement(688375..689058)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rnc"
FT                   /locus_tag="RPR_04080"
FT                   /product="ribonuclease III"
FT                   /EC_number="3.1.26.3"
FT                   /note="COG0571 dsRNA-specific ribonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_04080"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47513"
FT                   /db_xref="GOA:C4K1R3"
FT                   /db_xref="InterPro:IPR000999"
FT                   /db_xref="InterPro:IPR011907"
FT                   /db_xref="InterPro:IPR014720"
FT                   /db_xref="InterPro:IPR036389"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4K1R3"
FT                   /protein_id="ACR47513.1"
FT                   /translation="MESFEKLEKLLSYSFKNKELLIEALSHPSLRQHHEYKDDKDYERL
FT                   EFLGDAVLNLVITEILFRNFANYNEGNLAKIRSYLVCKETICMVGAKLTLKNYIIMTHG
FT                   EEVAGGRDNLNNIENATEALIAAIYLDSNIETTHDIIEKLWAEFIKVQNLTDYDPKTAL
FT                   QEWAQASDHHLPIYRLIKREGASHASTFTVLVKVKDYEQTGTGHAIKEAEKNAARSLLH
FT                   RLKND"
FT   gene            complement(689058..689858)
FT                   /locus_tag="RPR_04085"
FT   CDS_pept        complement(689058..689858)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_04085"
FT                   /product="signal peptidase I"
FT                   /note="COG0681 Signal peptidase I"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_04085"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47514"
FT                   /db_xref="GOA:C4K1R4"
FT                   /db_xref="InterPro:IPR000223"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR019757"
FT                   /db_xref="InterPro:IPR019758"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="UniProtKB/TrEMBL:C4K1R4"
FT                   /protein_id="ACR47514.1"
FT                   /translation="MQTDNTKSNTNKTAKQEWGSFAFVICIALLIRILIMEPFTVPTGS
FT                   MKATILENDYIFSTKYSYGYSNYSLSFFDFIPLFKGRIFAREPDRGDIVVFRPPNDMSV
FT                   RYIKRLIGLPGDKIQLIDDVIYINDKKIERTEVGTYISEEGIKYLKFKETLPNGRTYFS
FT                   YKLAPIYGVIYNDRYGNTDVFYVPEGKYFFLGDNRDQSNDSRVNLGFVPFENFIAKAQF
FT                   IWFSTKITWWDNDIGVINLVLKLKPWIESVRLNRIFRNLYNTDA"
FT   gene            complement(690042..691307)
FT                   /locus_tag="RPR_04090"
FT   CDS_pept        complement(690042..691307)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_04090"
FT                   /product="NADH dehydrogenase I subunit F"
FT                   /EC_number="1.6.99.5"
FT                   /note="COG1894 NADH:ubiquinone oxidoreductase, NADH-binding
FT                   (51 kDa) subunit"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_04090"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47515"
FT                   /db_xref="GOA:C4K1R5"
FT                   /db_xref="InterPro:IPR001949"
FT                   /db_xref="InterPro:IPR011537"
FT                   /db_xref="InterPro:IPR011538"
FT                   /db_xref="InterPro:IPR019554"
FT                   /db_xref="InterPro:IPR019575"
FT                   /db_xref="InterPro:IPR037207"
FT                   /db_xref="InterPro:IPR037225"
FT                   /db_xref="UniProtKB/TrEMBL:C4K1R5"
FT                   /protein_id="ACR47515.1"
FT                   /translation="MLKEEDKIFTNLHGQQSHDLKSSKKRGDWENTKALLDKGRDFIVE
FT                   EVKKSGLRGRGGAGFSTGMKWSFMPKNLEKSCYLVVNADESEPGTCKDRDILRFEPHKL
FT                   IEGCLLASFAIGANNCYIYIRGEFYNEASNIQHALDEAYKEGLIGKNSCGSGFDCNIYL
FT                   HRGAGAYICGEETALLESLEGKKGMPRLKPPFPAGFGLYGCPTTINNVESIAVVPTILR
FT                   RGASWFAGIGKPNNTGTKIFCISGHVNKPCNVEEAMGISLKELIEKYAGGVRGGWDNLK
FT                   AIIPGGSSVPLLPKSLCEVDMDFDSLRTAGSGLGTGGIIVMDQSTDIIYAIARLSKFYM
FT                   HESCGQCTPCREGTGWMWRVMMRLVKGNVKKSEIDELLNVTKEIEGHTICALGDAAAWP
FT                   IQGLIRHFRSEIEARIKSYSVV"
FT   gene            complement(691472..692398)
FT                   /gene="secF"
FT                   /locus_tag="RPR_04095"
FT   CDS_pept        complement(691472..692398)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secF"
FT                   /locus_tag="RPR_04095"
FT                   /product="preprotein translocase subunit SecF"
FT                   /note="COG0341 Preprotein translocase subunit SecF"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_04095"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47516"
FT                   /db_xref="GOA:C4K1R6"
FT                   /db_xref="InterPro:IPR000731"
FT                   /db_xref="InterPro:IPR005665"
FT                   /db_xref="InterPro:IPR022645"
FT                   /db_xref="InterPro:IPR022646"
FT                   /db_xref="InterPro:IPR022813"
FT                   /db_xref="UniProtKB/TrEMBL:C4K1R6"
FT                   /protein_id="ACR47516.1"
FT                   /translation="MQIYPLRLLPNKIDFDFMNFKKVSYTFSIILSLISFIWIGIYKFN
FT                   FGIDFAGGIVIEVRLDQAPDLPKMRGVLGKLGIGEVVLQNFGSERDLSIRFGSSSEENL
FT                   MKNIELIKGSLQSNFPYKFEYRKVDFVGPQVGRQLIEAGAMAMLFSFLAIMVYIWVRFE
FT                   WYFGLGILIALVHDVILALGFMSMTKLDFNLSTIAAVLTIIGYSVNDSVVIYDRIRENL
FT                   RKYHKKNITEIINLSINETLSRTMLTVITTLLANLALILFGGEAIRSFSVLVFFGIIAG
FT                   TYSSIFISAPILTMFVNRKFNKKVIER"
FT   gene            692471..692707
FT                   /locus_tag="RPR_04100"
FT   CDS_pept        692471..692707
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_04100"
FT                   /product="hypothetical protein"
FT                   /note="COG3750 Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_04100"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47517"
FT                   /db_xref="InterPro:IPR018753"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4K1R7"
FT                   /protein_id="ACR47517.1"
FT                   /translation="MSEVVVKEQLEQYISKIERLEQEKADLSQEVKDIFQDASSHGFDV
FT                   KAMKSILKLKKLDKDKLAEQDAMLELYRDTLGI"
FT   gene            complement(692763..693857)
FT                   /locus_tag="RPR_04105"
FT   CDS_pept        complement(692763..693857)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_04105"
FT                   /product="transposase ISRpe1"
FT                   /note="COG2801 Transposase and inactivated derivatives"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_04105"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47518"
FT                   /db_xref="GOA:C4K1R8"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:C4K1R8"
FT                   /protein_id="ACR47518.1"
FT                   /translation="MNLNQKIIKPKIGLLELAKSLGSISSACKAMGYSRDSYYRFKALY
FT                   ETGGEEALYEISRRKPIIANRVDPAIEKAVMDMAIEYPAYGQLRVSNELKKSGILVSPG
FT                   GVRSIWLRNDLNNISKRLKALEAKMAQDGIVLTESQLQVLEERRNEREAHGETETQHPG
FT                   YLGCQDTYYVGNFKGIGKVYSQVFIDSYTRVADAKLYTDKTALTAADMLNDRVLPWYET
FT                   QGIPILRILTDRGSEYKGNIEHHAFELFLSIEGIEHTTTKAYSPQTNGMCERFNKTMKQ
FT                   EFFDTAMRKKIYTDLDDLQLDLDIWLEHFNNERPHSGKYCYGKTPMQTFKDSKKLAVEK
FT                   NNEILYLEYVSDSQNLTDNQVQNL"
FT   gene            complement(694602..695993)
FT                   /gene="dnaA"
FT                   /locus_tag="RPR_04110"
FT   CDS_pept        complement(694602..695993)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaA"
FT                   /locus_tag="RPR_04110"
FT                   /product="chromosomal replication initiation protein"
FT                   /note="COG0593 ATPase involved in DNA replication
FT                   initiation"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_04110"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47519"
FT                   /db_xref="GOA:C4K1R9"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4K1R9"
FT                   /protein_id="ACR47519.1"
FT                   /translation="MSTNQIILTDQGDNYVNVWSHVAQDLYNHYGETLYNSWFSKVNFI
FT                   ESSLNTVILCAPTNFVRDWIKSKYSMVILQLFQHYNNTIKSIEIITKELPGTTQTVTEL
FT                   PTKTFADIGSSELNSENIFSTLDARFTFDNFVVGAPNELAYAAARAVAESSGAVSESNP
FT                   LFLYGGVGLGKTHLMHAIGWYIKQHNPSRKVIYMSAEKFMYQFVKALRNKEVISFKEKF
FT                   RSVDVLMIDDIQFICGKDSTQEEFFHTFNTLIDNNRQMVISCDRSPSDLDNIEDRIKSR
FT                   LGWGLVADVHSTTYELRLGILESKIEQMNVKIPKDVIDFLASKIVSNVRELEGALNKVI
FT                   AHSNFTLKEITLENTQNILRDLLRSNERIITVEDIQKKVASRYNIKLSDMSSSRRLREV
FT                   ARPRQIAMYLSKALTPKSLADIGKKFGKKDHTTVMHAIKKVEELLENDIELREEINLLM
FT                   KILQN"
FT   gene            complement(695994..696326)
FT                   /locus_tag="RPR_04115"
FT   CDS_pept        complement(695994..696326)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_04115"
FT                   /product="hypothetical protein"
FT                   /note="COG0607 Rhodanese-related sulfurtransferase"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_04115"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47520"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:C4K1S0"
FT                   /protein_id="ACR47520.1"
FT                   /translation="MLISNDNAFLVDVRTREEWQQVGIPHLDNKNKVIFLSWQLNKDFE
FT                   DNFLSIVNDKIHAIIFFLCRSGYRSFIAANFITNIGYKNCYNISDGFEGNNQDKGWKQN
FT                   NLPWQF"
FT   gene            696482..696745
FT                   /locus_tag="RPR_04120"
FT   CDS_pept        696482..696745
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_04120"
FT                   /product="hypothetical protein"
FT                   /note="COG2938 Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_04120"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47521"
FT                   /db_xref="InterPro:IPR005631"
FT                   /db_xref="InterPro:IPR036714"
FT                   /db_xref="UniProtKB/TrEMBL:C4K1S1"
FT                   /protein_id="ACR47521.1"
FT                   /translation="MNKLNKNSLQKKLVYRSKNRGCREMDYILGSFAEKYLSLMDEKKL
FT                   GSYSLILDQNDNDLYNWINNKSSAPSYLDAEIIDKLHKIAKI"
FT   gene            696757..700125
FT                   /locus_tag="RPR_04125"
FT   CDS_pept        696757..700125
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_04125"
FT                   /product="transcription-repair coupling factor"
FT                   /note="COG1197 Transcription-repair coupling factor
FT                   (superfamily II helicase)"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_04125"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47522"
FT                   /db_xref="GOA:C4K1S2"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR003711"
FT                   /db_xref="InterPro:IPR004576"
FT                   /db_xref="InterPro:IPR005118"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036101"
FT                   /db_xref="InterPro:IPR037235"
FT                   /db_xref="InterPro:IPR041471"
FT                   /db_xref="UniProtKB/TrEMBL:C4K1S2"
FT                   /protein_id="ACR47522.1"
FT                   /translation="MLQQKFPAAAKSFFAIDNFTKNLKQDFILSASNEEEALQLYKQAL
FT                   FFSSNENIYYFPSYNTIPYDHTSPNANILSRRAETLIKLTTNNSNSNKLLITHTANLLN
FT                   KLPPKDFFSKYFLKLSPKMKFTTDELAMFLVENSFTRNASSIDAGEFAVRGEIIDIILS
FT                   GPKAYRIHFSWGYIESIKEFDIDTQISTKSCRELIISPANEIVLNSETIGNFKNNYLRN
FT                   FGVNHTDNALYEAVISGRKFTGYEQLLPLFYDSCSNLIDYLNDPIFIFDNLSKQAILEF
FT                   EHSDNDFYSARSEANKLKFNSFYPTLSPTSLYFTASEITELLEQKNNILLTFENSEQAS
FT                   LIENIAATSFIEKKTVFDKLFEVIKANSHKKIIIGSSVLSSFERIKSIIQNYEYKYNEI
FT                   NTLDEAKASIINVAIIPLNQSFYTKEYLFITASELLEEKPSSTNTNKKLKNILLELDNL
FT                   AEGEFVVHKDHGIGQFLKLEALEIKGKPHDFLKILYAGNDKLYIPVESIEVIKKYGNDN
FT                   AEFDKLGSVAWQRSKAKLKKRIKEIALHLIQIAAKRKLNSSASVEFDLEEYDKFCANFP
FT                   FSETEDQLIAINDIKEDLRNGMLMDRLICGDVGFGKTEVAMRAVFMVAKSLNEHLPQVA
FT                   VVVPTTILCSQHFSRFIERFKGFGLNIKQLSSVISSKEAKIIRSELESGKINIIIGTHS
FT                   LLHKNIKFFNLKLLIIDEEQHFGVGQKEFLKSLKSSSHVLAMSATPIPRTLQMSMTGLK
FT                   ELSIIATPPLNRREVHTSVMPFDPVIIRDALLREHFRGGRSFYVVPRIKDIEDIAKQLK
FT                   QIVPELSYKIAYGKMTPSKIDEVMSEFYAGKFDILVSTTIIESGIDIAEANTMIIHNAD
FT                   MLGLSQLYQLRGRIGRGKMRGYAYLTVASNKKMTSHSLRCLEIIQNSCALGSGFTIANR
FT                   DMDLRGFGNLIGEEQSGQIKEVGTELYQEMLEEQIAIFKDEPIVSEQPFIPTINLGLSV
FT                   FIPDNYVADAALKLGLYRRIGNLSNEIEVETFKDEMIDRFGLLPIEFNNLLDIVKIKLL
FT                   CFKLNIENLDSGDNGFVIKFYKNADMTDKILKFVSTYSNQAKIKPDNKLVYIKKLVDKN
FT                   IIVEANQLLWNLSEV"
FT   gene            700272..701711
FT                   /gene="murE"
FT                   /locus_tag="RPR_04130"
FT   CDS_pept        700272..701711
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murE"
FT                   /locus_tag="RPR_04130"
FT                   /product="UDP-N-acetylmuramoylalanyl-D-glutamate--2,
FT                   6-diaminopimelate ligase"
FT                   /EC_number="6.3.2.13"
FT                   /note="COG0769 UDP-N-acetylmuramyl tripeptide synthase"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_04130"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47523"
FT                   /db_xref="GOA:C4K1S3"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005761"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR035911"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:C4K1S3"
FT                   /protein_id="ACR47523.1"
FT                   /translation="MSHNLKQLFQQHNVKGLSINSKTVKDKDIFFAIKGRNTDGNDFIK
FT                   DALSKGAVLVITDNKKNIVIDKVIYVKDVQAALYEAIEIFYPKKPKDLIAVTGTNGKSS
FT                   VVSYIAQTYSLLGKKAASIGTIGVEIFGCVNFINDVPELTTLDYLSFRKIAHNLAENGI
FT                   EYLVFEASSHGLDQARLREIKVNIACFTSFSQDHLDYHHTKENYLLAKLKLFINHLLPN
FT                   GIAILNSDIEEIEFVKDYLHNHNIKFITVGTKGDLEITRLNGSLKGQNINFTFNNREYN
FT                   FNTPIIGSFQASNLLIAVLSIHYIGFAFDDVIDSLVEVKAVKGRMERIDNTNIFVDYAH
FT                   TPDALEKALTELKNIKLRDSKLSVVFGCGGNRDKAKRSLMGQIAAKRADTIIITDDNPR
FT                   HEDPKLIRAAIISGIEKADYTEIANREEAIKYGINNLKQDDILLVAGKGHENYQIIGDK
FT                   KLPFDDAEVVRKCVKVCHPVA"
FT   gene            701920..703269
FT                   /locus_tag="RPR_04135"
FT   CDS_pept        701920..703269
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_04135"
FT                   /product="UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D-alanine
FT                   ligase"
FT                   /note="COG0770 UDP-N-acetylmuramyl pentapeptide synthase"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_04135"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47524"
FT                   /db_xref="GOA:C4K1S4"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005863"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR035911"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:C4K1S4"
FT                   /protein_id="ACR47524.1"
FT                   /translation="MIWNSKTLSAVLGITISNSINCNEVQFNSKDVKKGNLFIALQGNR
FT                   DGHDYVLDAIDKGAAAVIISKRVEINDKDKIILVDDCFEALQKMALYKRENSKAKFIAI
FT                   TGSVGKTSTKEALKVLLQHDFLVFASRGNFNNKLGMLINLASMADDTEYAIFELGMNHK
FT                   GEIRELVQILKPNITMITNISEAHLEFFNSLEEIAEAKCEIFANFSKNDIAVINADTNC
FT                   YNKILSILKNLSITDIHSFGRSAKTSAELILYENLGEQVYLKYKINNKVLDVTIPFIPR
FT                   HFTENYTGVLLIIDILGKDIEIAANHLANISPTKGRGEIINIQNCRVICDYYNASPQSM
FT                   KAALEYLKQVPAENKTAIIGDMLELGENSKRLHEKLVQYILDAACSKVYLVGVNTKYID
FT                   DLLPSKIAKKYFKNVDELITHITDLFEGNELILIKGSRGVKLDKIVDYYK"
FT   gene            703454..704539
FT                   /gene="mraY"
FT                   /locus_tag="RPR_04140"
FT   CDS_pept        703454..704539
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mraY"
FT                   /locus_tag="RPR_04140"
FT                   /product="phospho-N-acetylmuramoyl-pentapeptide-transferase"
FT                   /EC_number="2.7.8.13"
FT                   /note="COG0472 UDP-N-acetylmuramyl pentapeptide
FT                   phosphotransferase/UDP-N-acetylglucosamine-1-phosphate
FT                   transferase"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_04140"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47525"
FT                   /db_xref="GOA:C4K1S5"
FT                   /db_xref="InterPro:IPR000715"
FT                   /db_xref="InterPro:IPR003524"
FT                   /db_xref="InterPro:IPR018480"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4K1S5"
FT                   /protein_id="ACR47525.1"
FT                   /translation="MLYNLLLSHIHNSHIANLFHYITFRSGLAIIITLSLSFITGPILI
FT                   EFLRSLQKNGQPIRSDGPESHQTKVGTPTMGGIMIILSSCLSTLLLADLTNKYIWITLF
FT                   GFISFGIIGFIDDYAKVTKNNHYGVRGKSKLLLQGIISFIICVLLEYLDKSPSHLLNVP
FT                   FFKNLSLDLGYCYIVFAIFVIVGSSNAVNLTDGLDGLATVPIAFTAGSFALISYLVGNL
FT                   IYSHYLQLTYIPNTGELTVLCAGLVGSCLGFLWFNAQPAEVFMGDTGSLSLGGVLGIIS
FT                   VITKHEIVLAIVGGLFVIETASVILQVYYFKATKGKRIFKMAPLHHHFEKHGWAESKVV
FT                   IRFWIISVIFALIGLSSLKLR"
FT   misc_feature    704658..704774
FT                   /note="putative WASP, N-WASP, MENA proteins, rickA gene
FT                   fragment due to transposon insertion"
FT   gene            complement(704800..705894)
FT                   /locus_tag="RPR_04150"
FT   CDS_pept        complement(704800..705894)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_04150"
FT                   /product="transposase ISRpe1"
FT                   /note="COG2801 Transposase and inactivated derivatives"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_04150"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47526"
FT                   /db_xref="GOA:C4K0U6"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:C4K0U6"
FT                   /protein_id="ACR47526.1"
FT                   /translation="MNLNQKIIKPKIGLLELAKSLGSISSACKAMGYSRDSYYRFKALY
FT                   ETGGEEALYEISRRKPIIANRVDPAIEKAVMDMAIEYPAYGQLRVSNELKKSGILVSPG
FT                   GVRSIWLRNDLNNISKRLKALEAKMAQDGIVLTESQLQVLEERRNEREAHGETETQHPG
FT                   YLGCQDTYYVGNFKGIGKVYSQVFIDSYTRVADAKLYTDKTALTAADMLNDRVLPWYET
FT                   QGIPILRILTDRGSEYKGNIEHHAFELFLSIEGIEHTTTKAYSPQTNGMCERFNKTMKQ
FT                   EFFDTAMRKKIYTDLDDLQLDLDIWLEHFNNERPHSGKYCYGKTPMQTFKDSRKLAVEK
FT                   NNEILYLEYVSDSQNVTDNQVQNL"
FT   gene            706087..706371
FT                   /locus_tag="RPR_04155"
FT   CDS_pept        706087..706371
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_04155"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_04155"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47527"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:C4K1S7"
FT                   /protein_id="ACR47527.1"
FT                   /translation="MIEIINIMPNLDIKILNQVKKLYNKYLVTKSLVKIVNTTPNIAPK
FT                   AFNALQALFNDPIENFKCEAVSVLVEIVKAKPSLVKEALNILKTLIRNA"
FT   misc_feature    706621..708582
FT                   /note="authentic frameshifts in hypothetical rickettsial
FT                   gene"
FT   gene            708774..709262
FT                   /locus_tag="RPR_04180"
FT   CDS_pept        708774..709262
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_04180"
FT                   /product="guanosine-3',5'-bis(diphosphate)
FT                   3'-pyrophosphohydrolase"
FT                   /note="COG0317 Guanosine polyphosphate
FT                   pyrophosphohydrolases/synthetases"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_04180"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47528"
FT                   /db_xref="GOA:C4K1S8"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="UniProtKB/TrEMBL:C4K1S8"
FT                   /protein_id="ACR47528.1"
FT                   /translation="MEDLSSWKEKFETCVYAKKLLDNIEYLNAKVKNPVDIEEVTKGIY
FT                   YARKYHDLQIRQLGDPYYSHPIEVAIMLAEFVAEEAPKLYNAIMLQAALLHDTIEDIAL
FT                   TEEVITIGPEVAKHVEGLTRIKPYGKISSEKGLNLLVRQKRYDTILIKFFDRMYNLQT"
FT   gene            complement(710362..711462)
FT                   /locus_tag="RPR_04190"
FT   CDS_pept        complement(710362..711462)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_04190"
FT                   /product="rod shape-determining protein rodA"
FT                   /note="COG0772 Bacterial cell division membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_04190"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47529"
FT                   /db_xref="GOA:C4K1S9"
FT                   /db_xref="InterPro:IPR001182"
FT                   /db_xref="InterPro:IPR011923"
FT                   /db_xref="UniProtKB/TrEMBL:C4K1S9"
FT                   /protein_id="ACR47529.1"
FT                   /translation="MHKNYLERLQKLPITLILLISLICCIGFIVLYSAANSNLQPWAYK
FT                   QIINFCIFLPLAIIIVLIDLRIIFRLSYIFYLCVLALLVAVELFGSTAMGGKRWIDIGI
FT                   VKLQPSEPIKIAVVLMLARYFHSLTIDDLTKFHKVIIPIIGVLIPAFLIIREPDLGTGM
FT                   IVLIVSAIIFFTAGLRIKYFIILGLAALISLPIAWNMMYDYQKKRVMVFLDPEHDPLGA
FT                   SYNIIQSKIAIGSGSLFGRGLNQGSQSHLDFLPEHQTDFIFATFAEEFGFIGGMFLLIL
FT                   YFALITISLLIAANCREIFSKLMVIGITSILFIHVFINIAMVMGLLPVVGVPLPFISYG
FT                   GTMIASMLIGFGLVMNAQVHRHTALN"
FT   gene            complement(711584..712678)
FT                   /locus_tag="RPR_04195"
FT   CDS_pept        complement(711584..712678)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_04195"
FT                   /product="transposase ISRpe1"
FT                   /note="COG2801 Transposase and inactivated derivatives"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_04195"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47530"
FT                   /db_xref="GOA:C4K0H1"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:C4K0H1"
FT                   /protein_id="ACR47530.1"
FT                   /translation="MNLNQKIIKPKIGLLELAKSLGSISSACKAMGYSRDSYYRFKALY
FT                   ETGGEEALYEISRRKPIIANRVDPAIEKAVMDMAIEYPAYGQLRVSNELKKSGILVSPG
FT                   GVRSIWLRNDLNNISKRLKALEAKMAQDGIVLTESQLQVLEERRNEREAHGETETQHPG
FT                   YLGCQDTYYVGNFKGIGKVYSQVFIDSYTRVADAKLYTDKTALTAADMLNDRVLPWYET
FT                   QGIPILRILTDRGSEYKGNIEHHAFELFLSIEGIEHTTTKAYSPQTNGMCERFNKTMKQ
FT                   EFFDTAMRKKIYTDLDDLQLDLDIWLEHFNNERPHSGKYCYGKTPMQTFKDSKKLAVEK
FT                   NNEILYLEYVSDSQNVTDNQVQNL"
FT   misc_feature    complement(712744..714859)
FT                   /note="authentic frameshift: common BLAST hit:
FT                   gi|15892300|ref|NP_360014.1| protease II"
FT   gene            complement(715044..716582)
FT                   /locus_tag="RPR_04210"
FT   CDS_pept        complement(715044..716582)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_04210"
FT                   /product="putative monovalent cation/H+ antiporter subunit
FT                   D"
FT                   /note="COG0651 Formate hydrogenlyase subunit 3/Multisubunit
FT                   Na+/H+ antiporter, MnhD subunit"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_04210"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47531"
FT                   /db_xref="GOA:C4K1T1"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="UniProtKB/TrEMBL:C4K1T1"
FT                   /protein_id="ACR47531.1"
FT                   /translation="MFIQNTKCTFPLTNFELMFDFHPQNQLIALAFLIVTAILNLYTIS
FT                   QNRKLECLIGSLYCLSSIICVFAADFISMIISLEFMTIFACIIIFCDQLKIKPARQYFL
FT                   THLFSSGLILIGTTLLIQTTSNTTFTSLTESVNNFELPAIFILAGCLINASAIFVNGWV
FT                   VHCYPIASSSGIVYLISFTTKVILIIILKLFSGLEILKFFGISMIIYGLVLSLIEKKLK
FT                   RLICYLTVSQLGFILTAISINSPNIAYLITSFIFIHILYNGLFALYFAYIEDEYDIKNY
FT                   QDLQNTQINFILLSGFVISILIYTSILPISSSYIKDEIANILNENSVMLFSKIATCTVL
FT                   FGLLMESSTSFPSLFMSFLRKQESSKNLKNKSFIIFLDSRFRGDYIRTITYLSFCIITL
FT                   CICLFYPIQISHTANFKLVILAISLLLALIFRKIPRISTENINLDLYQYIEKFIYFSID
FT                   KYKETADNNEDAAEYLNFKVIWDNILSKISAWHNQQTAILIVLFLLISLILTLQ"
FT   gene            complement(716584..716988)
FT                   /locus_tag="RPR_04215"
FT   CDS_pept        complement(716584..716988)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_04215"
FT                   /product="Toxin of toxin-antitoxin system VapC"
FT                   /note="COG1487 Predicted nucleic acid-binding protein,
FT                   contains PIN domain"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_04215"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47532"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:C4K1T2"
FT                   /protein_id="ACR47532.1"
FT                   /translation="MGLIIDTAIIIALEREKVSTKQWSHYGQTYISPIVLTELLIGVDR
FT                   VKNENKRIKCLAFIEYVKSLFTILPFGIEEVYTYARITHDLYTQRITIGTHDMLIAATA
FT                   ITKGFLILTLNVKDFKRIQGLEVLTVSSKD"
FT   gene            complement(716979..717266)
FT                   /locus_tag="RPR_04220"
FT   CDS_pept        complement(716979..717266)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_04220"
FT                   /product="Antitoxin of toxin-antitoxin (TA) system VapB"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_04220"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47533"
FT                   /db_xref="UniProtKB/TrEMBL:C4K1T3"
FT                   /protein_id="ACR47533.1"
FT                   /translation="MAQIIRATEFVRSFSDIMNRVYYKGESFDVQKGNHIVARITPAEI
FT                   KPSVAVRDLEEAFKNGPHLDPEDADQFMKNREEIRHNTKQDIKKLVERWD"
FT   gene            complement(717453..718916)
FT                   /locus_tag="RPR_04225"
FT   CDS_pept        complement(717453..718916)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_04225"
FT                   /product="putative monovalent cation/H+ antiporter subunit
FT                   D"
FT                   /note="COG0651 Formate hydrogenlyase subunit 3/Multisubunit
FT                   Na+/H+ antiporter, MnhD subunit"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_04225"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47534"
FT                   /db_xref="GOA:C4K1T4"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="UniProtKB/TrEMBL:C4K1T4"
FT                   /protein_id="ACR47534.1"
FT                   /translation="MITQFTTPSLLILSTLLVGALNLTSPYATQKDSFIRNFLLITIAL
FT                   FFFGNILIIDWLFLKGIRAGFEFNICGNYSIGFHLEPLGLIFLSLIGFLWICALLYTPK
FT                   YLAINNIDYSARFLFFFNFTILIGVLIALSSNLFTMFICYELLTISTAFLIGHTKNNIV
FT                   LSGLYKYLKILMISATILFLPAVIIIYTKTGNGDFASGSLVENYFSKNQSIILLLMFIC
FT                   GIAKTAIFPVHSWLPAAMVAHYPISSLLHAVIVVKTGLFCIYKILLYIFGLSYLQMIFA
FT                   EFNWLIFIPIVSILYSSIKALDTDNIKKILAYSTMNQLSLALLSAFMLTPKALGAAILH
FT                   LVSHSFTKICLFYSMGSIYSLKKADQVQNLHGTSKEFPLISFIISISSLSLIGIPVFSG
FT                   FISKFSILLAASEQNQIIVMIVVIASSIFSSLYLLKILSSIYKPSLVESNVTKPLPYSM
FT                   QISIIMCCCAVTLFYFIQILIREFLAYIT"
FT   gene            complement(719062..720177)
FT                   /locus_tag="RPR_04230"
FT   CDS_pept        complement(719062..720177)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_04230"
FT                   /product="putative monovalent cation/H+ antiporter subunit
FT                   D"
FT                   /note="COG0651 Formate hydrogenlyase subunit 3/Multisubunit
FT                   Na+/H+ antiporter, MnhD subunit"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_04230"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47535"
FT                   /db_xref="GOA:C4K1T5"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="UniProtKB/TrEMBL:C4K1T5"
FT                   /protein_id="ACR47535.1"
FT                   /translation="MGGWTSKIGIEYRLNALNQAIIIYLNLVLLFFLVFCHKITNQTIL
FT                   KYINNNRKSLFYGILLFAHTGYLGMMATHDFFNLYIFIEISALSSYVLIASGNNPKSLI
FT                   GAFDYLIIGSIGATLILISIGFLLSITGSLNMAEIAAYLQEHTNSRIITIAIDFFLIGA
FT                   ILKTAFFPMHFWMMRAYNNTASVILVYLAGISTIIGIYIIYKFTYIIIGYETIKTAITN
FT                   FIKPIALATLIIAPYFAYQTKDFKNIIIYSCCTQIGYVFLLYVTENGIIVLPSLLLADS
FT                   INKIALFLIDAYNGSYKREPNKVLIIIAIMCSCGLPISPLFFIKVNILELLLTQNLLLD
FT                   FIIILLSSVGSLFYHYKMVLLSFPRKRESSN"
FT   gene            complement(720360..720695)
FT                   /locus_tag="RPR_04235"
FT   CDS_pept        complement(720360..720695)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_04235"
FT                   /product="putative monovalent cation/H+ antiporter subunit
FT                   C"
FT                   /note="COG1006 Multisubunit Na+/H+ antiporter, MnhC
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_04235"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47536"
FT                   /db_xref="GOA:C4K1T6"
FT                   /db_xref="InterPro:IPR039428"
FT                   /db_xref="UniProtKB/TrEMBL:C4K1T6"
FT                   /protein_id="ACR47536.1"
FT                   /translation="MHNLIYFFALILLTSGLFIMLTSRNYIHKIIGLGIFQSSVLVFYL
FT                   SIGKIKTGGVPIFQEGITTYTSPLPHVLMLTAIVVGFATLSVALSLIYQIYKHFGTISE
FT                   NEINFDK"
FT   gene            complement(720774..721526)
FT                   /locus_tag="RPR_04240"
FT   CDS_pept        complement(720774..721526)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_04240"
FT                   /product="conjugal transfer protein trbG precursor, virB9a"
FT                   /note="COG3504 Type IV secretory pathway, VirB9 components"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_04240"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47537"
FT                   /db_xref="InterPro:IPR010258"
FT                   /db_xref="InterPro:IPR014148"
FT                   /db_xref="InterPro:IPR033645"
FT                   /db_xref="InterPro:IPR038161"
FT                   /db_xref="UniProtKB/TrEMBL:C4K1T7"
FT                   /protein_id="ACR47537.1"
FT                   /translation="MKQLIIFCTFIILTLDVFALTISRPLGRDPRLRVMTYNPDDVFKF
FT                   TGYYGYQASIELARDEEIVSISMGDTTSWQIVPAGHRIFIKPMEPDATTNMTLITNKRT
FT                   YFFELYAAETLDMRDPEMVFNVKFLYPDDENDNMSGHMQTFSAALASLDLTHPEKYNFN
FT                   YYISGSEEIAPIKIFDDGEFTYLQFRDKNAEISGIFAVDDSLRESLVNYRLAQDNPNMV
FT                   ILEQVFPKLAIRKGKKVTCVFNQSFKAY"
FT   gene            complement(721528..722226)
FT                   /locus_tag="RPR_04245"
FT   CDS_pept        complement(721528..722226)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_04245"
FT                   /product="virB8a protein"
FT                   /note="COG3736 Type IV secretory pathway, component VirB8"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_04245"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47538"
FT                   /db_xref="GOA:C4K1T8"
FT                   /db_xref="InterPro:IPR007430"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:C4K1T8"
FT                   /protein_id="ACR47538.1"
FT                   /translation="MDPLTNAIQEYIKSGEYFIDARKWYNFKYILPLSHRSLLLLICTI
FT                   FTLLLTLICININILLPINKKVNYLIKDDAEKQAAVTNTKHSTLVKPYTSIANIMLQNY
FT                   VNQREEYNYDILKEQFTFIKNASTSIVYMQFANFMNIDNPLSPVIRYQKLYRRSINILS
FT                   INNINDNEAVVTFESLAKNSTDAILENMVWEARIGFIMDSISTNTSPDMPFNFTVTSYK
FT                   LKLLRNKNQK"
FT   gene            722691..722870
FT                   /locus_tag="RPR_04250"
FT   CDS_pept        722691..722870
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_04250"
FT                   /product="virB7 protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_04250"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47539"
FT                   /db_xref="InterPro:IPR024444"
FT                   /db_xref="UniProtKB/TrEMBL:C4K1T9"
FT                   /protein_id="ACR47539.1"
FT                   /translation="MLKSLKLLLVLIMLAQLLSCTPSAPYEIKSPCVSADIDDGLSVSV
FT                   NPCIRRPVNSVNIV"
FT   gene            722920..723651
FT                   /locus_tag="RPR_04255"
FT   CDS_pept        722920..723651
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_04255"
FT                   /product="virB8b protein"
FT                   /note="COG3736 Type IV secretory pathway, component VirB8"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_04255"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47540"
FT                   /db_xref="GOA:C4K1U0"
FT                   /db_xref="InterPro:IPR007430"
FT                   /db_xref="InterPro:IPR026264"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:C4K1U0"
FT                   /protein_id="ACR47540.1"
FT                   /translation="MNNIFGFFKSSNNSQSGSGDTQTQESIKSANPLKITQNWYEERSD
FT                   KLLVQRNLLIILIILLTIFMVIATLVIAFVVKSKQFEPFVIQLNSNTGRASVVEPISSP
FT                   VLTADESLTRYFIKKYITARETYNPVDFATIARTTIRLFSTSSVYYNYLGYIRNKDFDP
FT                   TLKYKEENNTFLVIKSWSKIAADKYIVRFSVNETSGNQLVYNKIAVVSYAYVPMQLTDS
FT                   ELDVNPVGFQVNGYRVDDDNS"
FT   gene            723638..724111
FT                   /locus_tag="RPR_04260"
FT   CDS_pept        723638..724111
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_04260"
FT                   /product="virB9b protein"
FT                   /note="COG3504 Type IV secretory pathway, VirB9 components"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_04260"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47541"
FT                   /db_xref="InterPro:IPR010258"
FT                   /db_xref="UniProtKB/TrEMBL:C4K1U1"
FT                   /protein_id="ACR47541.1"
FT                   /translation="MTIVRFYFLVFILLSGFTVQRECPLVDDPCNSSNNYVDDLSITKD
FT                   NRIKTYIYNPNEVYLLVLHFGFQSHIEFAKNEEVQNIILGDAYAWKITPLANRLFIKPL
FT                   EKDIRTNMTIITNKRIYEFDIASTELMMGNERDLVYVIKFYYPKKNSNYMARF"
FT   gene            724295..725743
FT                   /locus_tag="RPR_04265"
FT   CDS_pept        724295..725743
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_04265"
FT                   /product="virB10 protein"
FT                   /note="COG2948 Type IV secretory pathway, VirB10
FT                   components"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_04265"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47542"
FT                   /db_xref="GOA:C4K1U2"
FT                   /db_xref="InterPro:IPR005498"
FT                   /db_xref="InterPro:IPR042217"
FT                   /db_xref="UniProtKB/TrEMBL:C4K1U2"
FT                   /protein_id="ACR47542.1"
FT                   /translation="MAEEQNNNHNTGALSGADSPEVQRELSKVSVSFNKSIAIVVVICG
FT                   IFIYIFYTLFFGTEKEEIPETQIPSNIVKPVTEVDDNIPEIPKLPDPPKLETPTAPPPP
FT                   PPPVVKVPPVLPPTTPVEENKDKTLPLPPVSLPSTSGTLVESDAEKQRREAKRKSAIVL
FT                   IGGVEPKKTPEQITAETTFKDRGDMSLVLGRGKLIDAVLETAINSDLGGEIRAIISRDV
FT                   FSEKDKVILIPKGSKIFGKYATSTSSDSYGRVSIIWDRIDLTSGYTIEFDSPAVDNLGR
FT                   PGLQGRVDNKYKEQFANAVLQSGFNIGLAKVLDKLVPPPIASQAAATNSATAKQLLNTA
FT                   QTIASNAAMDANTRIVTICTNILAAITDKTSTAYTTMTQACTTAQTASSANTAEQRLQT
FT                   LVQAVNTAASSLLTTTSIASTPTQAQQASTQAFTDVTNVIKNMITQQQFKPTTTVNQGT
FT                   PVRIYVNKDYKFPKAVLLKSKVMK"
FT   gene            725740..726744
FT                   /locus_tag="RPR_04270"
FT   CDS_pept        725740..726744
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_04270"
FT                   /product="type IV secretion system ATPase VirB11"
FT                   /note="COG0630 Type IV secretory pathway, VirB11
FT                   components, and related ATPases involved in archaeal
FT                   flagella biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_04270"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47543"
FT                   /db_xref="GOA:C4K1U3"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR014155"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C4K1U3"
FT                   /protein_id="ACR47543.1"
FT                   /translation="MSEEFAALETFLLPFKNLFAEDGINEIMVNKPGEVWVEKKGDIYS
FT                   KQIPKLDSEHLLALGSLVAQSTEQMISEEKPLLSATLPNGYRIQIVFPPACEIGQIIYA
FT                   IRKPSGMNLTLDEYAKMGAFDDTATESLVDEDAVILNNFLAEKKIKEFIRHAVVSKQNI
FT                   IISGGTSTGKTTFTNAALTEIPAIERLITVEDAREVVLSHHPNRVHLLASKGGQGRANV
FT                   TTQDLIEACLRLRPDRIIVGELRGKEAFSFLRAINTGHPGSISTLHADSPAMAIEQLKL
FT                   MVMQADLGMPPEEVKKYILTVVDIVVQLKRGSGGKRYVSEVYYKKNKNAEGMV"
FT   gene            726899..728674
FT                   /locus_tag="RPR_04275"
FT   CDS_pept        726899..728674
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_04275"
FT                   /product="type IV secretion system component VirD4"
FT                   /note="COG3505 Type IV secretory pathway, VirD4 components"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_04275"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47544"
FT                   /db_xref="GOA:C4K1U4"
FT                   /db_xref="InterPro:IPR003688"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C4K1U4"
FT                   /protein_id="ACR47544.1"
FT                   /translation="MEWHKILKVTRNIFGHAIIHPVVIFCTIWISGAFVAIFTNEVGAL
FT                   GVNINAINIAYKWAYWLINVWGQLKIADYNYLKLKLLASLLSPAIIVIIFYIKNFERIK
FT                   SLQFFKQDEKVYGDASWANPSDIEAAGLRSKKGMLIGVDAGGYFVADGFQHALLFAPTG
FT                   SGKGVGFVIPNLLFWSDSVVVHDIKLENHGLTSGWREKQGQKVFVWEPSNPDGVTHCYN
FT                   PIDWVSTKPGQMVDDVQKISNLIMPEKDFWNNEARSLFLGVTLYLIADPTKTKSFGEVV
FT                   RTMRSDDVVYNLAVVLDTLGGVIHPVAYMNIAAFLQKADKERSGVISTMNSSLELWANP
FT                   LIDSATASSDFNIQEFKKVKTTVYVGLTPDNIQRLQKLMQVFYQQATEFLSRKMPDLKE
FT                   EPYGVMFLLDEFPTLGKMDTFKAGIAYFRGYRVRLFLIIQDTQQLKGTYEDAGMNSFLS
FT                   NATYRITFAANNYETANLISQLVGNKTVEQRSFSKPLFFDLNIATRTQNVSQVQRALLL
FT                   PQEVIQLPRDEQIVLIESFPPIKSRKIKYYEDKFFTSRLLPPTFVPTQVPFDPRANNNE
FT                   ASEETKTITVPENNE"
FT   gene            728667..730088
FT                   /locus_tag="RPR_04280"
FT   CDS_pept        728667..730088
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_04280"
FT                   /product="exopolyphosphatase"
FT                   /note="COG0248 Exopolyphosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_04280"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47545"
FT                   /db_xref="InterPro:IPR003695"
FT                   /db_xref="UniProtKB/TrEMBL:C4K1U5"
FT                   /protein_id="ACR47545.1"
FT                   /translation="MSKMRSAIIDIGSNALRAVVYESDELGAPEIFNYKFRNYLTNLLN
FT                   LDNLDVKHQTYLSLQYLIHIFTKLSVTNIRCVATAILRGHPKADEFKAIIKKRFNIDIE
FT                   IISGEREAYLTAAGLISGISDAFGIVADLGGGSLELAQIGNKKVGKLKSLPLGTKIIVS
FT                   SNFGDVGLITKMLEEEFGAAHYPNLYLIGGALRLMSRIYMESINYPLKNLHNFEINRVE
FT                   FELYLEKLSQIDKLKLSYYEQKVINYNAVLVIKAMIKVFSPEKIIISNYGLKEGVRFDS
FT                   LPSHETEKDIIYERVKRLVKFDRNICKIEKYIEAVQYLLINADATTLIIIELAIMLAQY
FT                   NKNIDKTLRANFVSEFILSSDIPFSHRQRLMLGIALTVTYTAKTDMQINKIAKKMISKS
FT                   DYYNSHIIGYYIKIAREIDGPEFQEPSFSIKLKDDKFLQINASNILPKQVFEKVCERLK
FT                   DISSARKNIRYNFSD"
FT   misc_feature    732100..732547
FT                   /note="authentic frameshift: common BLAST hit:
FT                   gi|67458863|ref|YP_246487.1| Phage portal protein"
FT   gene            complement(732492..732776)
FT                   /locus_tag="RPR_04315"
FT   CDS_pept        complement(732492..732776)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_04315"
FT                   /product="phage host specificity protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_04315"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47546"
FT                   /db_xref="UniProtKB/TrEMBL:C4K1U6"
FT                   /protein_id="ACR47546.1"
FT                   /translation="MFGSFFSSLGGTVGNAFGGGIFSSVGRFVGKMLGEYLDQLNHEPI
FT                   EYDNIKNFKESFKYVTANYGKPIPLIFGTARVNRQIISNQNKQLNCYVL"
FT   gene            733018..733902
FT                   /locus_tag="RPR_04320"
FT   CDS_pept        733018..733902
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_04320"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_04320"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47547"
FT                   /db_xref="InterPro:IPR022565"
FT                   /db_xref="UniProtKB/TrEMBL:C4K1U7"
FT                   /protein_id="ACR47547.1"
FT                   /translation="MFKKYIFILILFIASIARAEIIEVDSLNKIKQDFKENYNKNYVPQ
FT                   DLLVVTVLDDFLFKSLVPIVTQLDKDIYLTLTPLLLNINKNSKAIYIKQLVLTNDSYKK
FT                   ELQESDFPNFVNKMSNSKIPIIAVNDGFTGNFNNIPKFEIWFADYLKKNFDIDFSNSFP
FT                   NNNYIIFNNLDSFANTYPVFYKGILTSNNISEAEMMLNFLIQMNFIPKCFIMISSSIEL
FT                   LSSMELQLSSYSANILFIGYHYNNKNTPKNKDVAYYTKLINDLISQINKLKRNNPPLKN
FT                   NNAKGKNPYDTNK"
FT   gene            733886..734710
FT                   /locus_tag="RPR_04325"
FT   CDS_pept        733886..734710
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_04325"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_04325"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47548"
FT                   /db_xref="InterPro:IPR022565"
FT                   /db_xref="UniProtKB/TrEMBL:C4K1U8"
FT                   /protein_id="ACR47548.1"
FT                   /translation="MTRINKVLLSLLCLVISYAGYGQIIPTYSVDSVTMKNLLPKIDAD
FT                   TLVLINIDNTIITPKSKLFRYQDNSYINFTKYLYSLAADNASVNKTIAKLIVQRQMMLV
FT                   ESKWVDLINKMKQQGATVLGLQEITAPCNLIENYEGWLYTLLYGLNINFTNKVNDKDVF
FT                   RFNPSDAEAPIFYLGIIFTGNINRVKALIEFLKIIPKQPKKIVIFANNKKDLENMDSYL
FT                   SMVDIGYYGIEYLGWQMLPGSPDHQIAELQQSTFLNTGQWLEDDTAAKMLNK"
FT   gene            734713..735489
FT                   /locus_tag="RPR_04330"
FT   CDS_pept        734713..735489
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_04330"
FT                   /product="3'(2'),5'-bisphosphate nucleotidase"
FT                   /note="COG1218 3'-Phosphoadenosine 5'-phosphosulfate (PAPS)
FT                   3'-phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_04330"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47549"
FT                   /db_xref="GOA:C4K1U9"
FT                   /db_xref="InterPro:IPR000760"
FT                   /db_xref="InterPro:IPR006240"
FT                   /db_xref="InterPro:IPR020550"
FT                   /db_xref="InterPro:IPR020583"
FT                   /db_xref="UniProtKB/TrEMBL:C4K1U9"
FT                   /protein_id="ACR47549.1"
FT                   /translation="MNDNLINALKDLIINTGKIALDIKKAGMLTEIKSDGSVVTNADKE
FT                   ISKIIYQTLQTLTSQIAIVCEEQPLPIFSSDTFWLIDPIDGTWSYVNGKSTYTVNIGLI
FT                   ENGFPTIGLIYHPETAKLYYTDVNGRLKIEQNSKEIFVNHEPKHEELHAVIGFYNSNKA
FT                   TKEFLSKYSFGQINAIGSSMKLCLIAEGAADIYPKFGQTMEWDIAAGHALIKAGGGNIL
FT                   DTHGQEITYGKESFANPNFFACSKYWLEREARLHRY"
FT   gene            complement(735629..738301)
FT                   /locus_tag="RPR_04335"
FT   CDS_pept        complement(735629..738301)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_04335"
FT                   /product="DNA mismatch repair protein"
FT                   /note="COG0249 Mismatch repair ATPase (MutS family)"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_04335"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47550"
FT                   /db_xref="GOA:C4K1V0"
FT                   /db_xref="InterPro:IPR000432"
FT                   /db_xref="InterPro:IPR005748"
FT                   /db_xref="InterPro:IPR007695"
FT                   /db_xref="InterPro:IPR007696"
FT                   /db_xref="InterPro:IPR007860"
FT                   /db_xref="InterPro:IPR007861"
FT                   /db_xref="InterPro:IPR016151"
FT                   /db_xref="InterPro:IPR017261"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036187"
FT                   /db_xref="InterPro:IPR036678"
FT                   /db_xref="UniProtKB/TrEMBL:C4K1V0"
FT                   /protein_id="ACR47550.1"
FT                   /translation="MLLNMNLQELKQKYNYDVATKMMQQYLDIKFAHLDCLLLFRMGDF
FT                   YEMFYEDAILASNVLGIALTKHGKNGEEEIAMCGVPYHALENYLTKLIEENYKVAICDQ
FT                   LETPEEAKNRGGYKAVVTRDVTRIITPGTIIEENLIASAEPNYLASLVIPKNKETASLC
FT                   YVDLSTSEIVVVNVPETEILNELARLKPREILLSENLRSSNLADSIFKQLNFRITYQVD
FT                   SVFAINKCKKIILDFYKMKDIKGIGEISSSQICAIGSVLEYLSLTQKQNIPHLPIPRII
FT                   NFHSYMTIDFSTRRNLEIVTNSQGGSQGSLLSTLNHMVTKQGGRLLYNFLSSPLTNIAK
FT                   INHRLNITEFFYSNLEIVKKIRELLKKTSDIERCLTRITMNRSSGRDLLSIKYTLETAT
FT                   IIKGVFFDAYGFNLPDFIEKIIKPLSGDAELYNLIDETIREDAPNNLNDGGIIKHEYHP
FT                   KVAQLHDLINNGKLYIEKLKDQYRKETGIDSLKISHNNVIGLFIDITAKNVNKILDPKF
FT                   IHRQTTVNHVRYTTAELQKLESELVNAKTLVISLEKELYADICSHVIEKASYLRMLANS
FT                   LSGLDVFCNFAYIADEYDYVKPEFTDDLSFDIVKGRHPVVEKALQRESKSFVYNDCHLS
FT                   ELERIWLITGPNMAGKSTFLRQNAIIAIIAQIGSFVPAKSAKIGVVDKIFSRIGAADDL
FT                   IKGQSTFMAEMLETSAILAQSTKNSLIILDEVGRGTSTYDGVSIAWSVLEYIHDKLKCR
FT                   CLFATHYHELTVMSNFLPALQNYTIAIEESGKDILFLHNIISGAADRSYGLHVAALAGL
FT                   PASVINRAEQILLKFEKTSTGKGKNILSTESNNLSLFYLEPNKTTISSKLDKKFSTIDP
FT                   DKLSPKEALELIYELKKLV"
FT   gene            complement(738472..738906)
FT                   /locus_tag="RPR_04340"
FT   CDS_pept        complement(738472..738906)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_04340"
FT                   /product="ribose-5-phosphate isomerase B"
FT                   /EC_number="5.3.1.6"
FT                   /note="COG0698 Ribose 5-phosphate isomerase RpiB"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_04340"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47551"
FT                   /db_xref="GOA:C4K1V1"
FT                   /db_xref="InterPro:IPR003500"
FT                   /db_xref="InterPro:IPR004785"
FT                   /db_xref="InterPro:IPR036569"
FT                   /db_xref="UniProtKB/TrEMBL:C4K1V1"
FT                   /protein_id="ACR47551.1"
FT                   /translation="MKTYNIVIASDHSGYELKSEIINYLKQKSLKIYDCGTNNTQTVDY
FT                   PDYAKKVVDIIIEKSAPIGILISDTGIGMSIAANRSSEIRAALCNNILTAENAKAHNDA
FT                   NILILGAKTIDKKIVFDIIDKFLTTQFEGGRHSTRLSKIK"
FT   gene            738994..739632
FT                   /locus_tag="RPR_04345"
FT   CDS_pept        738994..739632
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_04345"
FT                   /product="peptidoglycan-specific endopeptidase, M23 family
FT                   protein"
FT                   /note="COG0739 Membrane proteins related to
FT                   metalloendopeptidases"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_04345"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47552"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="UniProtKB/TrEMBL:C4K1V2"
FT                   /protein_id="ACR47552.1"
FT                   /translation="MKYPVVLSIVICFCLVACVDQPPAPIEYKVGDVTANNNSTALDHD
FT                   EGMIVQRTMEDNPASEKVSGRLEEPKAKIIEDDNDDIEIPMSRNEDEDEESIEQLNFVK
FT                   PLNGVIITEFKAGKSKGIDIVAKEYSEVKSIAAGTVIYSGYNKQFGNLVIVKLDKDDLE
FT                   VAYASLDDLLLKKGDKIARNSVIGHVEHKLYFAMRKNKIAVDPNKYIEF"
FT   gene            739633..740325
FT                   /locus_tag="RPR_04350"
FT   CDS_pept        739633..740325
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_04350"
FT                   /product="zinc metalloprotease"
FT                   /note="COG1451 Predicted metal-dependent hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_04350"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47553"
FT                   /db_xref="GOA:C4K1V3"
FT                   /db_xref="InterPro:IPR002725"
FT                   /db_xref="UniProtKB/TrEMBL:C4K1V3"
FT                   /protein_id="ACR47553.1"
FT                   /translation="MEDVITLTKYGEPQNVIVRRSSKAKNIAIRITSKGAELVLPLKVK
FT                   AEKGHNFLLSQEYWVRQKLRRNVTAIPKDEDKISILGKSYEIIHIDSSKNQIKFNDSTL
FT                   EVYCCSQVLKKLSIEVFLKKKLLAEIKIIVENISKKHNLTYSNIRIMENVSRWGSCCSK
FT                   GNLVFNWRVVFAPFEVLKYLVAHEMAHLKEMNHSKNFWELVEYIYPEYQPAKLWLKRNG
FT                   KNLYSYLP"
FT   gene            740434..741318
FT                   /gene="thyX"
FT                   /locus_tag="RPR_04355"
FT   CDS_pept        740434..741318
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thyX"
FT                   /locus_tag="RPR_04355"
FT                   /product="FAD-dependent thymidylate synthase"
FT                   /EC_number="2.1.1.148"
FT                   /note="COG1351 Predicted alternative thymidylate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_04355"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47554"
FT                   /db_xref="GOA:C4K1V4"
FT                   /db_xref="InterPro:IPR003669"
FT                   /db_xref="InterPro:IPR036098"
FT                   /db_xref="UniProtKB/TrEMBL:C4K1V4"
FT                   /protein_id="ACR47554.1"
FT                   /translation="MHNTTKRVTVPALEEILYEPIKVLDCGFIRVIDYMGDDSAIVQAA
FT                   RVSYGKGTKQLNQDKGLINYLLRHYHTTPFEMCDIKFHIKLPIFIARQWIRHRTASVNE
FT                   YSARYSILGNEFYLPEPANIASQSAVNKQCREGDSLPKEVAEKVLAILEEDARQCYGHY
FT                   KELMNADEEGNIIDENATGIAKELARMNLTLNYYTEWYWKINLHNLLHFLRLRADPHAQ
FT                   YEIRVYAEKMLEIVKAWVPFAYEAFEEYRLQGANISRKGLDVIKRMINGEKVTHETSDM
FT                   TKREWEELMKIFG"
FT   gene            741393..742727
FT                   /gene="tolB"
FT                   /locus_tag="RPR_04360"
FT   CDS_pept        741393..742727
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tolB"
FT                   /locus_tag="RPR_04360"
FT                   /product="translocation protein TolB"
FT                   /note="COG0823 Periplasmic component of the Tol biopolymer
FT                   transport system"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_04360"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47555"
FT                   /db_xref="GOA:C4K1V5"
FT                   /db_xref="InterPro:IPR007195"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR011659"
FT                   /db_xref="InterPro:IPR014167"
FT                   /db_xref="InterPro:IPR036752"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4K1V5"
FT                   /protein_id="ACR47555.1"
FT                   /translation="MRNIIYFILSLLFSVTSYALETINIEHGRADPTPIAVNKFDADNS
FT                   AADVLGHDMVKVISNDLKLSGLFRPISAASFIEEKTGIEYKPLFAAWRQINASLLVNGE
FT                   VTKLESGKFQISFILWDTLLEKQLVGEILEVPKNLWRRAAHKIADKIYEKITGDAGYFD
FT                   TKIVYVSESSSLPKIKRIALMDYDGANNKYLTNGKSLVLTPRFARSADKIFYVSYATKR
FT                   RVLVYEKDLKTGKESVVGDFPGISFAPRFSPDGRKAVMSIAKNGSTHIYEIDLATKRLH
FT                   KLTDGFGINTSPSYSPDGKKIVYNSDRNGVPQLYIMNSDGSDVQRISFGGGSYAAPSWS
FT                   PRGDYIAFTKITKGDGGKTFNIGIMKACPQDDKNSERIITSGYLVESPCWSPNGRVIMF
FT                   AKGWPSSAKAPGKNKIFAIDLTGHNEREIMTPADASDPEWSGVLN"
FT   gene            complement(742865..743746)
FT                   /locus_tag="RPR_04365"
FT   CDS_pept        complement(742865..743746)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_04365"
FT                   /product="RNA polymerase factor sigma-32"
FT                   /note="COG0568 DNA-directed RNA polymerase, sigma subunit
FT                   (sigma70/sigma32)"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_04365"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47556"
FT                   /db_xref="GOA:C4K1V6"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR009042"
FT                   /db_xref="InterPro:IPR012759"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="UniProtKB/TrEMBL:C4K1V6"
FT                   /protein_id="ACR47556.1"
FT                   /translation="MTNNINALAISSESGFYSYLQKINKIPSLTQEEELLLAKSYLEGN
FT                   DLQAAHKLVTSHLKLVAKIASGYRTYGLPITELVSEGNIGLMQAVKKFNPELGFRLSTY
FT                   AMWWIKAAIQEYILKSWSLVKMGTTAAQKKLFFSLNKVKHKITNLYSRAITTDDFVQIA
FT                   DELGVSVNEVSEMNTRISGPDLSLNNSINSDDAESGELIELLPETRPTPEAMAINKQNS
FT                   TSKRQLLSNAMKILNDRELRILTERKLTDTPKTLDILSNEYNISKERIRQIENTAFEKI
FT                   KKFILNHSREVA"
FT   gene            743835..744401
FT                   /locus_tag="RPR_04370"
FT   CDS_pept        743835..744401
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_04370"
FT                   /product="Cytochrome oxidase assembly factor"
FT                   /note="COG3175 Cytochrome oxidase assembly factor"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_04370"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47557"
FT                   /db_xref="GOA:C4K1V7"
FT                   /db_xref="InterPro:IPR007533"
FT                   /db_xref="InterPro:IPR023471"
FT                   /db_xref="UniProtKB/TrEMBL:C4K1V7"
FT                   /protein_id="ACR47557.1"
FT                   /translation="MSKKSNKNLAFSLLGLIISMVLLSFASVPIYNLFCKVTGYGGTTA
FT                   KETVSVYSKVKGTKPIIIEFDANVDKDLPWRFIPRQQRVQIVPGQNTLVFYETENLSDN
FT                   DIIGTSVYNVTPNKAGKYFVKIHCFCFEEQLLKAGERVLMPVTFYIDKDFELDPEMQDI
FT                   KVLTLSYSFFKVREMSSLRGNYVSN"
FT   gene            complement(744499..745479)
FT                   /locus_tag="RPR_04375"
FT   CDS_pept        complement(744499..745479)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_04375"
FT                   /product="hypothetical protein"
FT                   /note="COG0457 FOG: TPR repeat"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_04375"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47558"
FT                   /db_xref="GOA:C4K1V8"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:C4K1V8"
FT                   /protein_id="ACR47558.1"
FT                   /translation="MLFKILYKTVITLALIYFILIILEYARQGFLNDLSLQKVDLSIQN
FT                   SIKEPIYLVSYADGLEYVYRNQNATTHYAINKGIDFIFNYKKKHINQAFIEKNQEIFNE
FT                   PAGAGLWLWKPYIILETMKNAPEGAIIVYLDSAFVIKKHISNLTNLLGDNDILLVHDRN
FT                   RKNGSFVKGETFALMDCLTDECRNDDHIWSAVIIVRNTKLSRSFIEQWLKSCEDIRILS
FT                   GKNYNIHPNYDEYKWHHSDQSVLSLIYHKNPQSVKVIEYEETTPSLSWFHRKYSNSSPL
FT                   KPWYSIYGIDPIINFNTNGKVLPATSLINTPTIVRLRKWVIEYIQ"
FT   gene            complement(745659..746639)
FT                   /locus_tag="RPR_04376"
FT   CDS_pept        complement(745659..746639)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_04376"
FT                   /product="hypothetical protein"
FT                   /note="COG0457 FOG: TPR repeat"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_04376"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47944"
FT                   /db_xref="GOA:C4K1V8"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:C4K1V8"
FT                   /protein_id="ACR47944.1"
FT                   /translation="MLFKILYKTVITLALIYFILIILEYARQGFLNDLSLQKVDLSIQN
FT                   SIKEPIYLVSYADGLEYVYRNQNATTHYAINKGIDFIFNYKKKHINQAFIEKNQEIFNE
FT                   PAGAGLWLWKPYIILETMKNAPEGAIIVYLDSAFVIKKHISNLTNLLGDNDILLVHDRN
FT                   RKNGSFVKGETFALMDCLTDECRNDDHIWSAVIIVRNTKLSRSFIEQWLKSCEDIRILS
FT                   GKNYNIHPNYDEYKWHHSDQSVLSLIYHKNPQSVKVIEYEETTPSLSWFHRKYSNSSPL
FT                   KPWYSIYGIDPIINFNTNGKVLPATSLINTPTIVRLRKWVIEYIQ"
FT   gene            746901..747998
FT                   /gene="trmU"
FT                   /locus_tag="RPR_04380"
FT   CDS_pept        746901..747998
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trmU"
FT                   /locus_tag="RPR_04380"
FT                   /product="tRNA
FT                   (5-methylaminomethyl-2-thiouridylate)-methyltransferase"
FT                   /EC_number="2.1.1.61"
FT                   /note="COG0482 Predicted
FT                   tRNA(5-methylaminomethyl-2-thiouridylate)
FT                   methyltransferase, contains the PP-loop ATPase domain"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_04380"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47559"
FT                   /db_xref="GOA:C4K1W0"
FT                   /db_xref="InterPro:IPR004506"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR023382"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4K1W0"
FT                   /protein_id="ACR47559.1"
FT                   /translation="MINLGDKQSTIVVAMSGGVDSSAVAAMLHEQGHNVIGITLQLYDH
FT                   GMAVGKKNSCCAGQDIYDAKMVANKLGIPHYVLDYESKFKESVIDNFVDSYLQGETPLP
FT                   CVQCNKSVKFRDLIKTARELGADKLATGHYVRKINGDNGAELHTGLDPAKDQSYFLFMT
FT                   TKEQLEYLRFPLGGLTKGETRKLASKFGLEVADKPDSQDICFIPDGNYKSVINKIRPNS
FT                   SESGKIIHVNGFELGEHSGIINYTIGQRRGLGIAYNEPLYVVKIDPKDNIVYVGPESAL
FT                   NVQEFIIRDVNWLADEIKDNEKLEVAVKIRSTRPPRLAEISKLGDDKMKVKFLCEEKAV
FT                   APGQACVIYAGERVLGGGWITREIR"
FT   gene            748129..749526
FT                   /locus_tag="RPR_04385"
FT   CDS_pept        748129..749526
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_04385"
FT                   /product="cationic amino acid transporter-1"
FT                   /note="COG0531 Amino acid transporters"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_04385"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47560"
FT                   /db_xref="GOA:C4K1W1"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:C4K1W1"
FT                   /protein_id="ACR47560.1"
FT                   /translation="MSFLRKKSFESVKEIGSSSGLSKTLGAFDLILLGLGAMIGTGVFV
FT                   VTGIIAAKYSGPAVMLSYAIAGITCIFVALVYTELAAMLPTSGSIYTYSYVAFGEVFAW
FT                   MIGSVIILELGVAAGIVAAGWSGYVQGILAAGGINLPKELTTVPTNGGIINLPAFLISG
FT                   FIGFILYLGTKDSKRLNAILVFIKMTAIFVFILAAAPHFDATNWSNFMPFGFSNVLVGA
FT                   SILFLAFTGFGTIATAAEECKNPKRDIMIGIIGSLVLTTIVYVTMAGLVTGIAPFDQLN
FT                   IDQPLAYALTINNSKIGSAIVATGAVCGMMTVLMMNIYGTSRIFYAIARDGLLPKSFAK
FT                   LHPKYDSPYITIIIFASLAAILGGFCSTELLTQLTSMGALIDYITVTIIVVLFRVTLPD
FT                   AQRPFRCPLVFIIVPFILIACAYLLFIQIYDGEFNLLTAGRALIYWFITIFVLYIIRSF
FT                   FMQKEQN"
FT   gene            749676..750920
FT                   /gene="hisS"
FT                   /locus_tag="RPR_04390"
FT   CDS_pept        749676..750920
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisS"
FT                   /locus_tag="RPR_04390"
FT                   /product="histidyl-tRNA synthetase"
FT                   /EC_number="6.1.1.21"
FT                   /note="COG0124 Histidyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_04390"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47561"
FT                   /db_xref="GOA:C4K1W2"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR004516"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR015807"
FT                   /db_xref="InterPro:IPR033656"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="InterPro:IPR041715"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4K1W2"
FT                   /protein_id="ACR47561.1"
FT                   /translation="MTEKLQPLRGMKDLLPDDYKVHDYIINTARDVGVLYGYKQMSTPI
FT                   VEYTKVFNRSMGESSDIISKEIYSFLDKSNDFVALRPEFTACIIRSLISNRLQHKLPLK
FT                   FFSTGPVFRYDRPQAGRQRQFHQLNYEYIGAKGAITDADTLKLAVDILKALEIEQDTTL
FT                   ELNSLGCNESRSVYQQKLVEYLNDFKDQLSKESKIRLSKNPMRILDSKSETDQKIIANA
FT                   PVLSEYYTDESKEYFEELIQYLDILGVKYSINPCLVRGLDYYCHTAFEFTTKKLGSQST
FT                   ILAGGRYDGLAKIMGNNDDVPAIGFAAGIERIALIREYNISEVKPVFVLPIGKNNICYA
FT                   LEIVDKLRTENIAIIIESLGKIAKRMQRIFNENAQFIIFIGDEEQANNNLKIKDLKKEE
FT                   EYIVDFAKALELLKK"
FT   misc_feature    751322..752054
FT                   /note="authentic frameshifts in partial COG0488 ATPase
FT                   components of ABC transporters with duplicated ATPase
FT                   domains"
FT   gene            755783..756508
FT                   /locus_tag="RPR_04435"
FT   CDS_pept        755783..756508
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_04435"
FT                   /product="tolQ protein"
FT                   /note="COG0811 Biopolymer transport proteins"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_04435"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47562"
FT                   /db_xref="GOA:C4K1W3"
FT                   /db_xref="InterPro:IPR002898"
FT                   /db_xref="InterPro:IPR014163"
FT                   /db_xref="UniProtKB/TrEMBL:C4K1W3"
FT                   /protein_id="ACR47562.1"
FT                   /translation="MSADTNISDGLEVITQDHLSIFSLISSSDIIGKSVMLMLLIASIW
FT                   SWAIILDKIFKLVQVQKSMRAFENVFWSGGVLEQLYESIKRSVNNPLALIFVSAMDECK
FT                   SLSTKGLSEGLKNNHKERITGAMYLAQNRAVEKLEKNLSFLATVGSSAPFVGLFGTVWG
FT                   IMHSFQSIATSKNTSLAVVAPGIAEALLATAIGLFAAIPAVIFYNYLISRITLINNKIE
FT                   DFISELNSILSKAIDQEKM"
FT   gene            756508..756939
FT                   /locus_tag="RPR_04440"
FT   CDS_pept        756508..756939
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_04440"
FT                   /product="tolR protein"
FT                   /note="COG0848 Biopolymer transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_04440"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47563"
FT                   /db_xref="GOA:C4K1W4"
FT                   /db_xref="InterPro:IPR003400"
FT                   /db_xref="InterPro:IPR014168"
FT                   /db_xref="UniProtKB/TrEMBL:C4K1W4"
FT                   /protein_id="ACR47563.1"
FT                   /translation="MAIKLAGSNRKSKRAVVSEINVTPLVDVMLVLLIIFMITSPMLVS
FT                   GVNVDLPETNSSPISGQDEPLVVTINNKGKIFLLEIPIERMHLTDKLANITKEKKDARI
FT                   FVRGDRNVSYGQVVEIVAEIHAAGFSRVALISNIENNEK"
FT   gene            756929..757900
FT                   /locus_tag="RPR_04445"
FT   CDS_pept        756929..757900
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_04445"
FT                   /product="tonB/tolA protein"
FT                   /note="COG0810 Periplasmic protein TonB, links inner and
FT                   outer membranes"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_04445"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47943"
FT                   /db_xref="GOA:C4K1W5"
FT                   /db_xref="UniProtKB/TrEMBL:C4K1W5"
FT                   /protein_id="ACR47943.1"
FT                   /translation="MKSNQNKDNFTVFLSFSIVLHLLLLYFFLFGMPSLFEQLPEEQTI
FT                   TFEMLPVSDKSNIITQTKQKEAPIENEDAKKSEQSKPKEEPQDLSKEEKAKEPEAKTME
FT                   AKPKIEEKKPIEEPKSEEAKEALPEKKEEVKEEKPKEEEKKQAEEKKKPEEKKEETKPA
FT                   EKPKDVKKKEPKTDELDSLLKHLEQSSEGDNVKSNKHQRSKKADNAQEAKGVYTDGLPL
FT                   SDSETSLIKRQIERHWSNVPAGVRGNNKVKVIISITLDKAGNVEQAKVNKKICPNIPAS
FT                   VCEALADNAIRAVWQASPIENLDSARFNHWKEINFSFDPSKL"
FT   gene            758888..759595
FT                   /locus_tag="RPR_04450"
FT   CDS_pept        758888..759595
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_04450"
FT                   /product="hypothetical protein"
FT                   /note="COG0317 Guanosine polyphosphate
FT                   pyrophosphohydrolases/synthetases"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_04450"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47564"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="UniProtKB/TrEMBL:C4K1W6"
FT                   /protein_id="ACR47564.1"
FT                   /translation="MKDIEYWEKNFESCKYSDQLIERLLFLNTQVKQPIDIREVQKGIY
FT                   YARKYHGEQMRQSGDPYYSHPIAVTIMVAEFVAKEVPKLFTFRMLQAALLHDTIEDTEL
FT                   TEEIIRNIFDEEVARHVAGLTRIKPWGKISSEKSLILLIKQKRYDTALIKLFDRIHNLQ
FT                   TLEAKSPEKAHKIITETLKSFLVLSEILEIPSVSDLIYAECYKNNLKFNINSTFNKIIN
FT                   FDSFPFSQNKLLP"
FT   gene            complement(759546..760862)
FT                   /locus_tag="RPR_04455"
FT   CDS_pept        complement(759546..760862)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_04455"
FT                   /product="proline/betaine transporter"
FT                   /note="COG0477 Permeases of the major facilitator
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_04455"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47565"
FT                   /db_xref="GOA:C4K1W7"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C4K1W7"
FT                   /protein_id="ACR47565.1"
FT                   /translation="MLGYEKEQRSLNTEQKQAVGLLSIGTFLEYFDLMLYVHMAVLLNN
FT                   LFFPEYDPFTFSLLTAFSFCSTYLLRPIGALIFGYIGDHFGRKIVVVLTTLLMAITCVI
FT                   IGSMPTYAQIGITASWVLTICRIIQGMSATAEARGAELYLTENSSPPIQYPLVTIITVF
FT                   SAVGTTVALGIASIFTNQNIYHHESSWRIAFFVGATIAFVGTIARTSLKEAEAFSNKRN
FT                   KLKLRLQENNIMLEEIDKDILDQKVPNTTSIWYFFIQCARPPCFYFVYIYCGDILKREC
FT                   GFTPNQIINQNFWVSIIDLLGIIGLAFISYKIHPLKILKVKLYLFFTSLIFFPIMLNYN
FT                   PTPLYIFIFQCLAALFVFDHVPAAPIFYKYFPVFKRFTYTSMLSAIAKLFTYIITSFGL
FT                   VYITNYLGYWGLFLIFIPVGITFFMGVTYFEKMETNRNL"
FT   gene            complement(761001..762536)
FT                   /locus_tag="RPR_04460"
FT   CDS_pept        complement(761001..762536)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_04460"
FT                   /product="type I secretion adaptor protein"
FT                   /note="COG0845 Membrane-fusion protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_04460"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47566"
FT                   /db_xref="GOA:C4K1W8"
FT                   /db_xref="InterPro:IPR006144"
FT                   /db_xref="InterPro:IPR010129"
FT                   /db_xref="InterPro:IPR039562"
FT                   /db_xref="UniProtKB/TrEMBL:C4K1W8"
FT                   /protein_id="ACR47566.1"
FT                   /translation="MQDLKHNKPQITPEQLKQLLSLREDALNLKGQSSKRKALINTTLK
FT                   KTSHAIEFLLVKLDRFVNFITKKTDKDRNNVAQAARSPILFGIYVMIFLVLIGGLWSAL
FT                   APLDSGAVAVGIVMPSTNKKTIQHHEGGIINAIYVKQGDKVKEGDKLIELEETRIKSEH
FT                   ENILGQYRNFLATENRLIAERDNLEQIEFSDFLMQDINLPEVAKIIHTQENLFRSRKEV
FT                   YNSEKDALHQNIAQLEKKIEGLEAKKVAASKTAEVYQDRLKALRTLKEKGFVKKAALLD
FT                   QEAKVAASKSDVATTEAEIAGIRHAITETQIKIINQQNKYTERTLTELCEAQVQTASLK
FT                   EKYNALTDSLNRVIIRSPVDGIVNNLKYHTIGGVISHGQPIMEISPTNDPLIIEAKVSQ
FT                   KNIDSVHEGLVAKIRFSAFKSRITPTFTGKVVSISPDIVQDERQHPGQQQDNYYVARVE
FT                   IDMDAFNKVAKVKNLELHPGMQAEVQIVTGTRTLLRYLLDPVTDTAFKAFREK"
FT   gene            complement(762721..764475)
FT                   /locus_tag="RPR_04465"
FT   CDS_pept        complement(762721..764475)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_04465"
FT                   /product="type I protein secretion ATP-binding protein"
FT                   /note="COG4618 ABC-type protease/lipase transport system,
FT                   ATPase and permease components"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_04465"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47567"
FT                   /db_xref="GOA:C4K1W9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010128"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="UniProtKB/TrEMBL:C4K1W9"
FT                   /protein_id="ACR47567.1"
FT                   /translation="MDNKNNNLNKKNPLVIALGECRTAFWIVFWFAFVINLLMLITPLY
FT                   SLQVLDRVLGSGNLQTLLFLSIIIAYIYFVYGLLQIARSFTLIKVGEWLDRTVAPVIFA
FT                   SSISAAATRANMGSSQLLRDFQAVKTFLTSTGINTLFDAPWSLIYIAVIFSIHPYIGLI
FT                   TVFGAMIIVSTAFFNAAATNKTLGEATEFSIKGMTQADIANRNAEAIEAMGMMKNVTKN
FT                   WHKFNILALDKQSVASYRNGVISNFSRFIRNIMQMAVTGVGAYIVVKSHSADMTPGNMI
FT                   MSSIIVGRALAPFDNAIDLWKSMSGAIKSYKNINNLFNTYSSRDETMPIPNVDGHLTVE
FT                   NIYYAHPIPQYLPQPPVPKYILKGVSFAVQPGEVLAIIGPSATGKSTLAKIIVGVWKES
FT                   SGSVRLDSAEIYRWNREDFGRHVGYLPQGIELFSGSIKQNIARMEEDADPQKVIEAAKI
FT                   AGAHEMILRFPDGYDSDIGPAGSNLSGGQRQRIGLARAFYGNPKLIILDEPNANLDEAG
FT                   EVALASALKQAKLKGIAVLVISHRPSVLSVVDKILILQDGAVAVYGTAEEIQKHFKTLK
FT                   SDTIHINN"
FT   gene            complement(764486..765502)
FT                   /locus_tag="RPR_04470"
FT   CDS_pept        complement(764486..765502)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_04470"
FT                   /product="aspartate-semialdehyde dehydrogenase"
FT                   /EC_number="1.2.1.11"
FT                   /note="COG0136 Aspartate-semialdehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_04470"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47568"
FT                   /db_xref="GOA:C4K1X0"
FT                   /db_xref="InterPro:IPR000534"
FT                   /db_xref="InterPro:IPR005986"
FT                   /db_xref="InterPro:IPR012080"
FT                   /db_xref="InterPro:IPR012280"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C4K1X0"
FT                   /protein_id="ACR47568.1"
FT                   /translation="MTKKYNIAVIGATGNVGRETLNILAERNFPINKVYAIASDSSLGR
FT                   EISFGEKILQINSLKSLHFDDIDIAFFCVGSEVSKEFIPKATASNCVVIDKSSLFRVDN
FT                   QVPLIVPEVNLSTLKEFNTKNIIANPNCIVIPLAVALKPLDNEIKIKRVVISTYQSVSG
FT                   AGKAGMDELYDQTKSKYVFGENDPKKFPKQIAFNLFPHIGDLNKDGYTSEEAKIASELN
FT                   KIIGNHFKASVTSVRVPVFIGHSISVNIEFNDKIDAKEVEEILQDADGIVTISNNNYLA
FT                   YISPVEVVGEDAVYVSRIRNDVSRDNTINLWITCDNLRKGAALNSVQIAEELINNYL"
FT   gene            complement(765495..765854)
FT                   /locus_tag="RPR_04475"
FT   CDS_pept        complement(765495..765854)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_04475"
FT                   /product="hypothetical protein"
FT                   /note="COG0537 Diadenosine tetraphosphate (Ap4A) hydrolase
FT                   and other HIT family hydrolases"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_04475"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47569"
FT                   /db_xref="GOA:C4K1X1"
FT                   /db_xref="InterPro:IPR001310"
FT                   /db_xref="InterPro:IPR011146"
FT                   /db_xref="InterPro:IPR019808"
FT                   /db_xref="InterPro:IPR036265"
FT                   /db_xref="UniProtKB/TrEMBL:C4K1X1"
FT                   /protein_id="ACR47569.1"
FT                   /translation="MYNKENVFAKIIGKNLPAEIIYEDEQILAFKDIAPVAPVHIIVIP
FT                   KNEYIDYADFISKASIDEIKHFFAKLSDIANEAGLDKDGYRLITNKGEKSGQTIFHFHF
FT                   HIIGGEKLIGLINND"
FT   gene            complement(766044..766394)
FT                   /locus_tag="RPR_04480"
FT   CDS_pept        complement(766044..766394)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_04480"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_04480"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47570"
FT                   /db_xref="GOA:C4K1X2"
FT                   /db_xref="UniProtKB/TrEMBL:C4K1X2"
FT                   /protein_id="ACR47570.1"
FT                   /translation="MNIYAIYINSTQKNNNFIVIAEGFSWIAALLSIFWALYHKMWLIV
FT                   AIAVIANIIVTAINIEELKFIFKIVLILGFGFFASDIRENYLKRNNYRLEDIIANSRIE
FT                   AELKFLKRSMLV"
FT   gene            766668..767216
FT                   /locus_tag="RPR_04485"
FT   CDS_pept        766668..767216
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_04485"
FT                   /product="ATP-dependent protease peptidase subunit"
FT                   /note="COG5405 ATP-dependent protease HslVU (ClpYQ),
FT                   peptidase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_04485"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47571"
FT                   /db_xref="GOA:C4K1X3"
FT                   /db_xref="InterPro:IPR001353"
FT                   /db_xref="InterPro:IPR022281"
FT                   /db_xref="InterPro:IPR023333"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4K1X3"
FT                   /protein_id="ACR47571.1"
FT                   /translation="MSDNLSLHGTTILCLKKNEEIIIAADGQVSHGNTVLKSTARKLRT
FT                   IANNKIIAGFAGSTADGLALFEKLAVKIEQHKHNLLRSAVELAKDWRSDKYLRRLEAMM
FT                   IVADRSHILILTGNGDVVEPEKNVAAIGSGGLFALSAARALMSYENNLTAEEIALKSMN
FT                   IAADLCVFSNHNIIMEKVV"
FT   gene            767213..768565
FT                   /gene="hslU"
FT                   /locus_tag="RPR_04490"
FT   CDS_pept        767213..768565
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hslU"
FT                   /locus_tag="RPR_04490"
FT                   /product="ATP-dependent protease ATP-binding subunit"
FT                   /note="COG1220 ATP-dependent protease HslVU (ClpYQ), ATPase
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_04490"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47572"
FT                   /db_xref="GOA:C4K1X4"
FT                   /db_xref="InterPro:IPR001208"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004491"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4K1X4"
FT                   /protein_id="ACR47572.1"
FT                   /translation="MKATKTTYKKDPMGLTPSQIVNELNRFIVGQEKAKKAVAIALRNR
FT                   CRRKRVEGNLRNEIVPKNILMIGSTGVGKTEIARRLAKLTNSPFYKIEATKFTEVGYVG
FT                   RDVESIIRDLVEIAVNTEKTLAKTKVDIHAREKAIERILDSLVGKTSSSETREKFKEKI
FT                   LNGELDDTEIEISVADTTPVGGGSFEIPGMPGASMGVLNLGDMIGRALGSSKTKTKKML
FT                   VKDAMAIIIPEESEKLIDQEKIIQQAINLAENDGIVFIDEIDKIASTGSSGAKNAEISR
FT                   EGVQRDLLPLIEGTTVNTKYGPVKTDHILFIASGAFHIAKPSDLLPELQGRLPIRVELN
FT                   SLTKDDMIKILLEPETSLIKQYSALIGTEDVRLEFAASAIEKIADYAITVNLEVEDIGA
FT                   RRLHTILENLLEDISFEASEMKGKKITIDDKFVENQLSKIITNLDLAKFVL"
FT   misc_feature    768932..770330
FT                   /note="authentic frameshift: common BLAST hit:
FT                   gi|67458910|ref|YP_246534.1| Mg chelatase-related protein"
FT   gene            770711..771289
FT                   /locus_tag="RPR_04520"
FT   CDS_pept        770711..771289
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_04520"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_04520"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47573"
FT                   /db_xref="UniProtKB/TrEMBL:C4K1X5"
FT                   /protein_id="ACR47573.1"
FT                   /translation="MYFPFDNMKAPLYHGKTIFREVDKKHPMKFSLGDMRGKIFDLYNV
FT                   FPEYVVISVPLFNDVIRDELDEWLYVVKHSEVKKDFKSPYMKKVAKRFDILKMTPKEQI
FT                   IYHAYMNRSYKERDYIVSAEEKGREQGMAKGIEEGRKKGKQEGEVTKSIKIATKMLMKK
FT                   NSIEKIHEITEVSIKEIERLQTEIENLKK"
FT   gene            771299..772639
FT                   /gene="lpxB"
FT                   /locus_tag="RPR_04525"
FT   CDS_pept        771299..772639
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lpxB"
FT                   /locus_tag="RPR_04525"
FT                   /product="lipid-A-disaccharide synthase"
FT                   /EC_number="2.4.1.182"
FT                   /note="COG0763 Lipid A disaccharide synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_04525"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47574"
FT                   /db_xref="GOA:C4K1X6"
FT                   /db_xref="InterPro:IPR003835"
FT                   /db_xref="InterPro:IPR022437"
FT                   /db_xref="UniProtKB/TrEMBL:C4K1X6"
FT                   /protein_id="ACR47574.1"
FT                   /translation="MTKIYFIAGEVSGDFVGGRIMQHLKNNTGVQLNSPVSSFVNDAVQ
FT                   FVGVGGKYMEEAGSFKSLFPITSINLMGFVEILPHIFKLKKLIDKTVEDIINSKADLLI
FT                   TIDSPGFTYRVAKRVRKLLPKLKMIHIVAPSVWAYKEGRAVKYAKIYDCLFALLPFEPP
FT                   CFTKVGLDCRYIGHPIMEQEFYSDKIALREEFKIDENERVLCVTLGSRKGEILRHLSVF
FT                   VSSIEEIFKSCNNLKVIFTLADPAHEAIIKPFLEDVKFNYLFSSERLKTYAVADVALAK
FT                   SGTNTLEIAASGTPMIVAYKVNLISFFIIRLWIKIKYVTLINIIADKEIIPEFIQFNCR
FT                   ANLISNKLQELLFNSKKAYEQVIESQKILQQLGFKSNRLQLNSESFRHDEFKGTLARCT
FT                   KVREHRLSLENSLVSSDRDDAVPSYIAAEIIKQEFLEPKIKLLKEKD"
FT   gene            complement(772636..772908)
FT                   /locus_tag="RPR_04530"
FT   CDS_pept        complement(772636..772908)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_04530"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_04530"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47575"
FT                   /db_xref="GOA:C4K1X7"
FT                   /db_xref="UniProtKB/TrEMBL:C4K1X7"
FT                   /protein_id="ACR47575.1"
FT                   /translation="MIQDHNTDLKHEEQTERLKALQNKLGNLSGFLTTMRSDNNEEYKK
FT                   IANDLKILMKQINTIRKNMEIYFVIILILMFIIIQKMLWTTGFKY"
FT   gene            773256..774275
FT                   /locus_tag="RPR_04535"
FT   CDS_pept        773256..774275
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_04535"
FT                   /product="hypothetical protein"
FT                   /note="COG1559 Predicted periplasmic solute-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_04535"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47576"
FT                   /db_xref="GOA:C4K1X8"
FT                   /db_xref="InterPro:IPR003770"
FT                   /db_xref="UniProtKB/TrEMBL:C4K1X8"
FT                   /protein_id="ACR47576.1"
FT                   /translation="MLNNLLKTKLFLVIVSLTIFITLLNFSIFYIFVPGDLTQNKTIII
FT                   EPKLSVNQIVTKLYSNEVIKYPRIFKVIAKIYSIKRPLKSGEYVFTRNISPLQTLRILA
FT                   SGKSIIHKIIVPEGTVVSEVIKQINEESRLLGEIKGIIPEGFLMPSTYFFSYGDQKEQI
FT                   IDHMRNLMSANLDKVMQNLAPDSPLKTRLEVLTLASIIEKEAGSNAEKPIIAAVFINRL
FT                   KKNMKLQADSTTIYALTEGKFKLARALTKKDLLQELPYNTYYIKGLPPGPISCPSLKSL
FT                   EAVVKSAKTDALFFVVDGKGGHNFSNNLNDHNRFVETYRKSLIKVPEPAIDPEKPSTR"
FT   gene            774415..774726
FT                   /gene="cyaY"
FT                   /locus_tag="RPR_04540"
FT   CDS_pept        774415..774726
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cyaY"
FT                   /locus_tag="RPR_04540"
FT                   /product="frataxin-like protein"
FT                   /note="COG1965 Protein implicated in iron transport,
FT                   frataxin homolog"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_04540"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47577"
FT                   /db_xref="GOA:C4K1X9"
FT                   /db_xref="InterPro:IPR002908"
FT                   /db_xref="InterPro:IPR020895"
FT                   /db_xref="InterPro:IPR036524"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4K1X9"
FT                   /protein_id="ACR47577.1"
FT                   /translation="MNNSEFSKIAETTIAYIAEKIEEQDKEASIDVDLQGDILNLDTDK
FT                   GVYVINKQSAAKEIWLSSPVSGPYHFCYEQGKWTNRAGLELMAILTEELNIKFDTRPT"
FT   gene            775843..776319
FT                   /locus_tag="RPR_04555"
FT   CDS_pept        775843..776319
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_04555"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_04555"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47578"
FT                   /db_xref="UniProtKB/TrEMBL:C4K1Y0"
FT                   /protein_id="ACR47578.1"
FT                   /translation="MHGQMPTYYKQIKNVKLESPIGKLQFRNQDSNKAILNTGKINIIR
FT                   LSYAIYQKTGNPCDIHEAIIRQNLIHSPGYGLFATPGDLNGNDIVAFNIEWNNIPDSWE
FT                   TISDYGLGKSVKFKAMPIELYSAVYAAGDLRVYKIVDQKNPVYLSLHGQFDFKD"
FT   misc_feature    777566..778660
FT                   /note="authentic internal stop codon: common BLAST
FT                   hit:gi|157964614|ref|YP_001499438.1| transposase ISRpe1"
FT   gene            complement(778767..778856)
FT                   /locus_tag="RPR_t07808"
FT   tRNA            complement(778767..778856)
FT                   /locus_tag="RPR_t07808"
FT                   /product="tRNA-Ser"
FT   gene            complement(778916..779908)
FT                   /locus_tag="RPR_04575"
FT   CDS_pept        complement(778916..779908)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_04575"
FT                   /product="tryptophanyl-tRNA synthetase"
FT                   /EC_number="6.1.1.2"
FT                   /note="COG0180 Tryptophanyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_04575"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47579"
FT                   /db_xref="GOA:C4K1Y1"
FT                   /db_xref="InterPro:IPR002305"
FT                   /db_xref="InterPro:IPR002306"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR024109"
FT                   /db_xref="UniProtKB/TrEMBL:C4K1Y1"
FT                   /protein_id="ACR47579.1"
FT                   /translation="MKKTVLSGVQATGSLHLGNYLGAIKNWVKMQEEYNCFFFLADLHA
FT                   ITVDIKPSELNNSIMEVLAVYLAAGLNPDKVTIFAQSMVKEHTELAWLLNCVTPLGWLK
FT                   RMTQFKDKAGSDQEKACLGLFSYPVLMAADILIYKADIVPVGEDQKQHLELTRDIAGVI
FT                   NRKFKKEILKVPEILISETGTRIMSLRDGLKKMSKSDISDFSRINLKDDNDLIHQKIKK
FT                   AKTDHLSFVSYDQETRPEISNLLDIYSSLSEESLEKIIGNYQNQGFAKFKEDLAEIIIT
FT                   NLQPIRDKYLELMNDKEYLLKILHKGAEKARIRASETVNEVKEQFGFVI"
FT   gene            780136..780711
FT                   /locus_tag="RPR_04580"
FT   CDS_pept        780136..780711
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_04580"
FT                   /product="1-acyl-sn-glycerol-3-phosphate acyltransferase"
FT                   /note="COG0204 1-acyl-sn-glycerol-3-phosphate
FT                   acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_04580"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47580"
FT                   /db_xref="GOA:C4K1Y2"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="UniProtKB/TrEMBL:C4K1Y2"
FT                   /protein_id="ACR47580.1"
FT                   /translation="MWLAKICCGLKYEVEGLEKLPKTIAIVVSNHQSFWDQMFMQLIIP
FT                   KHSWVLKRELFNIPLLGWGLRMVKPIAVDRGTNSSVAQILREGQEKIKEGLWLIIFPES
FT                   TKVPPDRTVKFKPSAVKLASITKVPIVMIAHNAGLFWPRGFWFKQPGTIKIKIIGVIEK
FT                   EEIEQTDVRILNDKVEQIINSEKQKLLN"
FT   gene            780776..781216
FT                   /locus_tag="RPR_04585"
FT   CDS_pept        780776..781216
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_04585"
FT                   /product="hypothetical protein"
FT                   /note="COG5622 Protein required for attachment to host
FT                   cells"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_04585"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47581"
FT                   /db_xref="InterPro:IPR019291"
FT                   /db_xref="UniProtKB/TrEMBL:C4K1Y3"
FT                   /protein_id="ACR47581.1"
FT                   /translation="MVRTTALKLIAVIDSKQMMLYDAQGVKITTNTPLKLSLDLEEHHH
FT                   HREKRQSLYQNKSTPASLFEPHTSLKDIALKEAARSVIKHLEKVTTADQAKYKELIIVA
FT                   EPQMLGCVRQELKNGLKKMITKEIAKDLVQHSVDAVERAVFS"
FT   gene            781453..782172
FT                   /locus_tag="RPR_04590"
FT   CDS_pept        781453..782172
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_04590"
FT                   /product="hypothetical protein"
FT                   /note="COG2945 Predicted hydrolase of the alpha/beta
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_04590"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47582"
FT                   /db_xref="GOA:C4K1Y4"
FT                   /db_xref="InterPro:IPR000383"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C4K1Y4"
FT                   /protein_id="ACR47582.1"
FT                   /translation="MPQIYFNGPEGRIEGRYAKATAPNAPIALVLHPHPLYEGNMNNKV
FT                   VYNAYKILADNGYTVLRINFRGVGGSQGKFDNGVGEVVDAGAALDWLQQNNPNAQSNLI
FT                   LGFSFGAWIAMQLVMRRPEINHFIAISPPVNTIHKYDFSFLSPCPIPGFILQGDNDSIV
FT                   SADDVKDLANRLSKQQSHIKVDYKIINGADHFFRYKTEEFSKAINAYLITIQSNYHHHN
FT                   NNVNEEISKHPKKLFLY"
FT   gene            complement(782364..783368)
FT                   /locus_tag="RPR_04595"
FT   CDS_pept        complement(782364..783368)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_04595"
FT                   /product="hypothetical protein"
FT                   /note="COG2956 Predicted N-acetylglucosaminyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_04595"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47583"
FT                   /db_xref="GOA:C4K1Y5"
FT                   /db_xref="InterPro:IPR010817"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:C4K1Y5"
FT                   /protein_id="ACR47583.1"
FT                   /translation="MFRLLLICATFLLLYFGFTFIESFDSKVFISLYDYNIETTLFFSL
FT                   ILGLLLLISCFIVIRFLILIIDLPSKIHNIFSKRKINHDRYALILAFAEYIMNNKATSA
FT                   SIARKNLSSEDLKDSQEFHNLILAVTEEDVDRKISYFQKLITSKEFVFYGSKNLAKLYY
FT                   DKSFYEKAENYATKAYNFNELDIDNLITLMRCYARLSLWTKFIFITNKLAKFHKHESMP
FT                   EIAEYYLLAAKQEVESNNTANAIDYLATAVDLNFYNDELLEFYFNLNNKLNVNKKIKIL
FT                   KDAFRIIPSLKLVQLFKKFTSLSDRQIYEELTQELDAKKDAILILAIEAYLEL"
FT   gene            complement(783361..784116)
FT                   /locus_tag="RPR_04600"
FT   CDS_pept        complement(783361..784116)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_04600"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_04600"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47584"
FT                   /db_xref="GOA:C4K1Y6"
FT                   /db_xref="InterPro:IPR022436"
FT                   /db_xref="UniProtKB/TrEMBL:C4K1Y6"
FT                   /protein_id="ACR47584.1"
FT                   /translation="MYKFDSLFKSKNIFFIAIVIFVLSSFTLYHNRSDILKLFKSENKD
FT                   LSQIPDQTVENKENTTLEEKEAAPLLSTKSLLNYVSSLKFPEAPTNLVEPKLETVVNSA
FT                   SFGYKEQGAKKPITNRRATSNEVGVWVSLDYINYLLNVNLLVYNFMQDKDYSKELRIVK
FT                   SRLLPQDIRNILNNLEAYNNYLFSKSSSTEVIFPTNHKWLAKFIKIEKKPSAMMIKEQD
FT                   KPLILENLNYLIDCLYSEKFMQEFVNKDV"
FT   gene            complement(784100..784774)
FT                   /locus_tag="RPR_04605"
FT   CDS_pept        complement(784100..784774)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_04605"
FT                   /product="uroporphyrinogen-III synthase"
FT                   /note="COG1587 Uroporphyrinogen-III synthase"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_04605"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47585"
FT                   /db_xref="GOA:C4K1Y7"
FT                   /db_xref="InterPro:IPR003754"
FT                   /db_xref="InterPro:IPR036108"
FT                   /db_xref="UniProtKB/TrEMBL:C4K1Y7"
FT                   /protein_id="ACR47585.1"
FT                   /translation="MKSVLLTRHIEENNETIKEISKYHLDLRDIHCPLIKYNTLDFNID
FT                   ILDNYSNIIITSKYAASILTGHNLKQDIWVVGSKSKRLLGKKVMYTAKNVEDLIKHFPP
FT                   DLYEQTIYLSSNEITKDLPSKIVRHIIYNVEYLNELPVSIIKAFKNNIDFILLYSQNSA
FT                   RTLVKLLLQNNLLEYLQDSLVVAISLKVANIVRPFIKNVVYCDDQNLNDIIKLLSENVQ
FT                   IR"
FT   gene            complement(784752..785393)
FT                   /locus_tag="RPR_04610"
FT   CDS_pept        complement(784752..785393)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_04610"
FT                   /product="lysine efflux permease"
FT                   /note="COG1279 Lysine efflux permease"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_04610"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47586"
FT                   /db_xref="GOA:C4K1Y8"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:C4K1Y8"
FT                   /protein_id="ACR47586.1"
FT                   /translation="MNNDILSAFLHGIVLALGLIVPLGVQNIFIFNQGATQPKFSKALP
FT                   SIIAASICDTMLICMAVLGISLLILEISWLKLSIFIVGFIFLIYMGYNTWNQPPIDLTM
FT                   HSGAFSAQKQILFAISVSILNPHAIMDTIIVIGISALKYSGIAKIIFTLTCILISWIWF
FT                   FSLAVAGYNIRKLNKSSTILTIINKIAAIIIWAVAFYIGVQILYEIGFIN"
FT   gene            complement(785988..787373)
FT                   /locus_tag="RPR_04620"
FT   CDS_pept        complement(785988..787373)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_04620"
FT                   /product="AmpG"
FT                   /note="COG0477 Permeases of the major facilitator
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_04620"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47587"
FT                   /db_xref="GOA:C4K1Y9"
FT                   /db_xref="InterPro:IPR004752"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C4K1Y9"
FT                   /protein_id="ACR47587.1"
FT                   /translation="MLFHKLCGAHVLMYTLRSSPYRLLALVEVDLRLSILHLLEVYKFM
FT                   LNNSRLCIILLFGLISGFNLMITGNTLNYWLAKEDIALQTIGILSFITLPYSINFLLAP
FT                   IFDAVQIKYLNKIFGHRLSWICLTSSALIFLIYIFSFLDPSTNLLLFAFTALIISFFSA
FT                   AQDTILSALRTEIVPKESLGFTSGIYIFGYRVGMLLAGSGAIYLSIYLTFNEIYKIFAG
FT                   LVFIYLILLIVGIKYCYLNENIHIQIIKNDIKNNQNKKNIINFIYNALKPIGSVYFIIL
FT                   ILIFLVLYRLPDNLINVMINPFLLHLEYDAFEIASVGKFCGVVGAIIGGLVGGVIMKHK
FT                   NILNSIFLFGIIHALGHILFIFLEINGKNSLLLFITIGIASITGGMTMTAYIAFISALC
FT                   QGKFRATQYSFLSSMMGISRSIFPIISGYIVVNFGWQNFFLFTTIITIPSLLILLKIKT
FT                   KLQ"
FT   gene            788435..789940
FT                   /locus_tag="RPR_04640"
FT   CDS_pept        788435..789940
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_04640"
FT                   /product="ADP,ATP carrier protein"
FT                   /note="COG3202 ATP/ADP translocase"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_04640"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47588"
FT                   /db_xref="GOA:C4K1Z0"
FT                   /db_xref="InterPro:IPR004667"
FT                   /db_xref="UniProtKB/TrEMBL:C4K1Z0"
FT                   /protein_id="ACR47588.1"
FT                   /translation="MLPPKIFFEKVKEIMWPIERKELKLFIPMALMMLCILFNFGALRS
FT                   IKDSLVVPSMGAEIISFLKLWLVLPSCVIFTVLYVKLSNNLNFEYIFYIIVGSFLLFFL
FT                   LFAYIIYPNQDIYHPNDEMINKLIASYPHFKWFIKIGSQWSYALMYIFAELWSAVVINL
FT                   MFWQFANHIFDTSKAKRFYPVLGMVGNIGLIIAGSVLVFFSSGQDVIDSELLPDAFNSS
FT                   VGNAIMLQPIMSIIVTAGIIAMLLFRIINRFILTDSINVLDAKKVTAKMKTKLSVIESI
FT                   KLVIHSKYIGRIALLIICYGLLINIVEGPWKAKIKELHPNTIDYVNFMGRFNIWMGISC
FT                   VTFMIIGSNILRRLGWLISALLTPIMLSITGLMFFIFIIFIEEIGECFGDFNLLYAAII
FT                   VGAIQNILSKSSKYSLFDSTKEMAYIPLSLELRTKGKAAVEVIGTKFGKSLGAFIQSLI
FT                   FIIIPTATFDSIIIYLLVTFIVMMSLWIWNVIKLNKEYIELCK"
FT   gene            790136..791794
FT                   /locus_tag="RPR_04645"
FT   CDS_pept        790136..791794
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_04645"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_04645"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47589"
FT                   /db_xref="GOA:C4K1Z1"
FT                   /db_xref="UniProtKB/TrEMBL:C4K1Z1"
FT                   /protein_id="ACR47589.1"
FT                   /translation="MKKILKIILFITIFIILAYSGLWFTIMFSLSHSINQKYAGTNLNI
FT                   EEADNNPNQQYLIKFSKVQPYGFPFKLGISVINWQEESINRVTEFTTPINIGYDLLKQK
FT                   LFIHFSGEAFGKFKPVQRGFGVRFYNENCILSTKIPLNFKLFEIVRFKKDLFEVINLIE
FT                   YIKFTSGKTEIFDLVDNQKLYEEDHTILTMLFDKSKYYTSKQDFLDNIPQKLAIYYETE
FT                   IVQSNLEDRIIPAGLLLYRPAWNNNFKFSGNFLISTSSVHFKDIAKDLTIEVTNAKINS
FT                   NNFENNINLLYKGKLNDFGNNNIDLLVDSQFKLKPGFIIGSLEFIKKYYDKQTYLFKLS
FT                   DNKLYKDFNNELSYILNNNKQYNFSIFEDREYNFNLNINLVTELNKLTRAQINALSLYS
FT                   NASGFNITNETIVNALKDSYSKGTIIINDYSRIIDVLSAYIYGVGDFKDFSEESKEVYG
FT                   NALKSFLKTISDHPNSSNLIDASIEYVFDLSDLNKAKIGNIDDINKLIPLYYLSLYQAA
FT                   VKKVQPGENVKEKITELIPNVNQKILEECILDELR"
FT   gene            791781..792896
FT                   /locus_tag="RPR_04650"
FT   CDS_pept        791781..792896
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_04650"
FT                   /product="octaprenyl-diphosphate synthase"
FT                   /note="COG0142 Geranylgeranyl pyrophosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_04650"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47590"
FT                   /db_xref="GOA:C4K1Z2"
FT                   /db_xref="InterPro:IPR000092"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="InterPro:IPR033749"
FT                   /db_xref="UniProtKB/TrEMBL:C4K1Z2"
FT                   /protein_id="ACR47590.1"
FT                   /translation="MNCVNHHCKQLKGAWQSQDFGTRLLRQNFQFFLAMTEQFIKIPTM
FT                   NIIVKIQQDLKDEVTKLNNLIISCLKSDEELIEKVGKYLLEAGGKRIRPLLTIITAKMF
FT                   DYKGDNHIKLASAVEFIHTATLLHDDVVDDSTLRRFKPTANVIWGSKTSILVGDFLFSQ
FT                   SFKLMVASGSIKAMNVLAKASAIISEGEVVQLVKLNERRIITIDEYQQIVKSKTAELFG
FT                   TACAVGAIIAEQVDHISKDMQDFGKLLGTIFQVIDDLLDYLGNDKQVGKNIGDDFLEGK
FT                   VTLPMIFLYNKLAQDKQLWLENIIKCDKRTKDDFVKIHDLMVKHEIYNETVNYLSNLEN
FT                   AASKLLNKIPVQNIYKDYLFSIIKFILDRSY"
FT   gene            792903..792979
FT                   /locus_tag="RPR_t07810"
FT   tRNA            792903..792979
FT                   /locus_tag="RPR_t07810"
FT                   /product="tRNA-Arg"
FT   gene            complement(793085..793159)
FT                   /locus_tag="RPR_t07812"
FT   tRNA            complement(793085..793159)
FT                   /locus_tag="RPR_t07812"
FT                   /product="tRNA-Gln"
FT   gene            complement(793211..795058)
FT                   /locus_tag="RPR_04655"
FT   CDS_pept        complement(793211..795058)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_04655"
FT                   /product="putative aminopeptidase"
FT                   /note="COG0006 Xaa-Pro aminopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_04655"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47591"
FT                   /db_xref="GOA:C4K1Z3"
FT                   /db_xref="InterPro:IPR000587"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR029149"
FT                   /db_xref="InterPro:IPR032416"
FT                   /db_xref="InterPro:IPR033740"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:C4K1Z3"
FT                   /protein_id="ACR47591.1"
FT                   /translation="MTAQPPSGQEHDIRDINMTKIRINLLRNLFTEYDIDGYIIPSNDK
FT                   YMSEYVPSYAKRLEYITGFTGSNGIAIIYKDTALFFTDGRYLEQANKELDLELFKLFDL
FT                   KDISKFGKDAKIGYDSELFTYPTISNLKFNFQKINGNLVDKIWPNQPLEPNSKVYLHDI
FT                   KLAGVSHTDKISKCREIFLDSRFCGNDIEESGNDTEQSALVILDSSSICWLLNLRASDV
FT                   AYTPLMFAKVILTSTQLYLFINPTRIDAEIINARPEITILPEEEFENILRDSENKHLSK
FT                   PAYRIFIDDTIASVHIMDLVADKKVQKITDPCLMLKACKNDVEIKHAIDLHIKDAVALC
FT                   EFFADFSQCHPRENGDPEKHNNELTEYSLGLKLTEQRAKQEGYVSDSFPAICGFQENSA
FT                   IIHYRADQKTAKKIEGQGILLIDSGGQYQGATTDITRTIVIGTPTDEQKKRYTQVLKGH
FT                   IALAKAKFPKNIIAGANLDILARQYLWQEMLDYPHGTGHGVGSFLSVHEGPQSINLRNK
FT                   TILKAGMILSNEPGFYVPGKYGIRIENLMYVKENNGWLEFETLSLVPYASKLTDMKLLN
FT                   IDEINYIKEYYNKIRAKIYDLLSTQARNWLNNEINLYCN"
FT   gene            complement(795200..796483)
FT                   /locus_tag="RPR_04660"
FT   CDS_pept        complement(795200..796483)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_04660"
FT                   /product="amino acid permease"
FT                   /note="COG0531 Amino acid transporters"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_04660"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47592"
FT                   /db_xref="GOA:C4K1Z4"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:C4K1Z4"
FT                   /protein_id="ACR47592.1"
FT                   /translation="MSQKLGFWAVFALVTGSQIGTSVFILPLSLAPFGIYSIWGWVLSL
FT                   FGAMSIALVFSTLCAKFPKTGGPHIYVRENFGDKIAFFTGWTYWVISFVSTSIVVISAI
FT                   GYLTLFFKSQAILDLILQIILLGAIMVLNLKGPEVTGKAEFYLTLLKFVPLLIVGLCAL
FT                   SHFNIDNITIAEEVENLSIPSIMGRVVLLTFWGFIGIECATTTAGAVKDPAKTIPRAII
FT                   VGTFCVAVLYIINSIGIMGLIPASELVSAKAPYADAASLLFGGKWSSVITVIASIICIG
FT                   TLNAWVLTSGQIALGLAEDGLLPKFFAKKNSNNAPTHGIIVSCLGIVPLLVFTANDNFA
FT                   KQITQIIDFSAITFLFVYLICSLAFLKMIFSSKENFSYYYLLIAIISIIFCAWVIYETP
FT                   VKTLIIASSFTIFGIPLYYGWYKCHSRL"
FT   gene            complement(797336..797668)
FT                   /locus_tag="RPR_04670"
FT   CDS_pept        complement(797336..797668)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_04670"
FT                   /product="HesB protein family protein"
FT                   /note="COG0316 Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_04670"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47593"
FT                   /db_xref="GOA:C4K1Z5"
FT                   /db_xref="InterPro:IPR000361"
FT                   /db_xref="InterPro:IPR016092"
FT                   /db_xref="InterPro:IPR017870"
FT                   /db_xref="InterPro:IPR035903"
FT                   /db_xref="UniProtKB/TrEMBL:C4K1Z5"
FT                   /protein_id="ACR47593.1"
FT                   /translation="MKNVISLTDSAAKQVKLLIEKRAKPTFGIRVGVKSGGCAGQTYYV
FT                   EYADSKNQFDEVVEEKGVRILIDPKALMYILGSEMDYVETKFKSQFTFTNPNEKANCGC
FT                   GKSFSV"
FT   gene            complement(797672..798067)
FT                   /locus_tag="RPR_04675"
FT   CDS_pept        complement(797672..798067)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_04675"
FT                   /product="scaffold protein"
FT                   /note="COG0822 NifU homolog involved in Fe-S cluster
FT                   formation"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_04675"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47594"
FT                   /db_xref="GOA:C4K1Z6"
FT                   /db_xref="InterPro:IPR002871"
FT                   /db_xref="InterPro:IPR011339"
FT                   /db_xref="UniProtKB/TrEMBL:C4K1Z6"
FT                   /protein_id="ACR47594.1"
FT                   /translation="MAYSKKVIDHYENPRNVGSLDKENKNVGTGLVGAPACGDVMKLQI
FT                   AVDDDGIITDAKFKTFGCGSAIASSSLVTEWVKGRSVEDAETIKNTEIAKELSLPPVKL
FT                   HCSLLAEDAIKAAIADYKQKKESKKDS"
FT   gene            complement(798219..799451)
FT                   /locus_tag="RPR_04680"
FT   CDS_pept        complement(798219..799451)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_04680"
FT                   /product="cysteine desulfurase"
FT                   /note="COG1104 Cysteine sulfinate desulfinase/cysteine
FT                   desulfurase and related enzymes"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_04680"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47595"
FT                   /db_xref="GOA:C4K1Z7"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR010240"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR016454"
FT                   /db_xref="InterPro:IPR020578"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4K1Z7"
FT                   /protein_id="ACR47595.1"
FT                   /translation="MNPQLNNLTLPIYMDYQATTPIDPRVMEAMLPYFTTKFGNPHSRS
FT                   HSFGWEAENAVEEARSMVAKLIGADTKEIIFTSGATESNNLAIKGIAKFYSNKKNHIIT
FT                   VVSEHKCVLDACRHLEQEGIKITYLPIKPNGIIDLETLKNAITDQTMLVSVMVVNNEIG
FT                   VVQPLKEIGKICREKGVFFHSDIAQGFGKIPIDVNAFNIDLASISGHKIYGPKGIGALY
FT                   VRKKPRVRVTPLINGGGQERGMRSGTLPTPLIVGLGMAAEIAYSEMEKDTKHVNYLFDR
FT                   FLNNIHKRISEVYLNGDKNQRYKGNLNLSFAGVEGESMILAIKDLAVSSGSACTSASLE
FT                   PSYVLRSMGIGEELAHTAIRFGIGRFTTEQEVDYAVNLICSKIDKLRALSPLWEMMQEG
FT                   IDLKKIKWAVH"
FT   gene            complement(799554..800672)
FT                   /locus_tag="RPR_04685"
FT   CDS_pept        complement(799554..800672)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_04685"
FT                   /product="NifS protein"
FT                   /note="COG1104 Cysteine sulfinate desulfinase/cysteine
FT                   desulfurase and related enzymes"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_04685"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47596"
FT                   /db_xref="GOA:C4K1Z8"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR016454"
FT                   /db_xref="InterPro:IPR020578"
FT                   /db_xref="UniProtKB/TrEMBL:C4K1Z8"
FT                   /protein_id="ACR47596.1"
FT                   /translation="MIYLDHNATTFIDPRVKEFIISLMDKELNPSSAHSSGRFAKNLIE
FT                   TVRAQIATALGITLSSREYDITFTSSGTEGNNLIMKNFYDGDIFISAIEHLSIYNYINY
FT                   APNIKVISVNTQGLVDLEHLEELLAQSTTSKKLVSIIMANNESGVLQDIAEIGKITKKY
FT                   EAKFHSDLVQGFGRIPINIKALGLDFATISGHKIGGGQGGAALISSSNFQVTPMIIGGG
FT                   QEKSVRSGTENVLAIAGFGLASALRTDNISENYIKIKKLQENLEKKLKKYPNVNIVSNN
FT                   VARLPNTTLITIPNTDAQAKLIGFDLHNICVSSGSACSSGKISKSHVLTNMGVGEEEAK
FT                   SSIRISLSHTNTVSDIEAFIEAFEEIYDVIPS"
FT   gene            complement(800669..801088)
FT                   /locus_tag="RPR_04690"
FT   CDS_pept        complement(800669..801088)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_04690"
FT                   /product="Rrf2 family protein"
FT                   /note="COG1959 Predicted transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_04690"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47597"
FT                   /db_xref="InterPro:IPR000944"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C4K1Z9"
FT                   /protein_id="ACR47597.1"
FT                   /translation="MMLTTKGRYAVMAILEMASKSSAEPVTLNEMSVKQNISLNYLEQI
FT                   FSKLKKADLVKAIRGSKGGYILIGNLEEIKISDIMDAVNENFIMTTCYKKSVKTCVPDT
FT                   IKCNSHKLWQGLGKHIRDYFENISIKDALNSNLNI"
FT   misc_feature    complement(801547..802795)
FT                   /note="authentic frameshifts in hypothetical rickettsial
FT                   gene"
FT   gene            complement(803076..803948)
FT                   /locus_tag="RPR_04710"
FT   CDS_pept        complement(803076..803948)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_04710"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_04710"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47598"
FT                   /db_xref="GOA:C4K200"
FT                   /db_xref="InterPro:IPR009574"
FT                   /db_xref="UniProtKB/TrEMBL:C4K200"
FT                   /protein_id="ACR47598.1"
FT                   /translation="MYLLSFILGGLNALLRQLHLSIRSIEFYKDVYKNYQGYGIRYVFT
FT                   LSFIPSIIYCIFILNYIITLKDYFNGIQSSKVTANIEYIINQLPEIKYNNSNISVEEVE
FT                   PIYLYSKNNNKIVVIDTKNQVSNKEKSKIPFVLEENKLKINLIVANTKKNFPSTVNYSE
FT                   IFKQNEVILTPEIIKKYFADHLLYAPNLFIYFGMPAIILFWFVTFLLERSIIVLLVYSL
FT                   ANLLTTKTSIQTSIRLVMFSSGVPIILQPVIIILIPELSILLQLLQMFTTCLVFVAIWQ
FT                   INKNLSHYM"
FT   gene            804399..804848
FT                   /locus_tag="RPR_04715"
FT   CDS_pept        804399..804848
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_04715"
FT                   /product="putative histone and other protein
FT                   acetyltransferase"
FT                   /note="COG0454 Histone acetyltransferase HPA2 and related
FT                   acetyltransferases"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_04715"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47599"
FT                   /db_xref="GOA:C4K201"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:C4K201"
FT                   /protein_id="ACR47599.1"
FT                   /translation="MSSVNISLATPDNITNILPLMAQLGYPSSSEELIARFKNFINREG
FT                   YGVALASLDNKIVGFIAWSKSLLFASDKTRIHIEALVIDENYRGKQIGKKLMEYLEEIA
FT                   KKYSLVIVDLTSGYRCAKDSTHIFYEVLDYHNSGEMAKLYLRKEL"
FT   misc_feature    804845..805315
FT                   /note="authentic internal stop codon: common BLAST hit:
FT                   gi|157827377|ref|YP_001496441.1| acetyltransferase"
FT   gene            805464..806558
FT                   /locus_tag="RPR_04730"
FT   CDS_pept        805464..806558
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_04730"
FT                   /product="transposase ISRpe1"
FT                   /note="COG2801 Transposase and inactivated derivatives"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_04730"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47600"
FT                   /db_xref="GOA:C4K0H1"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:C4K0H1"
FT                   /protein_id="ACR47600.1"
FT                   /translation="MNLNQKIIKPKIGLLELAKSLGSISSACKAMGYSRDSYYRFKALY
FT                   ETGGEEALYEISRRKPIIANRVDPAIEKAVMDMAIEYPAYGQLRVSNELKKSGILVSPG
FT                   GVRSIWLRNDLNNISKRLKALEAKMAQDGIVLTESQLQVLEERRNEREAHGETETQHPG
FT                   YLGCQDTYYVGNFKGIGKVYSQVFIDSYTRVADAKLYTDKTALTAADMLNDRVLPWYET
FT                   QGIPILRILTDRGSEYKGNIEHHAFELFLSIEGIEHTTTKAYSPQTNGMCERFNKTMKQ
FT                   EFFDTAMRKKIYTDLDDLQLDLDIWLEHFNNERPHSGKYCYGKTPMQTFKDSKKLAVEK
FT                   NNEILYLEYVSDSQNVTDNQVQNL"
FT   misc_feature    806592..807020
FT                   /note="TraD gene fragment, result of transposon insertion:
FT                   common BLAST hit: gi|91205235|ref|YP_537590.1| conjugal
FT                   transfer protein TraD"
FT   misc_feature    complement(807247..808252)
FT                   /note="authentic frameshift: common BLAST hit:
FT                   gi|157827424|ref|YP_001496488.1| transposase"
FT   misc_feature    complement(808266..810409)
FT                   /note="authentic frameshifts: common BLAST hit:
FT                   gi|157827425|ref|YP_001496489.1| conjugal transfer protein
FT                   TraA"
FT   misc_feature    810485..810812
FT                   /note="authentic frameshift in TraD gene fragment: common
FT                   BLAST hit: gi|91205235|ref|YP_537590.1| conjugal transfer
FT                   protein TraD"
FT   misc_feature    810911..812702
FT                   /note="authentic frameshift in COG0477 Permeases of the
FT                   major facilitator superfamily"
FT   misc_feature    813181..814275
FT                   /note="authentic internal stop codon: common BLAST hit:
FT                   gi|157964614|ref|YP_001499438.1| transposase ISRpe1"
FT   gene            complement(814640..818185)
FT                   /gene="dnaE"
FT                   /locus_tag="RPR_04800"
FT   CDS_pept        complement(814640..818185)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaE"
FT                   /locus_tag="RPR_04800"
FT                   /product="DNA polymerase III subunit alpha"
FT                   /EC_number="2.7.7.7"
FT                   /note="COG0587 DNA polymerase III, alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_04800"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47601"
FT                   /db_xref="GOA:C4K203"
FT                   /db_xref="InterPro:IPR003141"
FT                   /db_xref="InterPro:IPR004013"
FT                   /db_xref="InterPro:IPR004805"
FT                   /db_xref="InterPro:IPR011708"
FT                   /db_xref="InterPro:IPR016195"
FT                   /db_xref="InterPro:IPR029460"
FT                   /db_xref="InterPro:IPR040982"
FT                   /db_xref="InterPro:IPR041931"
FT                   /db_xref="UniProtKB/TrEMBL:C4K203"
FT                   /protein_id="ACR47601.1"
FT                   /translation="MRPEFIHLRTQSSYSFLESALTIEKVVELASSNKMPAICLADKGN
FT                   LFGSLEFALCAVKKGLQPIHGVILNIKYDIDIFAQILLIAKDETGYKNLLKLSSLTFTK
FT                   NDRKICDHIDFEDLIEYQEGLIGLCCYTDGIVGKCLLARNEEQAMLFARKLQEILGDRF
FT                   YFEIMRHELPEEQFIEDSYIRIAAELAIPLVATNKVLFSEKSMHDAHDVLLCISAGVTK
FT                   EYLDRKTVSENCYFRSPHEMIELFSDLPSAIQNTVNLRERCYFAAHANPPMLPNFATKD
FT                   ISETDLIKKDAKEGLLARLATKFKSENIALENQEALKTEYFARLNYELDIICNMNFAGY
FT                   FLIVSDFIKWSKKEGILVGPGRGSGAGSVVAWSLLITDLDPIKFGLLFERFLNPERISM
FT                   PDFDIDFCQERREEVINYVRSKYGNNRVGQIITFGKMQAKAVIKDVARVLSLPYKFADY
FT                   LTELVPFSAVNPVSLKQALHEVPELANAAKGNGLYNLDGEAELIKLVIDTSLILEGLHR
FT                   HSSTHAAGIVIAGTDLVDIVPVYKDSNSDMLVVGYSMKYSEIAGLIKFDFLGLQTLTVI
FT                   TDCKKLLKEQGIEVDFNNMTFDDNKTYQMLCKGKGVGVFQFESIGMKDALRRLKPDSIH
FT                   DLIALGALYRPGPMENIPTYIACKHKLQQPDYLHELLKPILEETYGVVIYQEQVQRIAQ
FT                   VLAGYTLGAADLLRRAMGKKIKKEMEEQEEIFVKGAIANNISESQAKSIFATVAKFAGY
FT                   GFNKAHAASYGVISYQTAYLKANYPAEFLVACLNLELNNHDKINFFLQEAKDNGIKIIA
FT                   PNINISEGYFSVKFSDTVIPHSVKPVIPRLDRGIQEISKDTVVKPRYDIAGAIIFALGA
FT                   IKGVTPNFGKLVTDERKARGAFKSITDFIERLPPKSINSKLLENLIKSGCFDELHDNRL
FT                   QLLSSIPKLLSYSTAYHEEQESNQFSLIKVSSLSPTILVSSDYADKNTLAFYEFEAMGL
FT                   FISNHPLTEYQEIFSRLNILNTADLHNNLPDGTNRVNLAGVIQKKDSRMSARGRFVTLV
FT                   LSDPENIFELSIFSEEVLKDYVHLLDVKSLVVVNCDIVKDEGGIKLTAKSFSSIEDAIN
FT                   NKQFELQFYPQNHEELRQIVTLLAARINNEDQSNAKATIYLQSADVKNFVAKITLPEKF
FT                   LLQGQDFEILKGYSK"
FT   gene            complement(818343..819641)
FT                   /locus_tag="RPR_04805"
FT   CDS_pept        complement(818343..819641)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_04805"
FT                   /product="UDP-glucose 6-dehydrogenase"
FT                   /note="COG1004 Predicted UDP-glucose 6-dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_04805"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47602"
FT                   /db_xref="GOA:C4K204"
FT                   /db_xref="InterPro:IPR001732"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR014026"
FT                   /db_xref="InterPro:IPR014027"
FT                   /db_xref="InterPro:IPR017476"
FT                   /db_xref="InterPro:IPR028357"
FT                   /db_xref="InterPro:IPR036220"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C4K204"
FT                   /protein_id="ACR47602.1"
FT                   /translation="MNITFIGSGYVGLVSGIIMGYLGHNVTCLDNDEVKISKLNKQILP
FT                   IYEAKLDEYLKQALESDRLKFTNIYNNELQNADAIFITVGTPSKGLGEADLKYVYDAID
FT                   KVFEHINKDCLIVIKSTVPPGSCSNIIAYLKSRGFSFNVASNPEFLREGSAVEDFLYPD
FT                   RIVIGVNNKESEEILRKIYAPLQGAKFVVTDLVTSELIKYASNSFLATKIAFINEMADL
FT                   CEKIGGNIKDLSKGVGLDQRIGQNFLNAGPGFGGSCFPKDILALNNLVENHHIDCRILK
FT                   AVIKSNKQRPSNMVDKIATLLDGDLKGKNIAILGLTYKAGTDDVRASPAIAIVKILLNK
FT                   DVYVKAFDPIGLENAKKNLEHKNLLYLDSAVDACKSVDIIVIATEWSEFKELNWQEIYD
FT                   LVKSPIIIDLRNILDNEAMKKIGFRYYAVGSKI"
FT   gene            819889..822399
FT                   /locus_tag="RPR_04810"
FT   CDS_pept        819889..822399
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_04810"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_04810"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47603"
FT                   /db_xref="InterPro:IPR025263"
FT                   /db_xref="InterPro:IPR032712"
FT                   /db_xref="UniProtKB/TrEMBL:C4K205"
FT                   /protein_id="ACR47603.1"
FT                   /translation="MNFIKKTFISIFIILISLSLAITLTVYSANKGHLNEPLKKIIEFY
FT                   LSKNDIKAVLHNLEFKENRLSIDKISLSLIDNARGEINDFNLFFNFKNFFSNSLIEANF
FT                   NIDKISVISNNDEEIINTSTTGDYSLNIIKKNSLTDIRLTSIKSDILTDEQGADLPLGN
FT                   ALCSYKTTYSKDNPKTVNCKLTFGNKAFLSLSGIITNKNIDASAAAANMPLIIYQTVEK
FT                   IIPDNPIISYLREHIKQGYIQNGELNIKLDKKFLKKNILVEDNLKANLHISNFEYKYHT
FT                   DLPPLTKVDTNIIISGPEIKFLINEAYSGKSVVSDGIMTFKWEGLDKSQFVFNATAKGE
FT                   INDLIAFVPNDAYQNIKAQNIDLKKIKGTANSIIELIIPISPNIPNSYNVLSTLTNISF
FT                   NTLDNNILLQNGEAKGSFKDNKLNISGQGNINNYASNFTYDHDISDKNNECLLKIKSNI
FT                   AANNQRFGVFKLISGSTVLNFEYKKQHNNESFITVNSNLNNLEFYIDKVSIHKKLYKKA
FT                   NLYLYTKLNDKNFDRNIVFNLSGQDNLKINGNALIKKNIYNINLASVKHNHTDLKGNII
FT                   IDNHNLNTTLYGNRLDLSNANMMQFLEKAGDSTRNINLKTNISKILLKNNIILGNLDLA
FT                   IKCDKVRCFSGFLNANIDNKKVKMSLTAKETFEQWFIESDNAGALLKGLGMYTTMQNGQ
FT                   ININLNTKRYEVKKGEIVPILDGKFSIKHFTVVDTPFLTRLVSFVSLPGFLSSITNNKN
FT                   ILFEDMIGKFNYRGNIITIFDTEAHGPFFDFTMTGNIDTKQQLIMVKGNVIPSFFLIST
FT                   IVTKIPVVGKIFSKVAPYSLKMKY"
FT   gene            822537..824078
FT                   /locus_tag="RPR_04815"
FT   CDS_pept        822537..824078
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_04815"
FT                   /product="AmpG"
FT                   /note="COG0477 Permeases of the major facilitator
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_04815"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47604"
FT                   /db_xref="GOA:C4K206"
FT                   /db_xref="InterPro:IPR004752"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C4K206"
FT                   /protein_id="ACR47604.1"
FT                   /translation="MFGVIPWLDHGIQKTTKNTNNISIFNWGLLKTCGMTEVEASHATK
FT                   PQLQGAWWQSRNNNRIFCKSEFFTGLLRRNLQFFLTMTLKINSCKNDINNHTYLIGILL
FT                   LGLISGLTFNLIFFTVPYQLSEAKYTTDIIGSISLAAFPYCLKVIWSPFIDKYSIPFLC
FT                   SKFGHRRGWALVSQIFLILAMTGFLNISPCNNLYITAIILFIISSCSSTQDIVLDAYRI
FT                   ERPTSKEELSMAFTFSSIGFRLGMLLGSVGTLYSSIIFGWNTVYKSALFITLIGPIVIL
FT                   CIKEPQSKEIHHTTTHLIGLQQYFEVIKKSIISLKNEQQYLLLIILFIFLYKAADSIPM
FT                   AMSSPLLLDLSFTTHEIAVIYKAYGLLIMIVGGALSGVLAAKMGIFHSVLIGGVIQLLS
FT                   PLMFMILATIGYDIKTFIITVTVQNFCAGFAGTIISIYFASLCNSEFVATQYSIIASFS
FT                   SLSRIILASLGGICAKYLTWPVFFLGNTLFSMLFIPIFYKIYRKKLGFMNISKKI"
FT   gene            824145..824900
FT                   /locus_tag="RPR_04820"
FT   CDS_pept        824145..824900
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_04820"
FT                   /product="Sec-independent protein translocase protein"
FT                   /note="COG0805 Sec-independent protein secretion pathway
FT                   component TatC"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_04820"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47605"
FT                   /db_xref="GOA:C4K207"
FT                   /db_xref="InterPro:IPR002033"
FT                   /db_xref="InterPro:IPR019820"
FT                   /db_xref="UniProtKB/TrEMBL:C4K207"
FT                   /protein_id="ACR47605.1"
FT                   /translation="MKLYSFQEHLLELKIRLLRIFTAFIIIFAICYYFSDYIYSVLLKP
FT                   LAKLSGDTVRNIIYTGLTEAFFTYIKLAAFTAFTIIIPIIALECYLFISPGLHRHEKKI
FT                   IAFILFMSPILFWCGSIFVFYFVMPKAWNFFLSFEKRDMIVPIVLEARISEYLNLVIHL
FT                   IIAFGVAFQLPVVIMILNILKIVKVQTLKQKRCIAVVINFIIAGILTPPDILSQFALAI
FT                   PLLLLYETSIMICNFIEKLRTLNVKYQMD"
FT   gene            824878..826155
FT                   /locus_tag="RPR_04825"
FT   CDS_pept        824878..826155
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_04825"
FT                   /product="seryl-tRNA synthetase"
FT                   /EC_number="6.1.1.11"
FT                   /note="COG0172 Seryl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_04825"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47606"
FT                   /db_xref="GOA:C4K208"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002317"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR015866"
FT                   /db_xref="InterPro:IPR033729"
FT                   /db_xref="InterPro:IPR042103"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4K208"
FT                   /protein_id="ACR47606.1"
FT                   /translation="MLNIKWIRENKELFDEKLSQRFIEPMSSKIAMLDREKRKITSLIQ
FT                   EFQHARKVKSKILGNMASKSGEEFEGLQRDVKHINEKLEALEHDLNNNNELNELLNMFP
FT                   NIPDEEVPYGMDESMNKLVRTYGETNPNALNKQHFELGIKLNLMDFEQTAKISGTRFVT
FT                   LKGDLAKLERALINFMIDVHTKEWDFFEISPPVLVRDNAMYNAGQLPKFAEESFATTNG
FT                   YRLIPTAEVSLVNMVADTIIPREKLPIRYVAYTPCFRSEAGSSGRDTRGMIRLHQFGKV
FT                   ELVSITTPEESTNEHEYITNASETILQKLNLPYRVMLLCTGDMGFAAKKTYDIEVWLPG
FT                   QKQYREIASCSNCGDFQARRMKARYKEFGSNETTLVHTLNASGLPIGRTMVAILENYQN
FT                   EDGSITIPDVLINYMGGLQKIIAYSE"
FT   gene            826493..828925
FT                   /locus_tag="RPR_04830"
FT   CDS_pept        826493..828925
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_04830"
FT                   /product="virB4b ATPase"
FT                   /note="COG3451 Type IV secretory pathway, VirB4 components"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_04830"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47607"
FT                   /db_xref="GOA:C4K209"
FT                   /db_xref="InterPro:IPR004346"
FT                   /db_xref="InterPro:IPR018145"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C4K209"
FT                   /protein_id="ACR47607.1"
FT                   /translation="MFSGLRKFDKDIYNYNAPNFIPIACHYNENTLLTKDGKLLQIIKI
FT                   HGITSEKISDNIQNLREMVRVSIKKNITNYDFAFWLHTIREKQNLDDSTPYKKLLPANI
FT                   HTLWQRKNHWNDKFVNTLYISIVHDSAKVNITNFNSLINSLSNKLITDFENNYLDSAFQ
FT                   KLDNITNNILNDLNEFGAEKLGIIFENDNVFSNPLFLYNRIANLNNNDCLVPIIDLSDA
FT                   IGRSIYTISSDKMVVTDHEKNNKFVSLLSIKEYHETPSNTLDKFLQLPIELIITEIFYF
FT                   VSKKQVISKLRGQDYILKITNDSTLLNHKGINKLEAANLDFQFCNQQISIAVIEEDENK
FT                   LDAAVAKASTELFKLGIIHVKEDINIEQIFWSQLPANFAFIRRMSPLSVEHIASLTALH
FT                   NTTLGNQYNPWGKAITLLRTEKGTPYFMNFHDKTNKGNTCIFGTGKTGKTVLLNFLISE
FT                   STKYDPTIIYISNNNDSKIFIEAIEGKWLEPDKQIINPFLVDDTEKSQAFILEFLKLIS
FT                   GHYISPLSEIEISFLEKLKNKILSIEKEKRIFSNILKLEDFKEEGGIQILDKLKVFTEE
FT                   QLYSGLFDGSSLNIEEGKVIGLNLYKLSDEPFSKQFYPTERKFLEQFNNNLKKHQSISA
FT                   AVIYAFTYHLSLVGTKPKIFAADNFDQLYRPEIYYDNINLIYNNLSQNNGIFVSNFNFI
FT                   YLKSYPKYTIKPWLDLINTKIILPSDVKIEDLDKILGLSKPEIRKLSQLILSARMFLIS
FT                   KDNESIASELSIAALIGVVRILSSRQEEMDIYKKILEQHQGPPDNWVNYLYNELNTD"
FT   gene            829061..832549
FT                   /locus_tag="RPR_04835"
FT   CDS_pept        829061..832549
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_04835"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_04835"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47608"
FT                   /db_xref="UniProtKB/TrEMBL:C4K210"
FT                   /protein_id="ACR47608.1"
FT                   /translation="MLKKYLLFFLFSFFSFNVYASIWDDIVTCLSDPCNCGQSERTEIW
FT                   NKDGGINAKPRGPFKPGTLCPPWNKSDGRNNDTCLLKFDYPGILIGFLLNRCAEEAPDS
FT                   SYFTPKIRIRIQSCNAIACWHQNSTLNWDGECVLWPTGYGIPLTRVCARVAVPDMPPPP
FT                   GINAPPSPADPGYTDGVHLNKVGYTETDNKIIGIDGKIITLKPPKLCAYSDPGLVNLVS
FT                   DSGAHLDPMDWNPNRQPLHHTNELSPIAKVLKFLVETIKGVSLPSLLGQLLGMIDQNSE
FT                   FIKVLQSILNAIGEIFNFFPALIIKIIEALGSLNGSVDSYSFGCVQLPLGPFPPPYCPN
FT                   LDYITTNASAHNVCSIKDASGQFDQSSTNPACVVPSNINVKNNIVNNTIRVSFSNLVPL
FT                   CTSSRSDLKTCVEPRNIDFSSAKITHTNTAFKDLIKSCKNTSGNTPCINTEISTPCSVT
FT                   ANGCNEGFRIIYSQKIGNVETPSDYYISDIPDCPSSNSTTCQKVWGVNIGEFKDVSVKF
FT                   PEVQKQDTTSLMPIKTDVILKDNNGKDRKLYVSISNTEDDKQNPNNICLFESGNLIDCV
FT                   PRVNHSYSLAAYECAKQYAGITCTNNSNPNYAYYKPQFIASVQVREGDNIIDETSTLVT
FT                   PLAYAGPPPPNPTDTESIVMLAGYKYSSSVAFIPKDPKEDKYIAMPFSGENALNQLTIH
FT                   GKYKDDKAPYDSNGNPDSSAVYLKYLEYINGKYIQGGTHACLMPKNFQHCNPMLRPTLP
FT                   DGSPIPGYNHDSTNCVLAKLNNNDTINCKDFKKKYNVKYPNLGLCKKDIDLTRCTLEET
FT                   VSGPGRGITIYTCNINKIPSKCYTNNDKANTPICVLSRDYTDRIEPKPNIGPILVPVDP
FT                   SKYYTVTYTKGDNNTPPEPTYNAETEDVRDKTWQELNLCAPILVPTCAKIPSTEKAPSG
FT                   NNHGNAEWPESDIGELAKGKCPTNWIPIDPNKPLERHCLSYFDRKVVEFEPLGHNVGCR
FT                   KFKGFPIKVGYNDFPSDQLLETPYNPVTKIGDYIFNKKPVPHGSIMAFPKDGALIAAAN
FT                   KPDNTILHTVEFKVTLDAIMDDIEYFEVKDLWYDDCTLIYVNGTKLLSFPTNIDSLDEK
FT                   RYCNNGNDQDQALQAKNLPIDIKRYLKPGENIIRFQLRVMFDGGLYFHMQYKMKR"
FT   gene            832554..833459
FT                   /locus_tag="RPR_04840"
FT   CDS_pept        832554..833459
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_04840"
FT                   /product="tellurium resistance protein TerC"
FT                   /note="COG0861 Membrane protein TerC, possibly involved in
FT                   tellurium resistance"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_04840"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47609"
FT                   /db_xref="GOA:C4K211"
FT                   /db_xref="InterPro:IPR005496"
FT                   /db_xref="InterPro:IPR022369"
FT                   /db_xref="UniProtKB/TrEMBL:C4K211"
FT                   /protein_id="ACR47609.1"
FT                   /translation="MSWIIFYTVIAALLILDLGIIHKKNTIMSFKESVLFSLFYIVIAC
FT                   LFGIYVYYNTGADHAREYYTCFLIEKAMSLDNIFVISIIFQFFKIPWQYQHRVLFFGII
FT                   GVIIFRAVMIYGGIILINKFAWLLYIFAVILIATGIKTFYVSHKTFDIQNSYIYKSIIK
FT                   NLNITPNLEGDKFVVKRNNKLYCTPLFISLVLIEAIDLVFAIDSIAAIFAITNDVYIIY
FT                   TSNIFAILGLRALFFCLAEIVERFSYIKYSLALILIFISFKIFIHHYIAIPEYVAFTVT
FT                   ITLLLFGIIASIIRKNMIDH"
FT   gene            833503..834246
FT                   /locus_tag="RPR_04845"
FT   CDS_pept        833503..834246
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_04845"
FT                   /product="hypothetical protein"
FT                   /note="COG3637 Opacity protein and related surface
FT                   antigens"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_04845"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47610"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="UniProtKB/TrEMBL:C4K212"
FT                   /protein_id="ACR47610.1"
FT                   /translation="MTKLLKLFFITIIIFNNIAFAKETGFYIGVEGGIIEPVVSKFRHK
FT                   HSNTEIILKKSSMYSGKIGYIIYPQIAIEFSATYQPKYSLHYVLPQQNLSNGLTIPKNP
FT                   GNTTVLSNIYMLNLIYDLEKIKTFTPFVILGGGIAQEKVKPTSSRWSVINSDYFKVRKT
FT                   HKNCVAWQAGLGISQDVTSNLSIDATAKLQTAYRVRINYDTLDMKTGQFVPTNPIKKTI
FT                   AVGEFGIGCTYRLPFNNSVKYLYES"
FT   gene            834301..835965
FT                   /locus_tag="RPR_04850"
FT   CDS_pept        834301..835965
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_04850"
FT                   /product="hypothetical protein"
FT                   /note="COG0500 SAM-dependent methyltransferases"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_04850"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47611"
FT                   /db_xref="InterPro:IPR018773"
FT                   /db_xref="InterPro:IPR025714"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C4K213"
FT                   /protein_id="ACR47611.1"
FT                   /translation="MSPKATNSSSTPNGHDKMAKQTHSAQSVVNGAVSDHNTYDEIPYE
FT                   SYPYALTNPYHLSTLATLFGVNAPEVENAKILELGCAAGGNLIPHAVLYPKAYFVGVDL
FT                   SKVQIDEANKNVKALGLKNIEFHHCAITDINDSFGKFDYIICHGVISWVPKTVRDKIFE
FT                   VCNKNLSPNGIAYISYNTLPGWNMVRTIRDMMMYHSSAFANVRDRIAQSRLLLEFVKDS
FT                   LENSKTPYAEALKTEAGLLAKQTDHYLRHDHLEEENAQFYFHEFMNEARKHNLQYLADC
FT                   NLSTMYLGNMPPKVVEQLKAVNDIVRTEQYMDFITNRRFRTTLLCHSDVKINRNINNDD
FT                   ITKFNIIFNIVPEKPLKEVDLNNASENLKFFLNGNQDSNLTTSSPYMKAILYTFSENLN
FT                   NPLSFEKITTEANKKLHNTKLNEIKAELLNNAMKLVLQGYISITNQKHRNNPELDKPKT
FT                   TKMVIHQATHTPSMWVTNLKHEPIGVNFFEKCALRYMDGKHDKKAIIEAVLGHVEKGEL
FT                   TLSKEGQKVENKEEIRKELESLFISMIKKFSSNALLV"
FT   gene            836008..836229
FT                   /locus_tag="RPR_04855"
FT   CDS_pept        836008..836229
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_04855"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_04855"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47612"
FT                   /db_xref="UniProtKB/TrEMBL:C4K214"
FT                   /protein_id="ACR47612.1"
FT                   /translation="MILNKNYLLILLRQWRIIIMSKKLISVVELTEFQKFAKNNLNEKE
FT                   CFKIIHYIAANPDQGDIIKGTGGIRRKL"
FT   gene            836302..836730
FT                   /locus_tag="RPR_04860"
FT   CDS_pept        836302..836730
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_04860"
FT                   /product="hypothetical protein"
FT                   /note="COG2944 Predicted transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_04860"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47613"
FT                   /db_xref="GOA:C4K215"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:C4K215"
FT                   /protein_id="ACR47613.1"
FT                   /translation="MPVFLITGFIKSKMENINHNSCNELKKLTEELENYMSDAAKINNK
FT                   NTNQTDKSILIGMQEAVLYTKGKLKANKHDIKSSNIDVHEARDKLKLTQQQFATTFGVS
FT                   VATLRNWEQGRRLPTGAAKLLLKIIEKEPNVVKRVLRG"
FT   gene            836763..837380
FT                   /locus_tag="RPR_04865"
FT   CDS_pept        836763..837380
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_04865"
FT                   /product="NADH dehydrogenase subunit J"
FT                   /EC_number="1.6.5.3"
FT                   /note="COG0839 NADH:ubiquinone oxidoreductase subunit 6
FT                   (chain J)"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_04865"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47614"
FT                   /db_xref="GOA:C4K216"
FT                   /db_xref="InterPro:IPR001457"
FT                   /db_xref="InterPro:IPR042106"
FT                   /db_xref="UniProtKB/TrEMBL:C4K216"
FT                   /protein_id="ACR47614.1"
FT                   /translation="MPIFFYLFATLITISSVCVVLSKNSVYSVLWLIFAFINGAGLMIL
FT                   LGAEFLAMMLIVIYVGAVAVLFLFVIMMLDMHFNKTITQLKANLALSIFIALIMFADLV
FT                   IIILLGTKNINFNSNVSFTITNNISNTKAIGGVLYTDFMLPFQMAGLILFVAMIACITL
FT                   TLKKREGVKRQDISKQLRHNKENTVLMTKPILNKGVENIKYE"
FT   gene            837373..837687
FT                   /locus_tag="RPR_04870"
FT   CDS_pept        837373..837687
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_04870"
FT                   /product="NADH dehydrogenase subunit K"
FT                   /EC_number="1.6.5.3"
FT                   /note="COG0713 NADH:ubiquinone oxidoreductase subunit 11 or
FT                   4L (chain K)"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_04870"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47615"
FT                   /db_xref="GOA:C4K217"
FT                   /db_xref="InterPro:IPR001133"
FT                   /db_xref="InterPro:IPR039428"
FT                   /db_xref="UniProtKB/TrEMBL:C4K217"
FT                   /protein_id="ACR47615.1"
FT                   /translation="MNEYISLNHYLILSSLVFTIGMFGLFMHRKNIINILMSIELMLLA
FT                   VNINFVAFSVYMQELSGQIFSIIILTVAAAETSIGLAILLIYFRNKGSIEITDINQMWG
FT                   "
FT   gene            837720..839660
FT                   /locus_tag="RPR_04875"
FT   CDS_pept        837720..839660
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_04875"
FT                   /product="NADH dehydrogenase subunit L"
FT                   /note="COG1009 NADH:ubiquinone oxidoreductase subunit 5
FT                   (chain L)/Multisubunit Na+/H+ antiporter, MnhA subunit"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_04875"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47616"
FT                   /db_xref="GOA:C4K218"
FT                   /db_xref="InterPro:IPR001516"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="InterPro:IPR003945"
FT                   /db_xref="InterPro:IPR018393"
FT                   /db_xref="UniProtKB/TrEMBL:C4K218"
FT                   /protein_id="ACR47616.1"
FT                   /translation="MLPLASSIINGLFVRVIDKKLAQVIATGFLSLSALFSLIIFCDAG
FT                   LDGNIIHIKLLPWIEVGNFKVNWSIYIDQLTSIMFIAVTWVSSIVHIYSLGYMAEDKGI
FT                   IRFLSFLSLFTFFMLMLVSSDNFLQLFFGWEGVGVCSYLLIGFWYSKESANKAAIKAFI
FT                   INRASDFAFILGIMTIIVYCGSANYKDVLSSAELLSNIKIFLHFYILDIICLLLFIGCM
FT                   GKSAQIGLHVWLPDAMEGPTPVSALIHAATMVTAGIFLVARCSYLFEYSPLILQFITII
FT                   GGVTCLFAASIAIMHSDIKKIIAYSTCSQLGYMFMACGVSAYNSGIFHLVTHAFFKALL
FT                   FLSAGSVIHAVHEQDIFKMGDLRNKMPVTYGNFLIGSLALIGIYPLAGFYSKDSILEAA
FT                   YSSGSFMFIFGIAAAILTPIYSMKIIMLVFHGKTKLEKDVFEHAHEPAKVMNNPLILLV
FT                   AGSFFSGMIGYYLLAMDKPNGYFHASLFNLHIYKLLISHPPLYIKLLPMAVGIVGIVTG
FT                   IYLYKSSTVMSFPQKRKSSKNIKNAWILRSSRGMTPLVLISNILRNKYYFDEIYNCLIV
FT                   KPINCLASLFYLGDQQIIDRFGPNGFSRVVNCFSVLTGKIQTGYVFNYALYIVSFIVVT
FT                   ISYFVWKNIMY"
FT   gene            839814..841295
FT                   /locus_tag="RPR_04880"
FT   CDS_pept        839814..841295
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_04880"
FT                   /product="NADH dehydrogenase subunit M"
FT                   /EC_number="1.6.5.3"
FT                   /note="COG1008 NADH:ubiquinone oxidoreductase subunit 4
FT                   (chain M)"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_04880"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47617"
FT                   /db_xref="GOA:C4K219"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="InterPro:IPR003918"
FT                   /db_xref="InterPro:IPR010227"
FT                   /db_xref="UniProtKB/TrEMBL:C4K219"
FT                   /protein_id="ACR47617.1"
FT                   /translation="MLELPIISISIFLPLISVLYILLFISQSKKADKPIYVMYVAVLSS
FT                   VLTFISTIYILIEFDSSNPAYQFVERYAWLDKIGLEFHVGVDGISIFFVVLTSFLTLIC
FT                   IIGSLFTVKKYIKEYLVCFLLMESLCIGAFTSVNLLLFYLFFEAILVPMYIIIGVWGGK
FT                   NRIYAALKFFLYTFFGSLFFLLSLIYIYSKMHSFDLTYIFQLTDNIPLFAQQILWWAIF
FT                   IAFAVKIPIIPFHTWLPDAHVQAPTSGSVILASILLKLGGYGFLRVLLPLCPSVSQEFA
FT                   IYVIYLSVIAIIYASLVALAQKDMKKMIAYSSIAHMGYVTIGIFSFTKAGVSGAIFQML
FT                   SHGVISSCLFLIVGTLYERLHTKEIAKYGGVASKMPVLAAFFMIAMLGSVGLPGTSGFI
FT                   GEFLSLLGIYKVNVVATFIAALGIIFGAVYMLKLYKEVMLGEITNKEIMHFRDLYKYEI
FT                   ISIAPLILLIIYFGLMPSSILNVFSLSVENLLVKF"
FT   gene            841581..842285
FT                   /locus_tag="RPR_04885"
FT   CDS_pept        841581..842285
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_04885"
FT                   /product="cytochrome c biogenesis protein CcmA"
FT                   /note="COG4133 ABC-type transport system involved in
FT                   cytochrome c biogenesis, ATPase component"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_04885"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47618"
FT                   /db_xref="GOA:C4K220"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005895"
FT                   /db_xref="InterPro:IPR022439"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C4K220"
FT                   /protein_id="ACR47618.1"
FT                   /translation="MKIKFIKKQQMSYRGLTTISSKIISILNCFYMDTVVKLRYDKDML
FT                   SLHQLQFKNLFDLNITFLPSSITYIKGANGCGKSSLLRMIAGIMQPSSGNIYYRNCNIN
FT                   NIAKLYCTYIGHNLGLKSEMTVFENLKFWSEIYNSAATLYAAIHYFKLHDLLDKKCYSL
FT                   SSGMQKIVAIARLIACQSDLWLLDEVETNLSKENRALLNNLIVMKANSGGIVLLSSHLE
FT                   SSIKSAQILRLD"
FT   gene            complement(842770..843249)
FT                   /locus_tag="RPR_04890"
FT   CDS_pept        complement(842770..843249)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_04890"
FT                   /product="NADH dehydrogenase subunit I"
FT                   /EC_number="1.6.5.3"
FT                   /note="COG1143 Formate hydrogenlyase subunit
FT                   6/NADH:ubiquinone oxidoreductase 23 kDa subunit (chain I)"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_04890"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47619"
FT                   /db_xref="GOA:C4K221"
FT                   /db_xref="InterPro:IPR010226"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4K221"
FT                   /protein_id="ACR47619.1"
FT                   /translation="MINYLKSFFLYEIVRGMALTLKYFFKPKVTINYPYEKSPISPRFK
FT                   GEHALRRYENGEERCIACKLCEAICPAQAIVIEADEREDGSRRTTRYDIDMTKCIYCGL
FT                   CQEACPVDAIVEGPNFEFASLTHTALIYDKERLLQNGDRWEQALASKLHKDYEYR"
FT   gene            complement(843436..844455)
FT                   /locus_tag="RPR_04895"
FT   CDS_pept        complement(843436..844455)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_04895"
FT                   /product="NADH dehydrogenase subunit H"
FT                   /EC_number="1.6.5.3"
FT                   /note="COG1005 NADH:ubiquinone oxidoreductase subunit 1
FT                   (chain H)"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_04895"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47620"
FT                   /db_xref="GOA:C4K222"
FT                   /db_xref="InterPro:IPR001694"
FT                   /db_xref="InterPro:IPR018086"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4K222"
FT                   /protein_id="ACR47620.1"
FT                   /translation="MLELFFEYIFPLIIIALKVVAITTPLILCVAYLTYAERRVIGLMQ
FT                   LRRGPNVVGPFGLLQPIADAVKLLFKEPIIPTNSDKILFILAPMITFILSLIGWAVIPF
FT                   AKGVVLADINVGVLYILAISSLSVYGIIIAGWASNSKYAFLGAIRSSAQMISYEVSMGL
FT                   VIITVLLTTGTLNLSEIIEAQRTMPWWIDLMLLPMGVVFFISVLAETNRLPFDLPEAES
FT                   ELVAGYNVEYSSMGFALFFLGEYANMILVSAMTTTFFLGGYLPPFNISWLDCIPGFFWF
FT                   VFKVGFLLFCFLWIRATLPRYRYDQLMRLGWKVFLPLTLFWVVLVSSVLVYTDNLPSI"
FT   gene            complement(844577..846607)
FT                   /locus_tag="RPR_04900"
FT   CDS_pept        complement(844577..846607)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_04900"
FT                   /product="NADH dehydrogenase subunit G"
FT                   /EC_number="1.6.5.3"
FT                   /note="COG1034 NADH dehydrogenase/NADH:ubiquinone
FT                   oxidoreductase 75 kDa subunit (chain G)"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_04900"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47621"
FT                   /db_xref="GOA:C4K223"
FT                   /db_xref="InterPro:IPR000283"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="InterPro:IPR010228"
FT                   /db_xref="InterPro:IPR015405"
FT                   /db_xref="InterPro:IPR019574"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:C4K223"
FT                   /protein_id="ACR47621.1"
FT                   /translation="MDKIKMIKLNVDGSEIEVSEGSTVYQACTQAGKEIPHFCYHERLK
FT                   IAGNCRMCLVEMEKSPKPIASCAMPVSNGMVIHTDTPMVKKAREGVMEFLLINHPLDCP
FT                   ICDQGGECNLQDQAFRYGKGTNRFHENKRSIKDKYMGPLIKTAMTRCIQCTRCIRFASD
FT                   IAGIEEMGAIHRGEHIEVTSYLEQTLDSEMSGNMIDICPVGALNSKPYAFKARKWELKH
FT                   TASIGVHDAEGSNIRIDSRGDEVMRILPRVNEEINEEWLSDKNRFSYDGLKYQRLDRPY
FT                   IRKNGKLVEASWSEALKTVADKIKSVKPEKIAAIAGSLSSVEAMFMLKILLQKLGSNNY
FT                   SVNQFDYKLDTMQRGNYLFNTTIAGIEKADLCLLIGANPRQIAPVLNSRIGMRVRADSL
FT                   KVARIGGGHNQTYKIQDLGSDIKIIEGLAIGTHEFTKALKAAKYLMIIVGDGVYARDDG
FT                   YAILSLIHKIVTEYNIMRDDWKGFNILHNHASIVGGLDIGFNTPIKLEELELAYLLGTD
FT                   AIPFDKLKSTFIIYQGHHGDAGASSADVILPAAAYTEQSGIYVNLEGRPQIAEKAVSPV
FT                   GVAKEDIEIIKELAGYLKIDIGMDNLQEVRVRLAKEYKVFASIDRIIENKFSKFSSKDK
FT                   LSKEPITAEPINYYMTDVISKNSVTMAKCVEAKEARDEEAA"
FT   gene            complement(846595..846951)
FT                   /locus_tag="RPR_04905"
FT   CDS_pept        complement(846595..846951)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_04905"
FT                   /product="hypothetical protein"
FT                   /note="COG3671 Predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_04905"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47622"
FT                   /db_xref="GOA:C4K224"
FT                   /db_xref="UniProtKB/TrEMBL:C4K224"
FT                   /protein_id="ACR47622.1"
FT                   /translation="MDKHLKEYTESGKKNLIVVYILYLCGIVAPILPLIGVFFAYLNKD
FT                   KGDNFAISHYVFLFRTFCLGVLGWIVCFIFTFIMIGVVLYVILAVWYILRVAIGFKYMI
FT                   EDKAYPNPMTYWIK"
FT   gene            complement(847120..849756)
FT                   /locus_tag="RPR_04910"
FT   CDS_pept        complement(847120..849756)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_04910"
FT                   /product="aconitate hydratase"
FT                   /EC_number="4.2.1.3"
FT                   /note="COG1048 Aconitase A"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_04910"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47623"
FT                   /db_xref="GOA:C4K225"
FT                   /db_xref="InterPro:IPR000573"
FT                   /db_xref="InterPro:IPR001030"
FT                   /db_xref="InterPro:IPR006249"
FT                   /db_xref="InterPro:IPR015928"
FT                   /db_xref="InterPro:IPR015931"
FT                   /db_xref="InterPro:IPR018136"
FT                   /db_xref="InterPro:IPR036008"
FT                   /db_xref="UniProtKB/TrEMBL:C4K225"
FT                   /protein_id="ACR47623.1"
FT                   /translation="MSKVHNSEYIQELSVDNTSYKIYDINKAASDIDLPLKKLPYSLRV
FT                   LFENVLRSNGSKQSLLVFKEWLKTKKSDAEIDFIPARVLMQDFTGVPAIVDLAAMRDAM
FT                   ETIGGDPLKINPLIPVDLVIDHSVSVDSYAAKDSFNKNVQMEMKRNIERYAFLKWGQQA
FT                   FNNFKVVPPGTGICHQVNLEYLAKVVWHKDGTLYPDSLVGTDSHTTMVNGLSVLGWGVG
FT                   GIEAEAAMLGQPLTMILPEVIGVKLTGKLTGIATATDLVLTVTEMLRKKKVVGKFVEFF
FT                   GEGLKNLMIADRATISNMSPEYGATCGFFPIDQETIKYLELTGREKTQIRLVEQYATEQ
FT                   NLWYDFEHAVEYTEVLELDLSMVHSSLAGPKRPQDRVNLNDVASNFKYELPNFALENKD
FT                   IDKKYAVANQNYEIGNGDVVIAAITSCTNTSNPSVMIGAALLAKKALEHGLKVKPWVKT
FT                   SLAPGSKVVTEYLKLSGLDKYLDELGFNLVGYGCTTCIGNSGPLNPEIEETINKNGLVV
FT                   ASVLSGNRNFEGRINPLTEASYLGSPILVVAYALSGTLNIDLTNMPIGENIYLKDLWPS
FT                   KEAIDEVIANSINSSMFIEKYSDIFSGTKEWKDLQVTNSSTYNWNKNSTYINNPPYFKD
FT                   IGSKNNIQDIKSAKILAILGDSITTDHISPAGSISKTSPAAKYLTDHHIEPLDFNSYGS
FT                   RRGNHEVMMRGTFANIRIKNEMCTGVEGGFTINQLNGTQQTIYDAAMDYKAHDVSVVIF
FT                   AGKEYGSGSSRDWAAKGPGLLGVKAVIAESFERIHRSNLVGMGILPLTFTGNNTRLDLK
FT                   LDGSETIDITGLSENISSYHPVKCVIKKQTGAIRTIDLILQIFTDNEINYIKHGSIMHF
FT                   VVESLKG"
FT   gene            complement(849938..850276)
FT                   /gene="atpC"
FT                   /locus_tag="RPR_04915"
FT   CDS_pept        complement(849938..850276)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpC"
FT                   /locus_tag="RPR_04915"
FT                   /product="F0F1 ATP synthase subunit epsilon"
FT                   /EC_number="3.6.3.14"
FT                   /note="COG0355 F0F1-type ATP synthase, epsilon subunit
FT                   (mitochondrial delta subunit)"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_04915"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47624"
FT                   /db_xref="GOA:C4K226"
FT                   /db_xref="InterPro:IPR001469"
FT                   /db_xref="InterPro:IPR020546"
FT                   /db_xref="InterPro:IPR036771"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4K226"
FT                   /protein_id="ACR47624.1"
FT                   /translation="MNATILVKIITPLSIALEKQAKMVTMSGEEGMFGVLPSHVPMIVS
FT                   LKAGLVQVYIDDMHKSENTYLISGGVTEVTANYINIATDTAINVTNLSEAEIATKLLDL
FT                   QKTLSDQH"
FT   gene            complement(850334..851755)
FT                   /locus_tag="RPR_04920"
FT   CDS_pept        complement(850334..851755)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_04920"
FT                   /product="F0F1 ATP synthase subunit beta"
FT                   /EC_number="3.6.3.14"
FT                   /note="COG0055 F0F1-type ATP synthase, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_04920"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47625"
FT                   /db_xref="GOA:C4K227"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005722"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR024034"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036121"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4K227"
FT                   /protein_id="ACR47625.1"
FT                   /translation="MTKNIGKITQIISAVVDVKFTNNSELPEILNALECYNDKQRIVLE
FT                   VAQHIGDDTVRCIAMDSMEGLVRGVEVIDTGSPIRIPVGTETLGRIMNVVGEPIDGKGD
FT                   IKSSNISSIYKPAPDFTNQSTERNILVTGIKVIDLLAPYTKGGKIGLFGGAGVGKTVLI
FT                   MELINNVAKAHGGYTVFAGVGERTREGNDLYHEMIDSGVINLAEPEKSKVALVYGQMNE
FT                   PPGARARVALSGLTIAESFRDMNEGQDVLFFVDNIFRFTQAGSEVSALLGRIPSAVGYQ
FT                   PTLATDMGELQERITSTKYGSITSVQAIYVPADDLTDPAPATSFAHLDATTVLSRQIAE
FT                   FGIYPAVDPLDSNSQVLDPMIVGEEHYSVARQVQQVLQTYKSLQDIITILGMDELSEED
FT                   KLTVVRARKIQRFLSQPFHVAEVFTGAAGKFVNLADTIAGFKGLVEGKYDDLPEAAFYM
FT                   VGTIDEAIEKAQTLK"
FT   gene            complement(851928..852899)
FT                   /locus_tag="RPR_04925"
FT   CDS_pept        complement(851928..852899)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_04925"
FT                   /product="F0F1 ATP synthase subunit gamma"
FT                   /EC_number="3.6.3.14"
FT                   /note="COG0224 F0F1-type ATP synthase, gamma subunit"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_04925"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47626"
FT                   /db_xref="GOA:C4K228"
FT                   /db_xref="InterPro:IPR000131"
FT                   /db_xref="InterPro:IPR022436"
FT                   /db_xref="InterPro:IPR035968"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4K228"
FT                   /protein_id="ACR47626.1"
FT                   /translation="MSNLKQLRTRIKSVKSTQKITKAMQLVSASKMAKIKSQIANSNFY
FT                   IEAVSKMMSAILSIDIYELSIEEQKFFNTVPNKANLLIVMTSQRGLCGTFNYSIIKQVK
FT                   NDIKELENKGEQIKLIIIGKKGYEALKRQYVNYIDSYFELPKIHDENLMLQVKQKIMSA
FT                   VENLEVSNCVIYFNKFKNAMTQIMTRQQILPVAKYQDHSMIDNPIVNLVGFGYKERGAK
FT                   PINNRRATSDIVGESKSIDYNYEYEGENLISNLINLYVNSQINYALLQSRASEEGARMT
FT                   AMENATNNANDLISKLVLKLNRSRQAIITTELIEIIAGSEAV"
FT   gene            complement(853032..854564)
FT                   /locus_tag="RPR_04930"
FT   CDS_pept        complement(853032..854564)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_04930"
FT                   /product="F0F1 ATP synthase subunit alpha"
FT                   /EC_number="3.6.3.14"
FT                   /note="COG0056 F0F1-type ATP synthase, alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_04930"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47627"
FT                   /db_xref="GOA:C4K229"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR000793"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005294"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR023366"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033732"
FT                   /db_xref="InterPro:IPR036121"
FT                   /db_xref="InterPro:IPR038376"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4K229"
FT                   /protein_id="ACR47627.1"
FT                   /translation="MKLKPIEVAEILQKEIANINCLSELEEVGQVITVGDGIAQIYGLA
FT                   NVKSGEVVEFKSGVKGLVLNLENDSVGAVIMGDDNQVQQGDNVKRTKEVLEVPVGKALL
FT                   GRVVDALGNPIDGKGDIASKEYRHIEMKAPGIIERTSVSEPVQTGIKAIDSLIPIGRGQ
FT                   RELIIGDRQTGKTAIAVDTIINQKQAHSLTNESDKIYCIYVAIGQKRSSVAQIVKKLED
FT                   AGAMDYTLIVSATASEAAALQFIAPYSACSMGEYFRDNGMHALIIYDDLSKHAVAYRQI
FT                   SLLLRRPPGREAYPGDVFYLHSRLLERAAKMSEAKGSGSLTALPIIETQAGDVSAYIPT
FT                   NVISITDGQIFLESELFYKGVRPAVNVGISVSRVGSAAQIKAMKQVAGSVKLELAQFRE
FT                   LESFSQFGSDLDPATKVQIDHGKRLVEILKQAQYHPFPVEEQIVSIYVGTKKYLNDVPL
FT                   QQVKEFEDKMLTEIRLNKKDILESIKNEQCITEETEQKLKAFLENFVKEFVK"
FT   gene            complement(854730..855284)
FT                   /locus_tag="RPR_04935"
FT   CDS_pept        complement(854730..855284)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_04935"
FT                   /product="F0F1 ATP synthase subunit delta"
FT                   /EC_number="3.6.3.14"
FT                   /note="COG0712 F0F1-type ATP synthase, delta subunit
FT                   (mitochondrial oligomycin sensitivity protein)"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_04935"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47628"
FT                   /db_xref="GOA:C4K230"
FT                   /db_xref="InterPro:IPR000711"
FT                   /db_xref="InterPro:IPR026015"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4K230"
FT                   /protein_id="ACR47628.1"
FT                   /translation="MNKGNLIENYAVALFNNAMVDNIQDKIFEEITSINRIITDNFDIR
FT                   EFLFSPIVNKNDKINAVNSLAKNIKISTIVQNFLLLLVKNSRIAILSNIVDAYNTLLYE
FT                   SKNIKIVQVISANKLQPKEQEWIKSRIEKELNQKTEILFDIDNTIIGGIVIKYDSMLQD
FT                   YSIKGSLEKITKALKTVNIAV"
FT   gene            complement(855446..856825)
FT                   /locus_tag="RPR_04940"
FT   CDS_pept        complement(855446..856825)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_04940"
FT                   /product="dihydrolipoamide dehydrogenase"
FT                   /EC_number="1.8.1.4"
FT                   /note="COG1249 Pyruvate/2-oxoglutarate dehydrogenase
FT                   complex, dihydrolipoamide dehydrogenase (E3) component, and
FT                   related enzymes"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_04940"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47629"
FT                   /db_xref="GOA:C4K231"
FT                   /db_xref="InterPro:IPR001100"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR006258"
FT                   /db_xref="InterPro:IPR012999"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C4K231"
FT                   /protein_id="ACR47629.1"
FT                   /translation="MEQYDVAVIGGGPGGYVAAIRAAQLKKKVVLIEKEHLGGVCLNWG
FT                   CIPTKSLLKSAEVFEYIKHAKDYGIDAKGAEINIKKIVERSREISNKLAGGVKLLLKKN
FT                   KVTVIDGVASLAGNKVININDKPTVKAGNIIIATGARSRVLKGFKPDGKQIWTSKEAMI
FT                   PQHVPKSMIIVGSGAIGIEFASFYNSIGVDVTVIEAHNRILPAEDMEISGIAHKNFEKK
FT                   GIKIITNAKLIKQTKSKDKIEVELELADKTQKLQAEILLMAVGITANTENLGLEKTKIK
FT                   VENGYITTNGLMQTAASGIYAIGDVAGVPCLAHKASHEGIIAAESIAGLKPHTINKHNI
FT                   PGCTYSSPQIASVGLTEEAATTLGYELKIGRFPFIANGKALVSGDSDGLIKTIFDAKTG
FT                   ELLGAHMIGSEVTELIQGYVVSKNLEGTELDLINTIFPHPTLSEMMHESVFSAYDRAIH
FT                   I"
FT   gene            complement(856980..857408)
FT                   /locus_tag="RPR_04945"
FT   CDS_pept        complement(856980..857408)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_04945"
FT                   /product="ferroxidase"
FT                   /note="COG0783 DNA-binding ferritin-like protein (oxidative
FT                   damage protectant)"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_04945"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47630"
FT                   /db_xref="GOA:C4K232"
FT                   /db_xref="InterPro:IPR002177"
FT                   /db_xref="InterPro:IPR008331"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="InterPro:IPR023188"
FT                   /db_xref="UniProtKB/TrEMBL:C4K232"
FT                   /protein_id="ACR47630.1"
FT                   /translation="MQVVKALEQILADSYALYFKTQNYHWNVEGAEFRSLHLLFEGQYE
FT                   DLAESLDELAERIRSLNAKVPALSDLIKLASIDEANLNATANEMLKSLTKDQDIIRDTL
FT                   YKGLKVAQAEGDEGTADMIIGRIKVHEKNRWMLKSSIL"
FT   misc_feature    complement(858605..859699)
FT                   /note="authentic internal stop codon: common BLAST hit:
FT                   gi|157964614|ref|YP_001499438.1| transposase ISRpe1"
FT   gene            complement(859829..861166)
FT                   /gene="tig"
FT                   /locus_tag="RPR_04970"
FT   CDS_pept        complement(859829..861166)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tig"
FT                   /locus_tag="RPR_04970"
FT                   /product="trigger factor"
FT                   /note="COG0544 FKBP-type peptidyl-prolyl cis-trans
FT                   isomerase (trigger factor)"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_04970"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47631"
FT                   /db_xref="GOA:C4K233"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="InterPro:IPR005215"
FT                   /db_xref="InterPro:IPR008880"
FT                   /db_xref="InterPro:IPR008881"
FT                   /db_xref="InterPro:IPR027304"
FT                   /db_xref="InterPro:IPR036611"
FT                   /db_xref="InterPro:IPR037041"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4K233"
FT                   /protein_id="ACR47631.1"
FT                   /translation="MGITVLKNEGLDFHARISTPLSEIDDDIQKELLDLTKKVKIAGFR
FT                   AGKVPVSIVKKKYGTSVRNDIIERRINHSVNHVIKEHNLNIIGRPKIEELQNESDKALE
FT                   FTVKIELLPKITIPDLKKISLDRPKLEVNSKDVEEQLEKLAALTKNYTKESKAKIKDGD
FT                   QVTIDAIGYIKEKAFEDGKLNDFKVIIGSNALIPGFEKQLIGSKTGSEVDVNVTFPENY
FT                   HAKDLAGKDARFVVQIKAVHTAEPTVIDDEFAKKFQSNSLEELRTHFTKQIENESEEAI
FT                   NTIMKMNLFDKLEKLLDFDVPESLLEQEKNILKSGTDKNEQDESLLKDKSSKEITAYYN
FT                   KLALRRVRIGLLLAEYAKSKNLQLEPDDLRKVIMQQARNFPGQENMIFDFYKNNPRAIE
FT                   GLKGPALEDKAVQYIFNHEIKLKEKKYTKEELEKYLEAEEQRITLV"
FT   gene            complement(862457..863701)
FT                   /locus_tag="RPR_04980"
FT   CDS_pept        complement(862457..863701)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_04980"
FT                   /product="5-aminolevulinate synthase"
FT                   /EC_number="2.3.1.37"
FT                   /note="COG0156 7-keto-8-aminopelargonate synthetase and
FT                   related enzymes"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_04980"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47632"
FT                   /db_xref="GOA:C4K234"
FT                   /db_xref="InterPro:IPR001917"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR010961"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:C4K234"
FT                   /protein_id="ACR47632.1"
FT                   /translation="MSYYDIIFSKHIDKIKSEGRYREFKALKRQADNFPFAEHANKQIV
FT                   MWCINDYLGMSKHAKVMHASIDALLKYGVGSGGTRNIGGNNIAILELEKELANLHKKQA
FT                   ALVFTSGFVANDTTLASLAKIMPDIVFFSDELNHASIIAGITSSRAEKYIYRHLDVKHL
FT                   EELLQSVDINRPKIVVFESAYSMDGFFSPIKDIINLAKKYNALTFIDEVHTVGLYGKQG
FT                   GGIAELLNCSDQIDIIQGTLAKAYGTIGGYITSNHNLVDSIRLNAPGFIFTTSLPPVIS
FT                   TAATHSIRHLKESNEERIKHQEVVTKLKNSFERFNIPYLKNESHIVPIIIGDPIKTAKA
FT                   SNMLLNEYGIYVQHINFPTVPRGTERLRIIPTPAHTDKMINDLSVALVQIFAELDIELS
FT                   SAKELNEEVRLNLIA"
FT   gene            complement(863880..865745)
FT                   /locus_tag="RPR_04985"
FT   CDS_pept        complement(863880..865745)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_04985"
FT                   /product="heat shock protein 90"
FT                   /note="COG0326 Molecular chaperone, HSP90 family"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_04985"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47633"
FT                   /db_xref="GOA:C4K235"
FT                   /db_xref="InterPro:IPR001404"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR019805"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020575"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR037196"
FT                   /db_xref="UniProtKB/TrEMBL:C4K235"
FT                   /protein_id="ACR47633.1"
FT                   /translation="MIQEKKKFDAEVGKILNLMIHSLYSNKEIFMRELISNASDACDKL
FT                   RYLSQSNSELVAGDSNFKITVKVDKDNGQIIIRDNGIGMNKDDLIENLGTIARSGTANF
FT                   LKSLSGDSKKDNMLIGQFGVGFYSSFMVADKVTVTSRKAGEDKVHIWESDGLGEYTVSD
FT                   SDKEFTRGTEIVLNIKKEEDTFLDHFRLKHIVKSYSDHIAVPIYFFDEAGNNEIQLNSA
FT                   SALWTRPKSEITEEQYKEFYKSLSYAIDDPWITMHNKNEGAIEFTNLLFIPSSKTFDLF
FT                   HPDRKRRVKLYIKRVFISDENIDLIPSYLRFLRGVVDSEDLPLNISRESLQHNSVLEKI
FT                   KNAITKRVLGELRKKKEESPEEYNKFWANFGGALKEGLCEATTNHEKLLEVCIFRSALH
FT                   NKMISLDEYIANFKEGQSTIYYLSGDNPDKLLSSPQIEGLLSKKIDVLLFTDTVDDFWV
FT                   NVNSKYKEHAIKSATRSDIDVEQTTSQSEEKNIDSKKSDDEYKLLTDYFKETLGELVKE
FT                   VKISKKLTSSPACLAVSDAAMDIRMERFLIEQKQIANASAKNLELNPKNKIIEKIFNDL
FT                   KANNKNNEELVNLIFDQACILEGEPVADTGAFSKRLNDIVQKAIL"
FT   gene            complement(865889..866206)
FT                   /locus_tag="RPR_04990"
FT   CDS_pept        complement(865889..866206)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_04990"
FT                   /product="hypothetical protein"
FT                   /note="COG1872 Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_04990"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47634"
FT                   /db_xref="InterPro:IPR003746"
FT                   /db_xref="InterPro:IPR036591"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4K236"
FT                   /protein_id="ACR47634.1"
FT                   /translation="MDKFYNYNSSSHQALLSFKVKPNSKQNLISNFVIINNIPYLKLSI
FT                   KAIPEQGKANEEIINYLAKEWKLSRSNIEIIKGHTHSLKTILIKNINEDYLNWIINSYI
FT                   K"
FT   gene            866303..866379
FT                   /locus_tag="RPR_t07814"
FT   tRNA            866303..866379
FT                   /locus_tag="RPR_t07814"
FT                   /product="tRNA-Arg"
FT   gene            complement(867882..868709)
FT                   /locus_tag="RPR_05010"
FT   CDS_pept        complement(867882..868709)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_05010"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_05010"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47635"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C4K237"
FT                   /protein_id="ACR47635.1"
FT                   /translation="MKNFIWAIILIPIFLSGCSTTHDVARRVKHSQDIATQNNFQMGLV
FT                   NGGDFTLTTYQRITDRNLPFVFYIEGDGHLADGSANSDNPTPVNPMLLKLATMDQRPNI
FT                   VYIARPCQYTPLEMNSKCISDYWLDKRMGQEVVDSINNVINIINNGQKFSLVGFSGGGG
FT                   LTILIAAQNSNVKDIITIAGNLDTKKFDKYHNYRGYLVKSLNPINYAKQVNNIPQLHLS
FT                   GMDDKRVPPFIAALYVKTSNSPCVKKQTFPNISHAKGWDKVWSNILDIPLICN"
FT   gene            complement(868721..869179)
FT                   /locus_tag="RPR_05015"
FT   CDS_pept        complement(868721..869179)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_05015"
FT                   /product="single-strand DNA-binding protein"
FT                   /note="COG0629 Single-stranded DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_05015"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47636"
FT                   /db_xref="GOA:C4K238"
FT                   /db_xref="InterPro:IPR000424"
FT                   /db_xref="InterPro:IPR011344"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:C4K238"
FT                   /protein_id="ACR47636.1"
FT                   /translation="MAGSLNKVILIGNVGRDPEMRTTGEGKKIINLSLATTETWKDRIT
FT                   SERKERTEWHRVVIFSEGLVSVVERYVTKGSKLYIEGSLQTRKWNDNSGQEKYTTEVVL
FT                   QNFNSQLILLDSKNSNNHNQDSGHSEYKHPETKNHSFDHSDLDDEIPF"
FT   gene            869288..872149
FT                   /gene="uvrA"
FT                   /locus_tag="RPR_05020"
FT   CDS_pept        869288..872149
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="uvrA"
FT                   /locus_tag="RPR_05020"
FT                   /product="excinuclease ABC subunit A"
FT                   /note="COG0178 Excinuclease ATPase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_05020"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47637"
FT                   /db_xref="GOA:C4K239"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR004602"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041102"
FT                   /db_xref="InterPro:IPR041552"
FT                   /db_xref="UniProtKB/TrEMBL:C4K239"
FT                   /protein_id="ACR47637.1"
FT                   /translation="MNQEYIKVRGAKEHNLKNINVNIPRNKFVVITGLSGSGKSSLAFD
FT                   TIYAEGQRRYVESLSSYARQFLHLQNKPNVESISGLSPAIAIDQKTTSKNPRSTVGTIT
FT                   EIYDYLRLLYARVGIPYSPATGLPIHSQTVSEMVDIINELPKGTKIYLLAPIVRGHKGE
FT                   FKREIMNLKKQGFQKLIVNGEVCEIDDLPKLDKNKKHNIEVIVDRIVLDESLGNRLADS
FT                   LESSLNLAEGITYLEIVELPPAVKSEFEKNQRITFSEQYSCPVSGFQLTEIEPRIFSFN
FT                   SPFGACPKCQGIGKEFFFDRDLIVPDQRIAIKDGAIVPWGSTASKFILETLKALADHYK
FT                   FSIEVPFVSLSQNVKDILFAGSGEEAIKFEFHDGSKTQIIKQPFAGIIPSLQEKDRTIE
FT                   SVLIKEELAKFKSEHKCTACSGFRLKDEALCVKIANFHIGEVAGMSIAALQKWFSHLEE
FT                   KLNKKQLFIAERILKEITERLKFLMNVGLDYLTLSREAGTLSGGESQRIRLASQIGSGL
FT                   SGVLYVLDEPSIGLHQRDNTRLIETLKRLRDLGNTVLVVEHDEETIYEADHIIDIGPGA
FT                   GIHGGRVIAEGNAEEIKNCEESITGRYLSGRQTIKVPSETRVGHDNRAIELLGAVSNNL
FT                   DNVDVKIPLGTFTAITGVSGSGKSSLMIHTLYKAALKHLEPTSKVFPGKYRELKGLEYI
FT                   DKIIDINQSPIGRTPRSNPATYTGAFTHIRDWFVELPESKARGYKVGRFSFNVKGGRCE
FT                   ACQGDGLIKIEMHFLPDVYVKCDICNGHRYNRETLEIKYKGKSIADILMMTVEDAMQFF
FT                   EKIPLIYEKLITLNEVGLGYIKIGQSATTLSGGEAQRVKLAKELSRRSTGKTLYILDEP
FT                   TTGLHIDDINKLLKVLHKLVDMGNTVLVIEHNLDVIKTADYIIDVGPEGGDKGGKIVVC
FT                   GTPADIAACEESHTGRYLKQYLV"
FT   gene            complement(874366..875067)
FT                   /locus_tag="RPR_05055"
FT   CDS_pept        complement(874366..875067)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_05055"
FT                   /product="zinc ABC transporter ATP-binding protein"
FT                   /note="COG1121 ABC-type Mn/Zn transport systems, ATPase
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:RPR_05055"
FT                   /db_xref="EnsemblGenomes-Tr:ACR47638"
FT                   /db_xref="GOA:C4K240"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017882"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C4K240"
FT                   /protein_id="ACR47638.1"
FT                   /translation="MQKPIIEFRNVSKKFGNKLPINNVSFTVKKNNITTLIGPNGAGKT
FT                   TIVRLMLGLEKPTSGEIIIDPKLKIGYVPQKFGLTLDLPITVKIFLELLAPSNFNNNIK
FT                   EINSFIDLEHIKDQEISKLSGGQFQKVVLACSIVNNPDLIILDEPLQSLDVTSQQEFYQ
FT                   LINLIRKKLNITVFMISHDLFTVIKNSDQVICLNGHICCSGIPNEITPNSEFSNALSAL
FT                   GFYTHHHDHKH"
FT   gene            complement(875207..875671)
FT                   /locus_tag="RPR_05060"
FT   CDS_pept        complement(875207..875671)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPR_05060"
FT